(data stored in SCRATCH3701 zone)

EMBL: CP024147

ID   CP024147; SV 1; circular; genomic DNA; STD; PRO; 4639454 BP.
XX
AC   CP024147;
XX
PR   Project:PRJNA414691;
XX
DT   10-JAN-2018 (Rel. 135, Created)
DT   10-JAN-2018 (Rel. 135, Last updated, Version 6)
XX
DE   Escherichia coli strain 14EC033 chromosome, complete genome.
XX
KW   .
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-4639454
RA   Li B., Wang X.;
RT   "mcr-1 positive E.coli isolates in China";
RL   Unpublished.
XX
RN   [2]
RP   1-4639454
RA   Li B., Wang X.;
RT   ;
RL   Submitted (18-OCT-2017) to the INSDC.
RL   Chinese Academy of Science, South China Sea Institute of Oceanology, 164
RL   Xingang West Rd, Guangzhou, Guangdong 510000, China
XX
DR   MD5; a42a21b89db2aafdf1023f1ba0727545.
DR   BioSample; SAMN07807403.
XX
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Assembly-Data-START##
CC   Assembly Method        :: HGAP v. v3
CC   Genome Representation  :: Full
CC   Expected Final Version :: Yes
CC   Genome Coverage        :: 100.0x
CC   Sequencing Technology  :: PacBio
CC   ##Genome-Assembly-Data-END##
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider               :: NCBI
CC   Annotation Date                   :: 10/25/2017 11:28:49
CC   Annotation Pipeline               :: NCBI Prokaryotic Genome
CC                                        Annotation Pipeline
CC   Annotation Method                 :: Best-placed reference protein
CC                                        set; GeneMarkS+
CC   Annotation Software revision      :: 4.2
CC   Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                        repeat_region
CC   Genes (total)                     :: 5,541
CC   CDS (total)                       :: 5,424
CC   Genes (coding)                    :: 4,936
CC   CDS (coding)                      :: 4,936
CC   Genes (RNA)                       :: 117
CC   rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
CC   complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
CC   tRNAs                             :: 85
CC   ncRNAs                            :: 10
CC   Pseudo Genes (total)              :: 488
CC   Pseudo Genes (ambiguous residues) :: 0 of 488
CC   Pseudo Genes (frameshifted)       :: 192 of 488
CC   Pseudo Genes (incomplete)         :: 259 of 488
CC   Pseudo Genes (internal stop)      :: 145 of 488
CC   Pseudo Genes (multiple problems)  :: 105 of 488
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4639454
FT                   /organism="Escherichia coli"
FT                   /strain="14EC033"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /isolation_source="clinical patient"
FT                   /collection_date="2014"
FT                   /db_xref="taxon:562"
FT   gene            37..237
FT                   /locus_tag="CR539_00005"
FT   CDS_pept        37..237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00005"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A2XS75"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001323701.1"
FT                   /protein_id="AUJ93988.1"
FT                   /translation="MYTPESILFPYLPRFSAPFRRENVRPHTSENQHGAPGGGLYGLMG
FT                   KAQGSSWIFIRSIKPIFVYGH"
FT   gene            531..1934
FT                   /locus_tag="CR539_00010"
FT   CDS_pept        531..1934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3V940"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3V940"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418157.1"
FT                   /protein_id="AUJ93989.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQT
FT                   QPQRAAPSTRSGWDNVPAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGG
FT                   AYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEF
FT                   KRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDR
FT                   LKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGAL
FT                   NRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRR
FT                   SRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDF
FT                   SNLIRTLSS"
FT   gene            1939..3039
FT                   /locus_tag="CR539_00015"
FT   CDS_pept        1939..3039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00015"
FT                   /product="DNA polymerase III subunit beta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLM2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006177590.1"
FT                   /protein_id="AUJ93990.1"
FT                   /translation="MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT
FT                   GTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGV
FT                   RLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMML
FT                   TDSVSSVQIEDAASQSAAYVVMPMRL"
FT   gene            3039..4112
FT                   /locus_tag="CR539_00020"
FT   CDS_pept        3039..4112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00020"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLM7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005121479.1"
FT                   /protein_id="AUJ93991.1"
FT                   /translation="MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQIGRVIRHEQEAFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGTDGHK
FT                   VAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNA
FT                   ALRQVTRYEQLRPWDKELIPLAEQISTWRAEYSAGIAADMADTCKQFLPEFSLTFSFQR
FT                   GWEKETEYAEVLERNFERDRQLTYTAHGPHKADLRIRADGAPVEDTLSRGQLKLLMCAL
FT                   RLAQGEFLTRESGRRCLYLIDDFASELDDERRGLLASRLKATQSQVFVSAISAEHVIDM
FT                   SDENSKMFTVEKGKITD"
FT   gene            4141..6555
FT                   /gene="gyrB"
FT                   /locus_tag="CR539_00025"
FT   CDS_pept        4141..6555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CR539_00025"
FT                   /product="DNA gyrase subunit B"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6ETT7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6ETT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312661.1"
FT                   /protein_id="AUJ93992.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKT
FT                   GTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGATLHTNASAPALA
FT                   GEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQTVTRWVNALVS
FT                   ELNDKEQHGSQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICALG
FT                   EKLRGLLEEDAFIERGERRQPVASFEQALDWLVKESRRGLSIQRYKGLGEMNPEQLWET
FT                   TMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            6786..7193
FT                   /locus_tag="CR539_00030"
FT   CDS_pept        6786..7193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00030"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSB5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001311237.1"
FT                   /protein_id="AUJ93993.1"
FT                   /translation="MIIMGLFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSG
FT                   GLGAILSTWLSNQQSNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKII
FT                   DALSPQGEVPPQANNDLLSAGMELLKGKLFR"
FT   gene            7308..8120
FT                   /locus_tag="CR539_00035"
FT   CDS_pept        7308..8120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00035"
FT                   /product="Cof-type HAD-IIB family hydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSH6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSH6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418152.1"
FT                   /protein_id="AUJ93994.1"
FT                   /translation="MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGR
FT                   PYAGVHNYLKELHMEQPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVG
FT                   SHFHALDRTTLYTANRDISYYTVHESFVATIPLVFCEAEKMDPYTQFLKVMMIDEPAIL
FT                   DQAIARIPQEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQE
FT                   NDIAMIEYAGVGVAMDNAIPSVKEVANFVTKSNLEDGVAFAIEKYVLN"
FT   gene            complement(8166..8822)
FT                   /locus_tag="CR539_00040"
FT   CDS_pept        complement(8166..8822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00040"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1FNL6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312658.1"
FT                   /protein_id="AUJ98123.1"
FT                   /translation="MKLNFKGFFKAASLFPLALMLSGCISYALVSHTAKGSSGKYQSQS
FT                   DTITGLSQAKDSNGTKGYVFVGESLDYLITDGADDIVKMLNDPALNRHNIQVADDARFV
FT                   LNAGKKKFTGTISLYYYWNNEEEKALATHYGFACGVQHCTRSLENLKGTIHEKNKNMDY
FT                   SKVMAFYHPFKVRFYEYYSPRGIPDGVSAALLPVTVTLDIITAPLQFLVVYAVNQ"
FT   gene            complement(9032..10132)
FT                   /locus_tag="CR539_00045"
FT   CDS_pept        complement(9032..10132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00045"
FT                   /product="colicin M resistance protein CbrA"
FT                   /note="FAD/NAD(P)-binding domain; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A3Q0N3W9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N3W9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414855.4"
FT                   /protein_id="AUJ98124.1"
FT                   /translation="MEHFDVAIIGLGPAGSALARKLAGKMQVIALDKKHQCGTEGFSKP
FT                   CGGLLAPDAQRSFIRDGLTLPVDVIANPQIFSVKTVDVAASLTRNYQRSYININRHAFD
FT                   LWMKSLIPASVEVYHDSLCRKIWREDDKWHVIFRADGWEQHITARYLVGADGANSMVRR
FT                   HLYPDHQIRKYVAIQQWFAEKHPVPFYSCIFDNAITDCYSWSISKDGYFIFGGAYPMKD
FT                   GQTRFATLKEKMSAFQFQFGKAVKSEKCTVLFPSRWQDFICGKDNAFLIGEAAGFISAS
FT                   SLEGISYALDSAEILRAVFLKQPEKSNAAYWRATRKLRLKLFGKIVKSRCLTAPALRKW
FT                   IMRSGVAHIPQLKDYPTRFTSPTSRM"
FT   gene            10200..11447
FT                   /locus_tag="CR539_00050"
FT   CDS_pept        10200..11447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00050"
FT                   /product="DUF3748 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSA6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418144.3"
FT                   /protein_id="AUJ93995.1"
FT                   /translation="MAGPVLYQDRAMKQITCAPRNHLLTNTNTWTPDSQWLVFDVRPSG
FT                   ASFTGETIERVNIHTGEVEVIYRASQGAHVGVVTVHPKSDKYVFIHGPENPDETWHYDF
FT                   HHRRGVIAEGGKVSNLDAMDITAPYTPGALRGGSHVHVFSPNGERVSFTYNDHVMHQLD
FT                   PALDLRNVGVAAPFGPVNVQKQHPREYSGSHWCVLVSKTTPTPQPGSDEINRAYEEGWV
FT                   GNHALAFIGDTLSPKGEKVPELFIVELPQDEAGWKAAGDAPLSGTETTLPAPPRGVVQR
FT                   RLTFTHHRAYPGLVNVPRHWVRCNPQGTQIAFLMRDDNGIVQLWLISPQGGEPRQLTHN
FT                   KTDIQSAFNWHPSGEWLGFVLDNRIACAHAESGEVEYLTENHANPPSADAVVFSPDGQW
FT                   LAWMEGGQLWITETDR"
FT   gene            complement(11449..11781)
FT                   /locus_tag="CR539_00055"
FT   CDS_pept        complement(11449..11781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00055"
FT                   /product="YceK/YidQ family lipoprotein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U4UNH1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418143.2"
FT                   /protein_id="AUJ93996.1"
FT                   /translation="MIRNVLLAFMICSGMTLLGGCSSVMSHTGGKEGTYPGTRASATMI
FT                   GDDETNWGTKSLAILDMPFTAVMDTLLLPWDVFRKDSSVRSRVEKSEANAQATNAVIPP
FT                   ARMPDN"
FT   gene            12087..12500
FT                   /locus_tag="CR539_00060"
FT   CDS_pept        12087..12500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00060"
FT                   /product="heat-shock protein IbpA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLR2"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLR2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_006687722.1"
FT                   /protein_id="AUJ93997.1"
FT                   /translation="MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDEN
FT                   HYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAEN
FT                   IHVRGANLVNGLLYIDLERVIPEAKKPRRIEIN"
FT   gene            12612..13040
FT                   /locus_tag="CR539_00065"
FT   CDS_pept        12612..13040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00065"
FT                   /product="heat-shock protein IbpB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1M0VSU3"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M0VSU3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418141.2"
FT                   /protein_id="AUJ93998.1"
FT                   /translation="MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHY
FT                   RITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENME
FT                   VSGATFVNGLLHIDLIRNEPEPIAAQRIAISERPALNS"
FT   gene            13236..14897
FT                   /locus_tag="CR539_00070"
FT   CDS_pept        13236..14897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00070"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A023LGA5"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023LGA5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414850.1"
FT                   /protein_id="AUJ93999.1"
FT                   /translation="MSDIALTVSILALVAVVGLFIGNVKFRGIGLGIGGVLFGGIIVGH
FT                   FVSQAGMTLSSDMLHVIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAVLIVIIG
FT                   GLVTAILHKLFDIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEMVDQMGMSYAMA
FT                   YPFGICGILFTMWMLRVIFRVNVETEAQQHESSRTNGGALIRTINIRVENPNLHDLAIK
FT                   DVPILNGDKIICSRLKREETLKVPSPDTIIQLGDLLHLVGQPADLHNAQLVIGQEVDTS
FT                   LSTKGTDLRVERVVVTNENVLGKRIRDLHFKERYDVVISRLNRAGVELVASGDISLQFG
FT                   DILNLVGRPSAIDAVANVLGNAQQKLQQVQMLPVFIGIGLGVLLGSIPVFVPGFPAALK
FT                   LGLAGGPLIMALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFVNTL
FT                   VNGEGLSWIGYGALITAVPLITVGILARMLAKMNYLTMCGMLAGSMTDPPALAFANNLH
FT                   PTSGAAALSYATVYPLVMFLRIITPQLLAVLFWSIG"
FT   gene            complement(14894..15610)
FT                   /locus_tag="CR539_00075"
FT   CDS_pept        complement(14894..15610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00075"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSJ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSJ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312651.1"
FT                   /protein_id="AUJ94000.1"
FT                   /translation="MIYKSIAERLRIKLNSADFTLNSLLPGEKKLAEEFAVSRMTIRKA
FT                   IDLLVAWGLVVRRHGSGTYLVRKDVLHQTASLTGLVEVLKRQGKTVTSQVLIFEIMPAP
FT                   PAIASQLRIQINEQIYFSRRVRFVEGKPLMLEDSYMPVKLFRNLSLQHLEGSKFEYIEQ
FT                   ECGILIGGNYESLTPVLADRLLARQMKVAEHTPLLRITSLSYSESGEFLNYSVMFRNAS
FT                   EYQVEYHLRRLHPDKS"
FT   gene            15906..17522
FT                   /locus_tag="CR539_00080"
FT   CDS_pept        15906..17522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00080"
FT                   /product="PTS alpha-glucoside transporter subunit IICB"
FT                   /note="involved in the phosphorylation and transport of
FT                   sugars across the cell membrane; protein IIA transfers a
FT                   phosphoryl group to IIB which then transfers the phosphoryl
FT                   group to the sugar; IIC forms the translocation channel for
FT                   the sugar uptake; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MS86"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MS86"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312650.2"
FT                   /protein_id="AUJ94001.1"
FT                   /translation="MLSQIQRFGGAMFTPVLLFPFAGIVVGLAILLQNPMFVGESLTDP
FT                   NSLFAQIVHIIEEGGWTVFRNMPLIFAVGLPIGLAKQAQGRACLAVMVSFLTWNYFINA
FT                   MGMTWGSYFGVDFTQDAVAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFDKKLP
FT                   VFLGIFQGTSYVVIIAFLVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFL
FT                   ERILILTGLHHFIYGPFIFGPAAVEGGIQMYWAQHLQEFSLSAEPLKSLFPEGGFALYG
FT                   NSKIFGAVGISLAMYFTAAPENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFA
FT                   VHAVLAASMSTVMYLFGVVGNMGGGLIDQVLPQNWIPMFSNHADMMLTQIAIGLCFTLL
FT                   YFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQTTAAEPKKELDQAAGILQALG
FT                   GVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLRE
FT                   QLDSLINSHQSAENVAITEAV"
FT   gene            17522..18844
FT                   /locus_tag="CR539_00085"
FT   CDS_pept        17522..18844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00085"
FT                   /product="6-phospho-alpha-glucosidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085P9P1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085P9P1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414847.1"
FT                   /protein_id="AUJ94002.1"
FT                   /translation="MTKFSVVVAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQ
FT                   EVIAEACKVILKEKAPDIAFSYTTDPEVAFSDVDFVMAHIRVGKYPMRELDEKIPLRHG
FT                   VVGQETCGPGGIAYGMRSIGGVLELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNA
FT                   KILNICDMPIGIESRMAQIVGLQDRKQMRVRYYGLNHFGWWTSIEDLQGNDLMPQLRQY
FT                   VSKHGYVPPQQDTHTEASWNDTYAKARDVQALDPDTLPNTYLKYYLFPDYVVQHSNPEH
FT                   TRANEVMEHREKQVFDACRAITAAGNSAAGKLEIDEHASYIVDLAAAIAFNTQERMLLI
FT                   VPNNGAIHNFDDEAMVEIPCLVGHNGPEPLVVGDIPQFQKGLMSQQVAVEKLVVDAWEQ
FT                   RSYQHLWQAITLSKTVPSASVAKAILDELLEANKAYWPELR"
FT   gene            complement(18841..19734)
FT                   /locus_tag="CR539_00090"
FT   CDS_pept        complement(18841..19734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00090"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSC0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSC0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418136.2"
FT                   /protein_id="AUJ94003.1"
FT                   /translation="MNGKLQTSDVKNETPYNIPLLINENVISSGISLISLWHTYADEHY
FT                   RVIWPRDKKKPLIANSWVAVYTVQGCGKILLKNGEQITLHGNCIIFLKPMDIHSYHCEG
FT                   LVWEQYWMEFTPTSMMDIPVGQQSVIYNGEIYNQELTEVAELITSPEAIKNNLAVAFLT
FT                   KIIYQWICLMYADGKKDPQRRQIEKLIATLHASLQQRWSVADMAATIPCSEAWLRRLFL
FT                   RYTGKTPKEYYLDVRLDLALSLLKQQGNSVGEVADTLNFFDSFHFSKAFKHKFGYAPSA
FT                   VLKNTDQHPTDASPHN"
FT   gene            19901..21616
FT                   /locus_tag="CR539_00095"
FT   CDS_pept        19901..21616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00095"
FT                   /product="solute:sodium symporter family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066R092"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R092"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312647.1"
FT                   /protein_id="AUJ94004.1"
FT                   /translation="MNSLQILSFVGFTLLVAIITWWKVRKTDTGSQQGYFLAGRSLKAP
FT                   VIAASLMLTNLSTEQLVGLSGQAYKSGMSVMGWEVTSAVTLIFLALIFLPRYLKRGIAT
FT                   IPDFLEERYDKTTRIIIDFCFLIATGVCFLPIVLYSGALALNSLFHVGESLQISHGAAI
FT                   WLLVILLGLAGILYAVIGGLRAMAVADSINGIGLVIGGLMVPVFGLIAMGKGSFMQGIE
FT                   QITTVHAEKLNSVGGPTDPLPIGAAFTGLILVNTFYWCTNQGIVQRTLASKSLAEGQKG
FT                   ALLTAVLKMLDPLVLVLPGLIAFHLYQDLPKADMAYPTLVNNVLPVPLVGFFGAVLFGA
FT                   VISTFNGFLNSASTLFSMGIYRRIINQNAEPQQLVTVGRKFGFFIAIVSVLVAPWIANA
FT                   PQGLYSWMKQLNGIYNVPLVTIIIMGFFFPRIPALAAKVAMGIGIISYITINYLVKFDF
FT                   HFLYVLACTFCINVVVMLVIGFIKPRATPFTFKDAFAVDMKPWKNVKIASIGILFAMIG
FT                   VYAGLAEFGGYGTRWLAMISYFIAAVVIVYLIFDSWRHRHDPAVTFTPDAKDSL"
FT   gene            21613..23106
FT                   /locus_tag="CR539_00100"
FT   CDS_pept        21613..23106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00100"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSA9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSA9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418134.1"
FT                   /protein_id="AUJ94005.1"
FT                   /translation="MKRPNFLFIMTDTQATNMVGCYSGKPLNTQNIDSLAAEGIRFNSA
FT                   YTCSPVCTPARAGLFTGIYANQSGPWTNNVAPGKNISTMGRYFKDAGYHTCYIGKWHLD
FT                   GHDYFGTGECPPEWDADYWFDGTNYLSELTEKEISLWRNGLNSVEDLQANHIDETFTWA
FT                   HRISNRAVDFLQQPARTEEPFLMVVSYDEPHHPFTCPVEYLEKYADFYYQLGEKAQDDL
FT                   ANKPEHHRLWAQAMPSPVGDDGLYHHPLYFACNDFVDDQIGRVINALTPEQRENTWVIY
FT                   TSDHGEMMGAHKLISKGAAMYDDITRIPLIIRSPQGERRQVNTPVSHIDLLPTMMALAD
FT                   IEKPEILPGENILAVKEPRGVMVEFNRYEIEHDSFGGFIPVRCWVTDDFKLVLNLFTSD
FT                   ELYDRRNDPNEMHNLIDDIRFADVRSKMHDALLDYMDKIRDPFRSYQWSLRPWRKDAQP
FT                   RWMGAFRPRPQDGYSPVVRDYDTGLPTQGVKVEEKKQKF"
FT   gene            complement(23153..23602)
FT                   /locus_tag="CR539_00105"
FT   CDS_pept        complement(23153..23602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00105"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLV2"
FT                   /db_xref="InterPro:IPR016512"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312645.1"
FT                   /protein_id="AUJ94006.1"
FT                   /translation="MGIIAQNKISSLGMLFGAIALMMGIIHFSFGPFSAPPPTLESIVA
FT                   DKTAEIKRGLLAGIKGEKITTVERKEDVDVDKILDQSGIALAIAALLCAFIGGMRKENR
FT                   WGIRGALVFGGGTLAFHTLLFGIGIVCSILLIFLIFSFLTGGSLV"
FT   gene            23711..24058
FT                   /locus_tag="CR539_00110"
FT   CDS_pept        23711..24058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00110"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLV7"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLV7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312644.1"
FT                   /protein_id="AUJ94007.1"
FT                   /translation="MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPD
FT                   FATPVIRELLALLLCLFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVA
FT                   VIVMGLVLYAG"
FT   gene            24048..24410
FT                   /locus_tag="CR539_00115"
FT   CDS_pept        24048..24410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00115"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLW2"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312643.1"
FT                   /protein_id="AUJ94008.1"
FT                   /translation="MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQ
FT                   AGMLFWISIGILAIVALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILF
FT                   AVTHIHQLIVFIERVA"
FT   gene            24407..24904
FT                   /locus_tag="CR539_00120"
FT   CDS_pept        24407..24904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00120"
FT                   /product="radical SAM protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSF1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSF1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312642.1"
FT                   /protein_id="AUJ94009.1"
FT                   /translation="MTGSQVIDAEEDRHKLVVEYKDTLQPADFYHNFKQRGIRSVQLIP
FT                   HLEFDDRGDMTAASVTAELWGKFLIALFECWVRADISRISIELFDSTLQKWCGSEKPQS
FT                   RRDCKACDWHRLCPHAREETPDNVLCAGYQAFYSYSAPHMRVMRDLIKQHRSPMELMTM
FT                   LR"
FT   gene            complement(24912..26096)
FT                   /locus_tag="CR539_00125"
FT   CDS_pept        complement(24912..26096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00125"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSK6"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418129.2"
FT                   /protein_id="AUJ94010.1"
FT                   /translation="MKRQRNVNLLLMLVLLVAVGQMAQTIYIPAIADMARDLNVREGAV
FT                   QSVMGAYLLTYGVSQLFYGPISDRVGRRPVILIGMSIFMLATLVAVTTSSLTVLIAASA
FT                   MQGMGTGVGGVMARTLPRDLYERTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWNWRA
FT                   CYLFLLVLCAGVTFSMARWMPETRPVDAPRTRLLTSYKALFGNGGFNCYLLMLIGGLAG
FT                   IAAFEACSGVLMGAVLGLSSMTVSILFILPIPAAFFGAWFAGRPNKRFSTLMWQSVICC
FT                   LLAGLLMWIPDWFGVMNVWTLLVPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVG
FT                   GLQNIGSGVLASLSAMLPQTGQGSLGLLMTLMGLLIVLCWLPLATRMSHQGQPV"
FT   gene            complement(26136..26333)
FT                   /locus_tag="CR539_00130"
FT   CDS_pept        complement(26136..26333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00130"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MS88"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001455255.1"
FT                   /protein_id="AUJ94011.1"
FT                   /translation="MFAPALPVPLTLSGRGLQFARNPSRQHLLPLLFTYSAAKQFPIPG
FT                   VYLANIYQCDRFLSRIYGNA"
FT   gene            complement(26428..26517)
FT                   /locus_tag="CR539_00135"
FT   CDS_pept        complement(26428..26517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00135"
FT                   /product="type I toxin-antitoxin system toxin TisB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024LAK6"
FT                   /db_xref="InterPro:IPR025211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024LAK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_001165331.1"
FT                   /protein_id="AUJ94012.1"
FT                   /translation="MSLVDIAILILKLIVAALQLLDAVLKYLK"
FT   gene            complement(26514..26627)
FT                   /locus_tag="CR539_00140"
FT   CDS_pept        complement(26514..26627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00140"
FT                   /product="LexA family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3VZK7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001303728.1"
FT                   /protein_id="AUJ94013.1"
FT                   /translation="MSTSTTFLLEIPRAQQLATGSGKVRQLAVLLNHRRRV"
FT   gene            complement(26650..26808)
FT                   /locus_tag="CR539_00145"
FT   CDS_pept        complement(26650..26808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00145"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A094XNU1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A094XNU1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414838.1"
FT                   /protein_id="AUJ94014.1"
FT                   /translation="MSIDHSLRFVQILLFIYTVNFYNITVRNVLCGGRIVTRRTKSWLK
FT                   RVVPSAP"
FT   gene            complement(26805..27095)
FT                   /locus_tag="CR539_00150"
FT   CDS_pept        complement(26805..27095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00150"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2D0CQF6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944571.1"
FT                   /protein_id="AUJ94015.1"
FT                   /translation="MEVVIGDLVGFVFNNIYTSTALQGRQWKIFQQGKIEGLITFCTEL
FT                   QVTKNPAGARFRQPPAAGNRKAHCIMSTLKVYVFRAERAISARILTYLVHS"
FT   gene            27082..27180
FT                   /locus_tag="CR539_00155"
FT   CDS_pept        27082..27180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00155"
FT                   /product="ilvB operon leader peptide IvbL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR012566"
FT                   /db_xref="UniProtKB/TrEMBL:E2QH38"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414837.1"
FT                   /protein_id="AUJ94016.1"
FT                   /translation="MTTSMFNAKLLPTAPSAAVVVVRVVVVVGNAP"
FT   gene            27286..28974
FT                   /gene="ilvB"
FT                   /locus_tag="CR539_00160"
FT   CDS_pept        27286..28974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="CR539_00160"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1M1W2K9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M1W2K9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312639.1"
FT                   /protein_id="AUJ94017.1"
FT                   /translation="MASSGTTSTRKRFTGAEFIVHFLEQQGIKIVTGIPGGSILPVYDA
FT                   LSQSTQIRHILARHEQGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDSIP
FT                   LICITGQVPASMIGTDAFQEVDTYGISIPITKHNYLVRHIEELPQVMSDAFRIAQSGRP
FT                   GPVWIDIPKDVQTAVFEIEAQPAVAEKAAAPAFSEESIRDAATMINAAKRPVLYLGGGV
FT                   INAPARVRELAEKAQLPTTMTLMALGMLPKAHPLSLGMLGMHGVRSTNYILQEADLLIV
FT                   LGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPLVEA
FT                   QPRAEWHQLVADLQREFPCPIPKACDPLSHYGLINAVAACVDDNAIITTDVGQHQMWTA
FT                   QAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATAS
FT                   ENQLDVKIILMNNEALGLVHQQQSLFYKQGVFAATYPGKINFMQIAAGFGLETCDLNNE
FT                   ADPQAALQEIINRPGPALIHVRIDAEEKVYPMVPPGAANTEMVGE"
FT   gene            28978..29268
FT                   /locus_tag="CR539_00165"
FT   CDS_pept        28978..29268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00165"
FT                   /product="acetolactate synthase isozyme 1 small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="with IlvB catalyzes the formation of 2-acetolactate
FT                   from pyruvate, the small subunit is required for full
FT                   activity and valine sensitivity; E.coli produces 3
FT                   isoenzymes of acetolactate synthase which differ in
FT                   specificity to substrates, valine sensitivity and affinity
FT                   for cofactors; also known as acetolactate synthase small
FT                   subunit; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLY7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312638.1"
FT                   /protein_id="AUJ94018.1"
FT                   /translation="MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQ
FT                   DSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ"
FT   gene            29530..30825
FT                   /locus_tag="CR539_00170"
FT   CDS_pept        29530..30825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00170"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSF6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414834.2"
FT                   /protein_id="AUJ94019.1"
FT                   /translation="MVSPINSGIMMSNPSPSTFLDKNRVVAAELNITNNEKKYSPGSNF
FT                   AKWMLQEIKRLIANIMSGSRSVNTEILNYFHPMPGTENNGNRTWMAATGENEYTVIEQT
FT                   GGKSFNVFQVGADKNNIKEILGNTSYSGVAVATIIKSLSEKTAALETHSADTVLRKKLV
FT                   NSIVMMNTDCSYEMPADIVSNTYDLLNLRIQKDEGHLPVQEKIDITEDYLHSMTMDAHR
FT                   CIKEQTKPSGAAKITCCGVELSKDILKIFAEKIETIEKDPNYSQKTPEQLVAQVCFKDD
FT                   DCARVRELLKQSNGNITDDKIDEIIACLASRQGITCFYYSSAQGYQSRLQHTSQDVREL
FT                   LSKSLDGATSSTLHLKKSGNAFFGSGKYLNEMDFTMNGFSQKIYLMAVNKNENEVNLQC
FT                   VRYFTTGRIDEQNSKIDKVDFTFFGAATTADL"
FT   gene            31555..32565
FT                   /locus_tag="CR539_00175"
FT   CDS_pept        31555..32565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00175"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N3W4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312634.1"
FT                   /protein_id="AUJ98125.1"
FT                   /translation="MKHEEVRKFSGPHAQEFLQLLSQHDQQEREQISELTVAANALKMD
FT                   VAKNNYNMNYSFDRQTERRMIELIREQKDLIPEKYLHQSSIKNLKLHKNEFSSLLADAE
FT                   RQVLEGSSFVLCCGEKINSTISELLRKKITDSTHFTKSLTLSESPSYDVYEEIFKKAVF
FT                   TPDECHLVRDSLVQDGIKPEKIAKIISCLSSRTGIGNLFYACSQAFHVANDNAALDVRR
FT                   AAIAIGDTIDDCPCCAALNGRSYHQHVDFSEYGFTQTLCVLGAIVNNANDTFDVANYIY
FT                   TTKGENIIHNDAEDDSPYVHSDESYRHKDDYWSRDNDIRNLRRNFSGNITIATYK"
FT   gene            complement(32543..32755)
FT                   /locus_tag="CR539_00180"
FT   CDS_pept        complement(32543..32755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00180"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N4G3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001446721.1"
FT                   /protein_id="AUJ98126.1"
FT                   /translation="MIVYKGNGDHNWVLADKKRAYLNDKRDVVQVGYGVCIGLMMLRLS
FT                   SKRLPEGKRLVRVIEKKRIICRLQS"
FT   gene            32726..33316
FT                   /locus_tag="CR539_00185"
FT   CDS_pept        32726..33316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00185"
FT                   /product="DNA-binding response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLZ2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLZ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312633.1"
FT                   /protein_id="AUJ94020.1"
FT                   /translation="MITVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPG
FT                   RGVQVCICDISMPDISGLELLSQLPKGMATIMLSVHDSPALVEQALNAGARGFLSKRCS
FT                   PDELIAAVHTVATGGCYLTPDIAIKLASGRQDPLTKRERQVAEKLAQGMAVKEIAAELG
FT                   LSPKTVHVHRANLMEKLGVSNDVELARRMFDGW"
FT   gene            33316..34818
FT                   /locus_tag="CR539_00190"
FT   CDS_pept        33316..34818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00190"
FT                   /product="signal transduction histidine-protein
FT                   kinase/phosphatase UhpB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A271R1N2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A271R1N2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418124.4"
FT                   /protein_id="AUJ94021.1"
FT                   /translation="MKTLFSSLITVIACFFIFSAAWFCLWSISLHLVERPDMAVLLFPF
FT                   GLRLGLMLQCPRGYWPVLLGAEWLLIYWLTQAVGLTHFPLLMIGSLLTLLPVALISRYR
FT                   HQRDWRTLLLQGAALTAAALLQSLPWLWHGKESWNALLLTLTGGLTLAPICLVFWHYLA
FT                   NNTWLPLGPSLVSQPINWRGRHLVWYLLLFVISLWLQLGLPDELSRFTPFCLALPIIAL
FT                   AWHYGWQGALIATLMNAIALIASQTWRDHPVDLLLSLLVQSLTGLLLGAGIQRLRELNQ
FT                   SLQKELARNQHLAERLLETEESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNASV
FT                   KQSGQLIEQLSLGVYDAVRRLLGRLRPRQLDDLTLEQAIRSLMREMELEGRGIVSHLEW
FT                   RIDESALSENQRVTLFRVCQEGLNNIVKHADASAVTLQGWQQDERLMLVIEDDGSGLPP
FT                   GSGQQGFGLTGMRERVTALGGTLHISCLHGTRVSVSLPQRYV"
FT   gene            34828..36147
FT                   /locus_tag="CR539_00195"
FT   CDS_pept        34828..36147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00195"
FT                   /product="MFS transporter family glucose-6-phosphate
FT                   receptor UhpC"
FT                   /note="membrane protein regulates uhpT expression; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A023LJA0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023LJA0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414830.1"
FT                   /protein_id="AUJ94022.1"
FT                   /translation="MLPFLKAPADAPLMTDKHEIDARYRYWRRHILLTIWLGYALFYFT
FT                   RKSFNAAVPEILANGVLSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIA
FT                   TGIINILFGFSTSLWAFAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAH
FT                   NVGGALIPIVMAAAALHYGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRH
FT                   DALEIAQQQEGAGLTRKEILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETL
FT                   GVDLVTANTAVTMFELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMP
FT                   FASYVMQATCFFTIGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWP
FT                   LAKVLDTWHWSGFFVVISIAAGISALLLLPFLNAQAPREA"
FT   gene            36285..37676
FT                   /locus_tag="CR539_00200"
FT   CDS_pept        36285..37676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00200"
FT                   /product="hexose phosphate transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SM07"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3SM07"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312630.1"
FT                   /protein_id="AUJ94023.1"
FT                   /translation="MLAFLNQVRKPTLDLPLEVRRKMWFKPFMQSYLVVFIGYLTMYLI
FT                   RKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTLVSYYADGKNTKQFLPFMLIL
FT                   SAICMLGFSASMGSGSVSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFLGF
FT                   WNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRYGSDSPESYGL
FT                   GKAEELFGEEISEEDKETESTDMTKWQIFVEYVLKNKVIWLLCFANIFLYVVRIGIDQW
FT                   STVYAFQELKLSKAVAIQGFTLFEAGALVGTLLWGWLSDLANGRRGLVACIALALIIAT
FT                   LGVYQHASNEYIYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIG
FT                   DSFAKLGLGMIADGTPVFGLTGWAGTFAALDIAAIGCICLMAIVAVMEERKIRREKKIQ
FT                   QLTVA"
FT   gene            37793..38245
FT                   /locus_tag="CR539_00205"
FT   CDS_pept        37793..38245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00205"
FT                   /product="DUF1198 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A271R208"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418119.2"
FT                   /protein_id="AUJ94024.1"
FT                   /translation="MIWIMLATVVVVFVVGFRVLTSGTRRAIRRLSERLNIDVVPVESM
FT                   IDQMGKMPGKEFLYYLHRPDESHLQNAAQVLLIWQIVIVDGSEQNLLRWHRLLQKARLA
FT                   APITDAQVRQALGLLRELEPDMQEINAFQMRYNALFQPEEGVFWLH"
FT   gene            complement(38264..39337)
FT                   /pseudo
FT                   /locus_tag="CR539_00210"
FT   CDS_pept        complement(38264..39337)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00210"
FT                   /product="lactam utilization protein LamB"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010426517.1"
FT   gene            complement(39353..40050)
FT                   /pseudo
FT                   /locus_tag="CR539_00215"
FT   CDS_pept        complement(39353..40050)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00215"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(40007..40105)
FT                   /pseudo
FT                   /locus_tag="CR539_00220"
FT   CDS_pept        complement(40007..40105)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00220"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            40105..41475
FT                   /pseudo
FT                   /gene="tnaA"
FT                   /locus_tag="CR539_00225"
FT   CDS_pept        40105..41475
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnaA"
FT                   /locus_tag="CR539_00225"
FT                   /product="tryptophanase"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418164.4"
FT   gene            41566..42813
FT                   /locus_tag="CR539_00230"
FT   CDS_pept        41566..42813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00230"
FT                   /product="low affinity tryptophan permease"
FT                   /note="tryptophan transporter of high affinity; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:C3SLI5"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLI5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312673.1"
FT                   /protein_id="AUJ94025.1"
FT                   /translation="MTDQAEKKHSAFWGVMVIAGTVIGGGMFALPVDLAGAWFFWGAFI
FT                   LIIAWFSMLHSGLLLLEANLNYPVGSSFNTITKDLIGNTWNIISGITVAFVLYILTYAY
FT                   ISANGAIISETISMNLGYHANPRIVGICTAIFVASVLWISSLAASRITSLFLGLKIISF
FT                   VIVFGSFFFQVDYSILRDATSSTAGTSYFPYIFMALPVCLASFGFHGNIPSLIICYGKR
FT                   KDKLIKSVVFGSLLALVIYLFWLYCTMGNIPRESFKAIISSGGNVDSLVKSFLGTKQHG
FT                   IIEFCLLVFSNLAVASSFFGVTLGLFDYLADLFKIDNSHGGRFKTVLLTFLPPALLYLI
FT                   FPNGFIYGIGGAGLCATIWAVIIPAVLAIKARKKFPNQMFTVWGGNLIPAIVILFGITV
FT                   ILCWFGNVFNVLPKFG"
FT   gene            42945..44120
FT                   /locus_tag="CR539_00235"
FT   CDS_pept        42945..44120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00235"
FT                   /product="multidrug transporter MdtL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSS6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023697"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSS6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312674.1"
FT                   /protein_id="AUJ94026.1"
FT                   /translation="MSRFLICSFALVLLYPAGIDMYLVGLPRIAADLNASEAQLHIAFS
FT                   VYLAGMATAMLFAGKVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLG
FT                   AGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIIPVLAPVLGHLIMLKFPWQSLFWTM
FT                   AIMGIAVLMLSLFILKETRPAAPAASDKSRENSESLLNRFFLSRVVITTLSVSVILTFV
FT                   NTSPVLLMEIMGFERGEYATIMALTAGVSMTVSFSTPFALGIFKPRTLMITSQVLFLAA
FT                   GITLTVSPSHAVSLFGITLICAGFSVGFGVAMSQALGPFSLRAGVASSTLGIAQVCGSS
FT                   LWIWLAAVVGIGAWNMLIGILIACSIVSLLLIMFVAPGRPAAAHEEIHHHA"
FT   gene            44095..45054
FT                   /locus_tag="CR539_00240"
FT   CDS_pept        44095..45054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00240"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1E5X1I0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR023746"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5X1I0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414877.1"
FT                   /protein_id="AUJ94027.1"
FT                   /translation="MKKSITTLDLNLLLCLQLLMQERSVTKAAKRMNVTPSAVSKSLAK
FT                   LRAWFDDPLFVNSPLGLSPTPLMVSMEQNLAEWMQMSNLLLDKPHHQTPRGLKFELAAE
FT                   SPLMMIMLNALSKRIYQRYPQATIKLRNWDYDSLDAITRGEVDIGFSGRESHPRSRELL
FT                   SSLPLAIDYEVLFSDVPCVWLRKDHPALHETWNLDTFLRYPHISICWEQSDTWALDNVL
FT                   QELGRERTIAMSLPEFEQSLFMAAQPDNLLLATAPRYCQYYNQLHQLPLVALPLPFDES
FT                   QQKKLEVPFTLLWHKRNSHNPKIVWLRDTIKNLYASMA"
FT   gene            45211..45960
FT                   /locus_tag="CR539_00245"
FT   CDS_pept        45211..45960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00245"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YQV2"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YQV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418168.2"
FT                   /protein_id="AUJ94028.1"
FT                   /translation="MATHFARGILTEGHLISVRLPSQCHQEARNIPPHRQSRFLASRGL
FT                   LAELMFMLYGIGELPEIVTLPKGKPVFSDKNLPSFSISYAGNMVGVALTTEGECGLDME
FT                   LQRATRGFHSPHAPDNHTFSSNESLWISKQNDPNEARAQLITLRRSVLKLTGDVLNDDP
FT                   RDLQLLPIAGRLKCAHVNHVEALCDAEDVLVWSVAVTPTIEKLSVWELDGKHGWKSLPD
FT                   IHSRANNPTSRMMRFAQLSTVKAFSPN"
FT   gene            45982..46548
FT                   /locus_tag="CR539_00250"
FT   CDS_pept        45982..46548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00250"
FT                   /product="NAD(P)H-dependent oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085P9R8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085P9R8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312677.1"
FT                   /protein_id="AUJ94029.1"
FT                   /translation="MSEKLQVVTLLGSLRKGSFNGMVARTLPKIAPASMEVNALPSIAD
FT                   IPLYDADVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQ
FT                   PLAGKPVLIQTSSMGVIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDQQTGEV
FT                   IDQGTLDHLTGQLTAFGEFIQRVKI"
FT   gene            complement(46602..47939)
FT                   /locus_tag="CR539_00255"
FT   CDS_pept        complement(46602..47939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00255"
FT                   /product="NCS2 family permease"
FT                   /note="involved in the transport or adenine; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:C3SLF7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLF7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312678.1"
FT                   /protein_id="AUJ94030.1"
FT                   /translation="MSQQHTTQASGQGMLERVFKLREHGTTARTEVIAGFTTFLTMVYI
FT                   VFVNPQILGVAGMDTSAVFVTTCLIAAFGSIMMGLFANLPVALAPAMGLNAFFAFVVVQ
FT                   AMGLPWQVGMGAIFWGAIGLLLLTIFRVRYWMIANIPVSLRVGITSGIGLFIGMMGLKN
FT                   AGVIVANPETLVSIGNLTSHSVLLGILGFFIIAILASRNIHAAVLVSIVVTTLLGWMLG
FT                   DVHYNGIVSAPPSVMTVVGHVDLAGSFNLGLAGVIFSFMLVNLFDSSGTLIGVTDKAGL
FT                   ADEKGKFPRMKQALYVDSISSVTGSFIGTSSVTAYIESSSGVSVGGRTGLTAVVVGLLF
FT                   LLVIFLSPLAGMVPGYAAAGALIYVGVLMTSSLARVNWQDLTESVPAFITAVMMPFSFS
FT                   ITEGIALGFISYCVMKIGTGRIRDLSPCVIIVALLFILKIVFIDAH"
FT   gene            48106..48771
FT                   /locus_tag="CR539_00260"
FT   CDS_pept        48106..48771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00260"
FT                   /product="6-phosphogluconate phosphatase"
FT                   /note="YieH; catalyzes the dephosphorylation of
FT                   phosphoenolpyruvate, AMP and p-nitrophenyl phosphate;
FT                   purine and pyrimidine nucleotides are secondary substrates;
FT                   member of the haloacid dehalogenase-like hydrolases
FT                   superfamily; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2D0CQB5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2D0CQB5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312679.1"
FT                   /protein_id="AUJ94031.1"
FT                   /translation="MSQIEAVFFDCDGTLVDSEVICSRAYVTMFREFGIHVDLKEIFTR
FT                   FKGVKLYEIIDIISKEQGVTMIQADAEHVYRAEVARLFDTELEDIAGANELLASINVPM
FT                   CVVSNGPVSKMQHSLGKLNMLHYFPEKLFSGYDIQRWKPDPALMFHAAKAMNVNVENCI
FT                   LVDDSSAGAQSGIDAGMEVFYFCADPHNKPIVHPKVTTFTELAQLPALWKARGWNITR"
FT   gene            complement(48908..51175)
FT                   /pseudo
FT                   /locus_tag="CR539_00265"
FT   CDS_pept        complement(48908..51175)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00265"
FT                   /product="type III effector"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414882.1"
FT   gene            complement(51193..51890)
FT                   /pseudo
FT                   /locus_tag="CR539_00270"
FT   CDS_pept        complement(51193..51890)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00270"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(51847..51948)
FT                   /pseudo
FT                   /locus_tag="CR539_00275"
FT   CDS_pept        complement(51847..51948)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00275"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            51969..53053
FT                   /pseudo
FT                   /locus_tag="CR539_00280"
FT   CDS_pept        51969..53053
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00280"
FT                   /product="type III effector protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001316741.1"
FT   gene            complement(53152..53331)
FT                   /locus_tag="CR539_00285"
FT   CDS_pept        complement(53152..53331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00285"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A152UTP0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152UTP0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312683.1"
FT                   /protein_id="AUJ94032.1"
FT                   /translation="MLSFPSEWCILLTEPFESTNAIKKTGIISLYLLFIAIALYGFIQL
FT                   KRDCFQRLWIIPGR"
FT   gene            complement(53522..55912)
FT                   /locus_tag="CR539_00290"
FT   CDS_pept        complement(53522..55912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00290"
FT                   /product="type III effector protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N598"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312684.1"
FT                   /protein_id="AUJ98127.1"
FT                   /translation="MSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFPMYHI
FT                   KEAKETIVEFVTKTEDKVKRFERIKSLAIPEEKWRFSTTTEFTVDENKDIIVSRVFKIN
FT                   INSKDNHNNAEENTMRSVLSEERNYNSYKHDIHFDEKAFQSGILKMQFPNDNEKLSVYL
FT                   KNKIPFENMIIDLSALKKDVLVSLKQCCFKKMTFTGNISYENLNGPVFENCFFEECNFE
FT                   NVSLVGFDKVTCESYDVLCNVKPNNKIPIYGMFKGCFLYQCEIKNFKIETSKIYSINQD
FT                   PQRGDKKVGAYLFMQSFVYASNLQDGVCKEASVIASSLLSCNIAKLNGVGMDFIETSFY
FT                   RKTRGGFRDSNNFYDCDFRYVNMTCKRDGIREDLRDYDPRKYFGESENKNKLNLDKALL
FT                   NFIHDDIFQNIKTHYNIKDDIDKHLNLNHCCLYAACLGELTGGNPLYDCAIDTHTTILS
FT                   GNLAANTQVKIPVYMYHRGAIAEKDILPFMEKVTNIYSRIEDIYKYSNNMKNNYKKALA
FT                   DLQSLLVNLHNIMPGDDVKDFQLNDETIKYIIDNVLYNRKKDIASEIDTDKVNFMHKIY
FT                   NNLYWYRHYDENGNEKTYRTANPNGNRFYFDFAGLQVLYYDYENKNKPTKEKFLEKQNL
FT                   FSTVKNFKAEEKINQEKHIEKPANVAHEIASFFDIEQYLLGGIDRNNNYINENFTYKLL
FT                   DLANRSGARDAQLERKVYFNEKMLNLNDNDEKEKVKIENDIKKIDKEIEEIDNAIWDLS
FT                   SETERFKIKFQQENRLNDVILGISRWLKENQVIVETIKKIDTE"
FT   gene            complement(55995..56201)
FT                   /locus_tag="CR539_00295"
FT   CDS_pept        complement(55995..56201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00295"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1E5X1A5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5X1A5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944572.1"
FT                   /protein_id="AUJ94033.1"
FT                   /translation="MEKKTKTRVKALYRNIKNERFFTVFIGGLAIIVSNQHPGMLFKTN
FT                   RLCVVLGRINIVFRRNDYGYIII"
FT   gene            complement(56267..56482)
FT                   /locus_tag="CR539_00300"
FT   CDS_pept        complement(56267..56482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00300"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1FZK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_013009306.1"
FT                   /protein_id="AUJ94034.1"
FT                   /translation="MSWINCWREKTRKSSANCRPDKAFCRIWQSARSYIVTGLINFLTE
FT                   ILPHKLTSKLSPVHCIYIITFEFFYF"
FT   gene            complement(56439..57164)
FT                   /gene="phoU"
FT                   /locus_tag="CR539_00305"
FT   CDS_pept        complement(56439..57164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="CR539_00305"
FT                   /product="phosphate transport system regulator PhoU"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLE7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLE7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312687.1"
FT                   /protein_id="AUJ94035.1"
FT                   /translation="MDSLNLNKHISGQFNAELESIRTQVMTMGGMVEQQLSDAITAMHN
FT                   QDSDLAKRVIEGDKNVNMMEVAIDEACVRIIAKRQPTASDLRLVMVISKTIAELERIGD
FT                   VADKICRTALEKFSQQHQPLLVSLESLGRHTIQMLHDVLDAFARMDIDEAVRIYREDKK
FT                   VDQEYEGIVRQLMTYMMEDSRTIPSVLTALFCARSIERIGDRCQNICEFIFYYVKGQDF
FT                   RHVGGDELDKLLAGKDPKE"
FT   gene            complement(57179..57952)
FT                   /locus_tag="CR539_00310"
FT   CDS_pept        complement(57179..57952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00310"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:B7TYI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7TYI3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000063125.1"
FT                   /protein_id="AUJ94036.1"
FT                   /translation="MSMVETAPSKIQVRNLNFYYGKFHALKNINLDIAKNQVTAFIGPS
FT                   GCGKSTLLRTFNKMFELYPEQRAEGEILLDGDNILTNSQDIALLRAKVGMVFQKPTPFP
FT                   MSIYDNIAFGVRLFEKLSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLC
FT                   IARGIAIRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHT
FT                   AFMYLGELIEFSNTDDLFTKPAKKQTEDYITGRYG"
FT   gene            complement(58129..59019)
FT                   /gene="pstA"
FT                   /locus_tag="CR539_00315"
FT   CDS_pept        complement(58129..59019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="CR539_00315"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:B7TYI2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7TYI2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312689.1"
FT                   /protein_id="AUJ94037.1"
FT                   /translation="MAMVEMQTTAALAESRRKMQARRRLKNRIALTLSMATMAFGLFWL
FT                   IWILMSTITRGIDGMSLALFTEMTPPPNTEGGGLANALAGSGLLILWATVFGTPLGIMA
FT                   GIYLAEYGRKSWLAEVIRFINDILLSAPSIVVGLFVYTIVVAQMEHFSGWAGVIALALL
FT                   QVPIVIRTTENMLKLVPDSLREAAYALGTPKWKMISAITLKASVSGIMTGILLAIARIA
FT                   GETAPLLFTALSNQFWSTDMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLIITLCVLL
FT                   LNILARVVFAKNKHG"
FT   gene            complement(59019..59978)
FT                   /gene="pstC"
FT                   /locus_tag="CR539_00320"
FT   CDS_pept        complement(59019..59978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="CR539_00320"
FT                   /product="phosphate ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLD2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312690.1"
FT                   /protein_id="AUJ94038.1"
FT                   /translation="MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLMLGGIIVSLIISS
FT                   WPSIQKFGLAFLWTKEWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELA
FT                   PGWLKRPLGIAIELLAAIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSG
FT                   PAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPF
FT                   TKNGVIGGIMLGLGRALGETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESG
FT                   LHVAALMELGLILFVITFIVLAASKFMIMRLAKNEGAR"
FT   gene            complement(60065..61105)
FT                   /gene="pstS"
FT                   /locus_tag="CR539_00325"
FT   CDS_pept        complement(60065..61105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="CR539_00325"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein PstS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLC7"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312691.1"
FT                   /protein_id="AUJ94039.1"
FT                   /translation="MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWA
FT                   DTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGV
FT                   VLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADG
FT                   SGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYA
FT                   YAKQNNLAYTKLISADGKPVLPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTT
FT                   FILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDS
FT                   SGKPLY"
FT   gene            complement(61419..63248)
FT                   /gene="glmS"
FT                   /locus_tag="CR539_00330"
FT   CDS_pept        complement(61419..63248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="CR539_00330"
FT                   /product="glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0F3U8N2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3U8N2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005121462.1"
FT                   /protein_id="AUJ94040.1"
FT                   /translation="MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTR
FT                   LRRLGKVQMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIEN
FT                   HEPLREELKARGYTFVSETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMD
FT                   SRHPDTLLAARSGSPLVIGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNI
FT                   FDKTGAEVKRQDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSE
FT                   LGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRR
FT                   NSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIG
FT                   VASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPNRIEQMLSQDKRIEAL
FT                   AEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVGSDNMHIIEMPHVEEVIAPIF
FT                   YTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE"
FT   gene            complement(63410..64780)
FT                   /gene="glmU"
FT                   /locus_tag="CR539_00335"
FT   CDS_pept        complement(63410..64780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="CR539_00335"
FT                   /product="bifunctional UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate N-acetyltransferase
FT                   GlmU"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /note="forms a homotrimer; catalyzes the acetylation of
FT                   glucosamine-1-phosphate and uridylation of
FT                   N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
FT                   function in cell wall synthesis; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MS99"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MS99"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312699.1"
FT                   /protein_id="AUJ94041.1"
FT                   /translation="MLNNVMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANE
FT                   LGAAHVHLVYGHGGDLLKQALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYG
FT                   DVPLISVETLQRLRDAKPQGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQR
FT                   QIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSE
FT                   VEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPTRFDLRGTLTHGRDVEIDTNVIIE
FT                   GNVTLGNRVKIGTGCVIKNSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLE
FT                   GAHVGNFVEMKKARLGKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGD
FT                   DVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEGWRRPVKKK"
FT   gene            complement(65168..65587)
FT                   /gene="atpC"
FT                   /locus_tag="CR539_00340"
FT   CDS_pept        complement(65168..65587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CR539_00340"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="part of catalytic core of ATP synthase;
FT                   alpha(3)beta(3)gamma(1)delta(1)epsilon(1); involved in
FT                   producing ATP from ADP in the presence of the proton motive
FT                   force across the membrane; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SLB2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001251972.1"
FT                   /protein_id="AUJ94042.1"
FT                   /translation="MAMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTA
FT                   IKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEE
FT                   HISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM"
FT   gene            complement(65608..66990)
FT                   /gene="atpD"
FT                   /locus_tag="CR539_00345"
FT   CDS_pept        complement(65608..66990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CR539_00345"
FT                   /product="ATP synthase subunit beta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SLA7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C3SLA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_017800291.1"
FT                   /protein_id="AUJ94043.1"
FT                   /translation="MATGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQ
FT                   QLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGE
FT                   EERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAK
FT                   KL"
FT   gene            complement(67017..67880)
FT                   /locus_tag="CR539_00350"
FT   CDS_pept        complement(67017..67880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00350"
FT                   /product="ATP synthase subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. The gamma chain is a
FT                   regulatory subunit; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSM0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSM0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312702.1"
FT                   /protein_id="AUJ94044.1"
FT                   /translation="MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPY
FT                   AETMRKVIGHLAHGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMK
FT                   TWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEG
FT                   RLDKLYIVSNKFINTMAQVPTISQLLPLPASDDDDLKHKSWDYLYEPDPKALLDTLLRR
FT                   YVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIV
FT                   SGAAAV"
FT   gene            complement(67931..69472)
FT                   /gene="atpA"
FT                   /locus_tag="CR539_00355"
FT   CDS_pept        complement(67931..69472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CR539_00355"
FT                   /product="ATP synthase subunit alpha"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL97"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL97"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001176751.1"
FT                   /protein_id="AUJ94045.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLA
FT                   DCMQGEMISLPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGAPIDGKGPLDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQ
FT                   RELIIGDRQTGKTALAIDAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTI
FT                   VVVATASESAALQYLAPYAGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETNLFNAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLAD
FT                   VELSKIGSFEAALLAYVDRDHAPLMQEINQTGGYNDEIEGKLKGILDSFKATQSW"
FT   gene            complement(69485..70018)
FT                   /locus_tag="CR539_00360"
FT   CDS_pept        complement(69485..70018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00360"
FT                   /product="ATP synthase subunit delta"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane; the delta subunit is part of
FT                   the catalytic core of the ATP synthase complex; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:C3SL92"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL92"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_015966593.1"
FT                   /protein_id="AUJ94046.1"
FT                   /translation="MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMA
FT                   ELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSE
FT                   ATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGS
FT                   VRGRLERLADVLQS"
FT   gene            complement(70033..70503)
FT                   /locus_tag="CR539_00365"
FT   CDS_pept        complement(70033..70503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00365"
FT                   /product="ATP synthase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. Subunit B is part of the
FT                   membrane proton channel; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL87"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001052215.1"
FT                   /protein_id="AUJ94047.1"
FT                   /translation="MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLA
FT                   SAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQ
FT                   AQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   gene            complement(70565..70804)
FT                   /locus_tag="CR539_00370"
FT   CDS_pept        complement(70565..70804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00370"
FT                   /product="ATP synthase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. Subunit C is part of the
FT                   membrane proton channel F0; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SL82"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312706.1"
FT                   /protein_id="AUJ94048.1"
FT                   /translation="MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA"
FT   gene            complement(70851..71666)
FT                   /locus_tag="CR539_00375"
FT   CDS_pept        complement(70851..71666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00375"
FT                   /product="ATP synthase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. Subunit A is part of the
FT                   membrane proton channel F0; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SL77"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL77"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005121454.1"
FT                   /protein_id="AUJ94049.1"
FT                   /translation="MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDS
FT                   MFFSVVLGLLFLVLFRSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPL
FT                   ALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILF
FT                   YSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIF
FT                   ILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
FT   gene            complement(71675..72055)
FT                   /locus_tag="CR539_00380"
FT   CDS_pept        complement(71675..72055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00380"
FT                   /product="ATP synthase I"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. Subunit I associates with the
FT                   membrane and may be involved with cation translocation;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:D1MDU2"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D1MDU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418195.2"
FT                   /protein_id="AUJ94050.1"
FT                   /translation="MSVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGL
FT                   AVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPL
FT                   IVTWVLVLVVQILAPAVINNKG"
FT   gene            complement(72672..73295)
FT                   /locus_tag="CR539_00385"
FT   CDS_pept        complement(72672..73295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00385"
FT                   /product="16S rRNA (guanine(527)-N(7))-methyltransferase
FT                   RsmG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSA1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSA1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312709.1"
FT                   /protein_id="AUJ94051.1"
FT                   /translation="MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRD
FT                   PNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRF
FT                   LRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLLGEQGRFYA
FT                   LKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANKI"
FT   gene            complement(73359..75248)
FT                   /locus_tag="CR539_00390"
FT   CDS_pept        complement(73359..75248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00390"
FT                   /product="tRNA uridine-5-carboxymethylaminomethyl(34)
FT                   synthesis enzyme MnmG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSD5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSD5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000499793.1"
FT                   /protein_id="AUJ94052.1"
FT                   /translation="MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLY
FT                   RQAVRTALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKI
FT                   HIGLDNYSGGRAGDPPSIPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDN
FT                   PMPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIE
FT                   DKVMRFADRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPG
FT                   YAIEYDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKE
FT                   GWAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLV
FT                   DDERWARFNEKLENIERERQRLKSTWVTPSAEAAAEVNAHLTAPLSREVSGEDLLRRPE
FT                   MTYEKLTTLTPFAPALTDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDY
FT                   RQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKKQGMLRRSA"
FT   gene            complement(75627..76070)
FT                   /locus_tag="CR539_00395"
FT   CDS_pept        complement(75627..76070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00395"
FT                   /product="FMN-binding protein MioC"
FT                   /note="An electron-transfer protein; flavodoxin binds one
FT                   FMN molecule, which serves as a redox-active prosthetic
FT                   group; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL57"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312711.1"
FT                   /protein_id="AUJ94053.1"
FT                   /translation="MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLS
FT                   ASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDK
FT                   LEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWINLLK"
FT   gene            complement(76160..76618)
FT                   /locus_tag="CR539_00400"
FT   CDS_pept        complement(76160..76618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00400"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL52"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312712.1"
FT                   /protein_id="AUJ94054.1"
FT                   /translation="MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEK
FT                   MKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGH
FT                   YSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP"
FT   gene            76770..77762
FT                   /locus_tag="CR539_00405"
FT   CDS_pept        76770..77762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00405"
FT                   /product="asparagine synthetase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL47"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL47"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312713.1"
FT                   /protein_id="AUJ94055.1"
FT                   /translation="MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQ
FT                   DNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDED
FT                   RLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPD
FT                   QIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWS
FT                   TPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLQLEWHQA
FT                   LLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPAAVRESVPSLL"
FT   gene            complement(77767..79218)
FT                   /locus_tag="CR539_00410"
FT   CDS_pept        complement(77767..79218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00410"
FT                   /product="ATPase RavA stimulator ViaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSV0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312714.1"
FT                   /protein_id="AUJ94056.1"
FT                   /translation="MLTLDTLNVMLAVSEEGLIEEMIIALLASPQLAVFFEKFPRLKAA
FT                   ITDDVPRWREALRNRLKDARVPPELTEEVMCYQQSQLLSTPQFIMQLPQILDLLHRLNS
FT                   PWAEQARQLVDANSSITSALHTLFLQRWRLSLIVQATTLNQQLLEEEREQLLSEVQERM
FT                   TLSGQLEPILADNNTAAGRLWDMSAGQLKRGDYQLIVKYGEFLNEQPELKHLAEQLGRS
FT                   REAKSIPRNDAQMETFRTMVREPATVPEQVDGLQQSDDILRLLPPELATLGITELEYEF
FT                   YRRLVEKQLLTYRLHGESWREKVIERPVVHKDYDEQPRGPFIVCVDTSGSMGGFNEQCA
FT                   KAFCLALMRIALAENRRCYIMLFSTEIVRYELSGPQGIEQAIRFLSQQFRGGTDLASCF
FT                   RAIMERLQSREWFDADAVVISDFIAQRLPDDVTSKVKELQRVHQHRFHAVAMSAHGKPG
FT                   IMRIFDHIWRFDTGMRSRLLRRWRR"
FT   gene            complement(79212..80708)
FT                   /locus_tag="CR539_00415"
FT   CDS_pept        complement(79212..80708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00415"
FT                   /product="ATPase RavA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A093GEY8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A093GEY8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418202.4"
FT                   /protein_id="AUJ94057.1"
FT                   /translation="MAHPHLLAERISRLSSSLEKGLYERSHAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFQNARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTSGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERQFRNGAHVEKIPMRLLVAASNELPEADSS
FT                   LEALYDRMLIRLWLDKVQDKANFRSMLTSQQDENDNPVPDALQVTDEEYERWQKEIGEI
FT                   TLPDHVFELIFMLRQQLDKLPDAPYVSDRRWKKAIRLLQASAFFSGRSAVAPVDLILLK
FT                   DCLWYDAQSLNLIQQQIDVLMTGHAWQQQGMLTRLGAIVQRHLQLQQQQSDKTALTVIR
FT                   LGGIFSRRQQYQLPVNVTASTLTLLLQKPLKLHDMEVVHISFERNALEQWLSKGGEIRG
FT                   KLNGIGFAQKLNLEVDSAQHLVVRDVSLQGSTLALPGSSAEGLPGEIKQQLEELESDWR
FT                   KQHALFSEQQKCLFIPGDWLGRIEASLQDVGAQIRQAQQC"
FT   gene            80931..82799
FT                   /gene="trkD"
FT                   /locus_tag="CR539_00420"
FT   CDS_pept        80931..82799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkD"
FT                   /locus_tag="CR539_00420"
FT                   /product="potassium transporter Kup"
FT                   /note="Responsible for the low-affinity transport of
FT                   potassium into the cell; involved in potassium ion uptake
FT                   under hyper-osmotic stress at a low pH; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSQ4"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSQ4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000102304.1"
FT                   /protein_id="AUJ94058.1"
FT                   /translation="MSTDNKQSLPAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVE
FT                   RDAVFGFLSLIFWLLIFVVSIKYLTFVMRADNAGEGGILTLMSLAGRNTSARTTSMLVI
FT                   MGLIGGSFFYGEVVITPAISVMSAIEGLEIVAPQLDTWIVPLSIIVLTLLFMIQKHGTA
FT                   MVGKMFAPIMLTWFLILAGLGLRSIIANPEVLHALNPMWAVHFFLEYKTVSFIALGAVV
FT                   LSITGVEALYADMGHFGKFPIRLAWFTVVLPSLTLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLIIAALATVIASQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIP
FT                   FVNWMLYVAVVIVIVSFEHSSNLAAAYGIAVTGTMVLTSILSTTVARQNWHWNKYFVAL
FT                   ILIAFLCVDIPLFTANLDKLLSGGWLPLSLGTVMFIVMTTWKSERFRLLRRMHEHGNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAINVIPFALMHNLKHNKVLHERVILLTLRTEDAPY
FT                   VHNVRRVQIEQLSPTFWRVVASYGWRETPNVEEVFHRCGLEGLSCRMMETSFFMSHESL
FT                   ILGKRPWYLRLRGKLYLLLQRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            82966..83385
FT                   /locus_tag="CR539_00425"
FT   CDS_pept        82966..83385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00425"
FT                   /product="D-ribose pyranase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K3WSX0"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3WSX0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414913.1"
FT                   /protein_id="AUJ98128.1"
FT                   /translation="MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALT
FT                   QGVPSFMQVLDVVTNEMQVEAAIIAEEIKQHNPQLHETLLTHLEQLQKHQGNTIEIRYT
FT                   THEQFKQQTAESQAVIRSGECSPYANIILCAGVTF"
FT   gene            83393..84898
FT                   /locus_tag="CR539_00430"
FT   CDS_pept        83393..84898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00430"
FT                   /product="ribose import ATP-binding protein RbsA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL22"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418205.1"
FT                   /protein_id="AUJ94059.1"
FT                   /translation="MEALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKST
FT                   MMKVLTGIYTRDAGTLLWLGKETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFVNRFGKIDWKTMYAEADKLLAKLNLRFKSDKLVGDLSIGDQQMVEIAKVLSFESKVI
FT                   IMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAE
FT                   REVASLTEDSLIEMMVGRKLEDQYPHLDKAPGDIRLKVDNLCGPGVNDVSFTLRKGEIL
FT                   GVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVVTRSPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSRAGGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEV
FT                   LGMSDRIIVMHEGHLSGEFTREQATQEVLMAAAVGKLNRVNQE"
FT   gene            84903..85868
FT                   /locus_tag="CR539_00435"
FT   CDS_pept        84903..85868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00435"
FT                   /product="ribose ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL17"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_002882531.1"
FT                   /protein_id="AUJ94060.1"
FT                   /translation="MTTQTVSGRRYFTKAWLMEQKSLIALLVLIAIVSTLSPNFFTINN
FT                   LFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGIEVNALVAVAAA
FT                   LALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTENADLFGW
FT                   FGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGINVNKIKII
FT                   VYSLCGLLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIG
FT                   ALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKKQ"
FT   gene            85893..86783
FT                   /locus_tag="CR539_00440"
FT   CDS_pept        85893..86783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00440"
FT                   /product="ribose ABC transporter substrate-binding protein
FT                   RbsB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SL12"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3SL12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312720.1"
FT                   /protein_id="AUJ94061.1"
FT                   /translation="MNMKKLATLVSAVALSATVSANAMAKDTIALVVSTLNNPFFVSLK
FT                   DGAQKEADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMAN
FT                   QANIPVITLDRQATKGEVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAA
FT                   RERGEGFQQAVAAHKFNVLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGA
FT                   LRALQTAGKSDVMVVGFDGTPDGEKAVNDGKLAATIAQLPDQIGAKGVETADKVLKGEK
FT                   VQAKYPVDLKLVVKQ"
FT   gene            86919..87848
FT                   /locus_tag="CR539_00445"
FT   CDS_pept        86919..87848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00445"
FT                   /product="ribokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6F5Q1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6F5Q1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312721.1"
FT                   /protein_id="AUJ98129.1"
FT                   /translation="MQNAGSLVVLGSINADHILNLHSFPTPGETVTGNHYQVAFGGKGA
FT                   NQAVAAGRSGANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNG
FT                   EGENVIGIHAGANAALSPALVDAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIV
FT                   ALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLI
FT                   TLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAA
FT                   AAIAVTRKGAQPSVPWREEIDAFLDRQR"
FT   gene            87852..88844
FT                   /locus_tag="CR539_00450"
FT   CDS_pept        87852..88844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00450"
FT                   /product="transcriptional regulator RbsR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2D0CRF8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2D0CRF8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312722.1"
FT                   /protein_id="AUJ94062.1"
FT                   /translation="MATMKDVARLAGVSTSTVSHVINKDRFVSEAITAKVEAAIKELNY
FT                   APSALARSLKLNQTHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRM
FT                   NRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNSLL
FT                   GGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDFEF
FT                   NGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELASF
FT                   MTPPLTTIHQPKDELGELAIDVLIHRIIQPTLQQQRLQLTPILMERGSA"
FT   gene            complement(88810..90237)
FT                   /locus_tag="CR539_00455"
FT   CDS_pept        complement(88810..90237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00455"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085P9V9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085P9V9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312723.1"
FT                   /protein_id="AUJ94063.1"
FT                   /translation="MSDKKKRSMAGLPWIAAMAFFMQALDATILNTALPAIAHSLNRSP
FT                   LAMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFTLAVSLFTLGSLACALSNSLPQLVV
FT                   FRVIQGIGGAMMMPVARLALLRAYPRNELLPVLNFVAMPGLVGPILGPVLGGVLVTWAT
FT                   WHWIFLINIPIGIAGLLYARKHMPNFTTARRRFDITGFLLFGLSLVLFSSGIELFGEKI
FT                   VASWIALTVIVTSIGLLLLYILHARRTPNPLISLDLFKTRTFSIGIVGNIATRLGTGCV
FT                   PFLMPLMLQVGFGYQAFIAGCMMAPTALGSIIAKSMVTQVLRRLGYRHTLVGITVIIGL
FT                   MIAQFSLQSPAMAIWMLILPLFILGMAMSTQFTAMNTITLADLTDDNASSGNSVLAVTQ
FT                   QLSISLGVAVSAAVLRVYEGMEGTTTVEQFHYTFITMGIITVASAAMFMLLKTTDGNNL
FT                   IKRQRKSKPNHVPSESE"
FT   gene            complement(90260..90952)
FT                   /locus_tag="CR539_00460"
FT   CDS_pept        complement(90260..90952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00460"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0B1H1H8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1H1H8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312724.2"
FT                   /protein_id="AUJ94064.1"
FT                   /translation="MPLSAQQLAAQKNLSYVLAEKLAQRILKGEYEPGTILPGEIELGE
FT                   QFGVSRTAVREAVKTLTAKGMVLPRPRIGTRVMPQSNWNFLDQELLTWWMTEENFHQVI
FT                   NHFLVMRICLEPQACLLAATVGTAEQKAHLNTLMAEMAALKENFRRERWIEVDMAWHEH
FT                   IYEMSANPFLTSFASLFHSVYHTYFTSITSDTVIKLDLHQAIVDAIIQSDGDAAFKACQ
FT                   ALLRSPDK"
FT   gene            91431..92986
FT                   /locus_tag="CR539_00465"
FT   rRNA            91431..92986
FT                   /locus_tag="CR539_00465"
FT                   /product="16S ribosomal RNA"
FT   gene            93060..93135
FT                   /locus_tag="CR539_00470"
FT   tRNA            93060..93135
FT                   /locus_tag="CR539_00470"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:93094..93096,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            93320..96243
FT                   /locus_tag="CR539_00475"
FT   rRNA            93320..96243
FT                   /locus_tag="CR539_00475"
FT                   /product="23S ribosomal RNA"
FT   gene            96327..96442
FT                   /gene="rrf"
FT                   /locus_tag="CR539_00480"
FT   rRNA            96327..96442
FT                   /gene="rrf"
FT                   /locus_tag="CR539_00480"
FT                   /product="5S ribosomal RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00001"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            96497..96573
FT                   /locus_tag="CR539_00485"
FT   tRNA            96497..96573
FT                   /locus_tag="CR539_00485"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:96531..96533,aa:Asp,seq:gtc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            96582..96657
FT                   /locus_tag="CR539_00490"
FT   tRNA            96582..96657
FT                   /locus_tag="CR539_00490"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:96615..96617,aa:Trp,seq:cca)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(96753..97592)
FT                   /locus_tag="CR539_00495"
FT   CDS_pept        complement(96753..97592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00495"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKY7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312725.1"
FT                   /protein_id="AUJ94065.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGV
FT                   NLFTRHRNNIRLTAAGEKLLPYAETLMSTWQAARKEVAHTSRHNEFSIGASASLWECML
FT                   NQWLGRLYQNQDAHTGLQFEARIAQRQSLVKQLHERQLDLLITTEAPKMDEFSSQLLGY
FT                   FTLALYTSAPSKLKGDLNYLRLEWGPDFQQHEAGLIGADEVPILTTSSAELAQQQIAML
FT                   NGCTWLPVSWARKKGGLHTVVDSTTLSRPLYAIWLQNSDKNTLIRDLLKINVLDEVY"
FT   gene            97711..98049
FT                   /locus_tag="CR539_00500"
FT   CDS_pept        97711..98049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00500"
FT                   /product="DUF413 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKY2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312726.1"
FT                   /protein_id="AUJ94066.1"
FT                   /translation="MAESFTTTNRYFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNEL
FT                   DLGKREPVTEEEKLFVAVCRGEREPVTEAERVWSKYMTRIKRPKRFHTLSGGKPQVEGA
FT                   EDYTDSDD"
FT   gene            complement(98074..99594)
FT                   /locus_tag="CR539_00505"
FT   CDS_pept        complement(98074..99594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00505"
FT                   /product="ATP-dependent protease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTM6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTM6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312727.2"
FT                   /protein_id="AUJ94067.1"
FT                   /translation="MSLSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEA
FT                   RDRVRSAIINSGYEYPAKKITINLAPADLPKEGGRYDLPIAIALLAASEQLTANKLDEY
FT                   ELVGELALTGALHGVPGAISSATEAIKSGRKIIVAKDNEDEVGLINGEGCLIADHLQAV
FT                   CAFLEGKHTLERPKPTDAVSRALQHDLSDVVGQEQEKRGLEITAAGGHNLLLIGPPGTG
FT                   KTMLASRINGLLPDLSNEEALESAAILSLVNAESVQKQWRQRPFRSPHHSASLTAMVGG
FT                   GAIPGPGEISLAHNGVLFLDELPEFERRTLDALREPIESGQIHLSRTRAKITYPARFQL
FT                   VAAMNPSPTGHYQGNHNRCTPEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVP
FT                   GESSTTVKQRVMAARERQFKRQNKLNAWLDSPEIRKFCKLESEDAQWLEETLIHLGLSI
FT                   RAWQRLLKVARTIADIDQSDIITRQHLQEAVSYRAIDRLLIHLQKLLT"
FT   gene            99738..99939
FT                   /pseudo
FT                   /locus_tag="CR539_00510"
FT   CDS_pept        99738..99939
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00510"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001437473.1"
FT   gene            99936..100034
FT                   /locus_tag="CR539_00515"
FT   CDS_pept        99936..100034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00515"
FT                   /product="IlvGMEDA operon leader peptide"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKX2"
FT                   /db_xref="InterPro:IPR012567"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKX2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312728.1"
FT                   /protein_id="AUJ94068.1"
FT                   /translation="MTALLRVISLVVISVVVIIIPPCGAALGRGKA"
FT   gene            100174..101820
FT                   /locus_tag="CR539_00520"
FT   CDS_pept        100174..101820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00520"
FT                   /product="acetolactate synthase 2 catalytic subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="catalyzes the formation of 2-acetolactate from
FT                   pyruvate; also known as acetolactate synthase large
FT                   subunit; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EU27"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EU27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001012636.1"
FT                   /protein_id="AUJ94069.1"
FT                   /translation="MNGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAMAAIGYARATGKTGVCIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFI
FT                   GTDAFQEVDVLGLSLACTKHSFLVQSLKELPRIMAEAFDVASSGRPGPVLVDIPKDIQL
FT                   ASGDLEPWFTTVENEVTFPHAEVEQARQMLAKAQKPMLYVGGGVGMAQAVPALREFLAA
FT                   TKMPATCTLKGLGAVDADYPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKL
FT                   NTFAPHASVIHMDIDPAEMNKLRQAHVALQGDLNALLPALQQPLNINDWQQYCTQLRDE
FT                   HTWRYDHPGDAIYAPLLLKQLSDRKPADCVVTTDVGQHQMWAAQHIAHTRPENFITSSG
FT                   LGTMGFGLPAAVGAQVARPNDTVVCISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFQERYSETTLTDNPDFLMLASAFGIPGQHITRKDQVEAALDTMLNSDGP
FT                   YLLHVSIDELENVWPLVPPGASNSEMLEKLS"
FT   gene            101817..102080
FT                   /locus_tag="CR539_00525"
FT   CDS_pept        101817..102080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00525"
FT                   /product="acetolactate synthase isozyme 2 small subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKW2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312730.1"
FT                   /protein_id="AUJ94070.1"
FT                   /translation="MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNI
FT                   NIELTVASPRSVDLLFSQLNKLVDVAHVAICQSTTTSQQIRA"
FT   gene            102100..103029
FT                   /locus_tag="CR539_00530"
FT   CDS_pept        102100..103029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00530"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKV7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKV7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312731.1"
FT                   /protein_id="AUJ94071.1"
FT                   /translation="MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDS
FT                   HKGPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVG
FT                   DVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGIT
FT                   RDAIIKLAKELGIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPV
FT                   TKRIQQAFFGLFTGETEDKWGWLDQVNQ"
FT   gene            103094..104944
FT                   /locus_tag="CR539_00535"
FT   CDS_pept        103094..104944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00535"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1Q4P8D8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4P8D8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005133366.1"
FT                   /protein_id="AUJ94072.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIQGADPKVSDSQSDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLL
FT                   ATHADRKQLFLNAGKRIVELTKRYYEQNDDSALPRNIASKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEAEIDFTMSDIDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELD
FT                   RAGLLNRDVKNVLGLTLPQTLEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDT
FT                   LDDDRANGCIRSLEHAYSKDGGLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQ
FT                   DDAVEAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGSIGLIEDGDLIAIDIPNRGIQLQVSDAELAARREAQEARG
FT                   DKAWTPKNRERQVSFALRAYASLATSADKGAVRDKSKLGG"
FT   gene            104947..106491
FT                   /gene="ilvA"
FT                   /locus_tag="CR539_00540"
FT   CDS_pept        104947..106491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="CR539_00540"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QIT5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:J7QIT5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312733.1"
FT                   /protein_id="AUJ94073.1"
FT                   /translation="MADSQPLSGAPEGAEYLRAVLRAPVYEAAQVTPLQKMEKLSSRLD
FT                   NVILVKREDRQPVHSFKLRGAYAMMAGLTEEQKAHGVITASAGNHAQGVAFSSARLGVK
FT                   ALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQQGFTWVPPFDHPMVI
FT                   AGQGTLALELLQQDAHLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKA
FT                   ALDAGHPVDLPRVGLFAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFEDV
FT                   RAVAEPSGALALAGMKKYIAQHNIRGERLAHILSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEEKGSFLKFCQLLGGRSVTEFNYRFADAKNACIFVGVRLSRGLEERKEILQML
FT                   NDGGYSVVDLSDDEMAKLHVRYMVGGRPSHPLQERLYSFEFPESPGALLRFLNTLGTHW
FT                   NISLFHYRSHGTDYGRVLAAFELGDHEPDFETRLNELGYDCHDETNNPAFRFFLAG"
FT   gene            complement(106488..107378)
FT                   /locus_tag="CR539_00545"
FT   CDS_pept        complement(106488..107378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00545"
FT                   /product="HTH-type transcriptional activator IlvY"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7R7Z7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:J7R7Z7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418221.1"
FT                   /protein_id="AUJ94074.1"
FT                   /translation="MDLRDLKTFLHLAESRHFGRSARAMHVSPSTLSRQIQRLEEDLGQ
FT                   PLFVRDNRTVTLTEAGEELRVFAQQTLLQYQQLRHTIDQQGPSLSGELHIFCSVTAAYS
FT                   HLPPILDRFRAEHPSVEIKLTTGDAADAMEKVVTGEADLAIAGKPETLPGAVAFSMLEN
FT                   LAVVLIAPALPCPVRNQVSVEKPDWSTVPFIMADQGPVRRRIELWFRRNKISNPMIYAT
FT                   VGGHEAMVSMVALGCGVALLPEVVLENSPEPVRNRVMILERSDEKTPFELGVCAQKKRL
FT                   HEPLIEAFWKILPNH"
FT   gene            107528..109003
FT                   /locus_tag="CR539_00550"
FT   CDS_pept        107528..109003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00550"
FT                   /product="ketol-acid reductoisomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QHV3"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E2QHV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414931.1"
FT                   /protein_id="AUJ94075.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSDVVRTVQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFE
FT                   TAPQYEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSYACVPLLKPFMAELQPGDLGKAIPEGAVDNAQL
FT                   RDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG"
FT   gene            complement(109049..109330)
FT                   /locus_tag="CR539_00555"
FT   CDS_pept        complement(109049..109330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00555"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="rotamase C; accelerates isomerization of the
FT                   peptidyl prolyl bond; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKT7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004097481.1"
FT                   /protein_id="AUJ94076.1"
FT                   /translation="MAKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGK
FT                   RGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN"
FT   gene            109417..111438
FT                   /locus_tag="CR539_00560"
FT   CDS_pept        109417..111438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00560"
FT                   /product="DNA helicase Rep"
FT                   /note="single-stranded DNA-dependent ATPase; initiates
FT                   unwinding at a nick in the DNA; involved in DNA
FT                   replication; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8U2K7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:W8U2K7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026251.1"
FT                   /protein_id="AUJ94077.1"
FT                   /translation="MRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGY
FT                   QARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMISTFHTLGLDIIKREYAALGMKAN
FT                   FSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERDRI
FT                   FAHCYGLYDAHLKACNVLDFDDLILLPTLLLQRNEEVRERWQNKIRYLLVDEYQDTNTS
FT                   QYELVKLLVGSRARFTVVGDDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKRLFSELGYGTELKVLSANNEEHEAERVTGELIAHHFVNKT
FT                   QYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD
FT                   SAFLRIVNTPKREIGPATLKKLGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTH
FT                   WLAEIQRLAEREPIAAVRDLIHGMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLE
FT                   GSELDEPMTLTQVVTRFTLRDMMERGESEEELDQVQLMTLHASKGLEFPYVYMVGMEEG
FT                   FLPHQSSIDEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ
FT                   DDLIWEQERKVVSAEERMQKGQSHLANLKAMMAAKRGK"
FT   gene            complement(111485..112969)
FT                   /locus_tag="CR539_00565"
FT   CDS_pept        complement(111485..112969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00565"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSS3"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSS3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312739.1"
FT                   /protein_id="AUJ94078.1"
FT                   /translation="MGSTSSLYAAIDLGSNSFHMLVVREVAGSIQTLTRIKRKVRLAAG
FT                   LNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRVVATATLRLAVNAGDFIAKAQEIL
FT                   GCPVQVISGEEEARLIYQGVAHTTGGADQRLVVDIGGASTELVTGTGAQTTSLFSLSMG
FT                   CVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHGWKVCVGASGTVQALQEIM
FT                   MAQGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNI
FT                   QCMTLAGGALREGLVYGMLHLAVEQDIRSRTLRNIQRRFMIDIDQAQRVAKVAANFFEQ
FT                   VENEWHLEAISRDLLISACQLHEIGLSVDFKQAPQHAAYLVRNLDLPGFTPAQKKLLAT
FT                   LLLNQTNPVDLSSLHQQNAVPPRVAEQLCRLLRLAIIFASRRRDDLVPEMTLQANHELL
FT                   TLTLPQGWLTQHPLGKEIIAQESQWQSYVHWPLEVH"
FT   gene            complement(112975..113097)
FT                   /locus_tag="CR539_00570"
FT   CDS_pept        complement(112975..113097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00570"
FT                   /product="addiction module toxin RelE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3WWS1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001346605.1"
FT                   /protein_id="AUJ94079.1"
FT                   /translation="MSYSKSFKLYQDGKRMNPDELTVVSDSGERMQPTQRQIEG"
FT   gene            complement(113105..114370)
FT                   /locus_tag="CR539_00575"
FT   CDS_pept        complement(113105..114370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00575"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EU25"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EU25"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418227.1"
FT                   /protein_id="AUJ94080.1"
FT                   /translation="MSKTHLTEQKFSDFALHPKVVESLEKKGFHNCTPIQALALPLTLA
FT                   GRDVAGQAQTGTGKTMAFLTSTFHYLLSHPAIADRKVNQPRALIMAPTRELAVQIHADA
FT                   EPLAEATGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYIEVE
FT                   PEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILDEFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGASGHSISLACEEYALNLPAIETYIGHSIPVSKYNPDALMTDLPKPLRL
FT                   TRPRTGNGPRRTGAPRNRRRSG"
FT   gene            114501..114830
FT                   /gene="trxA"
FT                   /locus_tag="CR539_00580"
FT   CDS_pept        114501..114830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="CR539_00580"
FT                   /product="thiol reductase thioredoxin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TGE9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:W8TGE9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_457831.1"
FT                   /protein_id="AUJ94081.1"
FT                   /translation="MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDE
FT                   IADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFL
FT                   DANLA"
FT   gene            114971..115072
FT                   /locus_tag="CR539_00585"
FT   CDS_pept        114971..115072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00585"
FT                   /product="rho operon leader peptide"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:C3SKQ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312742.1"
FT                   /protein_id="AUJ94082.1"
FT                   /translation="MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR"
FT   gene            115157..116416
FT                   /gene="rho"
FT                   /locus_tag="CR539_00590"
FT   CDS_pept        115157..116416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="CR539_00590"
FT                   /product="transcription termination factor Rho"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKQ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKQ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312743.1"
FT                   /protein_id="AUJ94083.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDDFFEMMKRS"
FT   gene            116656..117759
FT                   /locus_tag="CR539_00595"
FT   CDS_pept        116656..117759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00595"
FT                   /product="UDP-N-acetylglucosamine--undecaprenyl-phosphate
FT                   N-acetylglucosaminephosphotransferase"
FT                   /note="catalyzes the formation of
FT                   alpha-N-acetylglucosaminyl-pyrophosphoryl-undecaprenyl from
FT                   alpha-N-acetylglucosaminyl 1-phosphate and the lipid
FT                   carrier undecaprenyl phosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSQ3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSQ3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418231.1"
FT                   /protein_id="AUJ94084.1"
FT                   /translation="MNLLTVSTDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQG
FT                   LIPLVGGISVYAGICFTFGIVDYYIPHASLYLACAGVLVFIGALDDRFDISVKIRATIQ
FT                   AAVGIVMMVFGKLYLSSLGYIFGSWEMVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVSFAAIGMILWFDGQTSLAIWCFAMIAAILPYIMLNLGILGRRYKVFMGDAGSTL
FT                   IGFTVIWILLETTQGKTHPISPVTALWITAIPLMDMVAIMYRRLCKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLASIGVLAEYSHFVPEWVMLVLFLLAFFLYGYCIKR
FT                   AWKVARFIKRVKRRLRRNRGGSPNLTK"
FT   gene            117771..118817
FT                   /locus_tag="CR539_00600"
FT   CDS_pept        117771..118817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00600"
FT                   /product="LPS biosynthesis protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TGE5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:W8TGE5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418232.2"
FT                   /protein_id="AUJ94085.1"
FT                   /translation="MTQPMPGKPAEDAENELDIRGLFRTLWAGKLWIIGMGLAFALIAL
FT                   AYTFFARQEWSSTAITDRPTVNMLGGYYSQQQFLRNLDVRSNMASADQPSVMDEAYKEF
FT                   VMQLASWDTRREFWLQTDYYKQRMVGNSKADAALLDEMINNIQFIPGDFTRAVNDSVKL
FT                   IAETAPDANNLLRQYVAFASQRAASHLNDELKGAWAARTIQMKAQVKRQEEVAKAIYDR
FT                   RMNSIEQALKIAEQHNISRSATDVPAEELPDSEMFLLGRPMLQARLENLQAVGPAFDLD
FT                   YDQNRAMLNTLNVGPTLDPRFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGGLIGAGV
FT                   ALTRRCSK"
FT   gene            118873..120003
FT                   /locus_tag="CR539_00605"
FT   CDS_pept        118873..120003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00605"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase
FT                   (non-hydrolyzing)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066Q1W6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066Q1W6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312746.2"
FT                   /protein_id="AUJ94086.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAKDPFFEAKVCVTAQHREMLDQ
FT                   VLKLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILAEFKPDVVLVHGDTTTTLATSL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLAMYHFSPTETSRQNLLRENVAD
FT                   SRIFITGNTVIDALLWVRDQVMSSDTLRSELAANYPFIDPDKKMILVTGHRRESFGRGF
FT                   EEICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVKNVILIDPQEYLPFVWLMN
FT                   HAWLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVTAGTVRLVGTDKQRIVEEVTRLL
FT                   KDENEYQTMSRAHNPYGDGQACSRILEALKNNRISL"
FT   gene            120000..121262
FT                   /locus_tag="CR539_00610"
FT   CDS_pept        120000..121262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00610"
FT                   /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKN2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312747.1"
FT                   /protein_id="AUJ94087.1"
FT                   /translation="MSFATISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINRG
FT                   EIHIVEPDLASVVKTAVEGGFLRASTTPVEADAWLIAVPTPFKGDHEPDMTYVESAARS
FT                   IAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLP
FT                   GQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICADQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQQ
FT                   ARLIRTAREVNDHKPFWVIDQVKAAVADCLAATDKRASELKIACFGLAFKPNIDDLRES
FT                   PAMEIAELIAQWHSGETLVVEPNIHQLPKKLTGLCTLAQLDEALATADVLVMLVDHSQF
FT                   KVINGDNVHQQYVVDAKGVWR"
FT   gene            121262..122329
FT                   /locus_tag="CR539_00615"
FT   CDS_pept        121262..122329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00615"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XW32"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XW32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026255.1"
FT                   /protein_id="AUJ94088.1"
FT                   /translation="MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLA
FT                   PVAQSERFAFEKVDICDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVG
FT                   TYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQ
FT                   IRDWLYVEDHARALYCVATTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGV
FT                   AHYRDLITFVADRPGHDLRYAIDASKIAHELGWLPQETFESGMRKTVQWYLANESWWKQ
FT                   VQDGSYQGERLGLKG"
FT   gene            122348..123229
FT                   /gene="rfbA"
FT                   /locus_tag="CR539_00620"
FT   CDS_pept        122348..123229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="CR539_00620"
FT                   /product="glucose-1-phosphate thymidylyltransferase 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QAP8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:J7QAP8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005133346.1"
FT                   /protein_id="AUJ94089.1"
FT                   /translation="MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCL
FT                   VLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQ
FT                   PKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQY
FT                   LLELLRARPRQY"
FT   gene            123207..123881
FT                   /locus_tag="CR539_00625"
FT   CDS_pept        123207..123881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00625"
FT                   /product="dTDP-fucosamine acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TGE0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:W8TGE0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026256.2"
FT                   /protein_id="AUJ94090.1"
FT                   /translation="MPVRASIEPLTWENAFFGVNSAIVRITSEAPLLTPDALAPWSRVQ
FT                   AKIAASNTGELDALQQLGFSLVEGEVDLALPVNNASDSGAVVAQETDIPALRQLASAAF
FT                   AQSRFRAPWYAPDASSRFYAQWIENAVRGTFDHQCLILRAASGDIRGYVSLRELNATDA
FT                   RIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWL
FT                   YR"
FT   gene            123886..125016
FT                   /locus_tag="CR539_00630"
FT   CDS_pept        123886..125016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00630"
FT                   /product="dTDP-4-amino-4,6-dideoxygalactose transaminase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A192EXD3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A192EXD3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414947.1"
FT                   /protein_id="AUJ94091.1"
FT                   /translation="MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFG
FT                   SVKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDT
FT                   MNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKG
FT                   RALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPS
FT                   IPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFHYIPLHGCPAGERFGEFHGED
FT                   RYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS"
FT   gene            125018..126268
FT                   /locus_tag="CR539_00635"
FT   CDS_pept        125018..126268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00635"
FT                   /product="lipid III flippase WzxE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QIU8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:J7QIU8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418239.1"
FT                   /protein_id="AUJ94092.1"
FT                   /translation="MSLAKASLWTAASTLVKIGAGLLVGKLLAVSFGPAGLGLAANFRQ
FT                   LITVLGVLAGAGIFNGVTKYVAQYHDNPQQLRRVVGTSSAMVLGFSTLMALVFVLAAAP
FT                   ISQGLFGNTDYQGLVRLVALVQMGIAWGNLLLALMKGFRDAAGNALSLIVGSLIGVLAY
FT                   YVSYRLGGYEGALLGLALIPALVVIPAAIMLIKRGVIPLSYLKPSWDNGLAGQLSKFTL
FT                   MALITSVTLPVAYIMMRKLLAAQYSWDEVGIWQGVSSISDAYLQFITASFSVYLLPTLS
FT                   RLTEKRDITREVVKSLKFVLPAVAAASFTVWLLRDFAIWLLLSNKFTAMRDLFAWQLVG
FT                   DVLKVGAYVFGYLVIAKASLRFYILAEVSQFTLLMVFAHWLIPAHGALGAAQAYMATYI
FT                   VYFSLCCGVFLLWRRRA"
FT   gene            126265..127344
FT                   /locus_tag="CR539_00640"
FT   CDS_pept        126265..127344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00640"
FT                   /product="TDP-N-acetylfucosamine:lipid II
FT                   N-acetylfucosaminyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1E5WR02"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5WR02"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312753.1"
FT                   /protein_id="AUJ94093.1"
FT                   /translation="MTVLIHVLGSDIPHHNRTVLRFFNDALAATSEHAREFMVVGKDDG
FT                   LSDSCPALSVQFFPGKKSLAEAVIAKAKANRQQRFFFHGQFNPKLWLALLSGGIKSRQF
FT                   FWHIWGADLYELSSGLRYKLFYPLRRLAQKRVGCVFATRGDLSFFAKTHPKVRGELLYF
FT                   PTRMDPSLNTMANDRQREGKMTILVGNSGDRSNEHIAALRAVHQQFGDTVKVVVPMGYP
FT                   PNNEAYIEEVRQAGLELFSEENLQVLSEKLEFDAYLTLLRQCDLGYFIFARQQGIGTLC
FT                   LLIQAGIPCVLNRENPFWQDMTEQHLPVLFTTDDLNEDIVREAQRQLASVDKNTIAFFS
FT                   PNYLQGWQRALAIAAGEVA"
FT   gene            127341..128693
FT                   /locus_tag="CR539_00645"
FT   CDS_pept        127341..128693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00645"
FT                   /product="O-antigen assembly polymerase"
FT                   /note="enterobacterial common antigen polymerase; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:C3SKJ7"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKJ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312754.1"
FT                   /protein_id="AUJ94094.1"
FT                   /translation="MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLL
FT                   TFFFGFPLTSVLVFRFDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRP
FT                   LFTMNRVETNLTWVILMGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFY
FT                   FFIPAMLVVYFLRQDSKAWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRG
FT                   WISLWMLAAAGVLGIVGMFWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQN
FT                   YDNIDFQGLAPIVRDFYVFIPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGS
FT                   LVVMGGALFIPLGAIVVGLIIKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAR
FT                   EGLDSFVSRVVFFIVVFGACLMIAKLLYWLFESAGLIHKRTKSSLRTQVEG"
FT   gene            128696..129436
FT                   /locus_tag="CR539_00650"
FT   CDS_pept        128696..129436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00650"
FT                   /product="lipopolysaccharide
FT                   N-acetylmannosaminouronosyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7RB25"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:J7RB25"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414951.1"
FT                   /protein_id="AUJ94095.1"
FT                   /translation="MNNNTTAPTYTLRGLQLIGWRDMQHALDYLFADGQLKQGTLVAIN
FT                   AEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQAQVSRVAGADLWEELMARA
FT                   GKEGTPVFLVGGKPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQALFERIHASGAQI
FT                   VTVAMGSPKQEIFMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
FT                   SQPSRIKRQLRLLRYLRWHYTGNL"
FT   gene            129627..131012
FT                   /locus_tag="CR539_00655"
FT   CDS_pept        129627..131012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00655"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKI7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKI7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312756.1"
FT                   /protein_id="AUJ94096.1"
FT                   /translation="MADNKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSV
FT                   LLAYIIAGLFVFFIMRSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVG
FT                   ISEITAIGVYVQFWFPEMAQWIPALIAVALVALANLAAVRLYGEIEFWFAMIKVTTIIV
FT                   MIVIGLGVIFFGFGNGGQSIGFSNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGIT
FT                   AGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFAKIGIT
FT                   AAAGIINFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAMAKVSRHGVPVAGVAVSI
FT                   AILLIGSCLNYIIPNPQRVFVYVYSASVLPGMVPWFVILISQLRFRRAHKAAIASHPFR
FT                   SILFPWANYVTMAFLICVLIGMYFNEDTRMSLFVGIIFMLAVTAIYKVFGLNRHGKAHK
FT                   LEE"
FT   gene            131115..131191
FT                   /locus_tag="CR539_00660"
FT   tRNA            131115..131191
FT                   /locus_tag="CR539_00660"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:131149..131151,aa:Arg,seq:ccg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            131250..131325
FT                   /locus_tag="CR539_00665"
FT   tRNA            131250..131325
FT                   /locus_tag="CR539_00665"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:131283..131285,aa:His,seq:gtg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            131346..131432
FT                   /locus_tag="CR539_00670"
FT   tRNA            131346..131432
FT                   /locus_tag="CR539_00670"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:131380..131382,aa:Leu,seq:cag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            131475..131551
FT                   /locus_tag="CR539_00675"
FT   tRNA            131475..131551
FT                   /locus_tag="CR539_00675"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:131509..131511,aa:Pro,seq:tgg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            131698..132933
FT                   /pseudo
FT                   /locus_tag="CR539_00680"
FT   CDS_pept        131698..132933
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00680"
FT                   /product="anaerobic sulfatase maturase"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312757.1"
FT   gene            complement(133101..134756)
FT                   /locus_tag="CR539_00685"
FT   CDS_pept        complement(133101..134756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00685"
FT                   /product="arylsulfatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKH7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312758.1"
FT                   /protein_id="AUJ94097.1"
FT                   /translation="MEFSFSPKLLVVAVAAALPLMASAADTPSTATARKGFAGYDHPNQ
FT                   YLVKPATTIADNMMPVMQHPAQDKETQQKLAELEKKTGKKPNVVVFLLDDVGWMDVGFN
FT                   GGGVAVGNPTPDIDAVASQGLILTSAYSQPSSSPTRATILTGQYSIHHGILMPPMYGQP
FT                   GGLQGLTTLPQLLHDQGYVTQAIGKWHMGENKESQPQNVGFDDFRGFNSVSDMYTEWRD
FT                   VHVNPEVALSPDRSEYIKQLPFSKDDVHAVRGGEQQAIADITPKYMEDLDQRWMEYGVK
FT                   FLDKMAKSDKPFFLYYGTRGCHFDNYPNAKYAGSSPARTSYGDCMVEMNDVFANLYKAL
FT                   EKNGQLDNTLIVFTSDNGPEAEVPPHGRTPFRGAKGSTWEGGVRVPTFVYWKGMIQPRK
FT                   SDGIVDLADLFPTALDLAGHPGAKVANLVPKTTFIDGVDQTSFFLGTNGQSNRKAEHYF
FT                   LNGKLAAVRMDEFKYHVLIQQPYAYTQSGYQGGFTGTVMQTAGSSVFNLYTDPQESDSI
FT                   GVRHIPMGVPLQTEMHAYMEILKKYPPRAQIKSD"
FT   gene            complement(135435..136631)
FT                   /locus_tag="CR539_00690"
FT   CDS_pept        complement(135435..136631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00690"
FT                   /product="protoheme IX biogenesis protein HemY"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSU0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSU0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312759.1"
FT                   /protein_id="AUJ94098.1"
FT                   /translation="MLKVLLLFVLLIAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLA
FT                   IILILAMVVLFAIEWLLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVE
FT                   KLMAKNADHAEQPVVNYLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEITRVRLQ
FT                   LARNENHAARHGVDKLLEVTPRHPEVLRLAEQAYIRTGAWSSLLDIIPSMAKAHVGDEE
FT                   HRAMLEQQAWIGLMDQARADNGSEGLRNWWKNQSRKTRHQVALQVAMAEHLIECDDHDT
FT                   AQQIIIDGLKRQYDDRLLLPIPRLKTNNLEQLEKVLRQQIKNVGDRPLLWSTLGQSLMK
FT                   HGEWQEASLAFRAALKQRPDAYDYAWLADALDRLHKPEEATAMRRDGLMLTLQNNPPQ"
FT   gene            complement(136634..137839)
FT                   /locus_tag="CR539_00695"
FT   CDS_pept        complement(136634..137839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00695"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSM4"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSM4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312760.1"
FT                   /protein_id="AUJ94099.1"
FT                   /translation="MTEQEKTSAVVEETREAVDTTSQPVATEKKSKNNTALILSAVAIA
FT                   IALAAGVGLYGWGKQQAVNQTATSDALANQLTALQKAQESQKAELEGIIKQQAAQLKQA
FT                   NRQQETLAKQLDEVQQKVATISGSDAKTWLLAQADFLVKLAGRKLWSDQDVTTAAALLK
FT                   SADASLADMNDPSLITVRRAITDDIASLSAVSQVDYDGIILKLNQLSNQVDNLRLADND
FT                   SDGSPMDSDGEELSSSISEWRINLQKSWQNFMDNFITIRRRDDTAVPLLAPNQDIYLRE
FT                   NIRSRLLVAAQAVPRHQQETYRQALENVSTWVRAYYDTDDATTKAFLDEVDQLSQQNIS
FT                   MDLPETLQSQAMLEKLMQTRVRNLLAQPAAGTTEAKPAPAPAPAPAPAPQADTPAAAPQ
FT                   GE"
FT   gene            complement(137861..138601)
FT                   /locus_tag="CR539_00700"
FT   CDS_pept        complement(137861..138601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00700"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XWF4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XWF4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312761.1"
FT                   /protein_id="AUJ94100.1"
FT                   /translation="MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGQQLPQLAD
FT                   QLAALGESDLLFALSQHAVAFAQSQLHQQDRKWPRLPNYFAIGRTTALALHTVSGQKIL
FT                   YPQDREISEVLLQLPELQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAI
FT                   HYDGAEEAMRWQSREVTTVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLA
FT                   RELGWQDIKVADNADNDALLRALQ"
FT   gene            complement(138598..139539)
FT                   /locus_tag="CR539_00705"
FT   CDS_pept        complement(138598..139539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00705"
FT                   /product="hydroxymethylbilane synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSD0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSD0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026260.1"
FT                   /protein_id="AUJ94101.1"
FT                   /translation="MLDNVLRIATRQSPLALWQAHYVKDKLMASHPGLVVELVPMVTRG
FT                   DVILDTPLAKVGGKGLFVKELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDP
FT                   RDAFVSNNYDSLDALPAGSIVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGE
FT                   YDAIILAVAGLKRLGLESRIRAALPPEISLPAVGQGAVGIECRLDDAHTRELLAALNHH
FT                   ETALRVTAERAMNTRLEGGCQVPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQ
FT                   DAEQMGISLAEELLNNGAREILAEVYNGDAPA"
FT   gene            complement(139692..139898)
FT                   /locus_tag="CR539_00710"
FT   CDS_pept        complement(139692..139898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00710"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A135PYL4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001305378.1"
FT                   /protein_id="AUJ94102.1"
FT                   /translation="MTVIPPTSTVTRGIRDISYVKGNRYHFSRLVFLVSRRKNGLKRDQ
FT                   FNTLLIDRKERCATYKCSTVYSL"
FT   gene            139926..142472
FT                   /locus_tag="CR539_00715"
FT   CDS_pept        139926..142472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00715"
FT                   /product="adenylate cyclase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKF7"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKF7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312763.1"
FT                   /protein_id="AUJ94103.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYH
FT                   HPLMPGYLDGNVPKGICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGST
FT                   SSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLLESWAASLGVEVSFFLIDENRFRH
FT                   NESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQG
FT                   VLTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLL
FT                   AKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRE
FT                   RACVGWRRAVLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGR
FT                   ANRSGWYLYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDL
FT                   PKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFR
FT                   KLDVFSFGENQNCLVGSVDLLYRNSWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPD
FT                   SVEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQETGRFKALRVSGQTWGLFFERLN
FT                   VSVQKLENAIEFYGAISHNKLHGLSVQVETNHVKLPAVVDGFASEGIIQFFFEETQDEN
FT                   GFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   KVDGREQVIPFRTKSIGNMPPANQDHDTPLLQQYFS"
FT   gene            complement(142512..142832)
FT                   /locus_tag="CR539_00720"
FT   CDS_pept        complement(142512..142832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00720"
FT                   /product="iron donor protein CyaY"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSS0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSS0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000999950.1"
FT                   /protein_id="AUJ94104.1"
FT                   /translation="MNDSEFHRLADQLWLTIEERLDDWDGDSDTDCEINGGVLTITFEN
FT                   GSKIIINRQEPLHQVWLATKQGGYHFYLKGDEWICDRSGETFWDLLEQAATQQAGETVS
FT                   FR"
FT   gene            143294..143497
FT                   /locus_tag="CR539_00725"
FT   CDS_pept        143294..143497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00725"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:E2QHY1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944574.1"
FT                   /protein_id="AUJ94105.1"
FT                   /translation="MKNVFKALTVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKPVETQ
FT                   TQSTVPDKNDRATGDGPSQVNY"
FT   gene            143534..144358
FT                   /locus_tag="CR539_00730"
FT   CDS_pept        143534..144358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00730"
FT                   /product="diaminopimelate epimerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3V8C7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3V8C7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005133314.1"
FT                   /protein_id="AUJ94106.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQL
FT                   LVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRM
FT                   VLTVTDDDLVRVNMGEPNFEPSAVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQ
FT                   VDDVDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLAEEVRVELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL"
FT   gene            144355..145062
FT                   /locus_tag="CR539_00735"
FT   CDS_pept        144355..145062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00735"
FT                   /product="DUF484 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTR8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418255.1"
FT                   /protein_id="AUJ94107.1"
FT                   /translation="MKQPGEELQETLTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPH
FT                   PVRGTVSLVEWHMARARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDD
FT                   MLMRFHRWARDLGLAGASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYL
FT                   GPLNGPELLVVLPEAKAVGSVAMSMLGSDADLGVVLFTSRDASHYQQGQGTQLLHEIAL
FT                   MLLELLERWIERV"
FT   gene            145059..145955
FT                   /gene="xerC"
FT                   /locus_tag="CR539_00740"
FT   CDS_pept        145059..145955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="CR539_00740"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="site-specific tyrosine recombinase which cuts and
FT                   rejoins DNA molecules; binds cooperatively to specific DNA
FT                   consensus sites; forms a heterotetrameric complex with
FT                   XerC; XerCD exhibit similar sequences; essential to convert
FT                   chromosome dimers to monomers during cell division and
FT                   functions during plasmid segregation; cell division protein
FT                   FtsK may regulate the XerCD complex; enzyme from
FT                   Streptococcus group has unusual active site motifs; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EU56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EU56"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418256.1"
FT                   /protein_id="AUJ94108.1"
FT                   /translation="MTDLHTDVERYLRYLSVERQLSPITLLNYQRQLEAIINFASENGL
FT                   QSWQKCDAAMVRNFAVRSRRKGLGAASLALRLSALRSFFDWLVSQNELKANPAKGVSAP
FT                   KAPRHLPKNIDVDDMNRLLDIDINDPLAVRDRAMLEVMYGAGLRLSELVGLDIKHLDLE
FT                   SGEVWVMGKGSKERRLPIGRNAVAWIEHWLDLRDLFGSEDDALFLSKLGKRISARNVQK
FT                   RFAEWGIKQGLNNHVHPHKLRHSFATHMLESSGDLRGVQELLGHANLSTTQIYTHLDFQ
FT                   HLASVYDAAHPRAKRGK"
FT   gene            145955..146671
FT                   /locus_tag="CR539_00745"
FT   CDS_pept        145955..146671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00745"
FT                   /product="flavin mononucleotide phosphatase YigB"
FT                   /note="YigB; member of the haloacid dehalogenase (HAD)-like
FT                   hydrolases superfamily of protein; unknown function;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3V8C9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3V8C9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418257.1"
FT                   /protein_id="AUJ94109.1"
FT                   /translation="MRFYRPLGRISALTFDLDDTLYDNRPVILRTEREALTFVQNYHPA
FT                   LRSFQNEDLQRLRQAVREAEPEIYHDVTRWRFRSIEQAMLDAGLSAEEASAGAHAAMIN
FT                   FAKWRSRIDVPQQTHDTLKQLAKKWPLVAITNGNAQPELFGLGDYFEFVLRAGPHGRSK
FT                   PFSDMYFLAAEKLNVPIGEILHVGDDLTTDVGGAIRSGMQACWIRPENGDLMQTWDSRL
FT                   LPHLEISRLASLTSLI"
FT   gene            146755..148917
FT                   /locus_tag="CR539_00750"
FT   CDS_pept        146755..148917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00750"
FT                   /product="DNA helicase II"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XVL2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XVL2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312770.1"
FT                   /protein_id="AUJ94110.1"
FT                   /translation="MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAW
FT                   LMSVENCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMD
FT                   ANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYG
FT                   NPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEF
FT                   QDTNNIQYAWIRLLAGDTGKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQ
FT                   NYRSTSNILSAANALIENNNGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTW
FT                   QDNGGALTECAILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIA
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASAL
FT                   QRFMELIDALAQETADMPLHVQTDRVIKDSGLRTMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYNEEDEDLMPLQAFLSHAALEAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGE
FT                   LPEECVEEVRLRATVSRPVSHQRMGTPMVENDSGYKLGQRVRHAKFGEGTIVNMEGSGE
FT                   HSRLQVAFQGQGIKWLVAAYARLETV"
FT   gene            complement(148962..149864)
FT                   /locus_tag="CR539_00755"
FT   CDS_pept        complement(148962..149864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00755"
FT                   /product="acetolactate synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSD7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312771.1"
FT                   /protein_id="AUJ94111.1"
FT                   /translation="MKKTLATLFLLTCLGSSSAYADNALILQTDFSLKDGAVSAMKGVA
FT                   FGVDHNLKIFDLTHEIPPYNIWEGAYRLYQTASYWPQGSVFVSVVDPGVGTDRKSVVLK
FT                   TKNGQYFVSPDNGTLILVAESLGIESVRQIDEKTNRLKGSEKSYTFHGRDVYAYTGARL
FT                   ASGAITFEQVGPELPAKVVELSYQKAKATKGEVKGNIPILDIQYGNVWSNISDELLKQA
FT                   GIKLNDTLCVTISEGSQQKYEGKMPYVASFGDVPEGQPMVYLNSLLNVSVALNMDNFAQ
FT                   KHQVASGADWNIDVKKCAK"
FT   gene            complement(149947..150711)
FT                   /locus_tag="CR539_00760"
FT   CDS_pept        complement(149947..150711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00760"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSG9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312772.1"
FT                   /protein_id="AUJ94112.1"
FT                   /translation="MAHRLLIGKGMITLNLKRIFLALTLLPLFAVAADDCALSDPTLTV
FT                   QAYTVNPQTERVKMYWQKANGEAWGTLHALLANINSQGQVQMAMNGGIYDESYAPLGLY
FT                   IENGQQKVALNLASGEGNFFIRPGGVFYVAGDKVGIVRLDAFKASKEIQFAVQSGPMLM
FT                   ENGVINPRIHPNVASRKIRNGVGINKHGNAVFLLSQQATNFYDFACYAKAKLNVEQLLY
FT                   LDGTISHMYMKGGAIPWQRYPFVTMISVERKG"
FT   gene            151081..152031
FT                   /locus_tag="CR539_00765"
FT   CDS_pept        151081..152031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00765"
FT                   /product="magnesium transporter CorA"
FT                   /note="responsible for the influx of magnesium ions;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SKB2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C3SKB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000947142.1"
FT                   /protein_id="AUJ94113.1"
FT                   /translation="MLSAFQLENNRLTRLEVEESQPLVNAVWIDLVEPDDDERLRVQSE
FT                   LGQSLATRPELEDIEASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTL
FT                   RERELPAFRLYRMRARSQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIM
FT                   EGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSFGYPGAIIFMILAGLAPYLYFKRKNWL"
FT   gene            complement(152074..152454)
FT                   /locus_tag="CR539_00770"
FT   CDS_pept        complement(152074..152454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00770"
FT                   /product="DUF2628 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7RB42"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:J7RB42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418261.1"
FT                   /protein_id="AUJ98130.1"
FT                   /translation="MSKEYMNDGSLSEKWKYRFNFYDQHGFPGFWGATPEYKAAFKALK
FT                   VRQRLTIQMNFIAFFCSWIYLFVLGLWKKAIIVLLLGILSLFVGALIGVNILGIAVAAY
FT                   VAVNTNKWFYEKEVKGLNTWSL"
FT   gene            complement(152468..152884)
FT                   /locus_tag="CR539_00775"
FT   CDS_pept        complement(152468..152884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00775"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EU78"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EU78"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000955187.1"
FT                   /protein_id="AUJ94114.1"
FT                   /translation="MLTGDSYKDVKFMLRIFIPTSNGKISRRRYIFSFILINFIFAFLI
FT                   IFFNDGEAGFLVIVSTIVLHYLVINMNCQRLRDSGFVYIKTYVFGTLAVYIISIITMIA
FT                   EDFACSGNGSMIFLICYFSTFSMLMLAPTDSSKQ"
FT   gene            complement(152943..153833)
FT                   /gene="rarD"
FT                   /locus_tag="CR539_00780"
FT   CDS_pept        complement(152943..153833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="CR539_00780"
FT                   /product="protein RarD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSH7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026262.1"
FT                   /protein_id="AUJ94115.1"
FT                   /translation="MDAKQTRQGVLLALAAYFIWGIAPAYFKLIYYVPADEILTHRVIW
FT                   SFFFMVVLMSICRQWSYLKTLIQTPQKIFMLAVSAVLIGGNWLLFIWAVNNHHMLEASL
FT                   GYFINPLVNIVLGMIFLGERFRRMQWLAVILAICGVLVQLWTFGSLPIIALGLAFSFAF
FT                   YGLVRKKIAVEAQTGMLIETMWLLPVAAIYLFAIADSSTSHMGQNPISLNLLLIAAGIV
FT                   TTVPLLCFTAAATRLRLSTLGFFQYIGPTLMFLLAVTFYGEKPGADKMVTFTFIWVALA
FT                   IFVMDAIYTQRRTSK"
FT   gene            complement(153885..154352)
FT                   /locus_tag="CR539_00785"
FT   CDS_pept        complement(153885..154352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00785"
FT                   /product="4HBT family thioesterase YigI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3Y6V2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001350877.1"
FT                   /protein_id="AUJ94116.1"
FT                   /translation="MSAVLTAEQALKLVGEMFVYHMPFNRALGMELERYEKEFAQLAFK
FT                   NQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHETISEDELRQRLSRMGTIDL
FT                   RVDYLRPGRGERFTATSSLLRAGNKVAVARVELHNEEQLYIASATATYMVG"
FT   gene            154517..155386
FT                   /locus_tag="CR539_00790"
FT   CDS_pept        154517..155386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00790"
FT                   /product="phospholipase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTS8"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTS8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312778.1"
FT                   /protein_id="AUJ94117.1"
FT                   /translation="MRTLQGWLLPVFILPMAVYAQEATVKEVHDAPAVRGSIIANMLQE
FT                   HDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGP
FT                   NSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHD
FT                   SNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYH
FT                   LGDAVLSAKGQYNWNTGYGGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGV
FT                   GVMLNDLF"
FT   gene            155519..157348
FT                   /locus_tag="CR539_00795"
FT   CDS_pept        155519..157348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00795"
FT                   /product="DNA helicase RecQ"
FT                   /note="functions in blocking illegitimate recombination,
FT                   enhancing topoisomerase activity, initiating SOS signaling
FT                   and clearing blocked replication forks; component of the
FT                   RecF recombinational pathway; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:E2QHZ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E2QHZ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026263.3"
FT                   /protein_id="AUJ98131.1"
FT                   /translation="MAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLV
FT                   VMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQ
FT                   LEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYA
FT                   ALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFK
FT                   PLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEK
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFY
FT                   DPADMAWLRRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGN
FT                   CDICLDPPKQYDGSTDAQIALSTIGRVNQRFGMGYVVEVIRGANNQRIRDYGHDKLKVY
FT                   GMGRDKSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAARPVLRGESSLQLAVPRIVA
FT                   LKPKAMQKSFGGNYDRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASE
FT                   MLSVNGVGMRKLERFGKPFMALIRAHVDGDDEE"
FT   gene            157412..158032
FT                   /locus_tag="CR539_00800"
FT   CDS_pept        157412..158032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00800"
FT                   /product="threonine export protein RhtC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK87"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312780.1"
FT                   /protein_id="AUJ94118.1"
FT                   /translation="MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGI
FT                   TCGVMVWAGIALLGLHLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAP
FT                   QVELAKSGRSFLKGLLTNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVETLAW
FT                   FTVVASLFALPQMRRGYQRLAKWIDGFAGALFAGFGIHLIISR"
FT   gene            complement(158094..158714)
FT                   /locus_tag="CR539_00805"
FT   CDS_pept        complement(158094..158714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00805"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK82"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312781.1"
FT                   /protein_id="AUJ94119.1"
FT                   /translation="MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAG
FT                   LQTGLAIHIVLVGVGLGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLAS
FT                   TQSRRHLFQRAVFVNLTNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMI
FT                   GYATLAQRIALWIKGPKQMKALNKIFGSLFMLVGALLASARHA"
FT   gene            158825..159847
FT                   /locus_tag="CR539_00810"
FT   CDS_pept        158825..159847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00810"
FT                   /product="lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /note="lecithinase B; catalyzes the conversion of
FT                   1-lysophosphatidylcholine to glycerophosphocholine; can
FT                   also hydrolyze 2-acyl glycerophosphoethanolamine and other
FT                   substrates; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7R845"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:J7R845"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026266.1"
FT                   /protein_id="AUJ94120.1"
FT                   /translation="MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRF
FT                   VRFRAQHHDRVVVICPGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLADPHL
FT                   GHVNRFNDYVDDLAAFWQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTA
FT                   PMFGIVIRMPSFMARQILNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNL
FT                   RFYADDPTIRVGGPTYHWVRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRF
FT                   CELRTAAGHPVEGGRPLVIKGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
FT                   "
FT   gene            159855..160655
FT                   /locus_tag="CR539_00815"
FT   CDS_pept        159855..160655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00815"
FT                   /product="sugar/pyridoxal phosphate phosphatase YigL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSE2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312783.1"
FT                   /protein_id="AUJ94121.1"
FT                   /translation="MYQVVASDLDGTLLSPDHTLSPYAKETLKLLTARGINFVFATGRH
FT                   HVDVGQIRDNLEIKSYMITSNGARVHDLDGNLIFAHNLDRDIASDLFGVVNDNPDIITN
FT                   VYRDDEWFMNRHRPEEMRFFKEAVFKYALYEPGLLEPEGVSKVFFTCDSHEQLLPLEQA
FT                   INARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKKLGYSLKDCIAFGDGMNDAEML
FT                   SMAGKGCIMGSAHQRLKDLHPELEVIGTNADDAVSHYLRKLYLS"
FT   gene            160731..161630
FT                   /locus_tag="CR539_00820"
FT   CDS_pept        160731..161630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00820"
FT                   /product="EamA family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NWB2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NWB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312784.1"
FT                   /protein_id="AUJ94122.1"
FT                   /translation="MALLIITTILWAFSFSFYGEYLAGHVDSYFAVLVRVGLAALVFLP
FT                   FLRTRGNSLKTVGLYMLVGAMQLGVMYMLSFRAYLYLTVSELLLFTVLTPLYITLIYDI
FT                   MSKRRLRWGYAFSALLAVIGAGIIRYDQVTDHFWTGLLLVQLSNITFAIGMVGYKRLME
FT                   TRPMPQHNAFAWFYLGAFLVAVIAWFLLGNAQKMPQTTLQWSILVFLGVVASGIGYFMW
FT                   NYGATQVDAGTLGIMNNMHVPAGLLVNLAIWHQQPHWPTFITGALVILASLWVHRKWVA
FT                   PRSSQTADDRRRDCALSE"
FT   gene            complement(161518..162471)
FT                   /locus_tag="CR539_00825"
FT   CDS_pept        complement(161518..162471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00825"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NWA6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NWA6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312785.1"
FT                   /protein_id="AUJ94123.1"
FT                   /translation="MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTPQGEILLQLANQVLPQISQALQACNEPQQTRLRIAIECHSCIQWL
FT                   TPALENFHKNWPQVEMDFKSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPMFDYEV
FT                   RLVLAPDHPLAAKTRITPEDLASETLLIYPVQRSRLDVWRHFLQPAGVSPSLKSVDNTL
FT                   LLIQMVAARMGIAALPHWVVESFERQDLVVTKTLGEGLWSRLYAAVRDGEQRQPITEAF
FT                   IRSARNHACDHLPFVKSAERPTYDAPTVRPGSPARL"
FT   gene            162707..164968
FT                   /locus_tag="CR539_00830"
FT   CDS_pept        162707..164968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00830"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EU88"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EU88"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418273.1"
FT                   /protein_id="AUJ94124.1"
FT                   /translation="MTILNHTLGFPRVGLRRELKKAQESYWAGNSTREELLAVGRELRA
FT                   RHWDQQKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNKDGSVDIDTLFRIGRGRA
FT                   PTGEPAAAAEMTKWFNTNYHYMVPEFVKGQQFKLTWTQLLEEVDEALALGHKVKPVLLG
FT                   PVTWLWLGKVKGEQFDRLSLLNDILPVYQQVLAELAKRGIEWVQIDEPALVLELPQAWL
FT                   DAYKPAYDALQGQVKLLLTTYFEGVTPNLDTITALPVQGLHVDLVHGKDDVVELHKRLP
FT                   SDWLLSAGLINGRNVWRADLTEKYAQIKDIVGKRDLWVASSCSLLHSPIDLSVETRLDA
FT                   EVKSWFAFALQKCHELALLRDALNSGDTAALAEWSAPIQARRHSTRVHNPAVEKRLAAI
FT                   TAQDSQRANVYEVRAEAQRARFKLPAWPTTTIGSFPQTTEIRTLRLDFKKGNLDANNYR
FT                   TGIAEHIRQAIVEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCV
FT                   KPPIVIGDVSRPAPITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQ
FT                   IALALRDEVADLEAAGIGIIQIDEPALREGLPLRRSDWDAYLQWGVEAFRINAAVAKDD
FT                   TQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEEFDYPNEIGPGVYDIH
FT                   SPNVPSVEWIEALLKKAAKRIPAERLWVNPDCGLKTRGWPETRAALANMVQAAQNLRRG
FT                   "
FT   gene            complement(165008..165823)
FT                   /locus_tag="CR539_00835"
FT   CDS_pept        complement(165008..165823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00835"
FT                   /product="carboxymethylenebutenolidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A086TV87"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A086TV87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414982.1"
FT                   /protein_id="AUJ94125.1"
FT                   /translation="MATTQQSGFAPAASPLASTIVQTPDDAIVAGFTSIPSQGDNMPAY
FT                   HARPKQSDGPLPVVIVVQEIFGVHEHIRDICRRLALEGYLAIAPELYFREGDPNDFADI
FT                   PTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRLMITGFCWGGRITWLYAAHNPQL
FT                   KAAVAWYGKLTGDKSLNSPKQPVDIATDLNAPVLGLYGGLDNSIPQESVETMRQALRAA
FT                   NAKAEIIVYPDAGHAFNADYRPSYHAESAKDGWQRMLEWFKQYGGKKSL"
FT   gene            166085..166846
FT                   /locus_tag="CR539_00840"
FT   CDS_pept        166085..166846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00840"
FT                   /product="uridine phosphorylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK47"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK47"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312788.1"
FT                   /protein_id="AUJ94126.1"
FT                   /translation="MSKSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLA
FT                   SHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINV
FT                   GDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFY
FT                   PGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESQAVKIVVEAARRLL"
FT   gene            complement(166746..167003)
FT                   /locus_tag="CR539_00845"
FT   CDS_pept        complement(166746..167003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00845"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M3RY01"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001335242.1"
FT                   /protein_id="AUJ94127.1"
FT                   /translation="MIEKSTTPPDATTYPHKIELCCTNVQLERHFLRGATQKYKRPNAS
FT                   AFRQEKRITADDAPLPPRFSPLGFQFVSSSQHSGSLAGCG"
FT   gene            166987..168414
FT                   /locus_tag="CR539_00850"
FT   CDS_pept        166987..168414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00850"
FT                   /product="DNA recombination protein RmuC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK42"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312789.1"
FT                   /protein_id="AUJ94128.1"
FT                   /translation="MDFSIMVYAVIALVGVAIGWLFASYQHAQQKAEQLAEREEMVAEL
FT                   SAAKQQITQSEHWRAECELLNNEVRSLQSINTSLEADLREVTTRMEAAQQHADDKIRQM
FT                   INSEQRLSEQFENLANRIFEHSNRRVDEQNRQSLNSLLSPLREQLDGFRRQVQDSFGKE
FT                   AQERHTLTHEIRNLQQLNAQMAQEAINLTRALKGDNKTQGNWGEVVLTRVLEASGLREG
FT                   YEYETQVSIENDARSRMQPDVIVRLPQGKDVVIDAKMTLVAYERYFNAEDDYTRESALQ
FT                   EHIASVRNHIRLLGRKDYQQLPGLRTLDYVLMFIPVEPAFLLALDRQPELITEALKNNI
FT                   MLVSPTTLLVALRTIANLWRYEHQSRNAQQIADRASKLYDKMRLFIDDMSAIGQSLDKA
FT                   QDNYRQAMKKLSSGRGNVLAQAEAFRGLGVEIKREINPDLAEQAVSQDEEYRLRSVPEQ
FT                   PNDEAYQRDDEYNQQSR"
FT   gene            168509..169264
FT                   /locus_tag="CR539_00855"
FT   CDS_pept        168509..169264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00855"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   C-methyltransferase UbiE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK37"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK37"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312790.1"
FT                   /protein_id="AUJ94129.1"
FT                   /translation="MVDKSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSF
FT                   GIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMG
FT                   REKLRNIGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPG
FT                   GRLLVLEFSKPIIEPLSKAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLK
FT                   AMMQDAGFESVDYYNLTAGVVALHRGYKF"
FT   gene            169278..169883
FT                   /locus_tag="CR539_00860"
FT   CDS_pept        169278..169883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00860"
FT                   /product="ubiquinone biosynthesis protein UbiJ"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSV3"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414986.1"
FT                   /protein_id="AUJ94130.1"
FT                   /translation="MPFKPLVTAGIESLLNTFLYRSPALKTARSRLLDKVLRVEVKGFS
FT                   TSLILVFSERQVDVLGEWAGDADCTVIAYASVLPKLRDRQQLAALIRSGELEVQGDIQV
FT                   VQNFVALADLAEFDPAELLAPYTGDIAAEGISKAMRGGAKFLHHGIKRQQRYVAEAITE
FT                   EWRMAPGPLEVAWFAEETAAVERAVDALTKRLEKLEAK"
FT   gene            169880..171520
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /gene_synonym="yigQ"
FT                   /gene_synonym="yigR"
FT                   /locus_tag="CR539_00865"
FT   CDS_pept        169880..171520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /gene_synonym="yigQ"
FT                   /gene_synonym="yigR"
FT                   /locus_tag="CR539_00865"
FT                   /product="ubiquinone biosynthesis protein UbiB"
FT                   /note="an Escherichia coli mutant results in accumulation
FT                   of octaprenylphenol and no ubiquinone; functions in the
FT                   formation of 2-octaprenyl-6-hydroxy-phenol from
FT                   2-octaprenylphenol in ubiquinone (coenzyme Q) biosynthesis;
FT                   similar to eukaryotic proteins that exhibit kinase
FT                   functions; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSF2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSF2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002414987.1"
FT                   /protein_id="AUJ94131.1"
FT                   /translation="MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMP
FT                   NRHKDKPLGERLRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKL
FT                   AKQQIESAMGGLPVEAWFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVI
FT                   KADLKLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFED
FT                   SPMLYIPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFR
FT                   DSFFHADMHPGNIFVSYEHPENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKV
FT                   AELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQ
FT                   PQLVLLQKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWV
FT                   EKMPELPELVYDSLRQGKYLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLL
FT                   VSRPEWGLMPGWLMAGGLIAWFVGWRKTR"
FT   gene            171599..171868
FT                   /locus_tag="CR539_00870"
FT   CDS_pept        171599..171868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00870"
FT                   /product="twin-arginine translocase subunit TatA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QI31"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E2QI31"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312793.1"
FT                   /protein_id="AUJ94132.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSD
FT                   DEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV"
FT   gene            171872..172387
FT                   /locus_tag="CR539_00875"
FT   CDS_pept        171872..172387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00875"
FT                   /product="twin-arginine translocase subunit TatB"
FT                   /note="mediates the export of protein precursors bearing
FT                   twin-arginine signal peptides; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SK17"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312794.1"
FT                   /protein_id="AUJ94133.1"
FT                   /translation="MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATT
FT                   VQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKA
FT                   SDEAHTIHNPVVKDNEAAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAP
FT                   SPSSSDKP"
FT   gene            172390..173166
FT                   /gene="tatC"
FT                   /locus_tag="CR539_00880"
FT   CDS_pept        172390..173166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="CR539_00880"
FT                   /product="twin-arginine translocase subunit TatC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SK12"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C3SK12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312795.1"
FT                   /protein_id="AUJ94134.1"
FT                   /translation="MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLV
FT                   SAPLIKQLPQGSTMIATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHER
FT                   RLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFM
FT                   AFGVSFEVPVAIVLLCWMGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YCLFEIGVFFSRFYVGKGRNREEENDAEAESEKTEE"
FT   gene            173208..173990
FT                   /locus_tag="CR539_00885"
FT   CDS_pept        173208..173990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00885"
FT                   /product="3'-5' ssDNA/RNA exonuclease TatD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NWC4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NWC4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312796.1"
FT                   /protein_id="AUJ94135.1"
FT                   /translation="MFDIGVNLTSSQFAKDRDDVVARAFDAGVNGLLITGTNLRESQQA
FT                   QKLARQYSSCWSTAGVHPHDSSQWQAATEEAIIELAAQPEVVAIGECGLDFNRNFSTPE
FT                   EQERAFVAQLRIAADLNMPVFMHCRDAHERFMTLLEPWLDKLPGAVLHCFTGTREEMQA
FT                   CVAHGIYIGITGWVCDERRGLELRELLPLIPVEKLLIETDAPYLLPRDLTPKPSSRRNE
FT                   PAHLPHILQRIAHWRGEDAAWLAATTDANVKTLFGIAF"
FT   gene            complement(173987..174475)
FT                   /locus_tag="CR539_00890"
FT   CDS_pept        complement(173987..174475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00890"
FT                   /product="transcription/translation regulatory transformer
FT                   protein RfaH"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT17"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312797.1"
FT                   /protein_id="AUJ94136.1"
FT                   /translation="MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTA
FT                   VSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKPKDI
FT                   VDPATPYPGDKVIITEGAFEGFQAIFTEPDGETRSMLLLNLINKEIKHSVKNTEFRKL"
FT   gene            174642..176135
FT                   /locus_tag="CR539_00895"
FT   CDS_pept        174642..176135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00895"
FT                   /product="3-octaprenyl-4-hydroxybenzoate decarboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7R864"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:J7R864"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418285.1"
FT                   /protein_id="AUJ94137.1"
FT                   /translation="MDAMKYNDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRA
FT                   GGPALLFENPKGYSMPVLCNLFGTPKRVAMGMGQEDVSALREVGKLLAFLKEPEPPKGF
FT                   RDLFDKLPQFKQVLNMPTKRLRGAPCQQKIVSGDDVDLNRIPIMTCWPEDAAPLITWGL
FT                   TVTRGPHKERQNLGIYRQQLIGKNKLIMRWLSHRGGALDYQEWCAAHPGERFPVSVALG
FT                   ADPATILGAVTPVPDTLSEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGE
FT                   TAPEGPYGDHTGYYNEVDSFPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVF
FT                   VPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVI
FT                   VCDDDVNARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNK
FT                   WPGETQREWGRPIKKDPDVVAHIDAIWDELAIFNNGKSA"
FT   gene            176181..176882
FT                   /locus_tag="CR539_00900"
FT   CDS_pept        176181..176882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00900"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJZ2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJZ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312799.1"
FT                   /protein_id="AUJ94138.1"
FT                   /translation="MTTLSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQYLMVVMDERD
FT                   KRPFSMASTPDEKGFIELHIGASEINLYAKAVMDRILKDHQIVVDIPHGEAWLRDDEER
FT                   PMILIAGGTGFSYARSILLTALARNPNRDITIYWGGREEQHLYDLCELEALSLKHPGLQ
FT                   VVPVVEQPEAGWRGRTGTVLTAVLQDHGTLAEHDIYIAGRFEMAKIARDLFCSERNARE
FT                   DRLFGDAFAFI"
FT   gene            complement(177074..178237)
FT                   /gene="fadA"
FT                   /locus_tag="CR539_00905"
FT   CDS_pept        complement(177074..178237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="CR539_00905"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJY7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312800.1"
FT                   /protein_id="AUJ94139.1"
FT                   /translation="MEQVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPAL
FT                   EAAALDDIYWGCVQQTLEQGFNIARNAALLAEVPHSVPAVTVNRLCGSSMQALHDAARM
FT                   IMTGDAQACLVGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLARMHGISRE
FT                   MQDAFAARSHARAWAATQSGAFKNEIIPTGGHDADGVLKQFNYDEVIRPETTVEALATL
FT                   RPAFDPVNGTVTAGTSSALSDGAAAMLVMSESRAHELGLKPRARVRSMAVVGCDPSIMG
FT                   YGPVPASKLALKKAGLSVSDIGVFEMNEAFAAQILPCIKDLGLIEQIDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMEHKDVQFGLATMCIGLGQGIATVFERV"
FT   gene            complement(178247..180436)
FT                   /gene="fadB"
FT                   /locus_tag="CR539_00910"
FT   CDS_pept        complement(178247..180436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="CR539_00910"
FT                   /product="fatty acid oxidation complex subunit alpha FadB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSW3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSW3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001490315.1"
FT                   /protein_id="AUJ94140.1"
FT                   /translation="MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGV
FT                   LEQQSDLKGLLLRSNKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVP
FT                   TIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSA
FT                   LEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKLEPL
FT                   KLSKIEATMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLA
FT                   HTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVV
FT                   MKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEA
FT                   VVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELANALERPENFCGMHFFNPVHRM
FT                   PLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDG
FT                   ADFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALF
FT                   DANRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLAEVSQPKRDFSEEEIIARMMIPM
FT                   VNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLG
FT                   PLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA"
FT   gene            180626..181957
FT                   /locus_tag="CR539_00915"
FT   CDS_pept        180626..181957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00915"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QIY1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:J7QIY1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020801804.1"
FT                   /protein_id="AUJ94141.1"
FT                   /translation="MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDD
FT                   HPYPFKVNPQFKAWVPVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPTSFWTEDV
FT                   EVIALPKADGIGSLLPAARGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKT
FT                   EYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNE
FT                   HAAVLHYTKLDHQAPEEMRSFLLDAGAEYNGYAADLTRTWSAKSDNDYAQLVKDVNDEQ
FT                   LALIATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHP
FT                   LGLQVHDVAGFMQDDSGTHLAAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWRE
FT                   GQFSKHFNWQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA"
FT   gene            181957..182571
FT                   /locus_tag="CR539_00920"
FT   CDS_pept        181957..182571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00920"
FT                   /product="YigZ family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QI41"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:E2QI41"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312803.2"
FT                   /protein_id="AUJ94142.1"
FT                   /translation="MESWLIPAAPVTVVEEIKKSRFITLLAHTDGVEAAKAFVESVRAE
FT                   HPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYG
FT                   GILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYSQLTGIEALLGQCDGKII
FT                   NSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEE"
FT   gene            182610..184061
FT                   /locus_tag="CR539_00925"
FT   CDS_pept        182610..184061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00925"
FT                   /product="trk system potassium uptake protein trkH"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJW8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJW8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004146450.1"
FT                   /protein_id="AUJ94143.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFV
FT                   ALAIGSMLWWPNRKEKGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFE
FT                   SFSGLTTTGATTLVGLDSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMDAFDAIGHSFATIAIGG
FT                   FSTHDASIGYFDSPTINTIIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQ
FT                   FTLVVICTLVLWFHNVYSSALMTINQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWG
FT                   FFSAYALVFIVSMLAIIATGVDDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWIL
FT                   IANMLFGRLEVFTLLVLFTPTFWRE"
FT   gene            184073..184618
FT                   /locus_tag="CR539_00930"
FT   CDS_pept        184073..184618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00930"
FT                   /product="protoporphyrinogen oxidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJW2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312805.1"
FT                   /protein_id="AUJ94144.1"
FT                   /translation="MKTLILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQW
FT                   ENYDRVVIGASIRYGHYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSY
FT                   ARKFLMNSQWRPDRCAVIAGALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQ
FT                   VANFAREIAHLTDKPTLK"
FT   gene            184994..186549
FT                   /locus_tag="CR539_00935"
FT   rRNA            184994..186549
FT                   /locus_tag="CR539_00935"
FT                   /product="16S ribosomal RNA"
FT   gene            186606..186682
FT                   /locus_tag="CR539_00940"
FT   tRNA            186606..186682
FT                   /locus_tag="CR539_00940"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:186640..186642,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186725..186800
FT                   /locus_tag="CR539_00945"
FT   tRNA            186725..186800
FT                   /locus_tag="CR539_00945"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:186758..186760,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            186975..189903
FT                   /locus_tag="CR539_00950"
FT   rRNA            186975..189903
FT                   /locus_tag="CR539_00950"
FT                   /product="23S ribosomal RNA"
FT   gene            189981..190096
FT                   /gene="rrf"
FT                   /locus_tag="CR539_00955"
FT   rRNA            189981..190096
FT                   /gene="rrf"
FT                   /locus_tag="CR539_00955"
FT                   /product="5S ribosomal RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00001"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            complement(190200..190727)
FT                   /locus_tag="CR539_00960"
FT   CDS_pept        complement(190200..190727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00960"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein MobB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8SW94"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:W8SW94"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418293.2"
FT                   /protein_id="AUJ94145.1"
FT                   /translation="MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTH
FT                   HDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDL
FT                   ILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLA
FT                   DFVVEWMQKQNG"
FT   gene            complement(190709..191293)
FT                   /gene="mobA"
FT                   /locus_tag="CR539_00965"
FT   CDS_pept        complement(190709..191293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="CR539_00965"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="in Escherichia coli MobA links a guanosine
FT                   5'-phosphate to molydopterin to form molybdopterin guanine
FT                   dinucleotide during molybdenum cofactor biosynthesis;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT27"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312807.1"
FT                   /protein_id="AUJ94146.1"
FT                   /translation="MNLMTTITGVVLAGGKARRMGGVDKGLLDLNGKPLWQHVADALMT
FT                   QLSHVVVNANRHQEIYQAGGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPY
FT                   IPHDLATRLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMAFMRL
FT                   AGGHAVDFSDHKDAFVNVNTPEELARWQEKR"
FT   gene            191363..191632
FT                   /locus_tag="CR539_00970"
FT   CDS_pept        191363..191632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00970"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJU7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_015966571.1"
FT                   /protein_id="AUJ94147.1"
FT                   /translation="MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADL
FT                   TDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGVIKE"
FT   gene            191709..192695
FT                   /locus_tag="CR539_00975"
FT   CDS_pept        191709..192695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00975"
FT                   /product="stress response kinase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJU2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312809.1"
FT                   /protein_id="AUJ94148.1"
FT                   /translation="MNNSAFTFQTLHPDTIMDALFEQGIRVDSGLTPLNSYENRVYQFQ
FT                   DEDRRRFVVKFYRPERWTADQILEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFA
FT                   VFPSVGGRQFEADNIDQMEAVGRYLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDA
FT                   TLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDAR
FT                   NGPAIQDLWMLLNGDKAEQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWL
FT                   MRRWADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY"
FT   gene            192712..193338
FT                   /locus_tag="CR539_00980"
FT   CDS_pept        192712..193338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00980"
FT                   /product="protein disulfide oxidoreductase DsbA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJT7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312810.1"
FT                   /protein_id="AUJ94149.1"
FT                   /translation="MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFF
FT                   SFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVE
FT                   DKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAAD
FT                   VQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK"
FT   gene            193397..193495
FT                   /pseudo
FT                   /locus_tag="CR539_00985"
FT   CDS_pept        193397..193495
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00985"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            193452..194149
FT                   /pseudo
FT                   /locus_tag="CR539_00990"
FT   CDS_pept        193452..194149
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00990"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            194159..194665
FT                   /locus_tag="CR539_00995"
FT   CDS_pept        194159..194665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_00995"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSX9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSX9"
FT                   /inference="COORDINATES:protein motif:HMM:PRK10954.1"
FT                   /protein_id="AUJ94150.1"
FT                   /translation="MTEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGG
FT                   DLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAA
FT                   WNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKY
FT                   LSEKK"
FT   gene            194820..196250
FT                   /locus_tag="CR539_01000"
FT   CDS_pept        194820..196250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01000"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PA52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312811.2"
FT                   /protein_id="AUJ94151.1"
FT                   /translation="MIRKSATGVIVALAVIWGGGTWYTGTQIQPGVEKFIKDFNDAKKK
FT                   GEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITM
FT                   LMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEY
FT                   GKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQFSPMNKVTAKSFTIDSLARLEEKKF
FT                   PVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQ
FT                   LGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLP
FT                   LLQQSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVT
FT                   ETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFN
FT                   GQEMSEEEFMSRAGRFVH"
FT   gene            complement(196291..197223)
FT                   /locus_tag="CR539_01005"
FT   CDS_pept        complement(196291..197223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01005"
FT                   /product="acyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJS7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJS7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312812.1"
FT                   /protein_id="AUJ94152.1"
FT                   /translation="MANLLNKFIMTRILAAITLLLSIVLTILVTIFCSVPIIIAGIVKL
FT                   LLPVPVIWRKVSRFCDFMMYCWCEGLAVLLHLNPHLQWEVHGLEGLSKKNWYLLICNHR
FT                   SWADIVVLCVLFRKHIPMNKYFLKQQLAWVPFLGLACWALDMPFMKRYSRAYLLRHPER
FT                   RGKDVETTRRSCEKFRLHPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALN
FT                   VLGKQFDKLLNVTLCYPDNNRQPFFDMLSGKLTRIVVHVDLQPIADELHGDYINDKSFK
FT                   RHFQQWLNSLWQEKDRLLTSLMSSQRQDK"
FT   gene            complement(197343..197585)
FT                   /locus_tag="CR539_01010"
FT   CDS_pept        complement(197343..197585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0B0YRR2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B0YRR2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944575.1"
FT                   /protein_id="AUJ94153.1"
FT                   /translation="MSVPVYQIMGKGCHRQDKNMSFSPLFVKIFCRSSGSLANRHVDNF
FT                   VHKLFTSLLIYYHAFYSMMFVFVFHAVKNKAIPNN"
FT   gene            197587..200373
FT                   /locus_tag="CR539_01015"
FT   CDS_pept        197587..200373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01015"
FT                   /product="DNA polymerase I"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TXT4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:W8TXT4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418300.1"
FT                   /protein_id="AUJ94154.1"
FT                   /translation="MVQIPQNPLILVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLNM
FT                   LRSLIMQYKPTHAAVVFDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGL
FT                   PLLAVSGVEADDVIGTLAREAEKAGRPVLISTGDKDMAQLVTPNITLINTMTNTILGPE
FT                   EVVNKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLYAEPEKIA
FT                   GLSFRGAKTMAAKLEQNKEVAYLSYQLATIKTDVELELTCEQLEVQQPAAEELLGLFKK
FT                   YEFKRWTADVEAGKWLQAKGAKPAAKPQETSVADEAPEVTATVISYDNYVTILDEETLK
FT                   AWIAKLEKAPVFAFDTETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRE
FT                   RALELLKPLLEDEKALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRHDM
FT                   DSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPDLQ
FT                   KHKGPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAHEIAGE
FT                   EFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEYRGLAK
FT                   LKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFI
FT                   APEDYVIVSADYSQIELRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQ
FT                   RRSAKAINFGLIYGMSAFGLARQLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQ
FT                   GYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPMQGTAADIIKRAMIAVDAWLQAEQ
FT                   PRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDVPLLVEVGSGENWDQAH"
FT   gene            complement(200755..201387)
FT                   /locus_tag="CR539_01020"
FT   CDS_pept        complement(200755..201387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01020"
FT                   /product="YihA family ribosome biogenesis GTP-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSL1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSL1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418301.3"
FT                   /protein_id="AUJ94155.1"
FT                   /translation="MTNLNYQQTHFVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNT
FT                   LTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLE
FT                   KRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASSARKAQLNMVR
FT                   EAVLAFNGDVQVETFSSLKKQGVDKLRQKLDTWFSEMQPVEETQDGE"
FT   gene            201684..201850
FT                   /pseudo
FT                   /locus_tag="CR539_01025"
FT   CDS_pept        201684..201850
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01025"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; internal stop; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_462882.1"
FT   gene            201969..202475
FT                   /locus_tag="CR539_01030"
FT   CDS_pept        201969..202475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01030"
FT                   /product="Der GTPase-activating protein YihI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YI38"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YI38"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312815.1"
FT                   /protein_id="AUJ94156.1"
FT                   /translation="MKPSSPSRSKGHAKARRKTREELNQEARDRKRQKKRRGHAPGSRA
FT                   AGGNTTSGSKGQNAPKDPRIGSKTPIPLGVTEKVTKQHKPKSEKPMLSPQAELELLETD
FT                   ERLDALLERLEAGETLSAEEQSWVDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMR
FT                   LLRGN"
FT   gene            202664..204037
FT                   /gene="hemN"
FT                   /locus_tag="CR539_01035"
FT   CDS_pept        202664..204037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="CR539_01035"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUA8"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUA8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005121847.1"
FT                   /protein_id="AUJ94157.1"
FT                   /translation="MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAV
FT                   ARYPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRH
FT                   VSQLHWGGGTPTYLNKAQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTTESF
FT                   AFTLKRVAELNPDRLSVFNYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSG
FT                   YQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQ
FT                   KELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDLHFADY
FT                   FAEDLKLLAPLAKDGLVDVDEKGIQVTAKGRLLIRNICMCFDTYLRQKARMQQFSRVI"
FT   gene            complement(204227..204337)
FT                   /locus_tag="CR539_01040"
FT   CDS_pept        complement(204227..204337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01040"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:J7QY02"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002791260.1"
FT                   /protein_id="AUJ94158.1"
FT                   /translation="MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS"
FT   gene            complement(204449..205858)
FT                   /locus_tag="CR539_01045"
FT   CDS_pept        complement(204449..205858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01045"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3L4K7U6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3L4K7U6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_012133942.1"
FT                   /protein_id="AUJ98132.1"
FT                   /translation="MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALAS
FT                   KTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSIS
FT                   VLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANT
FT                   IRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATH
FT                   QNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARHFLQVAAHELGVEAKLL
FT                   HPETEAALTRLAWPGNVRQLENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQMQP
FT                   DSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNT
FT                   LTRKLKELGME"
FT   gene            complement(205870..206919)
FT                   /locus_tag="CR539_01050"
FT   CDS_pept        complement(205870..206919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01050"
FT                   /product="two-component system sensor histidine kinase
FT                   NtrB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJP7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312818.1"
FT                   /protein_id="AUJ94159.1"
FT                   /translation="MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSR
FT                   KLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMI
FT                   LLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPS
FT                   LLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIR
FT                   DYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAA
FT                   RIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTE
FT                   FSVYLPIRK"
FT   gene            complement(207093..208502)
FT                   /gene="glnA"
FT                   /locus_tag="CR539_01055"
FT   CDS_pept        complement(207093..208502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="CR539_01055"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="forms a homododecamer; forms glutamine from ammonia
FT                   and glutamate with the conversion of ATP to ADP and
FT                   phosphate; also functions in the assimilation of ammonia;
FT                   highly regulated protein controlled by the addition/removal
FT                   of adenylyl groups by adenylyltransferase from specific
FT                   tyrosine residues; addition of adenylyl groups results in
FT                   inactivation of the enzyme; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SJP2"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020233234.1"
FT                   /protein_id="AUJ94160.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRD
FT                   PRSIAKRAEDYLRSTGIADTVLFGPEPEFFLFDDIRFGSSISGSHVAIDDIEGAWNSST
FT                   QYEGGNKGHRPAVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLSKNGVN
FT                   LFAGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVSSPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYD
FT                   LPPEEAKEIPQVAGSLEEALNELDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTP
FT                   HPVEFELYYSV"
FT   gene            complement(208636..208782)
FT                   /locus_tag="CR539_01060"
FT   CDS_pept        complement(208636..208782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01060"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5I9P3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415015.1"
FT                   /protein_id="AUJ94161.1"
FT                   /translation="MQSPFVIAFTEHKKGYPKVIAPIWCLMFPLKHYIGATFTSWCSPF
FT                   ARC"
FT   gene            208875..210698
FT                   /locus_tag="CR539_01065"
FT   CDS_pept        208875..210698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01065"
FT                   /product="translational GTPase TypA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJN7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312820.1"
FT                   /protein_id="AUJ94162.1"
FT                   /translation="MIEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDG
FT                   PMPQTRFVTKKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPIV
FT                   YASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDVDLDGPFQMQISQLDYNSYVGVIG
FT                   IGRIKRGKVKPNQQVTIIDSEGKTRNAKVGKVLGHLGLERIETDLAEAGDIVAITGLGE
FT                   LNISDTVCDTQNVEALPALSVDEPTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELV
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEP
FT                   YENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEAVVLVPPIRMTLEQALEFIDDDE
FT                   LVEVTPTSIRIRKRHLTENDRRRANRAPKDD"
FT   gene            210915..211577
FT                   /locus_tag="CR539_01070"
FT   CDS_pept        210915..211577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01070"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSN4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSN4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312821.1"
FT                   /protein_id="AUJ94163.1"
FT                   /translation="MAENQSTVENAKEKLDRWLKDGITTPGGKLPSERELGELLGIKRM
FT                   TLRQALLNLEAESKIFRKDRKGWFVTQPRFNYSPELSASFQRAAIEQGREPSWGFTEKN
FT                   RTSDIPETLAPLIAVTPSTELYRITGWGALEGHKVFYHETYINPEVAPGFIEQLENHSF
FT                   SAVWEKCYQKETVVKKLIFKPVRMPGDISKYLGGSAGMPAILIEKHRADGDAANLLI"
FT   gene            211606..212303
FT                   /pseudo
FT                   /locus_tag="CR539_01075"
FT   CDS_pept        211606..212303
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01075"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            212320..213306
FT                   /pseudo
FT                   /locus_tag="CR539_01080"
FT   CDS_pept        212320..213306
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01080"
FT                   /product="MFS transporter"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312823.1"
FT   gene            complement(213381..213503)
FT                   /pseudo
FT                   /locus_tag="CR539_01085"
FT   CDS_pept        complement(213381..213503)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01085"
FT                   /product="DeoR family transcriptional regulator"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000022208.1"
FT   gene            complement(213494..213769)
FT                   /pseudo
FT                   /locus_tag="CR539_01090"
FT   CDS_pept        complement(213494..213769)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01090"
FT                   /product="hypothetical protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start and stop; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000196715.1"
FT   gene            213956..214555
FT                   /locus_tag="CR539_01095"
FT   CDS_pept        213956..214555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01095"
FT                   /product="glucose-1-phosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSX5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSX5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312835.2"
FT                   /protein_id="AUJ94164.1"
FT                   /translation="MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLATLKKSFHMGEAFH
FT                   QHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVV
FT                   VLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVF
FT                   FDDNADNIEGANHLGITSILVKDKTTIPDYFAKVLC"
FT   gene            214549..215421
FT                   /locus_tag="CR539_01100"
FT   CDS_pept        214549..215421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01100"
FT                   /product="YihY/virulence factor BrkB family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJG7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJG7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312836.1"
FT                   /protein_id="AUJ94165.1"
FT                   /translation="MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLL
FT                   SLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAV
FT                   GACGLIVTALLLMYSIDSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSY
FT                   LLSLRWASDLNTVIDNVLRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFE
FT                   AGKKGFALYITMFPSYQLIYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQA
FT                   AEQEEDDEP"
FT   gene            215418..215855
FT                   /gene="dtd"
FT                   /locus_tag="CR539_01105"
FT   CDS_pept        215418..215855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="CR539_01105"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT57"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000560980.1"
FT                   /protein_id="AUJ94166.1"
FT                   /translation="MIALIQRVTRASVTVEGKVTGEIGAGLLVLLGVEKDDDEQKANRL
FT                   CERVLGYRIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEA
FT                   LYDYFVERCRQQEMNTQTGRFAADMQVSLVNDGPVTFWLQV"
FT   gene            215852..216841
FT                   /locus_tag="CR539_01110"
FT   CDS_pept        215852..216841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01110"
FT                   /product="GNAT family N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QJ06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:J7QJ06"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312838.1"
FT                   /protein_id="AUJ94167.1"
FT                   /translation="MSQLPGLSRETRESIAMYHLRVPQTEEELERYYQFRWEMLRKPLH
FT                   QPKGSERDAWDAMAHHQMVVDEQGNLVAVGRLYINADNEASIRFMAVHPDVQDKGLGTL
FT                   MAMTLESVARQEGVKRVTCSAREDAVEFFAKLGFINQGEITTPTTTPIRHFLMIKPVAT
FT                   LDDILHRGDWCAQLQQAWYEHIPLSEKMGVRIQQYTGQKFITTMPETGNQNPHHTLFAG
FT                   SLFSLATLTGWGLIWLMLRERHLGGTIILADAHIRYSKPISGKPHAVADLGALSGDLDR
FT                   LARGRKARVQMQVEIFGDETPGAVFEGTYIVLPAKPFGPYEEGGNEEE"
FT   gene            217251..219065
FT                   /locus_tag="CR539_01115"
FT   CDS_pept        217251..219065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01115"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT02"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000226314.1"
FT                   /protein_id="AUJ94168.1"
FT                   /translation="MVANINLIQQESYSVVNLEKQLMSNESPKQTLLNDFSHRLKMEGE
FT                   EQLFHCVNELKYGLSSNNEYDLFKNRETSLWKRKVPESAALAMTGTVYKLFGSRLLNAR
FT                   NQLDKNLLEMAMQMVYGKDMVTKSGDILIDIQLNKDGSLQSKHYTFDVGEVINNYNIDL
FT                   FVNASSINQTYLHDKNPGDVISLYGTLDNIPLVVKECTGKNHQINVKAKLPQERSEKVE
FT                   DMCERMRGGISMFNHTTKTAGNIEHNLQLSFLVDSRPSITNKYSAKDVASDILVLPVNV
FT                   YHADFKIKINDAVEKASSIVLCAVQKNLHAARKVLSGIIGNVPKNNKPKTIIFDLRFLS
FT                   AIKQKVFLGSEKPLFVKHTAMMREACKELPQSVEYVPLTCEAHSHRSVALAKTVAAPIM
FT                   ATGVGAALMYATSSGPYYAQSLSGSPDIEMIKNRMAELFNQSDISVRNKYSPAFDKWNE
FT                   LVDKLNHERNTVPFACLTTILATAINETSGGDTNVAVVMGCKSAKDRTISIVLGNSMLQ
FT                   TLFEKRLADSGEIENLFDQQGYFSCDSLTAEELMMLKDLFDIRVLHVSNKFNVGLQGNI
FT                   NTDVLQDSFFKHVDFIHESNSYTVGMGV"
FT   gene            219115..219216
FT                   /locus_tag="CR539_01120"
FT   CDS_pept        219115..219216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01120"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6Y1C2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415036.1"
FT                   /protein_id="AUJ94169.1"
FT                   /translation="MKYKERCVQALSREGHGEAIQKAPAFRTPVKAA"
FT   gene            complement(219238..219456)
FT                   /locus_tag="CR539_01125"
FT   CDS_pept        complement(219238..219456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01125"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V5C2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312841.1"
FT                   /protein_id="AUJ94170.1"
FT                   /translation="MKLIFHHRPVSTATNRSLLAHRYNFVGNSSGNKEFLPEHPRHHPI
FT                   ALTSIIGSTVSFFNRIIGWQRSARYGS"
FT   gene            219746..219958
FT                   /locus_tag="CR539_01130"
FT   CDS_pept        219746..219958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01130"
FT                   /product="CopG family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1X0YL34"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1X0YL34"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418325.3"
FT                   /protein_id="AUJ98133.1"
FT                   /translation="MNTVFLHLSEEAIKRLNKLRGWRKVSRSAILREAVEQYLERQQFP
FT                   VRKAKGGRQKGEVVGVDDQCKEHKE"
FT   gene            220200..220418
FT                   /locus_tag="CR539_01135"
FT   CDS_pept        220200..220418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01135"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUB4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUB4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312843.2"
FT                   /protein_id="AUJ94171.1"
FT                   /translation="MDRIILDLSNEVIKQLDDLEVQRNLPRTELLREAVDQYLVNQSQT
FT                   VRTSAFGIWQGREEDGVEYQRKLREEW"
FT   gene            complement(220748..221677)
FT                   /locus_tag="CR539_01140"
FT   CDS_pept        complement(220748..221677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01140"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJE2"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312844.1"
FT                   /protein_id="AUJ94172.1"
FT                   /translation="MSIRIIPQDELGSSEKRTADMIPPLLFPRLKNLYNRRAERLRELA
FT                   ENNPLGDYLRFAALIAHAQEVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQ
FT                   KLLMALIAELKPEMSGPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAA
FT                   LSLYWAQMANLIPGKARAEYGEQRQYCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEW
FT                   HVVRVKCSNCEQSGKLHYWSLDDEQAAIKAESCDDCGTYLKILYQEKEPKVEAVADDLA
FT                   SLVLDARMEQEGYARSSINPFLFPGEGE"
FT   gene            complement(221674..222309)
FT                   /locus_tag="CR539_01145"
FT   CDS_pept        complement(221674..222309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01145"
FT                   /product="formate dehydrogenase cytochrome b556(fdo)
FT                   subunit"
FT                   /note="cytochrome b556(FDO) component; heme containing;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJD7"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJD7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312845.1"
FT                   /protein_id="AUJ94173.1"
FT                   /translation="MKRRDTIVRYTAPERINHWITAFCFILAAVSGLGFLFPSFNWLMQ
FT                   IMGTPQLARILHPFVGVVMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVGDT
FT                   GRYNFGQKCVFWAAIIFLVLLLVSGVIIWRPYFAPAFSIPVIRFALMLHSFAAVALIVV
FT                   IMVHIYAALWVKGTITAMVEGWVTSAWAKKHHPRWYREVRKTTEKKAE"
FT   gene            complement(222306..223208)
FT                   /gene="fdxH"
FT                   /locus_tag="CR539_01150"
FT   CDS_pept        complement(222306..223208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxH"
FT                   /locus_tag="CR539_01150"
FT                   /product="formate dehydrogenase-O iron-sulfur subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QIS4"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:E2QIS4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418329.1"
FT                   /protein_id="AUJ94174.1"
FT                   /translation="MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKAC
FT                   QVACSEWNDIRDTVGNNIGVYDNPNDLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCS
FT                   DPGCLKACPAEGAIIQYANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLC
FT                   VDRVVVGQEPACVKTCPTGAIHFGTKESMKTLASERVAELKTRGYDNAGLYDPAGVGGT
FT                   HVMYVLHHADKPNLYHGLPENPEISETVKFWKGIWKPLAAVGFAATFAASIFHYVGVGP
FT                   NRADEEENNLHEEKDEERK"
FT   gene            complement(223221..226271)
FT                   /gene="fdnG"
FT                   /locus_tag="CR539_01155"
FT   CDS_pept        complement(223221..226271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:225684..225686,aa:Sec)
FT                   /gene="fdnG"
FT                   /locus_tag="CR539_01155"
FT                   /product="formate dehydrogenase O subunit alpha,
FT                   selenocysteine-containing"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1Y2YXQ0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y2YXQ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418330.1"
FT                   /protein_id="AUJ94175.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTAAALGFAPSVALAETRQYKLLRTRE
FT                   TRNTCTYCSVGCGLLMYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHS
FT                   ESRLKFPEYRAPGSDKWQQISWEEAFDRIAKLMKEDRDANYIAQNAEGVTVNRWLSTGM
FT                   LCASASSNETGYLTQKFSRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKN
FT                   ANLVVVMGGNAAEAHPVGFRWAMEAKIHNGAKLIVIDPRFTRTAAVADYYAPIRSGTDI
FT                   AFLSGVLLYLLNNEKFNREYTEAYTNASLIVREDYGFEDGLFTGYDAEKRKYDKSSWTY
FT                   ELDENGFAKRDTTLQHPRCVWNLLKQHVSRYTPDVVENICGTPKDAFLKVCEYIAETSA
FT                   HDKTASFLYALGWTQHSVGAQNIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLG
FT                   LLSQSLPGYMTLPSEKQTDLQTYLTANTPKPLLEGQVNYWGNYPKFFVSMMKAFFGDKA
FT                   TAENSWGFDWLPKWDKGYDVLQYFEMMKEGKVNGYICQGFNPVASFPNKNKVIGCLSKL
FT                   KFLVTIDPLNTETSNFWQNHGELNEVDSSKIQTEVFRLPSTCFAEENGSIVNSGRWLQW
FT                   HWKGADAPGIALTDGEILSGIFLRLRKMYAEQGGANPDQVLNMTWNYAIPHEPKSEEVA
FT                   MESNGKALADITDPATGAVIVKKGQQLSSFAQLRDDGTTSCGCWIFAGSWTPEGNQMAR
FT                   RDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQGNPWDPKRQLLKWDGTKWTGWDIP
FT                   DYSAAPPGSGVGPFIMQQEGMGRLFALDKMAEGPFPEHYEPFETPLGTNPLHPNVISNP
FT                   AARIFKDDAEALGKADKFPYVGTTYRLTEHFHYWTKHALLNAILQPEQFVEIGESLANK
FT                   LGIAQGDTVKVSSNRGYIKAKAVVTKRIRTLKANGKDIDTIGIPIHWGYEGVAKKGFIA
FT                   NTLTPFVGDANTQTPEFKSFLVNVEKV"
FT   gene            226275..226529
FT                   /locus_tag="CR539_01160"
FT   CDS_pept        226275..226529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01160"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D8FE27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001368120.1"
FT                   /protein_id="AUJ94176.1"
FT                   /translation="MLLVSTLSRPIYIRLLRVQGVGVIFLCGRGRKGPELAQFPSIQEG
FT                   FVTEYHNVGVCVLIWLRESEKNTAKRNRKCDKYHRCSSN"
FT   gene            226465..227298
FT                   /locus_tag="CR539_01165"
FT   CDS_pept        226465..227298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01165"
FT                   /product="sulfurtransferase FdhD"
FT                   /note="involved in the production or activity of formate
FT                   dehydrogenase-H which is active when nitrate is not present
FT                   during anaerobic growth; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJC7"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312848.1"
FT                   /protein_id="AUJ94177.1"
FT                   /translation="MKKTQQKEIENVTNITGVRQIELWRRDDLQHPRLDEVAEEVPVAL
FT                   VYNGISHVVMMASPKDLEYFALGFSLSEGIIESPRDIFGMDVVPSCNGLEVQIELSSRR
FT                   FMGLKERRRALAGRTGCGVCGVEQLNDIGKPVQPLPFTQTFDLNKLDDALRHLNDFQPV
FT                   GQLTGCTHAAAWMLPSGELVGGHEDVGRHVALDKLLGRRSQEGESWQQGAVLVSSRASY
FT                   EMVQKSAMCGVEILFAVSAATTLAVEVAERCNLTLVGFCKPGRATVYTHPQRLSN"
FT   gene            227451..228506
FT                   /locus_tag="CR539_01170"
FT   CDS_pept        227451..228506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01170"
FT                   /product="DUF3829 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR024291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT11"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312849.1"
FT                   /protein_id="AUJ94178.1"
FT                   /translation="MKRNLLSSAIIVAIMALGLTGCDDKKAETETPPPANSQPAAPAPE
FT                   AKPTEAPVAKADAKPETPAQPVVDEQAVFDEKMDVYIKCYNKLQIPVQNSLARYADWLK
FT                   DFKQGPTGKESLVYGIYGISESNLSECQKGIKRVVALTPALQPIDGVAVSYIDAAVALG
FT                   NTINEMDKYYTQENYKDDAFAKGKTLHQTFLKNLEAFEPVAESYHAAIQEINDKRQLAE
FT                   LKNIEEREGKTFHYYSLAVMISAKQINNLISQEKFDVDAAMKKVSELETLVAQAKEADK
FT                   GGMNFSFINSADQYQLETKKYVRRVRDKVPYSDWDKEHLQDANTSWMVEDSFPRALREY
FT                   NEMVDDYNSLR"
FT   gene            complement(228556..228993)
FT                   /pseudo
FT                   /locus_tag="CR539_01175"
FT   CDS_pept        complement(228556..228993)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01175"
FT                   /product="hypothetical protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312850.1"
FT   gene            complement(229009..229706)
FT                   /pseudo
FT                   /locus_tag="CR539_01180"
FT   CDS_pept        complement(229009..229706)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01180"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(229735..231063)
FT                   /locus_tag="CR539_01185"
FT   CDS_pept        complement(229735..231063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01185"
FT                   /product="porin"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR016963"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSU8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001514700.1"
FT                   /protein_id="AUJ94179.1"
FT                   /translation="MKKSTLSLAIGLLLACSTGMAKTQHLTLEQRMALLEERLEAAEMR
FT                   AAKAESQVKQLQTQQAAEIREIKAAQGNTPVNGQATTESAKKNATSPNLLLSGYGDLKI
FT                   YGDVEFNMDAESNHGLLAMTNADVNSDPTNEQWNLNGRILLGFDGMRKMDNGYFAGFSA
FT                   QPLGDMHGSVNIDDAVFFFGKENDWKVKVGRFEAYDMFPLNQDTFVEHSGNTANDLYDD
FT                   GSGYIYMMKEGRGRSNAGGNFLVSKQLDNWYFELNTLLEDGTSLYNDGNYHGRDMEQQK
FT                   NVAYLRPVIAWSPTEEFTVSAAMEANVVNNAYGYTDSKGNFVDQSDRTGYGMSMTWNGL
FT                   KTDPDNGIVVNLNTAYLDANNEKDFTAGINALWKRFELGYIYAHNKIDEFSGVVCDNDC
FT                   WIDDEGTYTIHTIHASYQFANVMDMENFNIYLGTYGDAANLLI"
FT   gene            231541..231693
FT                   /pseudo
FT                   /locus_tag="CR539_01190"
FT   CDS_pept        231541..231693
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01190"
FT                   /product="PTS fructose transporter subunit IIA"
FT                   /note="with FrvBRX is part of the
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system involved in the transport and phosphorylation of
FT                   sugars; possibly responsible for the sugar specificity of
FT                   the system; incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312853.1"
FT   gene            231695..231793
FT                   /pseudo
FT                   /locus_tag="CR539_01195"
FT   CDS_pept        231695..231793
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01195"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            231750..232447
FT                   /pseudo
FT                   /locus_tag="CR539_01200"
FT   CDS_pept        231750..232447
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01200"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(232605..232919)
FT                   /gene="rhaM"
FT                   /locus_tag="CR539_01205"
FT   CDS_pept        complement(232605..232919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaM"
FT                   /locus_tag="CR539_01205"
FT                   /product="L-rhamnose mutarotase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0B0V9N7"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B0V9N7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312855.1"
FT                   /protein_id="AUJ94180.1"
FT                   /translation="MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYL
FT                   DKARNLLFAMVEIESEERWNAVASTEICQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
FT                   "
FT   gene            complement(232929..233753)
FT                   /locus_tag="CR539_01210"
FT   CDS_pept        complement(232929..233753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01210"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSI9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSI9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312856.1"
FT                   /protein_id="AUJ94181.1"
FT                   /translation="MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIALY
FT                   HDNFHPQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGVVKVDSDGAGYHI
FT                   LWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTR
FT                   QLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLD
FT                   ETFGLIDTAEKSAQVLVKIYSMGGMKQTISREELIALGKRFGVTPLASALAL"
FT   gene            complement(234201..235460)
FT                   /gene="rhaA"
FT                   /locus_tag="CR539_01215"
FT   CDS_pept        complement(234201..235460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaA"
FT                   /locus_tag="CR539_01215"
FT                   /product="L-rhamnose isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NV82"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NV82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026276.1"
FT                   /protein_id="AUJ94182.1"
FT                   /translation="MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDV
FT                   SGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTP
FT                   VSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCK
FT                   ASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLDPAHHI
FT                   DAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVP
FT                   QLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPA
FT                   GSEWLESVRAYEKEILSRRG"
FT   gene            complement(235457..236926)
FT                   /locus_tag="CR539_01220"
FT   CDS_pept        complement(235457..236926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01220"
FT                   /product="rhamnulokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSP9"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSP9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312858.1"
FT                   /protein_id="AUJ94183.1"
FT                   /translation="MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQ
FT                   NGYVTWDVDSLESAIRLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRD
FT                   SRTNGLMAQAQQQLGKRDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDY
FT                   FSYRLTGKMNWEYTNATTTQLVNINSDDWDGSLLAWSGANKAWFGRPTHPGNVIGHWIC
FT                   PQGNEIPVVAVASHDTASAVIASPLNGSRAAYLSSGTWSLMGFESKTPFTNDTALAANI
FT                   TNEGGAEGRYRVLKNIMGLWLLQRVLQERQINDLPALIAATQVLPACRFIINPNDDRFI
FT                   NPDEMCSEIQAACRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRGEDFSQLHI
FT                   VGGGCQNTLLNQLCADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTA
FT                   NLTTFTPNPDSEIAHYVAQIHSTRQTKELCA"
FT   gene            237214..238050
FT                   /locus_tag="CR539_01225"
FT   CDS_pept        237214..238050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01225"
FT                   /product="transcriptional activator RhaS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ92"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ92"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312859.1"
FT                   /protein_id="AUJ94184.1"
FT                   /translation="MTVLHSVDFFPSGNASVAIEPRLPQADFPEHHHDFHEIVIVEHGT
FT                   GIHVFNGQPYTITGGTVCFVRDHDRHLYEHTDNLCLTNVLYRSPDRFQFLAGLNQLLPQ
FT                   ELDGQYPSHWRVNHSVLQQVRQLVAQMEQQEGENDLPSTASREILFMQLLLLLRKSSLQ
FT                   ENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLHRQLKQQTGLTPQRYLNR
FT                   LRLMKARHLLRHSEASVTDIAYHCGFSDSNHFSTLFRREFNWSPRDIRQGRDGFLQ"
FT   gene            238034..238972
FT                   /locus_tag="CR539_01230"
FT   CDS_pept        238034..238972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01230"
FT                   /product="HTH-type transcriptional activator RhaR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K4BYW2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4BYW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415050.3"
FT                   /protein_id="AUJ94185.1"
FT                   /translation="MAFCNNANLLNVFVRHIANNQLRSLAEVATVAHQLKLLKDDFFAS
FT                   DQQAVAVADRYPQDVFAEHTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKH
FT                   SYASVNDLVLQNIIYCPERLKLNLDWQGAIPGFSASAGQPHWRLGSMGMAQARQVIGQL
FT                   EHESSQHVPFANEMAELLFGQLVMLLNRHRYTSDSLPPTSSETLLDKLITRLAASLKSP
FT                   FALDKFCDEASCSERVLRQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTEC
FT                   GFEDSNYFSVVFTRETGMTPSQWRHLNSQKD"
FT   gene            complement(238969..240003)
FT                   /locus_tag="CR539_01235"
FT   CDS_pept        complement(238969..240003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01235"
FT                   /product="L-rhamnose/proton symporter RhaT"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT74"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT74"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418343.1"
FT                   /protein_id="AUJ94186.1"
FT                   /translation="MSNAITMGIFWHLIGAASAACFYAPFKKVKKWSWETMWSVGGIVS
FT                   WIILPWAISALLLPNFWAYYSSFSLSTLLPVFLFGAMWGIGNINYGLTMRYLGMSMGIG
FT                   IAIGITLIVGTLMTPIINGNFDVLISTEGGRMTLLGVLVALIGVGIVTRAGQLKERKMG
FT                   IKAEEFNLKKGLVLAVMCGIFSAGMSFAMNAAKPMHEAAAALGVDPLYVALPSYVVIMG
FT                   GGAIINLGFCFIRLAKVKDLSLKSDFSLAKSLIIHNVLLSALGGLMWYLQFFFYAWGHA
FT                   RIPAQYDYISWMLHMSFYVLCGGIVGLELKEWNNAGRRPVTVLSLGCVVIIVAANIVGI
FT                   GMAN"
FT   gene            240288..240908
FT                   /locus_tag="CR539_01240"
FT   CDS_pept        240288..240908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01240"
FT                   /product="superoxide dismutase [Mn]"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ82"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ82"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_010345169.1"
FT                   /protein_id="AUJ94187.1"
FT                   /translation="MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALES
FT                   LPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIE
FT                   RDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFP
FT                   ILGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK"
FT   gene            241083..241190
FT                   /locus_tag="CR539_01245"
FT   CDS_pept        241083..241190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01245"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3XTY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001314327.1"
FT                   /protein_id="AUJ94188.1"
FT                   /translation="MSIFVSINTDAPLRNYASALKNMPTGDGNADKTLD"
FT   gene            241168..242151
FT                   /gene="kdgT"
FT                   /locus_tag="CR539_01250"
FT   CDS_pept        241168..242151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="CR539_01250"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QIT7"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/TrEMBL:E2QIT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418345.2"
FT                   /protein_id="AUJ94189.1"
FT                   /translation="MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMIT
FT                   GTVPILAVWFFCMGASIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVG
FT                   FFAGLSTLALVAAMDMTNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGI
FT                   ASFEPHVFVGAVLPFLVGFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQT
FT                   GLLGILLGVAVIIVTGIPLIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFK
FT                   PMAPAATSLVATAVIVTSILVPILTSIWSRKVKARAAKIEILGTVK"
FT   gene            242300..242974
FT                   /locus_tag="CR539_01255"
FT   CDS_pept        242300..242974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01255"
FT                   /product="MOSC domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT15"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT15"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418346.2"
FT                   /protein_id="AUJ94190.1"
FT                   /translation="MRYPVDVYTGKIQAYPEGKPSAIAKIQVDGELMLTELGLEGDEQA
FT                   EKKVHGGPDRALCHYPREHYLYWAREFPEQAELFVAPAFGENLSTDGLTESNVYMGDIF
FT                   RWGEALIQVSQPRSPCYKLNYHFDISDIAQLMQNTGKVGWLYSVIAPGKVSADAPLELV
FT                   SRVSDVTVQEAAAIAWHMPFDDDQYHCLLSAAGLSKSWTRTMQKRRLSGKIEDFSRRLW
FT                   GK"
FT   gene            complement(243080..244453)
FT                   /locus_tag="CR539_01260"
FT   CDS_pept        complement(243080..244453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01260"
FT                   /product="two-component system sensor histidine kinase
FT                   CpxA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K4TZ08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4TZ08"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312864.1"
FT                   /protein_id="AUJ94191.1"
FT                   /translation="MIGSLTARIFAIFWLTLALVLMLVLMLPKLDSRQMTELLDSEQRQ
FT                   GLMIEQHVEAELANDPPNDLMWWRRLFRAIDKWAPPGQRLLLVTTEGRVIGAERSEMQI
FT                   IRNFIGQADNADHPQKKKYGRVELVGPFSVRDGEDNYQLYLIRPASSSQSDFINLLFDR
FT                   PLLLLIVTMLVSTPLLLWLAWSLAKPARKLKNAADEVAQGNLRQHPELEAGPQEFLAAG
FT                   ASFNQMVTALERMMTSQQRLLSDISHELRTPLTRLQLGTALLRRRSGESKELERIETEA
FT                   QRLDSMINDLLVMSRNQQKNALVSETIKANQLWGEVLDNAAFEAEQMGKSLTVNFPPGP
FT                   WPLYGNPNALESALENIVRNALRYSHTKIEVGFAVDKDGITITVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRESGGTGLGLAIVETAIQQHRGWVKAEDSPLGGLRLVIWLPLYKRS"
FT   gene            complement(244450..245148)
FT                   /locus_tag="CR539_01265"
FT   CDS_pept        complement(244450..245148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01265"
FT                   /product="DNA-binding response regulator"
FT                   /note="response regulator in two-component regulatory
FT                   system with CpxA; part of the envelope stress response
FT                   system; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ67"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001033718.1"
FT                   /protein_id="AUJ94192.1"
FT                   /translation="MNKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSI
FT                   DLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFND
FT                   RELVARIRAILRRSHWSEQQQNNDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFT
FT                   LLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLR
FT                   GRGYLMVSAS"
FT   gene            245298..245798
FT                   /gene="cpxP"
FT                   /locus_tag="CR539_01270"
FT   CDS_pept        245298..245798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="CR539_01270"
FT                   /product="periplasmic protein CpxP"
FT                   /note="repressor of the Cpx envelope stress response
FT                   pathway which occurs via periplasmic interactions with
FT                   CpxA; CpxP is degraded by DegP protease especially in the
FT                   presence of misfolded substrates; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:E2QIU1"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:E2QIU1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026277.1"
FT                   /protein_id="AUJ98134.1"
FT                   /translation="MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHM
FT                   FDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMAN
FT                   EQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNS
FT                   RSQ"
FT   gene            245947..246849
FT                   /locus_tag="CR539_01275"
FT   CDS_pept        245947..246849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01275"
FT                   /product="cation-efflux pump FieF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ57"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312867.1"
FT                   /protein_id="AUJ94193.1"
FT                   /translation="MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVD
FT                   SLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQH
FT                   LISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGA
FT                   ILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIV
FT                   TSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVI
FT                   IHQDPCSVVPREGKRSMLS"
FT   gene            247030..247992
FT                   /gene="pfkA"
FT                   /locus_tag="CR539_01280"
FT   CDS_pept        247030..247992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="CR539_01280"
FT                   /product="ATP-dependent 6-phosphofructokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ52"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312868.1"
FT                   /protein_id="AUJ94194.1"
FT                   /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGL
FT                   YEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGD
FT                   GSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQR
FT                   ISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAIT
FT                   EHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYG
FT                   GRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY"
FT   gene            248311..249300
FT                   /locus_tag="CR539_01285"
FT   CDS_pept        248311..249300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01285"
FT                   /product="sulfate transporter subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085PAA7"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PAA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005133064.1"
FT                   /protein_id="AUJ94195.1"
FT                   /translation="MNKWGVGLTFLLATTSVMAKDIQLLNVSYDPTRELYEQYNKAFSA
FT                   HWKQQTGDNVVIRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKEWIKR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYA
FT                   LHHNNNDQAKAQDFVRALYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAANEL
FT                   GKDKFEIVTPSESILAEPTVSVVDKVVEKKGTKEVAEAYLKYLYSPEGQEIAAKNYYRP
FT                   RDAEVAKKYENAFPKLKLFTIDEEFGGWTKAQKEHFANGGTFDQISKR"
FT   gene            249407..250162
FT                   /locus_tag="CR539_01290"
FT   CDS_pept        249407..250162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01290"
FT                   /product="CDP-diacylglycerol diphosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A163CEM2"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR015993"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A163CEM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312870.1"
FT                   /protein_id="AUJ94196.1"
FT                   /translation="MKKAGLLFLVMIVIAVVAAGIGYWKLTGEESVTLRKIVLEECLPN
FT                   QQQNQNPSPCAEVKPNAGYVVLKDLNGPLQYLLMPTYRINGTESPLLTDPSTPNFFWLA
FT                   WQARDFMSKKYGQPVPDRAVSLAINSRTGRTQNHFHIHISCIRPDVREQLDNNLANISS
FT                   RWLPLPGGLRGHEYLARRVTESELVQRSPFMMLAEEVPEAREHMGSYGLAMVRQSDNSF
FT                   VLLATQRNLLTLNRASAEEIQDHQCEILR"
FT   gene            complement(250217..250984)
FT                   /locus_tag="CR539_01295"
FT   CDS_pept        complement(250217..250984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01295"
FT                   /product="triose-phosphate isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ37"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ37"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312871.1"
FT                   /protein_id="AUJ94197.1"
FT                   /translation="MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEM
FT                   YIDMAKREAEGSHIMLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKE
FT                   SDELIAKKFAVLKEQGLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAV
FT                   IAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELF
FT                   AQPDIDGALVGGASLKADAFAVIVKAAEAAKQA"
FT   gene            complement(251000..251095)
FT                   /locus_tag="CR539_01300"
FT   CDS_pept        complement(251000..251095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01300"
FT                   /product="triosephosphate isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1M3RXS1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M3RXS1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001311276.1"
FT                   /protein_id="AUJ94198.1"
FT                   /translation="MTKSKAFVPMNLYTVSQTCCPAGRPSSFIRL"
FT   gene            complement(251092..251691)
FT                   /locus_tag="CR539_01305"
FT   CDS_pept        complement(251092..251691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01305"
FT                   /product="DUF1454 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312872.1"
FT                   /protein_id="AUJ94199.1"
FT                   /translation="MKPGCTLFFLLCSALTVTTTAHAQTPDTATTAPYLLAGAPTFDLS
FT                   ISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSI
FT                   QMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTET
FT                   EGALRYVVADNGEKGLTFAVEPIKLALSESLEGLNK"
FT   gene            251792..252232
FT                   /locus_tag="CR539_01310"
FT   CDS_pept        251792..252232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01310"
FT                   /product="DUF805 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ27"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312873.1"
FT                   /protein_id="AUJ94200.1"
FT                   /translation="MTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQ
FT                   TAAFCLVCLLWPTAAVTVKRLHDRGRSGAWAFLMIVAWMLLAGNWAILPGVWQWAVGRF
FT                   VPTLILVMMLIDLGAFVGTQGENKYGKDTQDVKYKADNKSSN"
FT   gene            252445..252744
FT                   /locus_tag="CR539_01315"
FT   CDS_pept        252445..252744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01315"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ22"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312874.1"
FT                   /protein_id="AUJ94201.1"
FT                   /translation="MKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMT
FT                   KLKELAAAASSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLA"
FT   gene            252771..253199
FT                   /locus_tag="CR539_01320"
FT   CDS_pept        252771..253199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01320"
FT                   /product="universal stress protein UspD"
FT                   /note="with UspC and Usp E is involved in resistance to UV
FT                   radiation; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ17"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312875.1"
FT                   /protein_id="AUJ94202.1"
FT                   /translation="MAYKHIGVAISGNEEDALLVNKALELARHNDAHLTLIHIDDGLSE
FT                   LYPGIYFPATEDILQLLKNKSDNKLYKLTKNIQWPKTKLRIERGEMPETLLEIMQKEQC
FT                   DLLVCGHHHSFINRLMPAYRGMINKLSADLLIVPFIDK"
FT   gene            complement(253204..253950)
FT                   /locus_tag="CR539_01325"
FT   CDS_pept        complement(253204..253950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01325"
FT                   /product="ferredoxin--NADP(+) reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SJ12"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3SJ12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001742479.1"
FT                   /protein_id="AUJ94203.1"
FT                   /translation="MADWVTGKVTKVQNWTDALFSLTVHAPVHPFTAGQFTKLGLEIDG
FT                   ERVQRAYSYVNSPDNPDLEFYLVTVPDGKLSPRLAALKPGDEVQVVSEAAGFFVLDEVP
FT                   DCETLWMLATGTAIGPYLSILQLGKDLDRFKNLVLVHAARYAADLSYLPLMQELEKRYE
FT                   GKLRIQTVVSRETAAGSLTGRIPALIESGELESAIGLPMNKETSHVMLCGNPQMVRDTQ
FT                   QLLKETRQMTKHLRRRPGHMTAEHYW"
FT   gene            complement(254047..255057)
FT                   /gene="glpX"
FT                   /locus_tag="CR539_01330"
FT   CDS_pept        complement(254047..255057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="CR539_01330"
FT                   /product="fructose 1,6-bisphosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QIV2"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:E2QIV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418360.1"
FT                   /protein_id="AUJ94204.1"
FT                   /translation="MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLN
FT                   QVNIDGTIVIGEGEIDEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVL
FT                   AVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILA
FT                   KPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIR
FT                   ALDGDMNGRLLARHDVKGDNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFS
FT                   ATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYLDRKDPEMQVHIL"
FT   gene            complement(255287..256795)
FT                   /gene="glpK"
FT                   /locus_tag="CR539_01335"
FT   CDS_pept        complement(255287..256795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="CR539_01335"
FT                   /product="glycerol kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TBH0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:W8TBH0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312878.1"
FT                   /protein_id="AUJ94205.1"
FT                   /translation="MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGW
FT                   VEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVW
FT                   QCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLF
FT                   GTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSS
FT                   EVYGQTNIGGKGGTRIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAV
FT                   KSENGLLTTIACGPTGEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNT
FT                   NGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQAD
FT                   SGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNL
FT                   DELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWEEHDE"
FT   gene            complement(256818..257663)
FT                   /locus_tag="CR539_01340"
FT   CDS_pept        complement(256818..257663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01340"
FT                   /product="aquaporin"
FT                   /note="involved in the transport of glycerol into the cell;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUE2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312879.1"
FT                   /protein_id="AUJ94206.1"
FT                   /translation="MSQKSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEIS
FT                   VIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALV
FT                   YGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLI
FT                   LALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNV
FT                   AFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
FT                   "
FT   gene            258089..258334
FT                   /locus_tag="CR539_01345"
FT   CDS_pept        258089..258334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01345"
FT                   /product="cell division protein ZapB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIZ2"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIZ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418363.1"
FT                   /protein_id="AUJ94207.1"
FT                   /translation="MTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQN
FT                   AQHQREELERENNHLKEQQNGWQERLQALLGRMEEV"
FT   gene            complement(258373..259089)
FT                   /locus_tag="CR539_01350"
FT   CDS_pept        complement(258373..259089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01350"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT39"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT39"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312881.1"
FT                   /protein_id="AUJ94208.1"
FT                   /translation="MRYVILLILWIITIFLSHLQHSNLLTGDPGMVGEYIGSVLLGPLL
FT                   LPVLVSGILCTFTKKTRNFASFTRGYCWVLGVLLLSNVGNTFRLFTPWHYTFEKAAISV
FT                   TVPNRHWNTVSISTDKTIDIRSEDNSVFISAFRLPAGRSADDSLEELKKMQRDNLKDQY
FT                   NEETFQFHDCNAKHFTCKYQDVLINFDGQQKRTISVYLEDTPRAVGIIALMEPDTADKY
FT                   RQQAMEIMLSAKNTVK"
FT   gene            complement(259122..259796)
FT                   /locus_tag="CR539_01355"
FT   CDS_pept        complement(259122..259796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01355"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0N3X5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N3X5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312882.1"
FT                   /protein_id="AUJ98135.1"
FT                   /translation="MQNIILLFIYLLLIAVNHFRYKFLLSGNAGEMILYFANVFFNPLA
FT                   LSFIIATIICITIKKRSSRSFIRGTCWLMGLFLIYSSYTVWERHSIWDYTFPEPGITVT
FT                   VPSKQWVANIVKQGPTLVTRDAHAILAIVAFSQNELGVHSIEELTATQNGTAEMHVCDV
FT                   QGFACAYQEGVQTMSDGKVRHVIFMTLLDNTNLIQLVAAIDPDYLDEYQEEVMKMMLSA
FT                   RQ"
FT   gene            complement(259856..260341)
FT                   /gene="rraA"
FT                   /locus_tag="CR539_01360"
FT   CDS_pept        complement(259856..260341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="CR539_01360"
FT                   /product="ribonuclease E activity regulator RraA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIY7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001392924.1"
FT                   /protein_id="AUJ94209.1"
FT                   /translation="MKYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDN
FT                   GLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEE
FT                   LDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE"
FT   gene            complement(260434..261360)
FT                   /locus_tag="CR539_01365"
FT   CDS_pept        complement(260434..261360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01365"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="catalyzes the formation of dimethylmenaquinone from
FT                   1,4-dihydroxy-2-naphthoate and octaprenyl diphosphate;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIY2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIY2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312884.1"
FT                   /protein_id="AUJ94210.1"
FT                   /translation="MTEQQISRTQAWLESLRPKTLPLAFAAIIVGTALAWWQGHFDPLV
FT                   ALLALITAGLLQILSNLANDYGDAVKGSDKPDRIGPLRGMQKGVITQQEMKRALIITVV
FT                   LICLSGLALVAVACHTLADFVGFLILGGLSIIAAITYTVGNRPYGYIGLGDISVLVFFG
FT                   WLSVMGSWYLQAHTLIPALILPATACGLLATAVLNINNLRDINSDRENGKNTLVVRLGE
FT                   VNARRYHACLLMGSLVCLALFNLFSLHSLWGWLFLLAAPLLVKQARYVMREMDPVAMRP
FT                   MLERTVKGALLTNLLFVVGIFLSQWAA"
FT   gene            complement(261427..262758)
FT                   /gene="hslU"
FT                   /locus_tag="CR539_01370"
FT   CDS_pept        complement(261427..262758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="CR539_01370"
FT                   /product="HslU--HslV peptidase ATPase subunit"
FT                   /note="heat shock protein involved in degradation of
FT                   misfolded proteins; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIX7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIX7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_019841241.1"
FT                   /protein_id="AUJ94211.1"
FT                   /translation="MSEMTPREIVSELDKHIIGQDNAKRSVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTEQQQEPSAARQAFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTSQLQSMFQNLGGQKQKARKLKIKDAM
FT                   KLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQIAKPSDLIPELQGRLPIRVELQALTTSDF
FT                   ERILTEPNASITVQYKALMATEGVNIEFTDSGIKRIAEAAWQVNESTENIGARRLHTVL
FT                   ERLMEEISYDASDLSGQNITIDADYVSKHLDALVADEDLSRFIL"
FT   gene            complement(262768..263298)
FT                   /locus_tag="CR539_01375"
FT   CDS_pept        complement(262768..263298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01375"
FT                   /product="HslU--HslV peptidase proteolytic subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="heat shock protein involved in degradation of
FT                   misfolded proteins; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIX2"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIX2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_008457544.1"
FT                   /protein_id="AUJ94212.1"
FT                   /translation="MTTIVSVRRNGHVVIAGDGQATLGNTVMKGNVKKVRRLYNDKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPENDLIAIGSGGPYAQAAARALLENTELSAREIAEKALDIAGDICIYT
FT                   NHFHTIEELSYKA"
FT   gene            complement(263391..264350)
FT                   /locus_tag="CR539_01380"
FT   CDS_pept        complement(263391..264350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01380"
FT                   /product="cell division protein FtsN"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIW7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIW7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312887.1"
FT                   /protein_id="AUJ94213.1"
FT                   /translation="MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLV
FT                   TFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSA
FT                   GGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLA
FT                   EQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASTQQPYQDLLQTPAHTTAQSK
FT                   PQQAAPVTRAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNN
FT                   GWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG"
FT   gene            complement(264442..265467)
FT                   /locus_tag="CR539_01385"
FT   CDS_pept        complement(264442..265467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01385"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIW2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312888.1"
FT                   /protein_id="AUJ94214.1"
FT                   /translation="MKAKKQETAATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVE
FT                   KAAREVGYLPQPMGRNVKRNESRTILVIVPDICDPFFSEIIRGIEVTAANHGYLVLIGD
FT                   CAHQNQQEKTFIDLIITKQIDGMLLLGSRLPFDASIEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAFDAVNYLYEQGHKRIGCIAGPEEMPLCHYRLQGYVQALRRCGIMVDPQYI
FT                   ARGDFTFEAGSKAMQQLLDLPQPPTAVFCHSDVMALGALSQAKRQGLKVPEDLSIIGFD
FT                   NIDLTQFCDPPLTTIAQPRYEIGREAMLLLLDQMQGQHVGSGSRLMDCELIIRGSTRAL
FT                   P"
FT   gene            complement(265623..267821)
FT                   /locus_tag="CR539_01390"
FT   CDS_pept        complement(265623..267821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01390"
FT                   /product="primosomal protein N'"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSS5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSS5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418370.1"
FT                   /protein_id="AUJ94215.1"
FT                   /translation="MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQQERIGI
FT                   VVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHHPIGDVLFHALPILL
FT                   RQGRPAANAPMWYWFATEQGQVVDLNSLKRSPKQQQALAALRQGKIWRDQVATLEFNDA
FT                   ALQALRKKGLCDLASETPEFSDWRKNYAVSGERLRLNTEQATAVGAIHSAADTFSAWLL
FT                   AGVTGSGKTEVYLSVLENVLAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSAWLKAKNGEAAIVIGTRSALFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDL
FT                   AVYRAHSEQIPIILGSATPALETLCNVQQKKYRLLRLTRRAGNARPAIQHVLDLKGQKV
FT                   QAGLAPALITRMRQHLQADNQVILFLNRRGFAPALLCHDCGWIAECPRCDHYYTLHQAQ
FT                   QHLRCHHCDSQRPVPRQCPSCGSTHLVPVGLGTEQLEQTLAPLFPGVPISRIDRDTTSR
FT                   KGALEQQLAEVHRGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQTLLYKGYDAFAEQALAERRMMQLPPWTS
FT                   HVIVRAEDHNNQHAPLFLQQLRNLILSSPLADDKLWVLGPVPALAPKRGGRWRWQILLQ
FT                   HPSRVRLQHIINGTLALINTIPDSRKVKWVLDVDPIEG"
FT   gene            268024..268236
FT                   /locus_tag="CR539_01395"
FT   CDS_pept        268024..268236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01395"
FT                   /product="50S ribosomal protein L31"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIV2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312890.1"
FT                   /protein_id="AUJ94216.1"
FT                   /translation="MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFT
FT                   GKQRDVATGGRVDRFNKRFNIPGSK"
FT   gene            complement(268297..268905)
FT                   /locus_tag="CR539_01400"
FT   CDS_pept        complement(268297..268905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01400"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085PAC9"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PAC9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312893.1"
FT                   /protein_id="AUJ94217.1"
FT                   /translation="MKYRLLILSLLVSVPAFAWQPQTGDIIFQISRSSQSKAIQLATHS
FT                   DYSHTGMLVMRNKKPYVFEAVGPVKYTPLKQWIAHGEKGKYVVRRVEGGLSVEQQQKLA
FT                   QTAKRYLGKPYDFSFSWSDDRQYCSEVVWKVYQNALGMRVGEQQKLKEFDLSNPLVQAK
FT                   LKERYGKNIPLEETVVSPQAVFDAPQLTTVAKEWPLFSW"
FT   gene            complement(269089..269406)
FT                   /locus_tag="CR539_01405"
FT   CDS_pept        complement(269089..269406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01405"
FT                   /product="met repressor"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIU2"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312894.1"
FT                   /protein_id="AUJ94218.1"
FT                   /translation="MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWE
FT                   Y"
FT   gene            269683..270843
FT                   /locus_tag="CR539_01410"
FT   CDS_pept        269683..270843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01410"
FT                   /product="cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="catalyzes the formation of cystathionine from
FT                   L-cysteine and O-succinyl-L-homoserine; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A0D8WEA4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8WEA4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312895.1"
FT                   /protein_id="AUJ94219.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGS
FT                   YRLFDSLAKRGCYRVLFVDQGDEQALRAALAENPKLVLVESPSNPLLRVVDIAKICHLA
FT                   REVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTEL
FT                   AWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLP
FT                   ENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATM
FT                   THAGMAPEARAAAGISETLLRISTGIEDGEDLIADLENGFRAANKG"
FT   gene            270846..273278
FT                   /gene="metL"
FT                   /gene_synonym="metM"
FT                   /locus_tag="CR539_01415"
FT   CDS_pept        270846..273278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /gene_synonym="metM"
FT                   /locus_tag="CR539_01415"
FT                   /product="bifunctional aspartokinase II/homoserine
FT                   dehydrogenase II"
FT                   /EC_number="1.1.1.3"
FT                   /EC_number="2.7.2.4"
FT                   /note="multifunctional homodimeric enzyme that catalyzes
FT                   the phosphorylation of aspartate to form
FT                   aspartyl-4-phosphate as well as conversion of aspartate
FT                   semialdehyde to homoserine; functions in a number of amino
FT                   acid biosynthetic pathways; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SIT2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIT2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000110794.1"
FT                   /protein_id="AUJ94220.1"
FT                   /translation="MSVIAQAGAKGRQLHKFGGSSLADVKCYLRVAGIMAEYSQPDDMM
FT                   VVSAAGSTTNQLINWLKLSQTDRLSAHQVQQTLRRYQCDLISGLLPAEEADSLISAFVS
FT                   DLERLAALLDSGINDAVYAEVVGHGEVWSARLMSAVLNQQGLPAAWLDAREFLRAERAA
FT                   QPQVDEGLSYPLLQQLLVQHPGKRLVVTGFISRNNAGETVLLGRNGSDYSATQIGALAG
FT                   VSRVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSEI
FT                   DLQLRCSYTPDQGSTRIERVLASGTGARIVTSHDDVCLIEFQVPTSQDFKLAHKEIDQI
FT                   LKRAQVRPLAVGVHNDRQLLQFCYTSEVADSALKILDEAGLPGELRLRQGLALVAMVGA
FT                   GVTRNPLHCHRFWQQLKGQPVEFTWQSDDGISLVAVLRTGPTESLIQGLHQSVFRAEKR
FT                   IGLVLFGKGNIGSRWLELFAREQSTLSARTGFEFVLAGVVDSRRSLLSYDGLDASRALA
FT                   FFNDEAVEQDEESLFLWMRAHPYDDLVVLDVTASQQLADQYLDFASHGFHVISANKLAG
FT                   ASDSNKYRQIHDAFEKTGRHWLYNATVGAGLPINHTVRDLIDSGDTILSISGIFSGTLS
FT                   WLFLQFDGSVPFTELVDQAWQQGLTEPDPRDDLSGKDVMRKLVILAREAGYNIEPDQVR
FT                   VESLVPAHCEGGSIDHFFENGDELNEQMVQRLEAAREMGLVLRYVARFDANGKARVGVE
FT                   AVREDHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDINRLAQLL"
FT   gene            complement(273306..273551)
FT                   /locus_tag="CR539_01420"
FT   CDS_pept        complement(273306..273551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01420"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NV22"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000660585.1"
FT                   /protein_id="AUJ94221.1"
FT                   /translation="MKEKPKGVNRKMTNDGEEKSGKMKKLQDGKKKKIRYAKQTGLQIL
FT                   TNHVLIASCRIRRKRFIRPNPMIIQYISLETIDPKT"
FT   gene            273627..274517
FT                   /gene="metF"
FT                   /locus_tag="CR539_01425"
FT   CDS_pept        273627..274517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="CR539_01425"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="MTHFR; catalyzes NADH-linked reduction of
FT                   5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
FT                   using FAD as a cofactor; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIT0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIT0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418376.1"
FT                   /protein_id="AUJ94222.1"
FT                   /translation="MSFFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSI
FT                   DRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIAR
FT                   DYWNNGIRHIVALRGDLPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQ
FT                   ADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKK
FT                   FADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAE
FT                   MSYAICHTLGVRPGL"
FT   gene            274846..277026
FT                   /gene="katG"
FT                   /locus_tag="CR539_01430"
FT   CDS_pept        274846..277026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="CR539_01430"
FT                   /product="catalase/hydroperoxidase HPI(I)"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIS2"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIS2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312898.1"
FT                   /protein_id="AUJ94223.1"
FT                   /translation="MSTSDDIHNTTATGKCPFHQGGHDQSAGAGTTTRDWWPNQLRVDL
FT                   LNQHSNRSNPLGEDFDYRKEFSKLDYYGLKKDLKALLTESQPWWPADWGSYAGLFIRMA
FT                   WHGAGTYRSIDGRGGAGRGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGQKISWADLF
FT                   ILAGNVALENSGFRTFGFGAGREDVWEPDLDVNWGDEKAWLTHRHPEALAKAPLGATEM
FT                   GLIYVNPEGPDHSGEPLSAAAAIRATFGNMGMNDEETVALIAGGHTLGKTHGAGPTSNV
FT                   GPDPEAAPIEEQGLGWASTYGSGVGADAITSGLEVVWTQTPTQWSNYFFENLFKYEWVQ
FT                   TRSPAGAIQFEAVDAPEIIPDPFDPSKKRKPTMLVTDLTLRFDPEFEKISRRFLNDPQA
FT                   FNEAFARAWFKLTHRDMGPKSRYIGPEVPKEDLIWQDPLPQPIYNPTEQDIIDLKFAIA
FT                   DSGLSVSELVSVAWASASTFRGGDKRGGANGARLALMPQRDWDVNAAAVRALPVLEKIQ
FT                   KESGKASLADIIVLAGVVGVEKAASAAGLSIHVPFAPGRVDARQDQTDIEMFELLEPIA
FT                   DGFRNYRARLDVSTTESLLIDKAQQLTLTAPEMTALVGGMRVLGANFDGSKNGVFTDRV
FT                   GVLSNDFFVNLLDMRYEWKATDESKELFEGRDRETGEVKYTASRADLVFGSNSVLRAVA
FT                   EVYASSDAHEKFVKDFVAAWVKVMNLDRFDLL"
FT   gene            277120..278025
FT                   /locus_tag="CR539_01435"
FT   CDS_pept        277120..278025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01435"
FT                   /product="EamA/RhaT family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K4C4G8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4C4G8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312899.2"
FT                   /protein_id="AUJ94224.1"
FT                   /translation="MSAAGKSNPLAISGLVVLTLIWSYSWIFMKQVTSYIGAFDFTALR
FT                   CIFGALVLFIVLLLRGRGMRPTPFKYTLAIALLQTCGMVGLAQWALVSGGAGKVAILSY
FT                   TMPFWVVIFAAVFLGERLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSAMLAILSGVS
FT                   WGASAIVAKRLYARHPRVDLLSLTSWQMLYAALVMSVVALLVPQREIDWQPTVFWALAY
FT                   SAILATALAWSLWLFVLKNLPASIASLSTLAVPVCGVLFSWWLLGENPGAVEGSGIVLI
FT                   VLALALVSRKKKEAVSVKSI"
FT   gene            complement(278052..278669)
FT                   /locus_tag="CR539_01440"
FT   CDS_pept        complement(278052..278669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01440"
FT                   /product="DUF1287 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MST4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312900.1"
FT                   /protein_id="AUJ94225.1"
FT                   /translation="MKASLALVSLLTAFTSHSLKSPAVPPTVVQIQANTNLAIADGARQ
FT                   QIGSTLFYDPAYVQLTYPGGDVPQERGVCSDVVIRALRSQKVDLQKLVHEDMAKNFAEY
FT                   PQKWQLKRPDSNIDHRRVPNLETWFTRHDKTRPISKNPSDYQAGDIVSWRSDNGLAHIG
FT                   VVSDGFARDGTPLVIHNIGAGAQEEDVLFSWRMVGHYRYFVK"
FT   gene            complement(278944..280047)
FT                   /gene="gldA"
FT                   /locus_tag="CR539_01445"
FT   CDS_pept        complement(278944..280047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="CR539_01445"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="forms dimers and octamers; involved in conversion of
FT                   glycerol to dihydroxy-acetone; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUG2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUG2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418380.4"
FT                   /protein_id="AUJ94226.1"
FT                   /translation="MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQ
FT                   STVEKSFKDAGLVVEIAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALA
FT                   HFMGVPVAIAPTIASTDAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPAR
FT                   LLAAGIGDALATWFEARACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAE
FT                   QHVVTPALERVIEANTYLSGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLT
FT                   QLVLENAPVEEIETVAALSHAVGLPITLAQLDIKEDVPAKMRTVAEAACAEGETIHNMP
FT                   GGATPDQVYAALLVADQYGQRFLQEWE"
FT   gene            complement(280058..280720)
FT                   /gene="fsa"
FT                   /locus_tag="CR539_01450"
FT   CDS_pept        complement(280058..280720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsa"
FT                   /locus_tag="CR539_01450"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7RBI3"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR023001"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:J7RBI3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415093.1"
FT                   /protein_id="AUJ94227.1"
FT                   /translation="MELYLDTANVAEVERLARIFPIAGVTTNPSIIAASKESIWEVLPR
FT                   LQKAIGDEGILFAQTMSRDAQGMVEEAKRLRDAIPGIVVKIPVTSEGLAAIKMLKKEGI
FT                   TTLGTAVYSAAQGLLAALAGAKYVAPYVNRVDAQGGDGIRTVQELQALLEMHAPESMVL
FT                   AASFKTPRQALDCLLAGCESITLPLDVAQQMLNTPAVESAIEKFEHDWNAAFGTTHL"
FT   gene            complement(280732..283233)
FT                   /gene="ptsP"
FT                   /locus_tag="CR539_01455"
FT   CDS_pept        complement(280732..283233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="CR539_01455"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT53"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT53"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312903.2"
FT                   /protein_id="AUJ94228.1"
FT                   /translation="MALIVEFICELPNGVHARPASHVETLCNTFSSQIEWHNLRTDRKG
FT                   NAKSALALIGTDTLAGDNCQLLISGADEQEAHQRLSQWLRDEFPHCDAPLAEVKSDELE
FT                   PLPVSLTNLNPQIIRARTVCSGSAGGILTPISSLDLNALSNLPAAKDVDAEQSALENGL
FT                   TLVLKNIEFRLLDSDGATSAILEAHRSLAGDTSLREHLLAGVSAGLSCAEAIVASANHF
FT                   CEEFARSSSSYLQERALDVRDVCFQLLQQIYGEQRFPAPGKLTQPAICMADELTPSQFL
FT                   ELDKNHLKGLLLKSGGTTSHTVILARSFNIPTLVGVDIDALTPWQHQTIYIDGNAGAIV
FT                   VEPGEAVARYYQQEARVQDALREQQRVWLTQQARTADGIRIEIAANIAHSVEAQAAFGN
FT                   GAEGVGLFRTEMLYMDRTSAPGESELYNIFCQALESANGRSIIVRTMDIGGDKPVDYLN
FT                   IPAEANPFLGYRAVRIYEEYASLFTTQLRSILRASAHGSLKIMIPMISSMEEILWVKEK
FT                   LAEAKQQLRNEHIPFDEKIQLGIMLEVPSVMFIIDQCCEEIDFFSIGSNDLTQYLLAVD
FT                   RDNAKVTRHYNSLNPAFLRALDYAVQAVHRQGKWIGLCGELGAKGSVLPLLVGLGLDEL
FT                   SMSAPSIPAAKARMAQLDSRECRKLLNQAMACRTSLEVEHLLAQFRMTQQDAPLVTAEC
FT                   ITLESDWRSKEEVLKGMTDNLLLAGRCRYPRKLEADLWAREAVFSTGLGFSFAIPHSKS
FT                   EHIEQSTISVARLQAPVRWGDDEAQFIIMLTLNKHAAGDQHMRIFSRLARRIMHEEFRN
FT                   ALVNAASADAIASLLQHELEL"
FT   gene            283542..284621
FT                   /locus_tag="CR539_01460"
FT   CDS_pept        283542..284621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01460"
FT                   /product="fructose-like permease IIC component 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSZ0"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSZ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418384.1"
FT                   /protein_id="AUJ94229.1"
FT                   /translation="MNELVQILKNTRQHLMTGVSHMIPFVVSGGILLAVSVMLYGKGAV
FT                   PDAVADPNLKKLFDIGVAGLTLMVPFLAAYIGYSIAERSALAPCAIGAWVGNSFGAGFF
FT                   GALIAGIIGGIVVHYLKKIPVHKVLRSVMPIFIIPIVGTLITAGIMMWGLGEPVGALTN
FT                   SLTQWLQGMQQGSIVMLAVIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTVVAIAAVG
FT                   ICIPPLGMGLATLIGRKNFSAEERETGKAALVMGCVGVTEGAIPFAAADPLRVIPSIMV
FT                   GSVCGAVTAALVGAQCYAGWGGLIVLPVVEGKLGYIAAVAVGAVVTAVCVNVLKSLARK
FT                   NGASTDEKEDDLDLDFEIN"
FT   gene            284636..284956
FT                   /locus_tag="CR539_01465"
FT   CDS_pept        284636..284956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01465"
FT                   /product="fructose-like phosphotransferase enzyme IIB
FT                   component 2"
FT                   /note="FrwB with FrwC, FrwD and PtsA forms a PEP-dependent
FT                   sugar phosphotransferase system (PTS) permease which may
FT                   phosphorylate and transport sugars into the cell;
FT                   cytoplasmic protein that interacts with complex EIIA;
FT                   contains the second phosphorylation site of the PTS;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIP2"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312906.1"
FT                   /protein_id="AUJ94230.1"
FT                   /translation="MTKIIAVTACPSGVAHTYMAAEALESAAKAKGWEVKVETQGSIGL
FT                   ENELTAEDVASADMVILTKDIGIKFEERFAGKTIVRVNISDAVKRADAIMSKIEAHLAQ
FT                   TA"
FT   gene            285007..287304
FT                   /locus_tag="CR539_01470"
FT   CDS_pept        285007..287304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01470"
FT                   /product="formate C-acetyltransferase/glycerol dehydratase
FT                   family glycyl radical enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSM8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSM8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312907.1"
FT                   /protein_id="AUJ94231.1"
FT                   /translation="MTNRISRLKTALFANTREISLERALLYTASHRQTEGEPVILRRAK
FT                   ATVYILEHVEISIRDEELIAGNRTVKPRAGIMSPEMDPYWLLKELDQFPTRPQDRFAIS
FT                   EEDKRIYREELFPYWEKRSMKDFINGQMTDEVKAATSTQIFSINQTDKGQGHIIIDYPR
FT                   LLNHGLGELVAQMQQHCQQQPENHFYQAALLLLEASQKHILRYAELAETMAASCTDAQR
FT                   REELLTIAEISRHNAEHKPQTFWQACQLFWYMNIILQYESNASSLSLGRFDQYMLPFYQ
FT                   ASLTQGEDAAFLKELLESLWVKCNDIVLLRSTSSARYFAGFPTGYTALLGGLTENGRSA
FT                   VNVLSFLCLDAYQSVQLPQPNLGVRTNALIDTPFLMKTAETIRLGTGIPQIFNDEVVVP
FT                   AFLNRGVSLEDARDYSVVGCVELSIPGRTYGLHDIAMFNLLKVMEICLHENEGNAALTY
FT                   EGLLEQIRAKISHYITLMVEGSNICDIGHRDWAPVPLLSSFISDCLEKGRDITDGGARY
FT                   NFSGVQGIGIANLSDSLHALKGMVFDQQRLSFDELLSVLKANFATPEGEKVRARLINRF
FT                   EKYGNDIDEVDNISAELLRHYCKEVEKYQNPRGGYFTPGSYTVSAHVPLGSVVGATPDG
FT                   RFAGEQLADGGLSPMLGQDAQGPTAVLKSVSKLDNTLLSNGTLLNVKFTPATLEGEAGL
FT                   RKLADFLRAFTQLKLQHIQFNVVNADTLREAQQRPQDYAGLVVRVAGYSAFFVELSKEI
FT                   QDDIIRRTAHQL"
FT   gene            287270..288148
FT                   /locus_tag="CR539_01475"
FT   CDS_pept        287270..288148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01475"
FT                   /product="[formate-C-acetyltransferase]-activating enzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSS9"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSS9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418387.3"
FT                   /protein_id="AUJ94232.1"
FT                   /translation="MTSSAGQRISCNVVETRRNDVARIFNIQRYSLNDGEGIRTVVFFK
FT                   GCPHLCPWCANPESISGKIQTVRREAKCLHCAKCLRDADECPSGAFERIGRDISLDALE
FT                   REVMKDDIFFRTSGGGVTLSGGEVLMQAEFATRFLQRLRLWGVSCAIETAGDAPASKLL
FT                   PLAKLCDEVLFDLKIMDATQARDVVKMNLPRVMENLRLLVSEGVNVIPRLPLIPGFTLS
FT                   LENMQQALDVLIPLKIRQIHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVTTMREMA
FT                   ERAGFQVTVGG"
FT   gene            288150..288491
FT                   /locus_tag="CR539_01480"
FT   CDS_pept        288150..288491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01480"
FT                   /product="fructose-like phosphotransferase enzyme IIB
FT                   component 3"
FT                   /note="FrwD with FrwB, FrwC and PtsA forms a PEP-dependent
FT                   sugar phosphotransferase system permease which may
FT                   phosphorylate and transport sugars into the cell;
FT                   phosphorylated by EIIA; FrwB homolog; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SIN5"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIN5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418388.1"
FT                   /protein_id="AUJ94233.1"
FT                   /translation="MAYLVAVTACVSGVAHTYMAAERLEKLCLLEKWGVSIETQGALGT
FT                   ENRLADEDIRRADVALLITDIELAGAERFEHCRYVQCSIYAFLREPQRVMSAVRKVLSA
FT                   PQQTHLILE"
FT   gene            complement(288478..289329)
FT                   /locus_tag="CR539_01485"
FT   CDS_pept        complement(288478..289329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01485"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT68"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT68"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312910.1"
FT                   /protein_id="AUJ94234.1"
FT                   /translation="MYHDVSYLLSRLINGPLSLRQIYFASSNGPVPDLAYQVDFPRLEI
FT                   VLEGEFVDTGAGATLVPGDVLYVAAGGWNFPQWQAPATTFSVLFGKQQLGFSVVQWDGK
FT                   QYQNLAKQHVARRGPRIGSFLLQTLNEMQMQPQEQQTARLIVASLLSHCCDLLGSQIQT
FT                   ASRSQALFEAIRDYIDERYASALTRESVAQAFYISPNYLSHLFQKTGAIGFNEYLNHTR
FT                   LEHAKTLLKGYDLKVKEVAHACGFVDSNYFCRLFRKNTERSPSEYRRQYHSQLTEKPTT
FT                   PE"
FT   gene            complement(289544..291277)
FT                   /locus_tag="CR539_01490"
FT   CDS_pept        complement(289544..291277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01490"
FT                   /product="phosphoethanolamine transferase CptA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I2HPH4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I2HPH4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418390.1"
FT                   /protein_id="AUJ94235.1"
FT                   /translation="MHSTEVQAKPLFSWKALGWALLYFWFFSTLLQAIIYISGYSGTNG
FT                   IRDSLLFSSLWLIPVFLFPKRIKIIAAVIGVVLWAASLAALCYYVIYGQEFSQSVLFVM
FT                   FETNTNEASEYLSQYFSLKIVLIALAYTAVAVLLWTRLRPVYIPKPWRYVVSFALLYGL
FT                   ILHPIAMNTFIKNKPFEKTLDNLASRMEPAAPWQFLTGYYQYRQQLNSLTKLLNENNAL
FT                   PPLANFKDKSGNEPRTLVLVIGESTQRGRMSLYGYPRETTPELDALHKTDPNLTVFNNV
FT                   VTSRPYTIEILQQALTFANEKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTMTARNTML
FT                   TVFSRQTDKQYYMNQQRTQSAREYDTNVLKPFQEVLNDPAPKKLIIVHLLGTHIKYKYR
FT                   YPENQGKFDGNTDHVPPGLNAEELESYNDYDNANLYNDHVVASLIKDFKAADPNGFLVY
FT                   FSDHGEEVYDTPPHKTQGRNEDNPTRHMYTIPFLLWTSEKWQATHPRDFSQDVDRKYSL
FT                   AELIHTWSDLAGLSYDGYDPTRSVVNPQFKETTRWIGNPYKKNALIDYDTLPYGDQVGN
FT                   Q"
FT   gene            complement(291460..294111)
FT                   /locus_tag="CR539_01495"
FT   CDS_pept        complement(291460..294111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01495"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QIY7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:E2QIY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415102.1"
FT                   /protein_id="AUJ94236.1"
FT                   /translation="MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSS
FT                   RAGNDANRQELLTTLQNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVI
FT                   ARTLRKLKNQPELSEDTIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDN
FT                   KDIADYEHNQLMRRLRQLIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLR
FT                   ELNEQLEENLGYKLPVEFVPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLK
FT                   DIQVLVSELSMVEATPELLALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELP
FT                   KPEGLLTQNEELWEPLYACYQSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQES
FT                   TRHTEALGELTRYLGIGDYESWSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTC
FT                   QVIAEAPQGSIAAYVISMAKTPSDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDV
FT                   MTQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELT
FT                   LFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYT
FT                   GAILEANLLPPPEPKESWRRIMDELSVISCDLYRGYVRENKDFVPYFRSATPEQELGKL
FT                   PLGSRPAKRRPTGGVESLRAIPWIFAWTQNRLMLPAWLGAGTALQKVVEDGKQSELEAM
FT                   CRDWPFFSTRLGMLEMVFAKADLWLAEYYDQRLVDKALWPLGKELRNLQEEDIKVVLAI
FT                   ANDSHLMADLPWIAESIQLRNIYTDPLNVLQAELLHRSRQAEKEGQEPDPRVEQALMVT
FT                   IAGIAAGMRNTG"
FT   gene            complement(294586..295737)
FT                   /locus_tag="CR539_01500"
FT   CDS_pept        complement(294586..295737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01500"
FT                   /product="acetylornithine deacetylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MU42"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MU42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005122768.1"
FT                   /protein_id="AUJ94237.1"
FT                   /translation="MKNKLPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKN
FT                   LGFNVEVQPVPGTRNKFNMLASTGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGK
FT                   LYGLGTADMKGFFAFILDALRDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPD
FT                   CAIIGEPTSLQPVRAHKGHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDN
FT                   LKERYHYDAFTVPYPTLNLGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDA
FT                   LAPVSERWPGRLTVDELHPPIPGYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL
FT                   CPTLVLGPGSINQAHQPDEYLETRFIKPTRELITQVIHHFCWH"
FT   gene            295891..296895
FT                   /locus_tag="CR539_01505"
FT   CDS_pept        295891..296895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01505"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT65"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT65"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005122770.1"
FT                   /protein_id="AUJ94238.1"
FT                   /translation="MLNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLI
FT                   SDLHPQLKGIVDLPLQPMSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSG
FT                   AFRVNDATFYEKYYGFTHQYPELLEQAAYGLAEWCGNKLKEANLIAVPGCYPTAAQLAL
FT                   KPLIDADLLDLNQWPVINATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHL
FT                   GADVIFTPHLGNFPRGILETITCRLKPGVTQAQVAQALQQAYAHKPLVRLYDKGVPALK
FT                   NVVGLPFCDIGFAVQGEHLIIVATEDNLLKGATAQAVQCANIRFGYAETQSLI"
FT   gene            296903..297679
FT                   /gene="argB"
FT                   /locus_tag="CR539_01510"
FT   CDS_pept        296903..297679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="CR539_01510"
FT                   /product="acetylglutamate kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSZ9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSZ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415105.6"
FT                   /protein_id="AUJ94239.1"
FT                   /translation="MMNPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGG
FT                   CVVDELMKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFL
FT                   GDGDSVKVTQLDEELGHVGLAQPGSPKLINTLLENGYLPVVSSIGVTDEGQLMNVNADQ
FT                   AATALAATLGADLILLSDVSGILDGKGQRITEMTAAKAEQLIEQGIITDGMIVKVNAAL
FT                   DAARTLGRPVDIASWRHAEQLPALFNGMPMGTRILA"
FT   gene            297740..299113
FT                   /locus_tag="CR539_01515"
FT   CDS_pept        297740..299113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01515"
FT                   /product="argininosuccinate lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XTD7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XTD7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418395.1"
FT                   /protein_id="AUJ94240.1"
FT                   /translation="MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALV
FT                   TVGVLTAEEQAQLEEALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLH
FT                   TGRSRNDQVATDLKLWCKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASAT
FT                   RNSLDSVSDRDHVLELLSAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLH
FT                   MAALVLDGIQVKRPRCQEAAQQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQG
FT                   KPLEDLPLDELQKFSPVIGEDVYPILSLQSCLDKRAAKGGVSPQQVAQAIAFAQARLG"
FT   gene            299381..300298
FT                   /locus_tag="CR539_01520"
FT   CDS_pept        299381..300298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01520"
FT                   /product="DNA-binding transcriptional regulator OxyR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIJ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIJ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312917.1"
FT                   /protein_id="AUJ94241.1"
FT                   /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGV
FT                   MLLERTSRKVLFTQAGMLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPY
FT                   LLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPLFDE
FT                   PMLLAIYEDHPWANRECVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSR
FT                   YEQLAEAIRARMDGHFDKVLKQAV"
FT   gene            complement(300281..301681)
FT                   /locus_tag="CR539_01525"
FT   CDS_pept        complement(300281..301681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01525"
FT                   /product="Si-specific NAD(P)(+) transhydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YJW2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YJW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418397.2"
FT                   /protein_id="AUJ94242.1"
FT                   /translation="MPHSYDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLRSSFADILNHADNVINQQTRMRQGF
FT                   YERNHCEILQGNARFVDEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTHPRI
FT                   YDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDS
FT                   LSYHFWNSGVVIRHNEEYEKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQ
FT                   NIGLETDSRGQLKVNSMYQTAQPHVYAVGDVIGYPSLASAAYDQGRIAAQALVKGEATA
FT                   HLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKIL
FT                   FHRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   gene            302011..303177
FT                   /locus_tag="CR539_01530"
FT   CDS_pept        302011..303177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01530"
FT                   /product="amidohydrolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XTU4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XTU4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312919.1"
FT                   /protein_id="AUJ94243.1"
FT                   /translation="MIEHYIRGFEEELREIRHQIHENPELGLQEFKTSALVAEKLRQWG
FT                   YEVEQGLATTGIVATLKVGDGEKSIGLRADMDALPIYENSGKPWASKHPGLMHACGHDG
FT                   HTTILLGAARYFAETRRFNGTLRLIFQPAEEMINGGEIMVKEGLFDHFPCDVIFGMHNM
FT                   PGLPVGKFYFQPGALMASMDQFHITVRGCGGHGAIPHKAIDPVLVAAHITTALQSIVSR
FT                   NVDPLEAAVITVGSIVAGEAANVIPDSAEMKISVRSLSRDTRQLLLTRIPALAQAQAAS
FT                   FGATAEVTHVNGTPVLVNDEEMARFAWQVACKTFGEERAEFGIKPLMGSEDFSFMLEAQ
FT                   PKGGFLLFGNGDVGEGSCMVHNPGYDFNDASLVPASSYWGALVEAWLQ"
FT   gene            303220..304536
FT                   /locus_tag="CR539_01535"
FT   CDS_pept        303220..304536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01535"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K3V911"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3V911"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312920.1"
FT                   /protein_id="AUJ94244.1"
FT                   /translation="MTAIVNETVSVKKKPSGRRVIFASAFGNALEFFDFGVYNFFVVYI
FT                   STLFFPPSADKNVALLLAFATFGVSFFMRPLGGIIVGAWADRFGRKPAMVFTIALMSLG
FT                   TLMIGIAPTYETAGYWGTATLVLARLIQGVAAGGEVGASMSLLVESAPANRRGFYSSWS
FT                   LATQGLATTFGGVVALGLSAWLPFATGSETVMAEWGWRVPFFIGVLLAPVGCWLRLSLE
FT                   NDVPEPAHNKKAAASESAFSLLMQHKATIANGILLAIGSTVATYISLFYYGTWAAKYLG
FT                   MNQNYSHAAMLLAGVITFVGALLVGMLCDSVGRKKLILISRVMVLICSWPSFWLLVNYP
FT                   SPGMLLTVVFVMVSFTTLGGVPVMLLISELLPKRIRALGFALVYSIGVAIFGGFAQYFA
FT                   TQSIVLLDSLTAPAWYLGGGTLLSMLALLYVKEPAKELQ"
FT   gene            304643..305290
FT                   /locus_tag="CR539_01540"
FT   CDS_pept        304643..305290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01540"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A094WHT8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A094WHT8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418398.2"
FT                   /protein_id="AUJ98136.1"
FT                   /translation="MGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAP
FT                   TSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPN
FT                   AFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVTIVFS
FT                   AGAEALDVGVEQRRQLEERLVLQLRMISKGAYYWYRREQEKTAIIPGNVKDE"
FT   gene            305290..305649
FT                   /locus_tag="CR539_01545"
FT   CDS_pept        305290..305649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01545"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIH7"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312922.1"
FT                   /protein_id="AUJ94245.1"
FT                   /translation="MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVL
FT                   TVYCLHQRYLNRTMPVGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVF
FT                   WIGAKMRNRKQEVAE"
FT   gene            complement(305689..306789)
FT                   /gene="trmA"
FT                   /locus_tag="CR539_01550"
FT   CDS_pept        complement(305689..306789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="CR539_01550"
FT                   /product="tRNA (uridine(54)-C5)-methyltransferase TrmA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIH2"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIH2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312923.1"
FT                   /protein_id="AUJ94246.1"
FT                   /translation="MTPEHLPTEQYEAQLAEKVVRLQSMMAPFSDLVPEVFRSPVSHYR
FT                   MRAEFRIWHDGDDLYHIIFDQQTKSRIRVDSFPAASELINQLMTAMIAGVRNNPVLRHK
FT                   LFQIDYLTTLSNQAVVSLLYHKKLDDEWRQEAEALRDALRAQNLNVHLIGRATKTKIAL
FT                   DQDYIDERLPVAGKEMIYRQVENSFTQPNAAMNIQMLEWALDVTKGSKGDLLELYCGNG
FT                   NFSLALARNFDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMAAEEFTQAMNGVREFN
FT                   RLQGIDLKSYQCETIFVDPPRSGLDSETEKMVQAYPRILYISCNPETLCKNLETLSQTH
FT                   KVERLALFDQFPYTHHMECGVLLTAK"
FT   regulatory      306903..307093
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00174"
FT                   /regulatory_class="riboswitch"
FT   gene            307158..309041
FT                   /gene="btuB"
FT                   /locus_tag="CR539_01555"
FT   CDS_pept        307158..309041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuB"
FT                   /locus_tag="CR539_01555"
FT                   /product="TonB-dependent vitamin B12 receptor BtuB"
FT                   /note="involved in the active translocation of vitamin B12
FT                   (cyanocobalamin) across the outer membrane to the
FT                   periplasmic space; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MU52"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MU52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016151285.1"
FT                   /protein_id="AUJ94247.1"
FT                   /translation="MIKKASLLTACSVTAFSAWAQDTSPDTLVVTANRFQQPVNTVLAP
FT                   TDIVTREDIQRWQSKDLNDIMSHLPGVNISQTGGMGTSSSLYVRGTESRHVLVLIDGVP
FT                   MARAGIDNAIDISQFPVSLVQRVEYIRGPRSAVYGSGAIGGVVNIITMSNDEKAQINAG
FT                   MGTNGYQAYDGVINKRFGDTMVTVAGAYQTTKGFNIQPGSPYSGDSDRDGYRNKLFWGG
FT                   LQHKFNDNFSGFFRGYSYTANNDYDQGSMYGSATGNEEAQNYNQSWDTGLRYNSGIYSS
FT                   QLIANYQRLKNYNYTNNLGRYAGDATLDDMEQRYIQWGNSIEVGHGAISGGIDWKQEKL
FT                   TSSSITKSDDYERDTTGLYLTGQQQISNVTLEASGREDHDEQFGWHGTWQTAAGWEFID
FT                   GYQATLSYGTSFLSPSLGQQYGAARFASIYGPGIAANPNLKPEESKQWEIGIEGVTGTL
FT                   DWRLSGYRYEIQNLIDYKSINNVNQYINVKSATIKGLEWTGNITTGPVEHRLTLQYVDP
FT                   RDDETDKVLYRRAKQQVKYELTGQAYGFEWDVSYQYIGQRYDNAYDETSGSSHTVKLGG
FT                   VSLWDLAVAYPVTSHLTVRGKIANLFDKDYETVYGYQTAGREYTLSGSYTF"
FT   gene            308986..309843
FT                   /locus_tag="CR539_01560"
FT   CDS_pept        308986..309843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01560"
FT                   /product="glutamate racemase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K5WEL4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K5WEL4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312925.2"
FT                   /protein_id="AUJ94248.1"
FT                   /translation="MATKLQDGNTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLP
FT                   DLHYIYAFDNVAFPYGEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALR
FT                   EKFDFPVVGVVPAIKPAARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSA
FT                   EMVELAEAKLHGEDVSLDALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGT
FT                   RLVDSGAAIARRTAWLLEHEAPDAKSADANIAFCMAMTPEAEQLLPVLQRYGFETLEKL
FT                   AVLG"
FT   gene            310215..311770
FT                   /locus_tag="CR539_01565"
FT   rRNA            310215..311770
FT                   /locus_tag="CR539_01565"
FT                   /product="16S ribosomal RNA"
FT   gene            311844..311919
FT                   /locus_tag="CR539_01570"
FT   tRNA            311844..311919
FT                   /locus_tag="CR539_01570"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:311878..311880,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            312104..315027
FT                   /locus_tag="CR539_01575"
FT   rRNA            312104..315027
FT                   /locus_tag="CR539_01575"
FT                   /product="23S ribosomal RNA"
FT   gene            315111..315226
FT                   /gene="rrf"
FT                   /locus_tag="CR539_01580"
FT   rRNA            315111..315226
FT                   /gene="rrf"
FT                   /locus_tag="CR539_01580"
FT                   /product="5S ribosomal RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00001"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            315363..316391
FT                   /gene="murB"
FT                   /locus_tag="CR539_01585"
FT   CDS_pept        315363..316391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="CR539_01585"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="catalyzes the reduction of UDP-N-acetylglucosamine
FT                   enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
FT                   biosynthesis; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XRL2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XRL2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312926.1"
FT                   /protein_id="AUJ94249.1"
FT                   /translation="MNHSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQHATAEGQPVLI
FT                   LGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGL
FT                   ENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDCVELATGKQVRLTAKECRFGYRDSIF
FT                   KHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLEPTTVTPQQVFNAVCHMRTTKLPDPK
FT                   VNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQMGG
FT                   AAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVET
FT                   IS"
FT   gene            316388..317353
FT                   /locus_tag="CR539_01590"
FT   CDS_pept        316388..317353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01590"
FT                   /product="bifunctional biotin--[acetyl-CoA-carboxylase]
FT                   synthetase/biotin operon repressor"
FT                   /EC_number="6.3.4.15"
FT                   /note="catalyzes the formation of biotinyl-5'-AMP, also
FT                   acts as a transcriptional repressor of the biotin operon;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUJ9"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUJ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312927.1"
FT                   /protein_id="AUJ94250.1"
FT                   /translation="MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRD
FT                   WGVDVFTVPGKGYSLPEPIQLLNAEQILGQLDGGSVTVLPVIDSTNQYLLDRIGELKSG
FT                   DACVAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRK
FT                   LGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQG
FT                   WITLQEEGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIG
FT                   DKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEK"
FT   gene            complement(317382..318332)
FT                   /locus_tag="CR539_01595"
FT   CDS_pept        complement(317382..318332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01595"
FT                   /product="type I pantothenate kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIE8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIE8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312928.1"
FT                   /protein_id="AUJ94251.1"
FT                   /translation="MSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINED
FT                   LSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTT
FT                   ARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDL
FT                   KSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDF
FT                   VDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEI
FT                   NWLNLKQNILPTRERASLILTKSANHAVEEVRLRK"
FT   gene            318315..318509
FT                   /locus_tag="CR539_01600"
FT   CDS_pept        318315..318509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01600"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A148HG83"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001353728.1"
FT                   /protein_id="AUJ94252.1"
FT                   /translation="MLFYTHKHVSGGHSSIGKAIFAMARHSSVEWVNGQEGNTRWGGII
FT                   RKNLSQEAIVEKQCDRYSI"
FT   gene            complement(318519..318674)
FT                   /locus_tag="CR539_01605"
FT   CDS_pept        complement(318519..318674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01605"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIE2"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312929.1"
FT                   /protein_id="AUJ94253.1"
FT                   /translation="METCEFMQLKNCIICFIGHILCDTMKKQPNGGQISTLFQHHCAQQ
FT                   CAPAKP"
FT   gene            318694..318769
FT                   /locus_tag="CR539_01610"
FT   tRNA            318694..318769
FT                   /locus_tag="CR539_01610"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:318727..318729,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            318778..318862
FT                   /locus_tag="CR539_01615"
FT   tRNA            318778..318862
FT                   /locus_tag="CR539_01615"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:318812..318814,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            318979..319053
FT                   /locus_tag="CR539_01620"
FT   tRNA            318979..319053
FT                   /locus_tag="CR539_01620"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:319012..319014,aa:Gly,seq:tcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            319060..319135
FT                   /locus_tag="CR539_01625"
FT   tRNA            319060..319135
FT                   /locus_tag="CR539_01625"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:319093..319095,aa:Thr,seq:ggt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            319250..320434
FT                   /gene="tuf"
FT                   /locus_tag="CR539_01630"
FT   CDS_pept        319250..320434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CR539_01630"
FT                   /product="translation elongation factor EF-Tu 2"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QJ06"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E2QJ06"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312930.1"
FT                   /protein_id="AUJ94254.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREEIERGQVLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLS"
FT   gene            320664..321047
FT                   /locus_tag="CR539_01635"
FT   CDS_pept        320664..321047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01635"
FT                   /product="protein translocase subunit SecE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SID7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C3SID7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_007665874.1"
FT                   /protein_id="AUJ94255.1"
FT                   /translation="MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRA
FT                   LAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            321049..321594
FT                   /gene="nusG"
FT                   /locus_tag="CR539_01640"
FT   CDS_pept        321049..321594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CR539_01640"
FT                   /product="transcription termination/antitermination protein
FT                   NusG"
FT                   /note="Modulates Rho-dependent transcription termination;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SID2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C3SID2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005280494.1"
FT                   /protein_id="AUJ94256.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKA"
FT   gene            321753..322181
FT                   /gene="rplK"
FT                   /locus_tag="CR539_01645"
FT   CDS_pept        321753..322181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CR539_01645"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIC7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312933.1"
FT                   /protein_id="AUJ94257.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRA
FT                   QLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED"
FT   gene            322185..322889
FT                   /locus_tag="CR539_01650"
FT   CDS_pept        322185..322889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01650"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIC2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIC2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312934.1"
FT                   /protein_id="AUJ94258.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGV
FT                   AVDQAGLSASVN"
FT   gene            complement(322956..323165)
FT                   /pseudo
FT                   /locus_tag="CR539_01655"
FT   CDS_pept        complement(322956..323165)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01655"
FT                   /product="transcriptional regulator"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004146311.1"
FT   gene            323181..323678
FT                   /locus_tag="CR539_01660"
FT   CDS_pept        323181..323678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01660"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIB7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIB7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_002438625.1"
FT                   /protein_id="AUJ94259.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANA
FT                   KFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKE
FT                   AA"
FT   gene            323745..324110
FT                   /locus_tag="CR539_01665"
FT   CDS_pept        323745..324110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01665"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIB2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005122872.1"
FT                   /protein_id="AUJ94260.1"
FT                   /translation="MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGP
FT                   VEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDA
FT                   EALKKALEEAGAEVEVK"
FT   gene            324430..328458
FT                   /gene="rpoB"
FT                   /locus_tag="CR539_01670"
FT   CDS_pept        324430..328458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CR539_01670"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIA7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312937.1"
FT                   /protein_id="AUJ94261.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILD
FT                   LFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTND
FT                   LDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKL
FT                   DKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGADVRQKVDLSTFSD
FT                   EEVMRLAENLRKGMPIATPVFDGAKEAEIKELLKLGDLPTSGQIRLYDGRTGEQFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            328535..332758
FT                   /gene="rpoC"
FT                   /locus_tag="CR539_01675"
FT   CDS_pept        328535..332758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CR539_01675"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SIA2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C3SIA2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312938.1"
FT                   /protein_id="AUJ94262.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERLYRSGLASLHARVKVRITEYEKDANGELVAKTSLKDTTVGR
FT                   AILWMIVPKGLPYSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKHEIISEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVS
FT                   KAMMDNLQTETVINRDGQEEKQVSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHEGIMMTPVIEGGDVKEPLRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDL
FT                   LEENSVDAVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITR
FT                   QTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIVSFG
FT                   KETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDGPEAPHDILRLRG
FT                   VHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSR
FT                   VKIANRELEANGKVGATYSRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPAAPQVTAEDASASLAELLNAGLG
FT                   GSDNE"
FT   gene            332971..333510
FT                   /locus_tag="CR539_01680"
FT   CDS_pept        332971..333510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01680"
FT                   /product="stationary phase growth adaptation protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A0C2DJ21"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418416.1"
FT                   /protein_id="AUJ94263.1"
FT                   /translation="MKQEVEKWRPFGHPDGDIRDLSFLDAHQAVYVQHHEGKEPLEYRF
FT                   WVTYSLHCFTKDYEHQTNEEKQSLMYHAPKESRPFCQHRYNLARIHLKRTILALPESNV
FT                   IHAGYGSYAVIEVDLNGGDKAFYFVAFRAFREKKKLRLHVTSAYPISEKQKGKSVKFFT
FT                   IAYNLLRNKQLPQPSK"
FT   gene            complement(333920..335053)
FT                   /locus_tag="CR539_01685"
FT   CDS_pept        complement(333920..335053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01685"
FT                   /product="2-iminoacetate synthase ThiH"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A240D950"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A240D950"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415127.1"
FT                   /protein_id="AUJ94264.1"
FT                   /translation="MKTFSDRWRQLDWDDIRLRINGKTAADVEWALNASQLTRDDMMAL
FT                   LSPAASGYLEQLAQRAQRLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIKRKT
FT                   LDEADIARESAAIREMGFEHLLLVTGEHQAKVGMDYFRRHLPALREQFSSLQMEVQPLA
FT                   EAEYAELKQLGLDGVMVYQETYHEATYARHHLKGKKQDFFWRLETPDRLGRAGIDKIGL
FT                   GALIGLSDNWRVDCYMVAEHLLWLQQHYWQSRYSVSFPRLRPCTGGIEPASIMDERQLV
FT                   QTICAFRLLAPEIELSLSTRESPWFRDRVIPLAINNVSAFSKTQPGGYADNHPELEQFS
FT                   PHDDRRPEAVAAALTAQGLQPVWKDWDSYLGRASQRP"
FT   gene            complement(335050..335820)
FT                   /locus_tag="CR539_01690"
FT   CDS_pept        complement(335050..335820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01690"
FT                   /product="thiazole synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A240D808"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A240D808"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312941.2"
FT                   /protein_id="AUJ94265.1"
FT                   /translation="MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRV
FT                   DLRQHNDAILEPLIAAGVTLLPNTSGAKTAEEAIFAAHLAREALGTNWLKLEIHPDARW
FT                   LLPDPIETLKAAETLVQQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLET
FT                   RAMLEIIIQQATVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVNMAKAFRL
FT                   AVEAGLLARQAGPGSRSYFAHATSPLTGFLEASV"
FT   gene            complement(335822..336022)
FT                   /locus_tag="CR539_01695"
FT   CDS_pept        complement(335822..336022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01695"
FT                   /product="sulfur carrier protein ThiS"
FT                   /note="with ThiF, ThiG, and ThiO catalyzes the formation of
FT                   the thiazole moiety of thiamine pyrophosphate; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:J7QYE2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415129.1"
FT                   /protein_id="AUJ94266.1"
FT                   /translation="MQILFNDQPMQCAAGQTVHELLEQLDQRQAGAALAINQQIVPREQ
FT                   WAQHIVQDGDQILLFQVIAGG"
FT   gene            complement(336006..336761)
FT                   /gene="thiF"
FT                   /locus_tag="CR539_01700"
FT   CDS_pept        complement(336006..336761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="CR539_01700"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024L9Q8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012731"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L9Q8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418420.4"
FT                   /protein_id="AUJ94267.1"
FT                   /translation="MNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAAL
FT                   YLAGAGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQ
FT                   QRLTGEALKDAVARADVVLDCTDNMATRQEINAACVALNTPLITASAVGFGGQLMVLTP
FT                   PWEQGCYRCLWPDNQEPERNCRTAGVVGPVVGVMGTLQALEAIKLLSGIETPAGELRLF
FT                   DGKSSQWRSLALRRASGCPVCGGSNADPV"
FT   gene            complement(336754..337389)
FT                   /locus_tag="CR539_01705"
FT   CDS_pept        complement(336754..337389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01705"
FT                   /product="thiamine phosphate synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT91"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT91"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312943.1"
FT                   /protein_id="AUJ94268.1"
FT                   /translation="MYQPDFPPVPFRLGLYPVVDSVQWIERLLDAGVRTLQLRIKDWRD
FT                   EEVEADVVAAIALGRRYNARLFINDYWRLAIKHQAYGVHLGQEDLQATDLNAIRAAGLR
FT                   LGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLEQLARHVERLADYPTVA
FT                   IGGISLARAPAVIATGVGSIAVVSAITQAADWRLATAQLLEIAGVGDE"
FT   gene            complement(337389..339284)
FT                   /locus_tag="CR539_01710"
FT   CDS_pept        complement(337389..339284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01710"
FT                   /product="phosphomethylpyrimidine synthase ThiC"
FT                   /note="catalyzes the formation of
FT                   4-amino-2-methyl-5-phosphomethylpyrimidine from
FT                   5-amino-1-(5-phospho-D-ribosyl)imidazole and
FT                   S-adenosyl-L-methionine in thiamine biosynthesis; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT32"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312944.1"
FT                   /protein_id="AUJ94269.1"
FT                   /translation="MSATKLTRREQRARAQHFIDTLEGTTFPNSKRIYITGTQPGVRVP
FT                   MREIQLSPTLIGGSKEQPQYEENEAIPVYDTSGPYGDPQIAINVQQGLAKLRQPWIDAR
FT                   GDTEELTVRSSDYTKARLADDGLDELRFSGVLTPKRAKAGRRVTQLHYARQGIITPEME
FT                   FIAIRENMGRERIRSEVLRHQHPGMSFGARLPENITAEFVRDEVAAGRAIIPANINHPE
FT                   SEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYIHETRE
FT                   WILRNSPVPIGTVPIYQALEKVNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHAGVLLRY
FT                   VPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSLGDGLRPG
FT                   SIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAP
FT                   FYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITY
FT                   KIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPFTARAYHDETLPQESGK
FT                   VAHFCSMCGPKFCSMKISQEVRDYAATQTIEMGMVDMSENFRARGGEIYLRKEEA"
FT   regulatory      complement(339365..339465)
FT                   /bound_moiety="thiamine pyrophosphate"
FT                   /note="TPP riboswitch; Derived by automated computational
FT                   analysis using gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00059"
FT                   /regulatory_class="riboswitch"
FT   gene            complement(339518..339994)
FT                   /locus_tag="CR539_01715"
FT   CDS_pept        complement(339518..339994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01715"
FT                   /product="sigma D regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SI67"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI67"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312945.1"
FT                   /protein_id="AUJ94270.1"
FT                   /translation="MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKES
FT                   YMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIM
FT                   DYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA"
FT   gene            340089..340862
FT                   /locus_tag="CR539_01720"
FT   CDS_pept        340089..340862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01720"
FT                   /product="NAD(+) diphosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2D0CLV4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2D0CLV4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312946.1"
FT                   /protein_id="AUJ94271.1"
FT                   /translation="MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQ
FT                   IGEWQGEPVWLIQQQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHE
FT                   MYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEV
FT                   GETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLE
FT                   ANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE"
FT   gene            340902..341966
FT                   /locus_tag="CR539_01725"
FT   CDS_pept        340902..341966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01725"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SI60"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI60"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418425.1"
FT                   /protein_id="AUJ94272.1"
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRYPLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTSPVT
FT                   CKADVDKLPIPDPEDELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTVIKKMMYADPQALHALLDKLAKSVTLYLNAQIKAGAQAVMIFDTWGGVLTGRDYQQF
FT                   SLYYMHKIVDGLLRENDGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTTDIADARRR
FT                   VGNKVALQGNMDPSMLYAPPARIEEEVATILAGFGHGEGHVFNLGHGIHQDVPPEHAGV
FT                   FVEAVHRLSEQYHR"
FT   gene            341976..342647
FT                   /locus_tag="CR539_01730"
FT   CDS_pept        341976..342647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01730"
FT                   /product="endonuclease V"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SI53"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI53"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312948.1"
FT                   /protein_id="AUJ94273.1"
FT                   /translation="MDLASLRAQQIELASSVIREDRLDKDPPDLIAGADVGFEQGGEVT
FT                   RAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEMLSQKPDLVFVDG
FT                   HGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGKFEPLSSEPGALAPLMDKGEQLAWVW
FT                   RSKARCNPLFIATGHRVSVDSALAWVQRCMKGYRLPEPTRWADAVASERPAFVRYTANQ
FT                   P"
FT   gene            342690..343280
FT                   /locus_tag="CR539_01735"
FT   CDS_pept        342690..343280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01735"
FT                   /product="DUF416 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI50"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418427.1"
FT                   /protein_id="AUJ94274.1"
FT                   /translation="MLQNPIHLRLERLESWQHVTFMACLCERMYPNYAMFCQQTGFGDG
FT                   QIYRRILDLIWETLTVKDAKVNFDSQLEKFEEAIPSADDFDLYGVYPAIDACVALSELV
FT                   HSRLSGETLEHAVEVSKTSITTVAMLEMTQAGREMSDEELKENPAVEQEWDIQWEIFRL
FT                   LAECEERDIELIKGLRADLREAGESNIGIIFQQ"
FT   gene            343467..343739
FT                   /locus_tag="CR539_01740"
FT   CDS_pept        343467..343739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01740"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SI42"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_017460010.1"
FT                   /protein_id="AUJ94275.1"
FT                   /translation="MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   gene            343752..344447
FT                   /locus_tag="CR539_01745"
FT   CDS_pept        343752..344447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01745"
FT                   /product="DUF1481 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:C3SI37"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415139.1"
FT                   /protein_id="AUJ98137.1"
FT                   /translation="MNSFNEGVVSPLLSFWRRSLMLAGALFLTACSHNSSLPPFTASGF
FT                   AEDQGAVRIWRKDSGDNVHLLAVFSPWRSGDTTTREYRWQGDNLTLININVYSKPPVNI
FT                   RARFDDRGDLSFMQRESDGEKQQLSNDQIDLYRYRADQIRQISDALRQGRVVLRQGRWH
FT                   AMEQTVTTCEGQTIKPDLDSQAIAHIERRQSRSSVDVSVAWLEAPEGSQLLLVANSDFC
FT                   RWQPNEKTF"
FT   gene            complement(344449..344868)
FT                   /locus_tag="CR539_01750"
FT   CDS_pept        complement(344449..344868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01750"
FT                   /product="zinc resistance-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:W8T6Y5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312952.2"
FT                   /protein_id="AUJ94276.1"
FT                   /translation="MKRNTKIALVMMALSAMAMGSTSAFAHGGHGMWQQNAAPLTSEQQ
FT                   TAWQKIHNDFYAQSSALQQQLVTKRYEYNALLAANPPDSSKINAVAKEMENLRQSLDEL
FT                   RVKRDIAMAEAGIPRGTGMGYGGCGGGGHMGMGHW"
FT   gene            complement(344871..344999)
FT                   /locus_tag="CR539_01755"
FT   CDS_pept        complement(344871..344999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01755"
FT                   /product="zinc resistance-associated protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUN8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001326197.1"
FT                   /protein_id="AUJ94277.1"
FT                   /translation="MTRYPPQASHFYSFIMPDYPSYQRFIVGTEDAIPEVRQPLED"
FT   gene            345106..346482
FT                   /locus_tag="CR539_01760"
FT   CDS_pept        345106..346482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01760"
FT                   /product="two-component system sensor histidine kinase
FT                   ZraS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTA2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415141.1"
FT                   /protein_id="AUJ94278.1"
FT                   /translation="MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRETAAA
FT                   RQTLLEKGSVLIRALESGSRVGMGMRMHHAQQQALLEEMAGQPGVRWFAVTDEQGTIVM
FT                   HSNSGMVGKQLYSPQEMQQLHPEDEEAWRRIDSADGEPVLEIYRQFQPMFAAGMHRMRH
FT                   MQQYAATPQAIFIAFDASNIVSAEDREQRNTLIILFALATVLLASVLSFFWYRRYLRSR
FT                   QLLQDEMKRKEKLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMA
FT                   KEADRLNRVVSELLELVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLCFTANDTL
FT                   PEIQADPDRLTQVLLNLYLNAILAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLE
FT                   AIFTPYFTTKAEGTGLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPVNITRKDPQG
FT                   "
FT   gene            346479..347804
FT                   /locus_tag="CR539_01765"
FT   CDS_pept        346479..347804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01765"
FT                   /product="DNA-binding response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085PAI8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PAI8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418432.1"
FT                   /protein_id="AUJ94279.1"
FT                   /translation="MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQV
FT                   REQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYL
FT                   IKPLDFDNLQATLEKALAHTHSIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEA
FT                   TVLIHGDSGTGKELVARAIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGAD
FT                   KRREGRFVEADGGTLFLDEIGDISPMMQVRLLRAIQEREVQRVGSNQTISVDVRLIAAT
FT                   HRDLAAEVNAGRFRQDLYYRLNVVAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKG
FT                   FTPQAMDLLIHYDWPGNIRELENAVERAVVLLTGEYISERELPLAIAGTPIPLGQSQDI
FT                   QPLVEVEKEVILAALEKTGGNKTEAARQLGITRKTLLAKLSR"
FT   gene            complement(347801..349090)
FT                   /locus_tag="CR539_01770"
FT   CDS_pept        complement(347801..349090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01770"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUM2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418433.1"
FT                   /protein_id="AUJ94280.1"
FT                   /translation="MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQN
FT                   VAIGVTDIPALLDFAQNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGS
FT                   KAFTKDFLARHKIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEE
FT                   AEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKD
FT                   TGPNTGGMGAYSPAPVVTDEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGN
FT                   PKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGG
FT                   YPGDYRTGDVIHGLPLEEVADGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQK
FT                   RAYALMTDIHWDDCFCRKDIGWRAIEREQN"
FT   gene            complement(349102..350691)
FT                   /gene="purH"
FT                   /locus_tag="CR539_01775"
FT   CDS_pept        complement(349102..350691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CR539_01775"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="involved in de novo purine biosynthesis; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUM8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUM8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005132841.1"
FT                   /protein_id="AUJ94281.1"
FT                   /translation="MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLLA
FT                   EKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEEHQIQPIDMVVVN
FT                   LYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYDAIIKEMDDN
FT                   EGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKEAAGRFPRTLNLNFIK
FT                   KQDMRYGENSHQQAAFYIEENVKEASVATATQVQGKALSYNNIADTDAALECVKEFAEP
FT                   ACVIVKHANPCGVAIGNSILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAIISRQFV
FT                   EVIIAPSASEEALTITAAKQNVRVLTCGQWGERVPGLDFKRVNGGLLVQDRDLGMVGAE
FT                   ELRVVTQRQPTEQELRDALFCWKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVKGSSMASDAFFPFRDGIDAAAAAGVTCVIQPGGSIRDDEVIAAADEHGI
FT                   AMLFTDMRHFRH"
FT   gene            complement(350645..350830)
FT                   /pseudo
FT                   /locus_tag="CR539_01780"
FT   CDS_pept        complement(350645..350830)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01780"
FT                   /product="hypothetical protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_019725181.1"
FT   gene            351306..352861
FT                   /locus_tag="CR539_01785"
FT   rRNA            351306..352861
FT                   /locus_tag="CR539_01785"
FT                   /product="16S ribosomal RNA"
FT   gene            352935..353010
FT                   /locus_tag="CR539_01790"
FT   tRNA            352935..353010
FT                   /locus_tag="CR539_01790"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:352969..352971,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            353195..356118
FT                   /locus_tag="CR539_01795"
FT   rRNA            353195..356118
FT                   /locus_tag="CR539_01795"
FT                   /product="23S ribosomal RNA"
FT   gene            356202..356317
FT                   /gene="rrf"
FT                   /locus_tag="CR539_01800"
FT   rRNA            356202..356317
FT                   /gene="rrf"
FT                   /locus_tag="CR539_01800"
FT                   /product="5S ribosomal RNA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: cmsearch."
FT                   /inference="COORDINATES:nucleotide motif:Rfam:12.0:RF00001"
FT                   /inference="COORDINATES:profile:INFERNAL:1.1.1"
FT   gene            complement(356434..356877)
FT                   /locus_tag="CR539_01805"
FT   CDS_pept        complement(356434..356877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01805"
FT                   /product="acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSX0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSX0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312957.1"
FT                   /protein_id="AUJ94282.1"
FT                   /translation="MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRAELEELVRS
FT                   FLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDPDVCGCGVGRMLVEHALSMAPELTT
FT                   NVNEQNEQAVGFYKKVCFKVTGRSEVDDLGKPYPLLNLAYVGE"
FT   gene            357034..357963
FT                   /locus_tag="CR539_01810"
FT   CDS_pept        357034..357963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01810"
FT                   /product="homoserine O-succinyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUL0"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUL0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005132837.1"
FT                   /protein_id="AUJ94283.1"
FT                   /translation="MPIRVPDELPAVNFLREENVFVMTTSRASGQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPAEHLNNFYCNFEDIQDQNFDGLI
FT                   VTGAPLGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDK
FT                   LSGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLF
FT                   ASKDKRIAFVTGHPEYDAQTLAQEYFRDVEAGLKPDVPYNYFPHNDPQNKPRASWRSHG
FT                   NLLFTNWLNYYVYQITPYDLRHMNPTLD"
FT   gene            358232..359833
FT                   /locus_tag="CR539_01815"
FT   CDS_pept        358232..359833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01815"
FT                   /product="malate synthase A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTB5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTB5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415147.1"
FT                   /protein_id="AUJ94284.1"
FT                   /translation="MTEQVTTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRN
FT                   KLLAARIQQQQDIDNGTLPDFISETASIRDTDWKIRGIPADLQDRRVEITGPVERKMVI
FT                   NALNANVKVFMADFEDSLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVL
FT                   ICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEA
FT                   AWWREVFSYAEDRFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIF
FT                   SYIKTLKNYPDRVLPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEE
FT                   RNNQVLNKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAP
FT                   ITADQLLAPCDGERTEEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSI
FT                   WQWIHHQKTLSNGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAARLMEQITTS
FT                   DELIDFLTLPGYRLLA"
FT   gene            359863..361167
FT                   /locus_tag="CR539_01820"
FT   CDS_pept        359863..361167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01820"
FT                   /product="isocitrate lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0B1GN85"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1GN85"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312960.1"
FT                   /protein_id="AUJ94285.1"
FT                   /translation="MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTL
FT                   AQLGAAKMWRLLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAAS
FT                   MYPDQSLYPANSVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFG
FT                   GVLNAFELMKAMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADV
FT                   TGVPTLLVARTDADAADLITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAP
FT                   YADLVWCETSTPDLELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDNTIASFQQQL
FT                   SDMGYKFQFITLAGIHSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSH
FT                   QQEVGTGYFDKVTTIIQGGTSSVTALTGSTEESQF"
FT   gene            361351..363087
FT                   /locus_tag="CR539_01825"
FT   CDS_pept        361351..363087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01825"
FT                   /product="bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTG6"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTG6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312961.1"
FT                   /protein_id="AUJ94286.1"
FT                   /translation="MPRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEQADWHAVQQ
FT                   AMKNRIHLYDHHVGLVVEQLRCITNGQSTDAEFLLRVKEHYTRLLPDYPRFEIAESFFN
FT                   SVYCRLFDHRSLTPERLFIFSSQPERRFRTIPRPLAKDFHPDHGWESLLMRVISDLPLR
FT                   LRWQNKSRDIHYIIRHLTETLGPENLSKSHLQVANELFYRNKAAWLVGKLITPSGTLPF
FT                   LLPIHQTDDGELFIDTCLTTTAEASIVFGFARSYFMVYAPLPAALVEWLREILPGKTTA
FT                   ELYMAIGCQKHAKTESYREYLVYLQGCNEQFIEAPGIRGMVMLVFTLPGFDRVFKVIKD
FT                   RFAPQKEMSAAHVRACYQLVKEHDRVGRMADTQEFENFVLEKRHISPALMELLLQEAAE
FT                   KITDLGEQIVIRHLYIERRMVPLNIWLEQVEGQQLRDAIEEYGNAIRQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELASEPWYSVSPGDVFPEE
FT                   FRHWLCADPRIGPLFEEMHADLFRADYWRALQNRIREGHVEDVYAYRRRQRFSVQYGEM
FT                   LF"
FT   gene            complement(363056..365242)
FT                   /locus_tag="CR539_01830"
FT   CDS_pept        complement(363056..365242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01830"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR012927"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MU94"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312962.1"
FT                   /protein_id="AUJ94287.1"
FT                   /translation="MITRIPRSSFSVNINNTAQTNEHQNLSELFYKELEDKFSGKELAT
FT                   PLLKSFSENCRQNGRHIFSNKDFVIKFSTSVLQTDKKEITIINKNENTTLTQTIAPIFE
FT                   EYLMEILPQRSDALDKQKLNLNSDRKEKEFPRVKLNGQCYFPGRPQNRIVCRHIAAQYI
FT                   NDIYQNVNYKPHQDDYSSAEKFLTHFNKKCKNQTLALISSRPEGRCVAACGDFGLVMKA
FT                   YFDKMESNGISVMAAILLVDNHALTARLRIKNTTEGYTHYVVSVYDPNVTNDKIRIMSE
FT                   SKEDIKHYSLMDFMNVDYSLLKWSNDHVINQSVAIIPALPKEQLLMLKGSVDEITPPLS
FT                   PATMNLLMAIGQNHQLKQLMIQLQKMPELHRTEMLTAYNSINLPGLYLAINYGNADIVE
FT                   TIFNSLSEPGYEGLLSKKNLMHILEAKDKNGFSGLFLAISRKDKNVVTSILNALPKLAA
FT                   THHLDNEQVYKFLSAKNSTSSHVLYHVMANGDADMLNIVLDALPLLIRTCHLTKEQVLD
FT                   LLKAKDFYGCPGLYLAMQNGHSDIVKVILEALPSLAQEINISASDIVDLLTAKSLARDT
FT                   GLFMAMQRGHMNVINTIFNALPTLFNTFKFDKKNMKPLLLANNSNEYPGLFSAIQHKQQ
FT                   NVVEMVYLALSDHAHLFGFTAEDIMDFWQHKAPQKYSAFELAFELGQRVIAELILDTIN
FT                   KMAESFGFKDNPRYITEKNHMEALLKKASPHTVR"
FT   gene            complement(365559..366383)
FT                   /locus_tag="CR539_01835"
FT   CDS_pept        complement(365559..366383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01835"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TXB2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:W8TXB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418442.2"
FT                   /protein_id="AUJ94288.1"
FT                   /translation="MVAPIPAKRGRKPAVATAPATGQVQSLTRGLKLLEWIAESNGSVA
FT                   LTELAQQAGLPNSTTHRLLTTMQQQGFVRQVGELGHWAIGAHAFMVGSSFLQSRNLLAI
FT                   VHPILRNLMEESGETVNMAVLDQSDHEAIIIDQVQCTHLMRMSAPIGGKLPMHASGAGK
FT                   AFLAQLSEEQVTKLLHRKGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRC
FT                   LAACIFDEHREPFAAISISGPISRITDDRVTEFGAMVIKAAKEVTLAYGGMR"
FT   gene            366583..370266
FT                   /locus_tag="CR539_01840"
FT   CDS_pept        366583..370266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01840"
FT                   /product="methionine synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J2DAY9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J2DAY9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000096005.1"
FT                   /protein_id="AUJ94289.1"
FT                   /translation="MSSKVEQLRAQLNERILVLDGGMGTMIQSYRLNEADFRGERFADW
FT                   PCDLKGNNDLLVLSKPEVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEIN
FT                   FAAAKLARACADEWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLVAAY
FT                   RESTKALVEGGADLILIETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRT
FT                   LSGQTTEAFYNSLRHAEALTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAF
FT                   GEYDLDADTMAKQIREWAQAGFLNIVGGCCGTTPQHIAAMSRAVEGLAPRKLPEIPVAC
FT                   RLSGLEPLNIGDDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVENGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWDVIEKGLKCIQGKGIVNSIS
FT                   MKEGVDAFIHHAKLLRRYGAAVVVMAFDEQGQADTRARKIEICRRAYKILTEEVGFPPE
FT                   DIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVSFSFRGNDPVR
FT                   EAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRRDDGTERLLELA
FT                   EKYRGSKTDDTANAQQAEWRSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPIEVIE
FT                   GPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASKEQGKTNGKMVIAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPSLD
FT                   EMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALL
FT                   SDTQRDDFVARTRKEYETVRIQHGRKKPRTPPVTLEAARDNDFAFDWQAYTPPVAHRLG
FT                   VQEVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRLFKDANDMLDKLSA
FT                   EKTLNPRGVVGLFPANRVGDDIEIYRDETRTHVINVSHHLRQQTEKTGFANYCLADFVA
FT                   PKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMVKALADRLAEAFAEYLHERV
FT                   RKVYWGYAPNENLSNEELIRENYQGIRPAPGYPACPEHTEKATIWELLEVEKHTGMKLT
FT                   ESFAMWPGASVSGWYFSHPDSKYYAVAQIQRDQVEDYARRKGMSVSDVERWLAPNLGYD
FT                   AD"
FT   gene            370486..372117
FT                   /locus_tag="CR539_01845"
FT   CDS_pept        370486..372117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01845"
FT                   /product="transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QYH3"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/TrEMBL:J7QYH3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418444.1"
FT                   /protein_id="AUJ94290.1"
FT                   /translation="MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSRSVEKKP
FT                   LAFCAGIGVTALVQSSNATTMLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDL
FT                   SWLSPLLIFIGVIFFLGRKQSRAGQLGRVGIGLGLILLALELIVQAVTPITQANGVQVI
FT                   FASLTGDILLDALIGAMFAIISYSSLAAVLLTATLTAAGIISFPVALCLVIGANLGSGL
FT                   LAMLNNSAANAAARRVALGSLLFKLVGSLIILPFVHLLAETMGKLSLPKAELVIYFHVF
FT                   YNLVRCLVMLPFVDPMARFCKTIIRDEPELDTQLRPKHLDVSALDTPTLALANAARETL
FT                   RIGDAMEQMMEGLNKVMHGEPRQEKELRKLADDINVLYTAIKLYLARMPKEELAEEESR
FT                   RWAEIIEMSLNLEQASDIVERMGSEIADKSLAARRAFSLDGLKELDALYEQLLSNLKLA
FT                   MSVFFSGDVTSARRLRRSKHRFRILNRRYSHAHVDRLHQQNVQSIETSSLHLGLLGDMQ
FT                   RLNSLFCSVAYSVLEQPDEDEGRDEY"
FT   gene            complement(372207..372896)
FT                   /locus_tag="CR539_01850"
FT   CDS_pept        complement(372207..372896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01850"
FT                   /product="peptidase E"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A069FF26"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR023172"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A069FF26"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312966.1"
FT                   /protein_id="AUJ94291.1"
FT                   /translation="MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQT
FT                   WDDYTEKTAAVLAPLGVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLA
FT                   PITDVVKRGALYIGWSAGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALP
FT                   EGHKGETREQRIRELLVVAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVP
FT                   LEAGHRF"
FT   gene            complement(372968..373192)
FT                   /locus_tag="CR539_01855"
FT   CDS_pept        complement(372968..373192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01855"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A3VSX3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001331860.1"
FT                   /protein_id="AUJ94292.1"
FT                   /translation="MCTRRIKKHQRLKGRSNWWQSTHCLCRMRNKALFGLHNFENSIYC
FT                   SYLVGQVSVAHQAMLCLSSVSAPVQYVTS"
FT   gene            complement(373278..374507)
FT                   /locus_tag="CR539_01860"
FT   CDS_pept        complement(373278..374507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01860"
FT                   /product="L-sorbose 1-phosphate reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MSZ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MSZ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_312968.1"
FT                   /protein_id="AUJ94293.1"
FT                   /translation="MKTTALRLYGKRDLRLETFDLPEMQEEEILATVVTDSLCLSSWKE
FT                   ANLGENHKKVPDDVATNPIIIGHEFCGDILAVGKKWQHKFQPGQRYVIQANLQLPDRPD
FT                   CPGYSFPWVGGEATHVVIPNEVMEQDCLLAYDGETYFEGSLVEPLSCVIGAFNANYHLQ
FT                   EGSYNHTMGIRPQGRTLILGGTGPMGLLAIDYALHGPVNPSLLVITDTDNDKLSYARKH
FT                   YPSESQTLIHYLNATDAAFDTLMALSGGHGFDDIFVFVPNEGLVTLASSLLATDGCLNF
FT                   FAGPQDKHFSAPINFYDVHYAFTHYVGTSGGNTDDMRAAVKLIEEKKVQAAKVVTHILG
FT                   LNAAGETTLELPAVGGGKKLVYTGKYLPLTSLTQIQDQALAAILARHQGIWSGEAEQYL
FT                   LTHAEAISHD"
FT   gene            complement(374559..375413)
FT                   /locus_tag="CR539_01865"
FT   CDS_pept        complement(374559..375413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01865"
FT                   /product="PTS mannose transporter subunit IID"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1X1LNI8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1X1LNI8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415156.1"
FT                   /protein_id="AUJ94294.1"
FT                   /translation="MTNLTINGAIMEQRKITRSDLVSMFLRSNLQQASFNFERIHGLGF
FT                   CYDMIPAIKRLYPLKEDQVAALRRHLVFFNTTPAVCGPVIGVTAAMEEARANGAEIDDG
FT                   TINGIKVGLMGPLAGVGDPLVWGTLRPITAALGASLALSGNILGPLLFFFIFNAVRLAM
FT                   KWYGLQLGFRKGVNIVSDMGGNVLQKLTEGASILGLFVMGVLVTKWTSINVPLVVSQTH
FT                   AADGSTVTMTVQNILDQLCPGLLALGLTLLMVRLLNKKINPVWLIFALFGLGIIGNALG
FT                   FLS"
FT   gene            complement(375394..376191)
FT                   /locus_tag="CR539_01870"
FT   CDS_pept        complement(375394..376191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01870"
FT                   /product="PTS mannose/fructose/sorbose transporter subunit
FT                   IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; the IIC domain forms the PTS system
FT                   translocation channel and contains the specific
FT                   substrate-binding site; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT01"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT01"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_002884608.1"
FT                   /protein_id="AUJ94295.1"
FT                   /translation="MEISTLQIIAIFLFSCIAGMGSVLDEFQTHRPLIACTVIGLILGD
FT                   LKTGIILGGTLELIALGWMNVGAAQSPDSALASIISAILVIVGQQSIATGIAIALPVAA
FT                   AGQVLTVFARTITVVFQHAADKAAEEARFRTFDILHVSALGVQALRVAIPALIVSLFVS
FT                   ADMVSNMLNAIPEFVTRGLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDL
FT                   SLLAFGGVGVIMALVYIQLNPQWRKAEPQLQATASTALDQLDD"
FT   gene            complement(376257..376751)
FT                   /locus_tag="CR539_01875"
FT   CDS_pept        complement(376257..376751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01875"
FT                   /product="PTS system
FT                   mannose/fructose/N-acetylgalactosamine-transporter subunit
FT                   IIB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6Y2T1"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6Y2T1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313028.1"
FT                   /protein_id="AUJ94296.1"
FT                   /translation="MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRT
FT                   LLRQAAPPGMKVNVVNIEKAIAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNI
FT                   GGMAWRPGKKQLTKAVSLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIA
FT                   N"
FT   gene            complement(376751..377158)
FT                   /locus_tag="CR539_01880"
FT   CDS_pept        complement(376751..377158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01880"
FT                   /product="PTS sorbose transporter subunit IIA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUA4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUA4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313029.1"
FT                   /protein_id="AUJ94297.1"
FT                   /translation="MVNAIFCAHGKLACAMLESVQMVYGNTNVEAVEFVPGENAGDIVA
FT                   KLEKLVSIHNQDEWLITVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDS
FT                   MNVDELCEHLTQIAKQSCVVWKQLATTEEDF"
FT   gene            complement(377168..377974)
FT                   /locus_tag="CR539_01885"
FT   CDS_pept        complement(377168..377974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01885"
FT                   /product="sorbitol-6-phosphate 2-dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /note="Converts D-sorbitol-dphosphate to
FT                   D-fructose-6-phosphate; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTC3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTC3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415160.1"
FT                   /protein_id="AUJ94298.1"
FT                   /translation="MQTWLNLQDKIIIVTGGASGIGLAIVEELLAQGANVQMVDIHGGD
FT                   GQYEGHKGYQFWPTDISSAKEVNHTVAEIIQRFGRIDGLVNNAGVNFPRLLVDEKAPAG
FT                   KYELNEAVFEKMVNINQKGVFLMSQAVARQMVKQHDGVIVNVSSESGLEGSEGQSCYAA
FT                   TKAALNSFTRSWSKELGKHGIRVVGIAPGILEKTGLRTPEYEEALAWTRNITVEQLREG
FT                   YTKNAIPIGRAGRLAEVADFVCYLLSERASYITGVTTNIAGGKTRG"
FT   gene            complement(378044..378991)
FT                   /locus_tag="CR539_01890"
FT   CDS_pept        complement(378044..378991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01890"
FT                   /product="Cro/Cl family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A069F8X4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A069F8X4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415161.2"
FT                   /protein_id="AUJ94299.1"
FT                   /translation="MENSDDIRLIVKIAQLYYEQDMTQAQIARELGIYRTTISRLLKRG
FT                   RDQGIVTIAINYDYNENLWLEQQLKQKFGLKDVVVVSGNDEDEETQLAMMGLHGAQLLD
FT                   RLLEPGDIVGFSWGRAVSALVENLPQAGQSRQLICVPIIGGPSGKLESRYHVNTLTYSA
FT                   AAKLKGESHLADFPALLDNPLIRNGIMQSQHFKTISAYWDNLDVALVGIGSPAIRDGAN
FT                   WHAFYGGEESDDLNARQVAGDICSRFFDIHGAMVETNMSEKTLSIEMNKLKQARYSIGI
FT                   AMSEEKYSGIIGALRGKYINCLVTNSSTAELLLK"
FT   gene            379339..380211
FT                   /locus_tag="CR539_01895"
FT   CDS_pept        379339..380211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01895"
FT                   /product="23S rRNA pseudouridine synthase F"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHW7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHW7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313032.1"
FT                   /protein_id="AUJ94300.1"
FT                   /translation="MLPDSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQ
FT                   VKPGDVVKVNGQLIEPREAEDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRVFPIG
FT                   RLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPILGTV
FT                   TKKCKVKKEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSLSGIPLGEWR
FT                   DLTDDELIDLFKLIENSSSEAKPKAKAKPKTAGIKRPVVKMEKTAEKGGRPASNGKRFT
FT                   SPGRKKKGR"
FT   gene            complement(380212..380484)
FT                   /locus_tag="CR539_01900"
FT   CDS_pept        complement(380212..380484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01900"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR020317"
FT                   /db_xref="UniProtKB/TrEMBL:W8TXA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418447.1"
FT                   /protein_id="AUJ94301.1"
FT                   /translation="MALPRITQKEMTEREQRELKTLLDRARIAHGRVLTNSETNSIKKD
FT                   YIDKLMVEREAEAKKARQLKKKQAYKPDPEASFSWSANTSTRGRR"
FT   gene            complement(380583..381280)
FT                   /pseudo
FT                   /locus_tag="CR539_01905"
FT   CDS_pept        complement(380583..381280)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01905"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(381237..381335)
FT                   /pseudo
FT                   /locus_tag="CR539_01910"
FT   CDS_pept        complement(381237..381335)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01910"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            complement(381337..382029)
FT                   /pseudo
FT                   /locus_tag="CR539_01915"
FT   CDS_pept        complement(381337..382029)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01915"
FT                   /product="zeta toxin"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001666873.1"
FT   gene            complement(382174..383523)
FT                   /locus_tag="CR539_01920"
FT   CDS_pept        complement(382174..383523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01920"
FT                   /product="lysine-sensitive aspartokinase 3"
FT                   /EC_number="2.7.2.4"
FT                   /note="catalyzes the formation of 4-phospho-L-aspartate
FT                   from L-aspartate and ATP; functions in amino acid
FT                   biosynthesis; lysine sensitive; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A0F3WC60"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3WC60"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418448.1"
FT                   /protein_id="AUJ94302.1"
FT                   /translation="MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGIT
FT                   NLLVALAEGLEPGERFEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAAL
FT                   ATSPALTDELVSHGELMSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALA
FT                   ELAALQLLPRLNEGLVITQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTD
FT                   VPGIYTTDPRVVSAAKRIDEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKD
FT                   PRAGGTLVCNKTENPPLFRALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVD
FT                   LITTSEVSVALTLDTTGSTSTGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKA
FT                   CGVGKEVFGVLEPFNIRMICYGASSHNLCFLVPGEDAEQVVQKLHFNLFE"
FT   gene            383547..383848
FT                   /pseudo
FT                   /locus_tag="CR539_01925"
FT   CDS_pept        383547..383848
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01925"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014227529.1"
FT   gene            383845..384048
FT                   /locus_tag="CR539_01930"
FT   CDS_pept        383845..384048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01930"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3VJI4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001486276.1"
FT                   /protein_id="AUJ94303.1"
FT                   /translation="MSGAVVNDGVMRIFHPLLAVSSSANKCFTALRVYTQHYANGTKTI
FT                   TFFCDWRYNLPKSQFSKSEEYC"
FT   gene            384048..385697
FT                   /locus_tag="CR539_01935"
FT   CDS_pept        384048..385697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01935"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHV2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313035.1"
FT                   /protein_id="AUJ94304.1"
FT                   /translation="MKNINPTQTAAWQALQKHFDEMKDVTIADLFAKDGDRFSKFSATF
FT                   DDQMLVDYSKNRITEETLAKLQDLAKECDLAGAIKSMFSGEKINRTENRAVLHVALRNR
FT                   SNTPILVDGKDVMPEVNAVLEKMKTFSEAIISGEWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEVLKKVNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLKAAGDEKHVAKHFAALSTNAKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   VLSIGFDNFVELLSGAHAMDKHFSTTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFAAYFQQGNMESNGKYVDRNGNVVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMV
FT                   PCDFIAPAITHNPLSDHHQKLLSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLDYVV
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIFTFDQWGVELGKQLA
FT                   NRILPELKDDKEISSHDSSTNGLINRYKAWRG"
FT   gene            386210..386452
FT                   /locus_tag="CR539_01940"
FT   CDS_pept        386210..386452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01940"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR025858"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHU7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313036.1"
FT                   /protein_id="AUJ94305.1"
FT                   /translation="MKKVLYGIFAISALAATSAWAAPVQVGEAAGSAATSVSAGSSSAT
FT                   SVSTVSSAVGVALAATGGGDGSNTGTTTTTTTSTQ"
FT   gene            386566..387204
FT                   /locus_tag="CR539_01945"
FT   CDS_pept        386566..387204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01945"
FT                   /product="YjbF family lipoprotein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTI1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418451.4"
FT                   /protein_id="AUJ94306.1"
FT                   /translation="MKRPALILICLLLQACSATTKELGNSLWDSLFGTPGVQLTDDDIQ
FT                   NMPYASQYMQLNGGPQLFVVLAFAEDGQQKWVTQDQATLVTQHGRLVKTLLGGDNLIEV
FT                   NNLAADPLIKPAQIVDGATWTRTMGWTEYQQVRYATARSVFKWDSTGTVKVGSDETAVR
FT                   VLDEEVSTDQARWHNRYWIDSEGQIRQSEQYLGADYFPVKTTLIKAAKQ"
FT   gene            387201..387938
FT                   /locus_tag="CR539_01950"
FT   CDS_pept        387201..387938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01950"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUB5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313038.1"
FT                   /protein_id="AUJ94307.1"
FT                   /translation="MIKQTFVALLLSVGASSVFAAGTVKVFSNGSSEAKTLTGAEHLID
FT                   LVGQPRLANSWWPGAVISEELATAAALRQQQALLTRLAELAADSSADDAAAINALRQQI
FT                   QALKVTGRQKINLDPDIVRVAERANPPLQGNYTLWVGPPPSTVTLFGLISRPGYQPFTP
FT                   GRDVASYLSGQSLLSGADRSYAWVVYPDGRTQKAPVAYWNKRHVEPMPGSIIYVGLADS
FT                   IWSEMPDALNADILQTLTQRIPQ"
FT   gene            387938..390034
FT                   /locus_tag="CR539_01955"
FT   CDS_pept        387938..390034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01955"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H2UKU6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418453.1"
FT                   /protein_id="AUJ94308.1"
FT                   /translation="MKKRHLLSLLALGISTACYGETYPAPIGPSQSDFGGVGLLQTPTA
FT                   RMAREGELSLNYRDNDQYRYYSASVQLFPWLETTLRYTDVRTRQYSSVEAFSGDQTYKD
FT                   KAFDLKLRLWEESYWLPQVAVGARDIGGTGLFDAEYLVASKAWGPFDFTLGLGWGYLGT
FT                   SGNVKNPLCSASDKYCYRDNSYKQAGSIDGSQMFHGPASLFGGVEYQTPWQPLRLKLEY
FT                   EGNNYQQDFAGKLEQKSKFNVGAIYRVTDWADVNLSYERGNTFMFGVTLRTNFNDLRPS
FT                   YNDNARPQYQPQPQDAILQHSVVANQLTLLKYNAGLADPQIQAKGDTLYVTGEQVKYRD
FT                   SREGIIRANRIVMNDLPDGIKTIRVTENRLNMPQVTTETDVASLKNHLAGEPLGHETTL
FT                   AQKRVEPVVPQSTEQGWYIDKSRFDFHIDPVLNQSVGGPENFYMYQLGVMGTADLWLTD
FT                   HLLTTGSLFANLANNYDKFNYTNPPQDSHLPRVRTHVREYVQNDVYVNNLQANYFQHLG
FT                   NGFYGQVYGGYLETMFGGAGAEVLYRPLDSNWAFGLDANYVKQRDWRSAKDMMKFTDYS
FT                   VKTGHLTAYWTPSFAQDVLVKASVGQYLAGDKGGTLEIAKRFDSGVVVGGYATITNVSK
FT                   EEYGEGDFTKGVYVSVPLDLFSSGPTRSRAAIGWTPLTRDGGQQLGRKFQLYDMTSDRS
FT                   VNFR"
FT   gene            complement(390081..390359)
FT                   /locus_tag="CR539_01960"
FT   CDS_pept        complement(390081..390359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01960"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR031382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M2TYR8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_001165332.1"
FT                   /protein_id="AUJ94309.1"
FT                   /translation="MKHNLIKVVKMKPYFAALMLSVSVLPAYAGPLGTADKADLPQSNV
FT                   SSPMMAQSLRQPDLQPISTDRKTECFRLYTPDRKPGVNCVPDGSTGH"
FT   gene            390629..391039
FT                   /locus_tag="CR539_01965"
FT   CDS_pept        390629..391039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01965"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QJ61"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:E2QJ61"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418454.1"
FT                   /protein_id="AUJ94310.1"
FT                   /translation="MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADV
FT                   LFAPEQTSKYELVEGLVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVD
FT                   HKSPLDVLIYSAAILLLVITLWLCNSKRLKRE"
FT   gene            complement(391083..392558)
FT                   /locus_tag="CR539_01970"
FT   CDS_pept        complement(391083..392558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01970"
FT                   /product="D-xylose-proton symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHS4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHS4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313041.1"
FT                   /protein_id="AUJ94311.1"
FT                   /translation="MNTQYNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAP
FT                   QNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAW
FT                   PELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKL
FT                   VSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPE
FT                   SPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIG
FT                   VMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFG
FT                   RKPLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIF
FT                   PNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALF
FT                   MWKFVPETKGKTLEELEALWEPETKKTQQTATL"
FT   gene            complement(392930..393820)
FT                   /locus_tag="CR539_01975"
FT   CDS_pept        complement(392930..393820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01975"
FT                   /product="maltose ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHR7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001252048.1"
FT                   /protein_id="AUJ94312.1"
FT                   /translation="MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFA
FT                   TGSLIPEQISWDHWKLALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALST
FT                   TCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVI
FT                   FAYLGGIALHVWTIKGYFETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLA
FT                   QRWLVNGLTAGGVKG"
FT   gene            complement(393835..395379)
FT                   /locus_tag="CR539_01980"
FT   CDS_pept        complement(393835..395379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01980"
FT                   /product="maltose ABC transporter permease MalF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT13"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418457.1"
FT                   /protein_id="AUJ94313.1"
FT                   /translation="MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAIT
FT                   TLILSSAGLYIFANRKAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFER
FT                   AQEVLLDRSWQAGKTYNFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETT
FT                   AQPEGERVNLRVITQNRQALSDITAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNN
FT                   QSGVKYRPNNQIGFYQSITADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIF
FT                   VWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLF
FT                   NQSFGEINMMLSALFGVKPAWFSDPTTARTMLIIVNTWLGYPYMMILCMGLLKAIPDDL
FT                   YEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTT
FT                   TPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD"
FT   gene            complement(395533..396723)
FT                   /locus_tag="CR539_01985"
FT   CDS_pept        complement(395533..396723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01985"
FT                   /product="maltose-binding periplasmic protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHQ8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHQ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000695396.1"
FT                   /protein_id="AUJ94314.1"
FT                   /translation="MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNG
FT                   LAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   ITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDK
FT                   ELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLV
FT                   DLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS
FT                   KPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKD
FT                   PRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK"
FT   gene            complement(396816..396911)
FT                   /locus_tag="CR539_01990"
FT   CDS_pept        complement(396816..396911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01990"
FT                   /product="sugar ABC transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:J7R8X5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000922713.1"
FT                   /protein_id="AUJ94315.1"
FT                   /translation="MLLAKIVAILCAHLHITANSVTEITQSNGGA"
FT   gene            397088..398203
FT                   /locus_tag="CR539_01995"
FT   CDS_pept        397088..398203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_01995"
FT                   /product="maltose/maltodextrin import ATP-binding protein
FT                   MalK"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHQ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313045.1"
FT                   /protein_id="AUJ94316.1"
FT                   /translation="MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTL
FT                   LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   AKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY
FT                   HYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANM
FT                   SLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEG
FT                   ATFAIGLPPERCHLFREDGTACRRLHKEPGV"
FT   gene            398275..399615
FT                   /gene="lamB"
FT                   /locus_tag="CR539_02000"
FT   CDS_pept        398275..399615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lamB"
FT                   /locus_tag="CR539_02000"
FT                   /product="maltoporin"
FT                   /note="porin involved in the transport of maltose and
FT                   maltodextrins; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1E5WUF3"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5WUF3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418460.1"
FT                   /protein_id="AUJ94317.1"
FT                   /translation="MMITLRKLPLAVAVAAGVMSAQAMAVDFHGYARSGIGWTGSGGEQ
FT                   QCFQTTGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVAQQNDWEATDP
FT                   AFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLENIDVGFGK
FT                   LSLAATRSSEAGGSSSFASNDIYDYTNETANDVFDVRLAQMEINPGGTLELGVDYGRAN
FT                   LRDNYRLVDGASKDGWLFTAEHTQSVLKGFNKFVVQYATDSMTSQGKGLSQGSGVAFDN
FT                   EKFAYNINNNGHMLRILDHGAISMGDNWDMMYVGMYQDINWDNDNGTKWWTVGIRPMYK
FT                   WTPIMSTVMEIGYDNVESQRTGDKNNQYKITLAQQWQAGDSIWSRPAIRVFATYAKWDE
FT                   KWGYDYTGNANTNTNFGKAVPADFNGGSFGRGDSDEWTFGAQMEIWW"
FT   gene            399766..400686
FT                   /locus_tag="CR539_02005"
FT   CDS_pept        399766..400686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02005"
FT                   /product="maltose operon protein MalM"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I2HXM5"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I2HXM5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415178.1"
FT                   /protein_id="AUJ94318.1"
FT                   /translation="MKMNKSLIALCLSAGLLASAPGISLADVNYVPQNTSDAPAIPSAA
FT                   LQQLTWTPVDQSKTQTTQLATGGQQLNVAGISGPVAAYSVPANIGELTLTLTSEVNKQT
FT                   SVFAPNVLILDQNMTPSAFFPSSYFTYQEPGVMSADRLEGVMRLTPALGQQKLYVLVFT
FT                   TEKDLQQTTQLLDPAKAYAKGVGNSIPDIPDPVARHTSDGLLKLKVKTNSSSSVLVGPL
FT                   FGSSAPAPVTVGNTAAPAVAAPAPAPVKKSEPMLNDTESYFNTAIKNAVAKGDVDKALK
FT                   LLDEAERLGSTSARSTFISSVKGKG"
FT   gene            400916..402496
FT                   /locus_tag="CR539_02010"
FT   CDS_pept        400916..402496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02010"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR025726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT70"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415179.1"
FT                   /protein_id="AUJ94319.1"
FT                   /translation="MLGHISKFDGNNSLIKHGVVQGNNIVDLDLLRNFNGVPWLNRENF
FT                   IYISNIFLNIKQRNEKNHSINMFREVSISNDIISVKFYRNEEIECACDFLMDKDAQGYT
FT                   DLSDLDLTSCHFKGDVISKVSFISSNLQHVTFECKEIGDCNFTTATVDNVIFKCRRLHN
FT                   VIFIKASGEYVDFSQSILDTVDFSRSQLTHSNFRECQIRNSNFDNCYLYASHFTRAEFL
FT                   SDKEISFIKSNLTAVMFDHVRISTGNFKDSVTQLMVLSIDYSDIFGNEYLDGYINNIIK
FT                   MIDTLPDDPAILKSVLAVKLVMQLKILNIANKNFIENMKKIFSHCPYIKDPIIRSYIHP
FT                   DEDNKFDNFMRQNRFSKMHFDTQQMIDFINRFNMNKWLIDKNNNFFIQLIDQALRSTDD
FT                   MIKANAWHLYKEWIRSDDVSPLFIEIEDNLRTFNTNELTRNDNIFILFSSVDDGPVMVV
FT                   SSQRLHDMLNPTKDTNWNSTYIYKSRHEILPVNLTPETLFGSKSQDKHALFPIFTASWR
FT                   ANRIKNKGI"
FT   gene            402613..402705
FT                   /locus_tag="CR539_02015"
FT   CDS_pept        402613..402705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02015"
FT                   /product="chorismate lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2A2XRY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A2XRY4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001296636.1"
FT                   /protein_id="AUJ94320.1"
FT                   /translation="MVAFLLRIRSLNLLYISRKHFSAIQCLYVM"
FT   gene            402719..403216
FT                   /locus_tag="CR539_02020"
FT   CDS_pept        402719..403216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02020"
FT                   /product="chorismate--pyruvate lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066R876"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066R876"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418463.4"
FT                   /protein_id="AUJ94321.1"
FT                   /translation="MSHPALTQLRALRYFTEIPALDPQLLDWLLLEDSMTKRFEQQGKT
FT                   VSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPE
FT                   LALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASP
FT                   LY"
FT   gene            403229..404101
FT                   /gene="ubiA"
FT                   /locus_tag="CR539_02025"
FT   CDS_pept        403229..404101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="CR539_02025"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /note="catalyzes the conversion of 4-Hydroxybenzoate into
FT                   3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
FT                   biosynthesis pathway; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHM7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313050.1"
FT                   /protein_id="AUJ94322.1"
FT                   /translation="MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQ
FT                   LWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLV
FT                   LISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSE
FT                   SVPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGV
FT                   LALMAIIGELNGLGWGYYWSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFL
FT                   GLAMSYWHF"
FT   gene            complement(404256..406679)
FT                   /locus_tag="CR539_02030"
FT   CDS_pept        complement(404256..406679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02030"
FT                   /product="glycerol-3-phosphate 1-O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
FT                   3-phosphate by transfering the acyl moiety from acyl-CoA;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2T3T8A3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2T3T8A3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418465.4"
FT                   /protein_id="AUJ94323.1"
FT                   /translation="MSGWPRIYYKLLNLPLSILVKSKSIPADPAPELGLDTSRPIMYVL
FT                   PYNSKADLLTLRAQCLAHDLPDPLEPLEIDGTLLPRYVFIHGGPRVFTYYTPKEESIKL
FT                   FHDYLDLHRSNPNLDVQMVPVSVMFGRAPGREKGEVNPPLRMLNGVQKFFAVLWLGRDS
FT                   FVRFSPSVSLRRMADEHGTDKTIAQKLARVARMHFARQRLAAVGPRLPARQDLFNKLLA
FT                   SRAIAKAVEDEARSKKISHEKAQQNAIALMEEIAANFSYEMIRLTDRILGFTWNRLYQG
FT                   INVHNAERVRQLAHDGHELVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFVEGGRSRTGRLLDPKT
FT                   GTLSMTIQAMLRGGTRPITLIPIYIGYEHVMEVGTYAKELRGATKEKESLPQMLRGLSK
FT                   LRNLGQGYVNFGEPMPLMTYLNQHVPDWRESIDPIEAVRPAWLTPTVNNIAADLMVRIN
FT                   NAGAANAMNLCCTALLASRQRSLTREQLTEQLNCYLDLMRNVPYSTDSTVPSASASELI
FT                   DHALQMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIAHMLVLPSLMAAIVTQHRHISR
FT                   DVLMEHVNVLYPMLKAELFLRWDRDELPDVIDALANEMQRQGLITLQDDELHINPAHSR
FT                   TLQLLAAGARETLQRYAITFWLLSANPSINRGTLEKESRTVAQRLSVLHGINAPEFFDK
FT                   AVFSSLVLTLRDEGYISDSGDAEPAETMKVYQLLAELITSDVRLTIESATQGEG"
FT   gene            406850..407218
FT                   /locus_tag="CR539_02035"
FT   CDS_pept        406850..407218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02035"
FT                   /product="diacylglycerol kinase"
FT                   /note="catalyzes the phosphorylation of diacylglycerol to
FT                   form diacylglycerol phosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SHL7"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHL7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313052.1"
FT                   /protein_id="AUJ94324.1"
FT                   /translation="MANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVI
FT                   ACWLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEYHELSGRAKDMGSAAVLI
FT                   AIIVAVITWCILLWSHFG"
FT   gene            407328..407936
FT                   /locus_tag="CR539_02040"
FT   CDS_pept        407328..407936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02040"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="Represses a number of genes involved in the response
FT                   to DNA damage; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHL2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHL2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000646075.1"
FT                   /protein_id="AUJ94325.1"
FT                   /translation="MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSL
FT                   FKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGN
FT                   KVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL"
FT   gene            407955..409334
FT                   /locus_tag="CR539_02045"
FT   CDS_pept        407955..409334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02045"
FT                   /product="MATE family efflux transporter DinF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTJ9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTJ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415185.1"
FT                   /protein_id="AUJ94326.1"
FT                   /translation="MPPGVAVCFSSLFIRLVCMAFLTSSDKALWHLALPMIFSNITVPL
FT                   LGLVDTAVIGHLDSPVYLGGVAVGATATSFLFMLLLFLRMSTTGLTAQAYGAKNPQALA
FT                   RALVQPLLLSLGAGALIALLRTPIIDLALHIVGGSEAVLEQARRFLEIRWLSAPASLAN
FT                   LVLLGWLLGVQYARAPVILLVVGNILNIVLDVWLVMGLHMNVQGAALATVIAEYATLLI
FT                   GLLMVRKIFKLRGISGEMLKTAWRGNFRRLLALNRDIMLRSLLLQLCFGAITVLGARLG
FT                   SDIIAVNAVLMTLLTFTAYALDGFAYAVEAHSGQAYGARDGSQLLDVWRAACRQSGIVA
FT                   LLFSVVYLLAGEHIIALLTSLTQIQQLADRYLIWQVILPLVGVWCYLLDGMFIGATRAA
FT                   EMRNSMAVAAAGFALTLLTLPWLGNHGLWLALTVFLALRGLSLAAIWQRHWRNGTWFVA
FT                   T"
FT   gene            409450..409659
FT                   /locus_tag="CR539_02050"
FT   CDS_pept        409450..409659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02050"
FT                   /product="stress-induced protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHK2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313055.1"
FT                   /protein_id="AUJ94327.1"
FT                   /translation="MNKDEAGGNWKQFKGKVKEQWGKLTDDDMTIIEGKRDQLVGKIQE
FT                   RYGYQKDQAEKEVVDWETRNEYRW"
FT   gene            complement(409701..410216)
FT                   /locus_tag="CR539_02055"
FT   CDS_pept        complement(409701..410216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02055"
FT                   /product="transcriptional regulator Zur"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QJ75"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E2QJ75"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415187.1"
FT                   /protein_id="AUJ94328.1"
FT                   /translation="MEKTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAY
FT                   DLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFICD
FT                   RCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEACRHPEQCQHDHS
FT                   VQVKKKSR"
FT   gene            410535..411497
FT                   /locus_tag="CR539_02060"
FT   CDS_pept        410535..411497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02060"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR020404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT80"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313057.1"
FT                   /protein_id="AUJ94329.1"
FT                   /translation="MLKIIPGATGYFNKTLNSNQFDNKDATKDKLDNIDATNDKLDNRG
FT                   TIKDKLNNIYGKSIDYSALRHRDIIIAKIDLFIQRITHNLWHARKKNVFLIEQITNLKE
FT                   WVNKYIADCTDEELNDRDFIASVVDRAIFHFAVNSICNTEGNKDATPIERYTFDVETKN
FT                   GLPSTVQLFYEESKDNEPLANIHLQAIGSGFLTFVNACQKYDDNSLKLFASLLISLSYS
FT                   SAYTDLAGAEKVNINDHNGNYLTAQFEELSQRDMKKYLGEMKRLADGGEMNFDGYLDKM
FT                   SHLVNEGTLAPDILSKMRDAAPKLIDFSKSFDPNSKEKI"
FT   gene            411919..412956
FT                   /locus_tag="CR539_02065"
FT   CDS_pept        411919..412956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02065"
FT                   /product="tRNA dihydrouridine(20/20a) synthase DusA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J2E1D5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J2E1D5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313058.1"
FT                   /protein_id="AUJ94330.1"
FT                   /translation="MHGNSEMQKINQTSAMPEKTDVHWSGRFSVAPMLDWTDRHCRYFL
FT                   RLLSRNTLLYTEMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARG
FT                   YDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDS
FT                   YEFLCNFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLT
FT                   MSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIFGSSDTDADPVAVVRA
FT                   MYPYIERELSQGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADINVLEHALKL
FT                   VADKR"
FT   gene            413090..413332
FT                   /locus_tag="CR539_02070"
FT   CDS_pept        413090..413332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02070"
FT                   /product="envelope stress response protein PspG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8T6U6"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:W8T6U6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313059.2"
FT                   /protein_id="AUJ94331.1"
FT                   /translation="MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMI
FT                   KLLPWLLLAIAVVWVIKAIKAPKVPKYQRYDRWRY"
FT   gene            complement(413498..414481)
FT                   /locus_tag="CR539_02075"
FT   CDS_pept        complement(413498..414481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02075"
FT                   /product="quinone oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT12"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313060.1"
FT                   /protein_id="AUJ94332.1"
FT                   /translation="MATRIEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDT
FT                   YIRSGLYPPPSLPSGLGTEAAGIVSKVGSGVKHIKAGDRVVYAQSALGAYSSVHNINAD
FT                   KAAILPAAISFEQAAAAFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKA
FT                   LGAKLIGTVGTAQKAQSALKAGAWQVINYREENLVERLKEITGGKKVRVVYDSVGRDTW
FT                   ERSLDCLQRRGLMVSFGNSSGAVTGVNLGILNQKGSLYVTRPSLQGYITTREELTEASN
FT                   ELFSLIASGVIKVDVAEQQKYPLKDAQRAHEILESRATQGSSLLIP"
FT   gene            414564..415979
FT                   /locus_tag="CR539_02080"
FT   CDS_pept        414564..415979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02080"
FT                   /product="replicative DNA helicase"
FT                   /note="unwinds double stranded DNA; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:E2QJ79"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E2QJ79"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418476.1"
FT                   /protein_id="AUJ94333.1"
FT                   /translation="MAGNKPFNKQQAEPRERDPQVAGLKVPPHSIEAEQSVLGGLMLDN
FT                   ERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFA
FT                   YLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAES
FT                   RVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQ
FT                   PSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQ
FT                   TKIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLI
FT                   MIDYLQLMRVPALSDNRTLEIAEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVN
FT                   SDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWS
FT                   RFDNYAGPQYDDE"
FT   gene            416032..417111
FT                   /gene="alr"
FT                   /locus_tag="CR539_02085"
FT   CDS_pept        416032..417111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="CR539_02085"
FT                   /product="alanine racemase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTH8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTH8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313062.1"
FT                   /protein_id="AUJ94334.1"
FT                   /translation="MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLET
FT                   ARTLPDADAFGVARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQ
FT                   LAALEEAHLEEPVTVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARA
FT                   DEPKCGATEKQLAIFNTFCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLED
FT                   RSTGADFGCQPVMSLTSSLIAVREHKVGEPVGYGGTWISERDTRLGVVAMGYGDGYPRA
FT                   APSGTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKV
FT                   SAYELITRLTSRVAMKYVD"
FT   gene            417364..418557
FT                   /locus_tag="CR539_02090"
FT   CDS_pept        417364..418557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02090"
FT                   /product="aromatic amino acid transaminase"
FT                   /EC_number="2.6.1.57"
FT                   /note="catalyzes the formation of L-glutamate and an
FT                   aromatic oxo acid from an aromatic amino acid and
FT                   2-oxoglutarate; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NRR1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NRR1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415194.1"
FT                   /protein_id="AUJ94335.1"
FT                   /translation="MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQ
FT                   LKAVADAEARLNAVPHGASLYLPMEGLNSYRHAIAPLLFGADHPVLQQQRVATIQTLGG
FT                   SGALKVGADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDL
FT                   LATLKTLPARSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGM
FT                   EEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVLCEDAEAAGRVLGQLKATVR
FT                   RNYSSPPNFGAQVVAAVLNDEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFD
FT                   YLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM"
FT   gene            complement(418779..419303)
FT                   /locus_tag="CR539_02095"
FT   CDS_pept        complement(418779..419303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02095"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3L8Y2B5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415195.1"
FT                   /protein_id="AUJ94336.1"
FT                   /translation="MVTNFITPDGDDDMNISYVNNNKMTSLPVELDALNNKDISYAIDL
FT                   FLYIETQLKIAKDFCRPGEEVSSSIASTVFHAFIDLVNKIRGKKDFMYICTLCCFAEEV
FT                   KGDYSHYRTFLFDIGNQYKVKLTQSGKKEFSLTLEFNDTIIESQKVTGNKAKHILEDIE
FT                   KFYRNKPDTYY"
FT   gene            complement(419440..419619)
FT                   /locus_tag="CR539_02100"
FT   CDS_pept        complement(419440..419619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02100"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NRQ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001665922.1"
FT                   /protein_id="AUJ94337.1"
FT                   /translation="MLQKPSDHNASCRGKEGLSAVFVMKSRMIIFNPVNTFLSFFCKKM
FT                   VIARCKNTLIFRLL"
FT   gene            419666..420379
FT                   /pseudo
FT                   /gene="aphA"
FT                   /locus_tag="CR539_02105"
FT   CDS_pept        419666..420379
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="CR539_02105"
FT                   /product="acid phosphatase AphA"
FT                   /note="Class B; non-specific; catalyzes the
FT                   dephosphorylation of organic phosphomonoesters; also has
FT                   phosphotransferase activity; internal stop; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313064.1"
FT   gene            420490..420906
FT                   /locus_tag="CR539_02110"
FT   CDS_pept        420490..420906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02110"
FT                   /product="thiamine phosphate synthase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHG7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313065.1"
FT                   /protein_id="AUJ94338.1"
FT                   /translation="MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHT
FT                   SASLTLNENCDPTVRHDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPV
FT                   HKGRIQTGTWQGIWLGEHRIHGGSRRIIATLQGE"
FT   gene            420910..421266
FT                   /locus_tag="CR539_02115"
FT   CDS_pept        420910..421266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02115"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHG2"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHG2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313066.1"
FT                   /protein_id="AUJ94339.1"
FT                   /translation="MTISELLQYCMAKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENR
FT                   PAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAV
FT                   NLLPEEKRKLLVQL"
FT   gene            complement(421301..424123)
FT                   /locus_tag="CR539_02120"
FT   CDS_pept        complement(421301..424123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02120"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QB19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:J7QB19"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418482.1"
FT                   /protein_id="AUJ94340.1"
FT                   /translation="MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHT
FT                   KTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVRDDLTQRLAESFE
FT                   TALELSGGTAVVADMDDPKAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDPDRVIQNPELSLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLS
FT                   ANVHKVVLYGSGKENIEFKYMNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRPCASCEGTRLRREARHVYVENTPLPAISDMSIGHAMEFFNNLKLAGQRAKIAEK
FT                   ILKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGP
FT                   LEAIMAVPESLTGQYMSGKRKIEVPKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLF
FT                   TCITGVSGSGKSTLINDTLFPIAQRQLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDAVPALARKLQT
FT                   LMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LDVLHKLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECEAS
FT                   HTARFLKPML"
FT   gene            424074..424256
FT                   /locus_tag="CR539_02125"
FT   CDS_pept        424074..424256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02125"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3VJM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001337742.1"
FT                   /protein_id="AUJ94341.1"
FT                   /translation="MFLRLWVRAPRTSILSIHLSRIKRFFARWHGATGDHKRLIMTQID
FT                   LNEYTVLECITRSVV"
FT   gene            424378..424914
FT                   /locus_tag="CR539_02130"
FT   CDS_pept        424378..424914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02130"
FT                   /product="ssDNA-binding protein"
FT                   /note="binds to single stranded DNA and PriA helcase
FT                   facilitate replication restart; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SHF2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHF2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_004591906.1"
FT                   /protein_id="AUJ94342.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKA
FT                   TGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAA
FT                   PSNEPPMDFDDDIPF"
FT   gene            complement(425013..425294)
FT                   /locus_tag="CR539_02135"
FT   CDS_pept        complement(425013..425294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02135"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6Y290"
FT                   /db_xref="InterPro:IPR016958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6Y290"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313069.2"
FT                   /protein_id="AUJ94343.1"
FT                   /translation="MATLTTGMVLLRWQLLSAVMMFLASTLNIRFRRSDYVGLAVISSG
FT                   LGVVSACWFAMGLLGITMADITAIWHNIESVMIEEMNQTPPQWPMILT"
FT   gene            425253..425399
FT                   /locus_tag="CR539_02140"
FT   CDS_pept        425253..425399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02140"
FT                   /product="integrase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A2XPU6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001467666.1"
FT                   /protein_id="AUJ94344.1"
FT                   /translation="MPAKKNHASGEGSHQTIPLKRADALDSAALFTGGVVHSGYRGACR
FT                   TQK"
FT   gene            425723..427309
FT                   /locus_tag="CR539_02145"
FT   CDS_pept        425723..427309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02145"
FT                   /product="EAL domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUW4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUW4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418485.1"
FT                   /protein_id="AUJ94345.1"
FT                   /translation="MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTF
FT                   AQLALDKSELVIRQADLVSDAAERYQGQVCSPAHQKRMLNIIRGYLYINELIYARDNHF
FT                   LCSSLIAPVNGYTIAPADYERDPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWS
FT                   EVMSDDPTLQWGVYDTVTKTFFSLSNEASAATFSPLIHLKDLTVQRNGYLYATVYSTKR
FT                   PIAAIVATSYQRLIAHFYNHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEK
FT                   HQLCLYYQPIIDIKTEKCIGAEALLRWPGEQGQVMNPAEFIPLAEKEGMIEQVTDYIID
FT                   NVFRDLGAYLATHADRYVSINLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAF
FT                   LDVDKMTPIILAFRQAGYEVAIDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTS
FT                   HLIAEHIIELAHSLGLKTIAEGVETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWME
FT                   QLPARELTRGQ"
FT   gene            complement(427312..427635)
FT                   /locus_tag="CR539_02150"
FT   CDS_pept        complement(427312..427635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02150"
FT                   /product="regulatory protein SoxS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHD7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHD7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313071.1"
FT                   /protein_id="AUJ94346.1"
FT                   /translation="MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTV
FT                   THQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTPSDYR
FT                   HRL"
FT   gene            427721..428185
FT                   /locus_tag="CR539_02155"
FT   CDS_pept        427721..428185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02155"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHD2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHD2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313072.1"
FT                   /protein_id="AUJ94347.1"
FT                   /translation="MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGN
FT                   QRRYKRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDR
FT                   RIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN"
FT   gene            428172..428438
FT                   /locus_tag="CR539_02160"
FT   CDS_pept        428172..428438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02160"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUU3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUU3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001308278.1"
FT                   /protein_id="AUJ94348.1"
FT                   /translation="MNKTKAPQGRFSLFSGLCLSLYPAGTQEGFPRRQHTSFEHVVEVP
FT                   VGVDALIVCHRRFFASVKVYFLAAIFLSSQTIFYRNPERYTAR"
FT   gene            complement(428476..428695)
FT                   /pseudo
FT                   /locus_tag="CR539_02165"
FT   CDS_pept        complement(428476..428695)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02165"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001303755.1"
FT   gene            428634..428831
FT                   /locus_tag="CR539_02170"
FT   CDS_pept        428634..428831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02170"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT99"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014640476.1"
FT                   /protein_id="AUJ94349.1"
FT                   /translation="MVANLEREDNVSLAGDCPPRILTKIKLSGDVLLCLRHQRVPAVHS
FT                   TPGLKFHNVEALSVRKWLPG"
FT   gene            428732..430081
FT                   /locus_tag="CR539_02175"
FT   CDS_pept        428732..430081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02175"
FT                   /product="guanine/hypoxanthine permease GhxP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHC7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005132609.1"
FT                   /protein_id="AUJ94350.1"
FT                   /translation="MSTPSARTGGSLDAWFKISQRGSTVRQEVVAGLTTFLAMVYSVIV
FT                   VPGMLGKAGFPPAAVFVATCLVAGLGSIVMGLWANLPLAIGCAISLTAFTAFSLVLGQH
FT                   ISVPVALGAVFLMGVLFTVISATGIRSWILRNLPHGVAHGTGIGIGLFLLLIAANGVGL
FT                   VIKNPLDGLPVALGDFATFPVIMSLVGLAVIIGLEKLKVPGGILLTIIGISIVGLIFDP
FT                   NVHFSGVFAMPSLSDENGNSLIGSLDIMGALNPVVLPSVLALVMTAVFDATGTIRAVAG
FT                   QANLLDKDGQIIDGGKALTTDSMSSVFSGLVGAAPAAVYIESAAGTAAGGKTGLTAITV
FT                   GVLFLLILFLSPLSYLVPGYATAPALMYVGLLMLSNVAKIDFADFVDAMAGLVTAVFIV
FT                   LTCNIVTGIMIGFATLVIGRLVSGEWRKLNIGTVVIAVALVTFYAGGWAI"
FT   gene            430232..431881
FT                   /locus_tag="CR539_02180"
FT   CDS_pept        430232..431881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02180"
FT                   /product="Na+/H+ antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHC2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHC2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313074.1"
FT                   /protein_id="AUJ94351.1"
FT                   /translation="MEIFFTILIMTLVVSLSGVVTRVMPFQIPLPLMQIAIGALLAWPT
FT                   FGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGFLI
FT                   YWVVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGLVSL
FT                   KFAVAVAMGTMIFTVGGATVEFMKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEPATQI
FT                   VLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWAMLEFV
FT                   FNGMVFLLLGLQLPGILETSLMAAEIDPNVEIWMLFTDIILIYAALMLVRFGWLWTMKK
FT                   FSNRFLKKKPMEFGSWTTREILIASFAGVRGAITLAGVLSIPLLLPDGNVFPARYELVF
FT                   LAAGVILFSLFVGVVMLPILLQHIEVADHSQQLKEERIARAATAEVAIVAIQKMEERLA
FT                   ADTEENIDNQLLTEVSSRVIGNLRRRADGRNDVESSVQEENLERRFRLAALRSERAELY
FT                   HLRATREISNETLQKLLHDLDLLEALLIEENQ"
FT   gene            complement(432017..432714)
FT                   /pseudo
FT                   /locus_tag="CR539_02185"
FT   CDS_pept        complement(432017..432714)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02185"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(432671..432769)
FT                   /pseudo
FT                   /locus_tag="CR539_02190"
FT   CDS_pept        complement(432671..432769)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02190"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            complement(432812..433405)
FT                   /locus_tag="CR539_02195"
FT   CDS_pept        complement(432812..433405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02195"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT30"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001374275.1"
FT                   /protein_id="AUJ94352.1"
FT                   /translation="MTRANIKNTFLDYSNFYMAYMAEVNLYKVIAPYINLFRADLSFSK
FT                   LDLINFEHADLSRVNLNKATLQNINLIDSKLFFTRLTNTFLEMVICTGSNMANVNFNNA
FT                   NLSNCHFNCSVLTKAWMFNTRLYRVNFDEASVQGMGISILRGEENIPIDSDTLVTLQKF
FT                   FEEDCTSHTGMSQTEDNINAVAMKITADIMQHAD"
FT   gene            complement(433415..433918)
FT                   /locus_tag="CR539_02200"
FT   CDS_pept        complement(433415..433918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02200"
FT                   /product="insertion element IS1 protein InsB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:Q6SIY8"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SIY8"
FT                   /inference="COORDINATES:protein motif:HMM:PF03400.11"
FT                   /protein_id="AUJ94353.1"
FT                   /translation="MPGNRPHYGRWPQHDFPPFKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWP
FT                   LYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNI
FT                   KHYQ"
FT   gene            complement(433837..434112)
FT                   /locus_tag="CR539_02205"
FT   CDS_pept        complement(433837..434112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02205"
FT                   /product="IS1 family transposase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A6MEV5"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A6MEV5"
FT                   /inference="COORDINATES:protein motif:HMM:PF12759.5"
FT                   /protein_id="AUJ94354.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSGRSR"
FT   gene            complement(434168..434881)
FT                   /pseudo
FT                   /locus_tag="CR539_02210"
FT   CDS_pept        complement(434168..434881)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02210"
FT                   /product="hypothetical protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313075.1"
FT   gene            complement(435059..436708)
FT                   /gene="actP"
FT                   /locus_tag="CR539_02215"
FT   CDS_pept        complement(435059..436708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="CR539_02215"
FT                   /product="cation acetate symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A023KE79"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A023KE79"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005132593.1"
FT                   /protein_id="AUJ94355.1"
FT                   /translation="MKRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVF
FT                   TLGITYWASKRVRSRNDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGL
FT                   IYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLI
FT                   AQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFM
FT                   AFMVMKHVGFSFNNLFSEAMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHI
FT                   LMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGN
FT                   NMAAVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKGATER
FT                   EELRVSKITVLILGVIAIILGVLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTT
FT                   RGAMMGGWLGLITAVVLMILGPTIWVQILGHEKAIFPYEYPALFSISVAFLGIWFFSAT
FT                   DNSAEGARERELFRAQFIRSQTGFGVEQGRAH"
FT   gene            complement(436705..437019)
FT                   /locus_tag="CR539_02220"
FT   CDS_pept        complement(436705..437019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02220"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SHA7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C3SHA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313077.1"
FT                   /protein_id="AUJ94356.1"
FT                   /translation="MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIA
FT                   FAPGWLGTPLNPNTSVTRGIPVGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
FT                   "
FT   gene            complement(437152..439110)
FT                   /gene="acs"
FT                   /locus_tag="CR539_02225"
FT   CDS_pept        complement(437152..439110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="CR539_02225"
FT                   /product="acetate--CoA ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YDD8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YDD8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418493.1"
FT                   /protein_id="AUJ94357.1"
FT                   /translation="MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKI
FT                   LDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQ
FT                   SKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIF
FT                   GGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKR
FT                   TGGKIDWQEGRDLWWHDLVEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPA
FT                   RMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYW
FT                   KKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEG
FT                   ATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELY
FT                   AEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADP
FT                   GVVEKLLEEKQAIAMPS"
FT   gene            439221..439406
FT                   /locus_tag="CR539_02230"
FT   CDS_pept        439221..439406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02230"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A135PXE4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001324833.1"
FT                   /protein_id="AUJ94358.1"
FT                   /translation="MQINGRVIFEGQQQKLINSLRNMQLCMLLKKRKILTNSKVVFYMH
FT                   LQLIKDNIHSVVICYT"
FT   gene            439503..440939
FT                   /gene="nrfA"
FT                   /locus_tag="CR539_02235"
FT   CDS_pept        439503..440939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="CR539_02235"
FT                   /product="ammonia-forming cytochrome c nitrite reductase
FT                   subunit c552"
FT                   /EC_number="1.7.2.2"
FT                   /note="catalyzes the formate-dependent reduction of nitrite
FT                   to ammonia; cytochrome C552; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SH97"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH97"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313079.1"
FT                   /protein_id="AUJ94359.1"
FT                   /translation="MTRIKINARRIFSLLIPFFFFTSVHAEQTAAPAKPVTVEAKNETF
FT                   APQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSRDYNKPRGHAFAVTDVRET
FT                   LRTGAPKNAEDGPLPMACWSCKSPDVARLIQKDGEDGYFHGKWARGGPEIVNNLGCADC
FT                   HNTASPEFAKGKPELTLSRPYAARAMEAIGKPFEKAGRFDQQSMVCGQCHVEYYFDGKN
FT                   KAVKFPWDDGMKVENMEQYYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGKNNVT
FT                   CIDCHMPKVQNAEGKLYTDHKIGNPFDNFAQTCANCHTQDKAALQKVVAERKQSINDLK
FT                   IKVEDQLVHAHFEAKAALDAGATEAEMKPIQDDIRHAQWRWDLAIASHGIHMHAPEEGL
FT                   RMLGTAMDKAADARTKLARLLATKGITHEIQIPDISTKEKAQQAIGLNMEQIKAEKQDF
FT                   IKTVIPQWEEQARKNGLLSQ"
FT   gene            440984..441550
FT                   /locus_tag="CR539_02240"
FT   CDS_pept        440984..441550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02240"
FT                   /product="cytochrome c nitrite reductase pentaheme subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024L845"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017564"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L845"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418495.2"
FT                   /protein_id="AUJ94360.1"
FT                   /translation="MSVLRSLLTAGVLASGLLWSLNGITATPAAQASGDRYEVTQQRNP
FT                   DAACLDCHKPDTEGMHGKHASVINPNNKLPVTCTNCHGQPSPQHREGVKDVMRFNEPMY
FT                   KVGEQNSVCMSCHLPEQLQKAFWPHDVHVTKVACASCHSLHPQQDTMQTLSDKGRIKIC
FT                   VDCHSDQRTNPNFNPASVPLLKEQP"
FT   gene            441547..442218
FT                   /gene="nrfC"
FT                   /locus_tag="CR539_02245"
FT   CDS_pept        441547..442218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfC"
FT                   /locus_tag="CR539_02245"
FT                   /product="protein NrfC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SH87"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017567"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313081.1"
FT                   /protein_id="AUJ94361.1"
FT                   /translation="MTWSRRQFLTGVGVLAAVSGTAGRVVAKTLNINGVRYGMVHDESL
FT                   CIGCTACMDACREVNKVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVC
FT                   PTGASFRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLQAG
FT                   KLPACVEACPTKALTFGNLDDPNSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVS
FT                   Q"
FT   gene            442215..443171
FT                   /gene="nrfD"
FT                   /locus_tag="CR539_02250"
FT   CDS_pept        442215..443171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfD"
FT                   /locus_tag="CR539_02250"
FT                   /product="cytochrome c nitrite reductase subunit NrfD"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT36"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT36"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418497.1"
FT                   /protein_id="AUJ94362.1"
FT                   /translation="MTQTSAFYFESLVWDWPIAIYLFLIGISAGLVTLAVLLRRFYPQA
FT                   GGADSTLLRTTLIVGPGAVILGLLILVFHLTRPWTFWKLMFHYSFTSVMSMGVMLFQLY
FT                   MVVLVLWLAKIFEHDLLALQQRWLPKLGIMQKVLSLLTPVHRGLETLMLVLAVLLGAYT
FT                   GFLLSALKSYPFLNNPILPVLFLFSGISSGAAVALIAMAIRQRSNPHSTEAQFVHRMEI
FT                   PVVWGEIFLLVAFFVGLALGDDGKVRALVAALGGGFWTWWFWLGVAGLGLIVPMLLKPW
FT                   VNRSSGIPAVLAACGASLVGVLMLRFFILYAGQLTVA"
FT   gene            443191..444909
FT                   /locus_tag="CR539_02255"
FT   CDS_pept        443191..444909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02255"
FT                   /product="heme lyase CcmF/NrfE family subunit"
FT                   /note="with NrfF and NrfG catalyzes the insertion of heme
FT                   into cytochrome c552; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT52"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR003570"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT52"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_014640253.1"
FT                   /protein_id="AUJ94363.1"
FT                   /translation="MDVFLPEVGFLALLLSLGVNVLTPLTAFAGVRLRWPAMMRLTCIG
FT                   ILAQFALLLLAFGVLTYCFLISDFSVIYVAQHSYSLLSWELKLAAVWGGHEGSLLLWVL
FT                   LLSAWSTLFAWHYRQQTDPLFPLTLAVLSLMLAALLLFVVLWSDPFVRIFPPAIEGRDL
FT                   NPMLQHPGLIFHPPLLYLGYGGLMVAASVALASLLRGEFDGACARICWRWALPGWSALT
FT                   AGIILGSWWAYCELGWGGWWFWDPVENASLLPWLSATALLHSLSLTRQRGIFRHWSLLL
FT                   AIVTLMLSLLGTLIVRSGILVSVHAFALDNVRAVPLFSLFALISLASLALYGWRARDGG
FT                   PAVRFSGLSREMLILATLLLFCAVLLIVLVGTLYPMIYGLLGWGRLSVGAPYFNRATLP
FT                   FGLLMLVVIVLATFVSGKRAQLPALLAHAGMLLFAAGIVVSSVSRQEISLNLQPGQQVT
FT                   LAGYTFRFERLDLQAKGNYTSEKAIVALFDHQQRIGELTPERRFYEARRQQMMEPSIRW
FT                   NGIHDWYAVMGEKTGADRYAFRLYVQSGVRWIWGGGLLMIAGALLSGWRGRKRDE"
FT   gene            444902..445285
FT                   /locus_tag="CR539_02260"
FT   CDS_pept        444902..445285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02260"
FT                   /product="heme lyase NrfEFG subunit NrfF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTK8"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR017565"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTK8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313084.1"
FT                   /protein_id="AUJ94364.1"
FT                   /translation="MSKGLLTLLLLFTCFARAQVVDTWQFANPQQQEQALNIASQLRCP
FT                   QCQNQNLLESNAPVAVSMRHQVYSMVAEGKSEVEIIGWMTERYGDFVRYNPPLTGQTLV
FT                   LWALPVVLLLLMALILWRVRAKR"
FT   gene            445282..445878
FT                   /locus_tag="CR539_02265"
FT   CDS_pept        445282..445878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02265"
FT                   /product="heme lysase NrfEFG subunit NrfG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024L849"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L849"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418500.1"
FT                   /protein_id="AUJ94365.1"
FT                   /translation="MKQPKIPVKMLTTLTILMVFLCVGSYLLSPKWQAVRAEYQRQRDP
FT                   LHQFASQQTPEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRG
FT                   ENAELYAALATVLYYQASQHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQA
FT                   IELWQKVMDLNSPRINRTQLVESINMAKLLQRRSD"
FT   gene            complement(446115..446306)
FT                   /locus_tag="CR539_02270"
FT   CDS_pept        complement(446115..446306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02270"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6F5P2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001486758.1"
FT                   /protein_id="AUJ98138.1"
FT                   /translation="MVVQVASQENAQHHSKQNLPGQAEFYIFHQNNFLNGAPFPVQKRE
FT                   NVTYCQGMNCVALVCGFF"
FT   gene            446220..447533
FT                   /locus_tag="CR539_02275"
FT   CDS_pept        446220..447533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02275"
FT                   /product="glutamate/aspartate:proton symporter GltP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SH62"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH62"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313086.1"
FT                   /protein_id="AUJ94366.1"
FT                   /translation="MKNIKFSLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAG
FT                   DIFIHLIKMIVVPIVISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLAN
FT                   VFQPGAGVDMSQLATVDISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPI
FT                   IFFSVLFGLGLSSLPATHREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANF
FT                   GFSSLWPLAKLVLLVHFAILFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSE
FT                   SVLPRIIEKMEAYGAPASITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQE
FT                   IILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWEHKFDRKKALAYEREVLGKFDKTADQ"
FT   gene            complement(447723..448412)
FT                   /locus_tag="CR539_02280"
FT   CDS_pept        complement(447723..448412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02280"
FT                   /product="sel1 repeat family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313087.1"
FT                   /protein_id="AUJ94367.1"
FT                   /translation="MKKIIALMLFLTFFAHANDSEPGSQYLKAAEAGDRRAQYFLADSW
FT                   FSSGDLSKAEYWAQKAADSGDADACALLAQIKITNPVSLDYPQAKVLAEKAAQAGSKEG
FT                   EVTLAHILVNTQAGKPDYPKAISLLENASEDLENDSAVDAQMLLGLIYANGVGIKADDD
FT                   KATWYFKRSSAISRTGYSEYWAGMMFLNGEEGFIEKNKQKALHWLNLSCMEGFDTGCEE
FT                   FEKLTNG"
FT   gene            complement(448506..450653)
FT                   /locus_tag="CR539_02285"
FT   CDS_pept        complement(448506..450653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:450234..450236,aa:Sec)
FT                   /locus_tag="CR539_02285"
FT                   /product="formate dehydrogenase N subunit alpha,
FT                   selenocysteine-containing"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A167SBX0"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A167SBX0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418503.1"
FT                   /protein_id="AUJ94368.1"
FT                   /translation="MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKG
FT                   YYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQ
FT                   TTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINE
FT                   IDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGS
FT                   NIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQA
FT                   ARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQG
FT                   ACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAY
FT                   IMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAA
FT                   DRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATY
FT                   EKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMV
FT                   LSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKI
FT                   ITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAA
FT                   EQYVIDEYNKLKTRLREAALA"
FT   gene            complement(450851..452314)
FT                   /locus_tag="CR539_02290"
FT   CDS_pept        complement(450851..452314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02290"
FT                   /product="multidrug resistance transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTB7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTB7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415221.1"
FT                   /protein_id="AUJ94369.1"
FT                   /translation="MINRQLSRLLLCSILGSTTLISGCALVRKDSAPHQQLKPEQIKLA
FT                   DDIHLASSGWPQAQWWKQLNDPQLDALIQRTLSGSHTLAEAKLREEKAQSQADLLDAGS
FT                   QLQVAALGMLNRQRVSANGFLSPYAMDAPALGMDGPYYTEATVGLFAGLDLDLWGVHRS
FT                   AVAAAIGAHNAALAETAAVELSLTTGVAQLYYSMQASYQMLDLLEQTRDVIDYAVKAHQ
FT                   RKVAHGLEAQVPFHGARAQILAVDKQIAAVKGQITETRESLRALIGAGASDMPEIKPVA
FT                   LPRVQTGIPATLSYELLARRPDLQAMRWYVQASLDQVDSARALFYPSFDIKAFFGLDSI
FT                   HLDTLFKKTSRQFNFIPGLKLPLFDGGRLNANLEGTRAASNMIERYNQSVLNAVRDVAV
FT                   NGTRLQTLNDEREMQAERVEATRFTQRAAEAAYQRGLTSRLQATEARLPVLAEEMSLLM
FT                   LDSRRVIQSIQLMKSLGGGYQAGPVVEKK"
FT   gene            complement(452311..454362)
FT                   /locus_tag="CR539_02295"
FT   CDS_pept        complement(452311..454362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02295"
FT                   /product="multidrug transporter subunit MdtO"
FT                   /note="possibly part of a tripartite efflux system composed
FT                   of MdtN, MdtO and MdtP which could be involved in
FT                   resistance to puromycin, acriflavine and
FT                   tetraphenylarsonium chloride; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTI8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTI8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313090.2"
FT                   /protein_id="AUJ94370.1"
FT                   /translation="MSALNSLPLPVVRLLAFFHEELSERRPGRVPQTVQLWVGCLLVIL
FT                   ISMTFEIPFVALSLAVLFYGIQSNAFYTKFVAILFVVATVLEIGSLFLIYKWSYGEPLI
FT                   RLIIAGPILMGCMFLMRTHRLGLVFFAVAIVAIYGQTFPAMLDYPEVVVRLTLWCIVVG
FT                   LYPTLLMTLIGVLWFPSRAISQMHQVLNDRLDDAISHLTDSLAPLPETRIEREALALQK
FT                   LNVFCLADDANWRTQSAWWQSCVATVTYIYSTLNRYDPTSFADSQAIIEFRQKLASEIN
FT                   KLQHAITEGQCWQSDWQISESEAMAARECNLENICQTLLQLGQMDPNTPPTPAAKPPSM
FT                   VADAFTNPDYMRYAVKTLLACLICYTFYSGVDWEGIHTCMLTCVIVANPNVGSSYQKMV
FT                   LRFGGAFCGVILALLFTLLVMPWLDNIVELLFVLAPIFLLGAWITTSSERSSYIGTQMV
FT                   VTFALATLENVFGPVYDLVEIRDRALGIIIGTVVSAVICTFVWPESEARTLPQKLAGAL
FT                   GMLSKVMRIPRQQEVTALRTYLQIRIGLHAAFNACEEMCQRVALERQLDSEERALLIER
FT                   SQTVIRQGRDLLHAWDATWNSAQALDNALQPDRAGQFADALEKYAAGLATALSRSPQIT
FT                   LEETPASQAILPTLLKQEQHVCQLFARLPDWTAPALTPATEQAQGATQ"
FT   gene            complement(454362..455393)
FT                   /locus_tag="CR539_02300"
FT   CDS_pept        complement(454362..455393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02300"
FT                   /product="multidrug resistance protein MdtN"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TB30"
FT                   /db_xref="InterPro:IPR005694"
FT                   /db_xref="InterPro:IPR030196"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:W8TB30"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418506.1"
FT                   /protein_id="AUJ94371.1"
FT                   /translation="MESTPKKAPRSKFPALLVVALALVALVFVIWRVDSAPSTNDAYAS
FT                   ADTIDVVPEVSGRIVELAVTDNQAVKQGDLLFRIDPRPYEANLAKAEASLAALDKQIML
FT                   TQRSVDAQQFGADSVNATVEKARAAAKQATDTLRRTEPLLKEGFVSAEDVDRARTAQRA
FT                   AEADLNAVLLQAQSAASAVSGVDALVAQRAAVEADIALTKLHLEMATVRAPFDGRVISL
FT                   KTSVGQFASAMRPIFTLIDTRHWYVIANFRETDLKNIRSGTPATIRLMSDSGKTFEGKV
FT                   DSIGYGVLPDDGGLVLGGLPKVSRSINWVRVAQRFPVKIMVDKPDPEMFRIGASAVANL
FT                   EPQ"
FT   gene            complement(455412..455687)
FT                   /locus_tag="CR539_02305"
FT   CDS_pept        complement(455412..455687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02305"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SH42"
FT                   /db_xref="InterPro:IPR031381"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313092.1"
FT                   /protein_id="AUJ94372.1"
FT                   /translation="MPTVLSRMAMQLKKTAWIIPVFMVSGCSLSPAIPVIGAYYPSWFF
FT                   CAIASLILTLITRRVIQRANIKLAFVGIIYTALFALYAMLFWLAFF"
FT   gene            complement(455896..457881)
FT                   /locus_tag="CR539_02310"
FT   CDS_pept        complement(455896..457881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02310"
FT                   /product="alkyl/aryl-sulfatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT66"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT66"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418507.2"
FT                   /protein_id="AUJ94373.1"
FT                   /translation="MNNSQLFRLSRIVIALTAVSGMMVNTANAKEEAKAATQYTQQVNQ
FT                   NYAKSLPFSDRQDFDDAQRGFIAPLLDEGILRDANGKVYYRADDYKFDINAAAPETVNP
FT                   SLWRQSQINGISGLFKVTDKMYQVRGQDISNITFVEGEKGIIVIDPLVTPPAAKAALDL
FT                   YFQHRPQKPIVAVIYTHSHTDHYGGVKGIISEADVKSGKVQVIAPAGFMDEAISENVLA
FT                   GNIMSRRALYSYGLLLPHNAQGNVGNGLGVTLATGDPSIIAPTKTIVRTGEKMIIDGLE
FT                   FDFLMTPGSEAPAEMHFYIPALKALCTAENATHTLHNFYTLRGAKTRDTSKWTEYLNET
FT                   LDMWGNDAEVLFMPHTWPVWGNKHINDYIGKYRDTIKYIHDQTLHLANQGYTMNEIGDM
FT                   IKLPPALANNWASRGYYGSVSHNARAVYNFYLGYYDGNPANLHPYGQVEMGKRYVKALG
FT                   GSARVINLAQEANKQGDYRWSAELLKQVIAANPGDQVAKNLQANNFEQLGYQAESATWR
FT                   GFYLTGAKELREGVHKFSHGTTGSPDTIRGMSVEMLFDFMSVRLDSEKAAGKNISLNFN
FT                   MSNGDNLNLTLNDSVLNYRKTLQSQADASFYISREDLHAVLTGQAKMADLVKAKKAKII
FT                   GNGAKLEEIIACLDNFDLWVNIVTPN"
FT   gene            458172..458879
FT                   /locus_tag="CR539_02315"
FT   CDS_pept        458172..458879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02315"
FT                   /product="DNA-binding response regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066QCV3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066QCV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313094.1"
FT                   /protein_id="AUJ94374.1"
FT                   /translation="MKPVVLVVDDDTAICALLQDVLSEHVFTVSVCHTGQEAILRIEGD
FT                   PDIALVVLDMMLPDTNGLRVLQQIQKLRPTLPVVMLTGMGSESDVVVGLEMGADDYICK
FT                   PFTPRVVVARLKAVLRRVGALAVNDEKSAGLSFNGWYLDTMRCQLHNPLQQHVELTQGE
FT                   YGLLLALAQNARRVLSREQLLAFTHSDSVEVFDRTIDVLIMRLRRKIELNPHQPMLIKT
FT                   LRGLGYVFAADVH"
FT   gene            complement(458876..459877)
FT                   /locus_tag="CR539_02320"
FT   CDS_pept        complement(458876..459877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02320"
FT                   /product="carbohydrate kinase family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K6DBN2"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K6DBN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313095.1"
FT                   /protein_id="AUJ94375.1"
FT                   /translation="MMERKGIIAAGNMLVDHVHQIIQWPERGWLAEITHSERSTGGAPL
FT                   NVLLTLAKMRTGLPLQAVGLIGQDSDGDYIMAMLEQYHVNRQHVQRTTFAPTSMSQVMT
FT                   DPSGQRTFFHSPGANRLLDLPAFDQLDNTMKIFHLGYLLLLDSLDMPDDVYGTRSARLL
FT                   AQMRDTGFETSLDLVSRKGDPRYQPLVLPALRHLDYLVINELEAGEFSGLEIRLPNGEP
FT                   HIAHIAAAARELLDAGVRQRVVIHCPEGAWGETPEQGGVWIPSQKLEQREIIGSVGAGD
FT                   AFCAGFLYGCHERWTLTESIKLAHACARASLLCANAIDGAKTLEELQTEMSD"
FT   gene            complement(459874..460734)
FT                   /locus_tag="CR539_02325"
FT   CDS_pept        complement(459874..460734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02325"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085PAS6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PAS6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313096.1"
FT                   /protein_id="AUJ94376.1"
FT                   /translation="MPLISLAEGLAHAREHHYSLGAFNVLDSHFLRALFAAARQERSPF
FT                   IINIAEVHFKYISLDSLVETVKFEAARHAIPVVLNLDHGLHFESVVQALRLGFSSVMFD
FT                   GSTLGYEENVRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGHADESLFTDPQLARD
FT                   FVDRTGIDALAVAIGNAHGKYRGEPKLDFPRLDAIRQQAAIPLVLHGGSGISDADFRRA
FT                   IELGIHKINFYTGMSQAALAAVEARMAHRQPMYDEFAELLLAVEAAISDTVAQQMRIFG
FT                   SAGQA"
FT   gene            complement(460749..461432)
FT                   /locus_tag="CR539_02330"
FT   CDS_pept        complement(460749..461432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02330"
FT                   /product="D-lyxose/D-mannose family sugar isomerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUI2"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUI2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313097.1"
FT                   /protein_id="AUJ94377.1"
FT                   /translation="MKRSAINDILGHTRQFFSQHDVHLPPFASFSPAQWQQLDTAAWEE
FT                   VFDLKLGWDVTAFGGNNFAAQGLTLFTLRNGSAKGMPYVKCYAEKIMHVRDAQVTPMHF
FT                   HWRKREDIINRGGGNLIVELWNADSNEQTVDTDVTVVIDGCRQTHVAGSQLRLTPGESI
FT                   CLPPGLYHSFWAETGFGDVLVGEVSSVNDDDHDNHFLRPLARYNLIDEDEPAQLVLCNE
FT                   YRQFR"
FT   gene            complement(461487..462428)
FT                   /locus_tag="CR539_02335"
FT   CDS_pept        complement(461487..462428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02335"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066QL87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313098.1"
FT                   /protein_id="AUJ94378.1"
FT                   /translation="MRLKPLVTALCAGALLAAAPFAQAKELKSIGVTVGDLANPFFVQI
FT                   TKGAELEARKLAGDNVKVTLVSSGYDLGQQVSQIDNFIAANVDMIILNAADSKGIGPAV
FT                   KRAKDAGIVVVAVDVAAEGADATITSDNTQAGEMACKYITDRLKGKGNVVIINGPPVSA
FT                   VQNRVEGCQTEFKRHPDIKVLSDNQNAKGSREGGLEVMTGLLAANPKIDGVFAINDPTA
FT                   IGADLAAKQAQRNEFFIVGVDGSPDAEEALKRENSLFVATPAQDPQVMAAKAVEIGYDI
FT                   LQGKPAPKEPVLIPVTMIDKNNVGNYKGWTVK"
FT   gene            complement(462447..463421)
FT                   /locus_tag="CR539_02340"
FT   CDS_pept        complement(462447..463421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02340"
FT                   /product="ribose ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTC6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTC6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313099.1"
FT                   /protein_id="AUJ94379.1"
FT                   /translation="MTTSAKTSAKKMLMSDLMQTVGILPILILIVAVFGFIAPNFFTES
FT                   NLLNITRQASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLSPEFAMLSIPA
FT                   ALMLGLLLGLFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVINSNINFEWIGN
FT                   NYLGPVPWLVVIALAVIVLCWFILRRTTLGVHIYAVGGNMQAARLTGIKVWLVLLFVYG
FT                   MSGLLSGLGGIMNASRLYSANGNLGMGYELDAIAAVILGGTSFVGGIGTITGTLVGALI
FT                   IATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA"
FT   gene            complement(463418..464937)
FT                   /pseudo
FT                   /locus_tag="CR539_02345"
FT   CDS_pept        complement(463418..464937)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02345"
FT                   /product="D-xylose ABC transporter ATP-binding protein"
FT                   /note="with RbsBCD acts to import ribose into the cell;
FT                   RbsA contains 2 ATP-binding domain; frameshifted; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313100.1"
FT   gene            464936..465049
FT                   /locus_tag="CR539_02350"
FT   CDS_pept        464936..465049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02350"
FT                   /product="histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1V3CKM3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V3CKM3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001301959.1"
FT                   /protein_id="AUJ94380.1"
FT                   /translation="MVDSCEVVDISTPSQESKCKMSEAVHICHIAIFLHGA"
FT   gene            465051..467315
FT                   /locus_tag="CR539_02355"
FT   CDS_pept        465051..467315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02355"
FT                   /product="hybrid sensor histidine kinase/response
FT                   regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT45"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000940957.1"
FT                   /protein_id="AUJ94381.1"
FT                   /translation="MAHPGRHFFASARGRLLLLNLLVVAVTLMVSGVAVMGFRHASQMQ
FT                   ELVQQQTVDDMTGSLNLARDTANVATAAVRLSQVVGALEYKGEAERLQETQRALKSSLA
FT                   QLANAPLAQQEAGLVTRIITRSNELQTSVGGMLERGQRRHLERNALLSSLYQNLSYLRH
FT                   LQKVTHSQDDILLNEMNRLIVAAIATPAPQAIIHQLVGVMSALPTHSDTPLVNTLLNDF
FT                   NRELRKLAPLSAALEQSDLAISWYMFHIKALVAILNGDINRYAEQVATLSGQRVAQSYQ
FT                   DLRSGERVIMIFALLAVVITAFAGWYIYRNLGTNLTAISRAMSRLAYGEADVTFPALQR
FT                   RDELGELARAFNVFARNTASLERTSRLLKEKTTQMEIAQTERQGLEEALLHSQKLKAVG
FT                   QLTGGLAHDFNNLLAVIIGSLELVNTDSPDAPRIQRAQQAAERGALLTQRLLAFSRKQS
FT                   LHPQSVELKTLLEELSELMRHSLPATLALEIEAQSPAWPAWIDISQLENAIINLVMNAR
FT                   DAMEGQTGIIKIRTWNQRVTRSSGQRQDMVALEVIDHGSGMSQAVKSQVFEPFFTTKQT
FT                   GSGSGLGLSMVYGFVRQSGGRVEIESAPGQGTTVRLQLPRALTAAKNLSPAAVEQASVS
FT                   GDKLVLVLEDEAAVRQTICEQLHLLGYLTLEASSGEQALDLLAASAEIDIFISDLMLPG
FT                   GMSGAEVVNAARKLYPHLTLLLISGQDLRPSHNPALPDVALLRKPFTRAQLAQALGQIE
FT                   G"
FT   gene            467428..468060
FT                   /locus_tag="CR539_02360"
FT   CDS_pept        467428..468060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02360"
FT                   /product="N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUW7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUW7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000636707.1"
FT                   /protein_id="AUJ94382.1"
FT                   /translation="MIVMPTTYSPMTVARSFRVVEEIELSGRLLQVIYDKQTPRAAIIE
FT                   ADIEVFAGVPRHRVHAALDLQRKKEFGSDIIAVERWWEDSDLVQVEGICVSPGERDKGL
FT                   ATRLYEALILQCGITLISDFDQYDGGKMLWQKIARESDQISVFVLDTEQGAFWPYDGTK
FT                   VIYDGGCIPEERIWSISPDQKCHGIVLVAENKQRANQLMEESAPYRV"
FT   gene            468129..468458
FT                   /locus_tag="CR539_02365"
FT   CDS_pept        468129..468458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02365"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A3VTD9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944582.1"
FT                   /protein_id="AUJ94383.1"
FT                   /translation="MKPYSTLFLFTLLTLTTVPAQADIIDDTIGNIQQAINDAYNPDRG
FT                   RDYEDSRDDGWQREVSDDRRRQYDDRRRQFEDRRRQLDDRQRQLDQERRQLEDEERRME
FT                   DEYGR"
FT   gene            complement(468554..469312)
FT                   /locus_tag="CR539_02370"
FT   CDS_pept        complement(468554..469312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02370"
FT                   /product="phosphonate metabolism protein PhnP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUY1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017693"
FT                   /db_xref="InterPro:IPR035682"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUY1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313102.1"
FT                   /protein_id="AUJ94384.1"
FT                   /translation="MNLTLTLTGTGGAQGVPAWGCECAACARARRSPQYRRQPCSGVVK
FT                   FNDAITLIDAGLHDLADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGVGDPIPVYGPPDE
FT                   QGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLETAHSRVAWLS
FT                   DTAGLPEKTLKFLLNNQPQVIVIDCSHPPREDAPRNHCDLNTVLALNQVIRSPRVVLTH
FT                   ISHQFDAWLIENALPPGFEAGFDGMEIGVA"
FT   gene            complement(469314..469748)
FT                   /locus_tag="CR539_02375"
FT   CDS_pept        complement(469314..469748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02375"
FT                   /product="protein PhnO"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QYT7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:J7QYT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418517.1"
FT                   /protein_id="AUJ94385.1"
FT                   /translation="MPACELRPATQYDTDAVYALICELKQAEFDHHAFRVGFNANLRDP
FT                   NMRYHLALLDGEVVGMIGLHLQFHLHHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEE
FT                   ARQAGAEMTELSTNVKRHDAHRFYLREGYEQSHFRFTKAL"
FT   gene            complement(469735..470292)
FT                   /locus_tag="CR539_02380"
FT   CDS_pept        complement(469735..470292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02380"
FT                   /product="ribose 1,5-bisphosphokinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XVW1"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XVW1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313104.1"
FT                   /protein_id="AUJ94386.1"
FT                   /translation="MTGKLIWLMGPSGSGKDSLLAELRLREQTQLLVAHRYITRDASAG
FT                   SENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGVEIDLWLHAGFDVLVNGSRAHLPQ
FT                   ARARYQSALLPICLQVSPEILRQRLENRGRENASEINARLVRAARYTPQDCHTLNNDGS
FT                   LRQSVDTLLTLIHQKEKHHACL"
FT   gene            complement(470292..471428)
FT                   /locus_tag="CR539_02385"
FT   CDS_pept        complement(470292..471428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02385"
FT                   /product="alpha-D-ribose 1-methylphosphonate 5-triphosphate
FT                   diphosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1M1WW74"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1M1WW74"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313105.1"
FT                   /protein_id="AUJ94387.1"
FT                   /translation="MIINNVKLVLENEVVNGSLEMQDGEIRAFAESQSRLPEAMDGEGG
FT                   WLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAIGDVRDG
FT                   GDRLENLEKMINAIEETQKRGVNRAEHRLHLRCELPHHTTLPLFEKLVQREPVTLVSLM
FT                   DHSPGQRQFANREKYREYYQGKYSLTDAQMQQYEEEQLALAARWSQPNRESIAAMCRAR
FT                   HIALASHDDATHAHVAESHQLGSVIAEFPTTFEAAEASRKHGMNVLMGAPNIVRGGSHS
FT                   GNVAASELAQLGLLDILSSDYYPASLLDAAFRVADDESNRFTLPQAVKLVTKNPAQALN
FT                   LQDRGVIGEGKRADLVLAHRKGNHIHIDHVWRQGKRVF"
FT   gene            complement(471425..472105)
FT                   /gene="phnL"
FT                   /locus_tag="CR539_02390"
FT   CDS_pept        complement(471425..472105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="CR539_02390"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1Y2XL34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y2XL34"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313106.1"
FT                   /protein_id="AUJ94388.1"
FT                   /translation="MINVQNVSKTFILHQQNGVRLPVLQRASLTVNAGECVVLHGHSGS
FT                   GKSTLLRSLYANYLPDEGQIQIKHGDEWVDLVTAPARKVVEIRKTTVGWVSQFLRVIPR
FT                   ISALEVVMQPLLDTGVPREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARG
FT                   FIVDYPILLLDEPTASLDAKNSAAVVELIREAKARGAAIVGIFHDEAVRNDVADRLHPM
FT                   GASA"
FT   gene            complement(472216..472974)
FT                   /gene="phnK"
FT                   /locus_tag="CR539_02395"
FT   CDS_pept        complement(472216..472974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="CR539_02395"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SH12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3SH12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313107.1"
FT                   /protein_id="AUJ94389.1"
FT                   /translation="MNQPLLSVNNLTHLYAPGKGFSDVSFDLWPGEVLGIVGESGSGKT
FT                   TLLKSISARLTPQQGEIHYENRSLYGMSEADRRRLLRTEWGVVHQHPLDGLRRQVSAGG
FT                   NIGERLMATGARHYGDIRATAQKWLEEVEIPANRIDDLPTTFSGGMQQRLQIARNLVTH
FT                   PKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQG
FT                   QVVESGLTDRVLDDPHHPYTQLLVSSVLQN"
FT   gene            complement(472971..473816)
FT                   /locus_tag="CR539_02400"
FT   CDS_pept        complement(472971..473816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02400"
FT                   /product="carbon-phosphorus lyase complex subunit PhnJ"
FT                   /note="required for use of phosphonate and phosphite;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EUX1"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EUX1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313108.1"
FT                   /protein_id="AUJ94390.1"
FT                   /translation="MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPMP
FT                   YGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTERTDDATVI
FT                   QTRHRIPETPLTEDQIIIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYEDIAR
FT                   FGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPPFTRV
FT                   ESLDFDDYPFTVQQWDEPCAICGSTHSYLDEVVLDDAGNRMFVCSDTDYCRQQSEAKSQ
FT                   "
FT   gene            complement(473809..474873)
FT                   /locus_tag="CR539_02405"
FT   CDS_pept        complement(473809..474873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02405"
FT                   /product="carbon-phosphorus lyase complex subunit PhnI"
FT                   /note="required for the use of phosphonate and phosphite;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0F3T6I4"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F3T6I4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313109.1"
FT                   /protein_id="AUJ94391.1"
FT                   /translation="MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAV
FT                   DRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTEMRLERR
FT                   ISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQG
FT                   LAKFEEDSGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFA
FT                   GEIRSGYIDVSIVPEELGFAVNVGELLMTECEMVNGFIDPPDEPPHFTRGYGLVFGMSE
FT                   RKAMAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAE
FT                   LELLKRLQQEQNHG"
FT   gene            complement(474873..475457)
FT                   /locus_tag="CR539_02410"
FT   CDS_pept        complement(474873..475457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02410"
FT                   /product="phosphonate C-P lyase system protein PhnH"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085PAU2"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085PAU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313110.1"
FT                   /protein_id="AUJ94392.1"
FT                   /translation="MTLETAFILPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLN
FT                   IATTSVLLTLADNDTPVWLAAPLSNDIVSQSLRFHTNAPLVSQPEQATFAVTDEAISSE
FT                   QLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPQLPECILHELTE
FT                   RPHPFPLGIDLILTCGERLLAIPRTTHVEVC"
FT   gene            complement(475454..475906)
FT                   /gene="phnG"
FT                   /locus_tag="CR539_02415"
FT   CDS_pept        complement(475454..475906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="CR539_02415"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT84"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT84"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313111.1"
FT                   /protein_id="AUJ94393.1"
FT                   /translation="MHADTATRQHWMSVLAHSQPAELAARLNALNITANYEVIRAAETG
FT                   LVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVLGRDKQHAERCALIDALMQQ
FT                   SRHFQNLSEILIAPLDADRMARIAARQAEVNASRVDFFTMVRGDNA"
FT   gene            complement(475907..476632)
FT                   /locus_tag="CR539_02420"
FT   CDS_pept        complement(475907..476632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02420"
FT                   /product="phosphonate metabolism transcriptional regulator
FT                   PhnF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTN7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTN7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418526.1"
FT                   /protein_id="AUJ94394.1"
FT                   /translation="MHLSTHPTSYPTRYQEIAAKLEQELRQHYRCGDYLPAEQQLAARF
FT                   EVNRHTLRRAIDQLVEKGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPTSE
FT                   KLLSVLRPASGHVADALGIAGGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRFD
FT                   SGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSP
FT                   AEYSVSLTRADMIEFTMEH"
FT   gene            complement(476653..477432)
FT                   /gene="phnE"
FT                   /locus_tag="CR539_02425"
FT   CDS_pept        complement(476653..477432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="CR539_02425"
FT                   /product="phosphonate ABC transporter, permease protein
FT                   PhnE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0N435"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N435"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415238.1"
FT                   /protein_id="AUJ98139.1"
FT                   /translation="MQTITIAPPKRSWFSLLSWAIVLAVLVVSWQGAEMAPLTLIKDGG
FT                   NMATFAADFFPPDFSQWQDYLTEMAVTLQIAVWGTALAVVLSIPFGLMSAENLVPWWVY
FT                   QPVRRLMDACRAINEMVFAMLFVVAVGLGPFAGVLALFIHTTGVLSKLLSEAVEAIEPG
FT                   PVERIRATGANKLEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIGVTLW
FT                   EAIRGFQFQQTCALMVLIIVTVSLLDFLSQRLRKHFI"
FT   gene            complement(477538..478554)
FT                   /gene="phnD"
FT                   /locus_tag="CR539_02430"
FT   CDS_pept        complement(477538..478554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="CR539_02430"
FT                   /product="phosphonate ABC transporter substrate-binding
FT                   protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0L6XVV3"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0L6XVV3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418529.1"
FT                   /protein_id="AUJ94395.1"
FT                   /translation="MNAKIIASLAFTSMFSLSTLLSPAHAEEQEKALNFGIISTESQQN
FT                   LKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANG
FT                   QVFAQTVAADGSPGYWSVLIVNKDSPINNLSDLLAKRKDLTFGNGDPNSTSGFLVPGYY
FT                   VFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVI
FT                   WKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLV
FT                   PIRQLALFKEMQGVKGNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ"
FT   gene            complement(478579..479367)
FT                   /gene="phnC"
FT                   /locus_tag="CR539_02435"
FT   CDS_pept        complement(478579..479367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="CR539_02435"
FT                   /product="phosphonates import ATP-binding protein PhnC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTR5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313115.1"
FT                   /protein_id="AUJ94396.1"
FT                   /translation="MQTIIRVEQLSKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKST
FT                   LLRHLSGLITGDKSAGSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVL
FT                   ENVLIGALGSTPFWRTCFSWFTREQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAI
FT                   ARALMQQAKVILADEPIASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCER
FT                   IVALRQGHVFYDGSSQQFDNERFDHLYRSINRVEENAKAA"
FT   gene            complement(479500..479943)
FT                   /locus_tag="CR539_02440"
FT   CDS_pept        complement(479500..479943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02440"
FT                   /product="VOC family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:J7RC14"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418531.1"
FT                   /protein_id="AUJ94397.1"
FT                   /translation="MPLSPYLSFAGNCADAIAYYQRTLGAELLYKISFGEMPKSAQDSA
FT                   ENCPSGMQFPDTAIAHANVRIAGSDIMMSDAMPSGKASYSGFTLVLDSQQVEEGKRWFD
FT                   NLAANGKIEMAWQETFWAHGFGKVTDKFGVPWMINVVKQQPTQ"
FT   gene            complement(480401..480736)
FT                   /locus_tag="CR539_02445"
FT   CDS_pept        complement(480401..480736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02445"
FT                   /product="protein PhnA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGW2"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313117.1"
FT                   /protein_id="AUJ98140.1"
FT                   /translation="MSLPHCPKCNSEYTYEDNGMYICPECAYEWNDAEPAQESDELIVK
FT                   DANGNLLADGDSVTIIKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLK
FT                   SEFVKKN"
FT   gene            480708..480920
FT                   /locus_tag="CR539_02450"
FT   CDS_pept        480708..480920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02450"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L3WI60"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001303758.1"
FT                   /protein_id="AUJ98141.1"
FT                   /translation="MHFGQCGNDMWISSKVSRAKAPKNGRLPKKAAIIHKIPEFVGGTA
FT                   DFRRRSFSFERKRKKKIIFLPPFII"
FT   gene            481138..483366
FT                   /locus_tag="CR539_02455"
FT   CDS_pept        481138..483366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02455"
FT                   /product="clamp-binding protein CrfC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTK7"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTK7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418533.1"
FT                   /protein_id="AUJ94398.1"
FT                   /translation="MYTQTLYELSQEAERLLQLSRQQLQLLEKMPLSVPGDDAPQLALP
FT                   WSQPNIAERHAMLNNELRKISQLEMVLAIVGTMKAGKSTTINAIVGTEVLPNRNRPMTA
FT                   LPTLIRHTPGQKEPVLHFSHVAPIDCLIQQLQQRLRDCDIKHLTDVLEIDKDMRALMQR
FT                   IENGVAFEKYYLGAQPIFHCLKSLNDLVRLAKALDVDFPFSAYAAIEHIPVIEVEFVHL
FT                   AGLESYPGQLTLLDTPGPNEAGQPHLQKMLNQQLARASAVLAVLDYTQLKSISDEEVRE
FT                   AILAVGQSVPLYVLVNKFDQQDRNSDDADQVRALISGTLMKGCITPQQIFPVSSMWGYL
FT                   ANRARHELANNDKLPAPEQQRWVEDFAHAALGRRWRHADLADLEHIRHAADQLWEDSLF
FT                   AQPIQALLHAAYANASLYALRSAAHKLLNYAQQAREYLDFRAHGLNVACEQLRQNIHQV
FT                   EESLQLLQLNQAQVSGEIKHEIELALTSANHFLRQQQDALNAQLAALFQDDSEPLSEIR
FT                   TRCETLLQTAQNTISRDFTLRFAELESTLCRVLTDVIRPIEQQVKMELSESGFRPGFHF
FT                   PVFHGAVPHFNTRQLFSEVISRQEATDEQSTRLGVVRETFSRWLNQPDWGRGNEKSPTE
FT                   TVDYSVLQRALSAEVDLYCQQMAKVLAEQVDESVTAGMNTFFAEFASCLTELQTRLRES
FT                   LALRQQNESVVRLMQQQLQQTVMTHGWIYTDAQLLRDDIQTLFTAERY"
FT   gene            483363..484241
FT                   /locus_tag="CR539_02460"
FT   CDS_pept        483363..484241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02460"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR025599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTE4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313119.2"
FT                   /protein_id="AUJ94399.1"
FT                   /translation="MTKTLLDGPGRVLESVHPRFLVDLAQGDDARLPQAHQQQFRERLM
FT                   QELLARVQLQAWTNGGMLNAPLSLRLTLVEKLASMLDPGHLALTQIAQHLALLQKMDLR
FT                   QHSAFPELPQQIAALYEWFSARCRWKEKALTQRGLLVQAGEQSEQIFTRWRAGAYNAWS
FT                   LPGRCFIVLEELRWGAFGDACRLGSPQAVALLLGDLRVKATQHLAESINAAPTTRHYYH
FT                   QWFASSTVPTGGDHADFLSWLGKWTTADKQPVCWSVTQRWQTVALGMPRLCSAQRLAGA
FT                   MLEEIFSVNLV"
FT   gene            484505..486007
FT                   /locus_tag="CR539_02465"
FT   CDS_pept        484505..486007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02465"
FT                   /product="proline/glycine betaine transporter ProP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A236FE85"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR015041"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A236FE85"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313120.1"
FT                   /protein_id="AUJ94400.1"
FT                   /translation="MLKRKKVKPITLRDVTIIDDGKLRKAITAASLGNAMEWFDFGVYG
FT                   FVAYALGKVFFPGADPSVQMVAALATFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIV
FT                   IMSISTFCIGLIPSYDTIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRGF
FT                   MGSWLDFGSIAGFVLGAGVVVLISTIVGEENFLDWGWRIPFFIALPLGIIGLYLRHALE
FT                   ETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKYWRSLLTCIGLVIATNVTYYMLLTY
FT                   MPSYLSHNLHYSEDHGVLIIIAIMIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLAI
FT                   PAFILINSNVIGLIFAGLLMLAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISVLV
FT                   AGLTPTLAAWLVESSQNLMMPAYYLMVVAVVGLITGVTMKETANRPLKGATPAASDIQE
FT                   AKEILVEHYDNIEQKIDDIDHEIADLQAKRTRLVQQHPRIDE"
FT   gene            486122..486211
FT                   /locus_tag="CR539_02470"
FT   CDS_pept        486122..486211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02470"
FT                   /product="LpxT activity modulator PmrR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A094XWZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A094XWZ5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016155406.1"
FT                   /protein_id="AUJ94401.1"
FT                   /translation="MKNRVYESLTTVFSVLVVSSFLYIWFATY"
FT   gene            complement(486187..487278)
FT                   /locus_tag="CR539_02475"
FT   CDS_pept        complement(486187..487278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02475"
FT                   /product="two-component system sensor histidine kinase
FT                   BasS"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0N3Z2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N3Z2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418536.1"
FT                   /protein_id="AUJ98142.1"
FT                   /translation="MRFLRRPISLRQRLILTIGAILLVFELISVFWLWHESTEQIQLFE
FT                   QALRDNRNNDRHIMREIREAVASLIVPGVFMVSLTLFICYQAVRRITRPLAELQKELEA
FT                   RTADNLTPIAIHSATLEIEAVVSALNDLVSRLTSTLDNERLFTADVAHELRTPLAGVRL
FT                   HLELLAKTHHIDVAPLVARLDQMMESVSQLLQLARAGQSFSSGNYQHVKLLEDVILPSY
FT                   DELSTMLDQRQQTLLLPESTADITVQGDATLLRMLLRNLVENAHRYSPQGSNIMIKLQE
FT                   DDGAVMAVEDEGPGIDESKCGELSKAFVRMDSRYGGIGLGLSIVSRITQLHHGQFFLQN
FT                   QQETSGTRAWIRLKKDQYVANQI"
FT   gene            complement(487288..487956)
FT                   /locus_tag="CR539_02480"
FT   CDS_pept        complement(487288..487956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02480"
FT                   /product="two-component system response regulator BasR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGU2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313122.1"
FT                   /protein_id="AUJ94402.1"
FT                   /translation="MKILIVEDDTLLLQGLILAAQTEGYACDGVTTARMAEQSLEAGHY
FT                   SLVVLDLGLPDEDGLHFLARIRQKKYTLPVLILTARDTLTDKIAGLDVGADDYLVKPFA
FT                   LEELHARIRALLRRHNNQGESELIVGNLTLNMGRRQVWMGGEELILTPKEYALLSRLML
FT                   KAGSPVHREILYNDIYNWDNEPSTNTLEVHIHNLRDKVGKARIRTVRGFGYMLVANEEN
FT                   "
FT   gene            complement(487953..489596)
FT                   /locus_tag="CR539_02485"
FT   CDS_pept        complement(487953..489596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02485"
FT                   /product="phosphoethanolamine transferase EptA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MT93"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MT93"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418538.2"
FT                   /protein_id="AUJ94403.1"
FT                   /translation="MLKRLLKRPSLNLLAWLLLAAFYISICLNIAFFKQVLQALPLDSL
FT                   HNVLVFLSMPVVAFGVINIVLTLSSFLWLNRPLACLFILVGAAAQYFIMTYGIVIDRSM
FT                   IANIIDTTPAESYALMTPQMLLTLGFSGVLAALIACWIKIKPATSRLRSVLFRGANILV
FT                   SVLLILLVAALFYKDYASLFRNNKELVKSLSPSNSIVASWSWYSHQRLANLPLVRIGED
FT                   AHRNPLMQNEKRKNLTILIVGETSRAENFSLNGYPRETNPRLAKDNVVYFPNTASCGTA
FT                   TAVSVPCMFSDMPREHYKEELAQHQEGVLDIIQRAGINVLWNDNDGGCKGACDRVPHQN
FT                   VTALNLPGQCINGECYDEVLFHGLEEYINNLQGDGVIVLHTIGSHGPTYYNRYPPQFRK
FT                   FTPTCDTNEIQTCTKEQLVNTYDNTLVYVDYIVDKAINLLKEHQDKFTTSLVYLSDHGE
FT                   SLGENGIYLHGLPYAIAPDSQKQVPMLLWLSEDYQKRYQVDQNCLQKQAQTQHYSQDNL
FT                   FSTLLGLTGVETKYYQAADDILQTCRRVSE"
FT   gene            complement(489700..491037)
FT                   /locus_tag="CR539_02490"
FT   CDS_pept        complement(489700..491037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02490"
FT                   /product="arginine:agmatine antiporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGT2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGT2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313124.1"
FT                   /protein_id="AUJ94404.1"
FT                   /translation="MSSDADAHKVGLIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYG
FT                   WLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAM
FT                   VVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIV
FT                   GIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKR
FT                   NVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFC
FT                   AAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLS
FT                   SISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCI
FT                   WAVVGSGAKEVMWSFVTLMVITAMYALNYNRLHKNPYPLDAPISKD"
FT   gene            complement(491174..491935)
FT                   /locus_tag="CR539_02495"
FT   CDS_pept        complement(491174..491935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02495"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="regulates genes involved in arginine decarboxylase;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1E5WUK6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E5WUK6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313125.1"
FT                   /protein_id="AUJ94405.1"
FT                   /translation="MRICSDQPCIVLLTEKDVWIRVNGKEPISLKANHMALLNCENNII
FT                   DVSSLNNTLVAHISHDIIKDYLRFLNKDLSQIPVWQRSATPILTLPCLTPDVFHVAAQH
FT                   SMMPAETESEKERTRALLFTVLSRFLDSKKFLSLMMYMLRNCVSDSVYQIIESDIHKDW
FT                   NLSMVASCLCLSPSLLKKKLKSENTSYSQIITTCRMRYAVNELMMDGKNISQVSQSCGY
FT                   NSTSYFISVFKDFYGMTPLHYVSQHRERTVA"
FT   gene            complement(492259..494526)
FT                   /locus_tag="CR539_02500"
FT   CDS_pept        complement(492259..494526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02500"
FT                   /product="arginine decarboxylase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0N3Y8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0N3Y8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415251.6"
FT                   /protein_id="AUJ98143.1"
FT                   /translation="MKVLIVESEFLHQDTWVGNAVERLADALSQQNVTVIKSTSFDDGF
FT                   AILSSNEAIDCLMFSYQMEHPDEHQNVRQLIGKLHERQQNVPVFLLGDREKALAAMDRD
FT                   LLELVDEFAWILEDTADFIAGRAVAAMTRYRQQLLPPLFSALMKYSDIHEYSWAAPGHQ
FT                   GGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLDHTGAFGESEKYAARVFGADR
FT                   SWSVVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQGLMLTGAKPVYMVPSRNRYGI
FT                   IGPIYPQEMQPETLQKKISESPLTKDKAGQKPSYCVVTNCTYDGVCYNAKEAQDLLEKT
FT                   SDRLHFDEAWYGYARFNPIYADHYAMRGEPGDHNGPTVFATHSTHKLLNALSQASYIHV
FT                   REGRGAINFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFR
FT                   QAMARLYKEFTADGSWFFKPWNKEVVTDPQTGKTYDFADAPTKLLTTVQDCWVMHPGES
FT                   WHGFKDIPDNWSMLDPIKVSILAPGMGEDGELEETGVPAALVTAWLGRHGIVPTRTTDF
FT                   QIMFLFSMGVTRGKWGTLVNTLCSFKRHYDANTPLAQVMPELVEQYPDTYANMGIHDLG
FT                   DTMFAWLKENNPGARLNEAYSGLPVAEITPREAYNAIVDNNVELVSIENLPGRIAANSV
FT                   IPYPPGIPMLLSGENFGDKNSPQLSYLRSLQSWDHHFPGFEHETEGTEIIDGIYHVMCV
FT                   KA"
FT   gene            complement(494725..495633)
FT                   /locus_tag="CR539_02505"
FT   CDS_pept        complement(494725..495633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02505"
FT                   /product="melibiose operon regulatory protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QJK3"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:J7QJK3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418542.1"
FT                   /protein_id="AUJ94406.1"
FT                   /translation="MNTDTFMCSSDEKQTRSPLSLYSEYQRMEIEFRAPHIMPTSHWHG
FT                   QVEVNVPFDGDVEYLINNEKVNINQGHITLFWACTPHQLTDTGTCQSMAIFNLPMHLFL
FT                   SWPLDKDLINHVTHGMVIKSLATQQLSPFEVRRWQQELNSPNEQIRQLAIDEIGLMLKR
FT                   FSLSGWEPILVNKTSRTHKNSVSRHAQFYVSQMLGFIAENYDQALTINDVAEHVKLNAN
FT                   YAMGIFQRVMQLTMKQYITAMRINHVRALLSDTDKSILDIALTAGFRSSSRFYSTFGKY
FT                   VGMSPQQYRKLSQQRRQTFPG"
FT   gene            495916..497271
FT                   /locus_tag="CR539_02510"
FT   CDS_pept        495916..497271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02510"
FT                   /product="alpha-glucosidase/alpha-galactosidase"
FT                   /note="catalyses the hydrolysis of terminal non-reducing
FT                   alpha-D-galactose residues in alpha-D-galactosides; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUL7"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUL7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418543.1"
FT                   /protein_id="AUJ94407.1"
FT                   /translation="MMSAPKITFIGAGSTIFVKNILGDVFHREALKTAHIALMDIDPTR
FT                   LEESHIVVRKLMDSAGASGKITCHTQQKEALEDADFVVVAFQIGGYEPCTVTDFEVCKR
FT                   HGLEQTIADTLGPGGIMRALRTIPHLWQICEDMTEVCPDATMLNYVNPMAMNAWAMYAR
FT                   YPHIKQVGLCHSVQGTAEELARDLNIDPATLRYRCAGINHMAFYLELERKTADGSYVNL
FT                   YPELLAAYEAGQAPKPNIHGNTRCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGR
FT                   EDLIERYKVPLDEYPKRCVEQLANWHKELEEYKNASRIDIKPSREYASTIINAIWTGEP
FT                   SVIYGNVRNDGLIDNLPQGCCVEVACLVDANGIQPTKVGTLPSHLAALMQTNINVQTLL
FT                   TEAILTENRDRVYHAAMMDPHTAAVLGIDEIYALVDDLIAAHGDWLPGWLHR"
FT   gene            497374..498795
FT                   /locus_tag="CR539_02515"
FT   CDS_pept        497374..498795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02515"
FT                   /product="melibiose/sodium symporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A086VF78"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A086VF78"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415254.4"
FT                   /protein_id="AUJ94408.1"
FT                   /translation="MSISMTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVG
FT                   TLFLVARIWDAINDPIMGWIVNATRSRWGKFKPWILIGTLANSVILFLLFSAHLFEGTT
FT                   QIVFVCVTYILWGMTYTIMDIPFWSLVPTITLDKREREQLVPYPRFFASLAGFVTAGVT
FT                   LPFVNYVGGGDRGFGFQMFTLVLIAFFIVSTIITLRNVHEVFSSDNQPSAEGSHLTLKA
FT                   IVALIYKNDQLSCLLGMALAYNVASNIITGFAIYYFSYVIGDADLFPYYLSYAGAANLV
FT                   TLVFFPRLVKSLSRRILWAGASILPVLSCGVLLLMALMSYHNVVLIVIAGILLNVGTAL
FT                   FWVLQVIMVADTVDYGEYKLHVRCESIAYSVQTMVVKGGSAFAAFFIAVVLGMIGYVPN
FT                   VEQSTQALLGMQFIMIALPTLFFMVTLILYFRFYRLNGDTLRRIQIHLLDKYRKVPPEP
FT                   VHADIPVGAVSDVKA"
FT   gene            complement(498934..499563)
FT                   /locus_tag="CR539_02520"
FT   CDS_pept        complement(498934..499563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02520"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A161QY13"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A161QY13"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313130.1"
FT                   /protein_id="AUJ94409.1"
FT                   /translation="MTRTLKPLILNTGALALTLILIYTGISAHDKLTWLMEVTPVIIVM
FT                   PLLLATAKRYPLTPLLYTLIFFHAIILMVGGQYTYAKVPVGFEVQEWLKLSRNPYDKLG
FT                   HFFQGLVPALVAREILVRGMYVRGRKMVAFLVCCVALAISAMYELIEWWAALAMGQGAD
FT                   DFLGTQGDQWDTQSDMFCALLGALTTVIFLARFHCRQLRRFGLITG"
FT   gene            complement(499686..501332)
FT                   /locus_tag="CR539_02525"
FT   CDS_pept        complement(499686..501332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02525"
FT                   /product="fumarate hydratase"
FT                   /note="catalyzes the formation of malate from fumerate;
FT                   Derived by automated computational analysis using gene
FT                   prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTN2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418546.1"
FT                   /protein_id="AUJ94410.1"
FT                   /translation="MSNKPFIYQAPFPMGKDNTEYYLLTSNYISVADFNGETILKVEPE
FT                   ALTLLAHQAFHDASFMLRPAHQKQVAAILHDPEASENDKYVALQFLRNSEIAAKGVLPT
FT                   CQDTGTAIIVGKKGQRVWTGGGDEEALSKGVYNTYIEDNLRYSQNAALDMYKEVNTGTN
FT                   LPAQIDLYAVDGDEYKFLCVAKGGGSANKTYLYQETKALLTPGKLKNFLVEKMRTLGTA
FT                   ACPPYHIAFVIGGTSAETNLKTVKLASAHYYDELPTEGNEHGQAFRDVQLEQELLEEAQ
FT                   KLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKAKINREGIWIEKLEH
FT                   NPGQYIPEELRQAGEGEAVKVDLNRPMKEILAQLSQYPVSTRLSLTGTIIVGRDIAHAK
FT                   LKELIDSGKELPQYIKDHPIYYAGPAKTPAGYPSGSLGPTTAGRMDSYVDLLQSHGGSM
FT                   IMLAKGNRSQQVTDACHKHGGFYLGSIGGPAAVLAQQSIKHLECVAYPELGMEAIWKIE
FT                   VEDFPAFILVDDKGNDFFQQIVNKQCANCTK"
FT   gene            complement(501410..502750)
FT                   /locus_tag="CR539_02530"
FT   CDS_pept        complement(501410..502750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02530"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuB"
FT                   /note="functions in anaerobic transport of C4-dicarboxylate
FT                   compounds such as fumarate; similar to DcuA; DcuA and DcuB
FT                   function as independent and mutually redundant
FT                   C4-dicarboxylate (aspartate, malate, fumarate and
FT                   succinate) transporters; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGP2"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313132.1"
FT                   /protein_id="AUJ94411.1"
FT                   /translation="MLFTIQLIIILICLFYGARKGGIALGLLGGIGLVILVFVFHLQPG
FT                   KPPVDVMLVIIAVVAASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTILC
FT                   GTGHVVYTILPIIYDVAIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLGNVT
FT                   FDGRHLEFLDLLAITIPSTLIGILAIGIFSWFRGKDLDKDEEFQKFISVPENREYVYGD
FT                   TATLLDKKLPKSNWLAMWIFLGAIAVVALLGADSDLRPSFGGKPLSMVLVIQMFMLLTG
FT                   ALIIILTKTNPASISKNEVFRSGMIAIVAVYGIAWMAETMFGAHMSEIQGVLGEMVKEY
FT                   PWAYAIVLLLVSKFVNSQAAALAAIVPVALAIGVDPAYIVASAPACYGYYILPTYPSDL
FT                   AAIQFDRSGTTHIGRFVINHSFILPGLIGVSVSCVFGWIFAAMYGFL"
FT   gene            502818..502997
FT                   /pseudo
FT                   /locus_tag="CR539_02535"
FT   CDS_pept        502818..502997
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02535"
FT                   /product="hypothetical protein"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001325992.1"
FT   gene            503246..503344
FT                   /pseudo
FT                   /locus_tag="CR539_02540"
FT   CDS_pept        503246..503344
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02540"
FT                   /product="glutamate decarboxylase"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005016344.1"
FT   gene            complement(503321..504040)
FT                   /locus_tag="CR539_02545"
FT   CDS_pept        complement(503321..504040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02545"
FT                   /product="two-component system response regulator DcuR"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGN7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGN7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313133.1"
FT                   /protein_id="AUJ94412.1"
FT                   /translation="MINVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFN
FT                   SDTPIDLILLDIYMQKENGLDLLPVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYL
FT                   IKPFQASRFEEALTGWRQKKMALEKHQYYDQAELDQLIHGSSSNEQDPRRLPKGLTPQT
FT                   LRTLCQWIDAHQDYEFSTDELANEVNISRVSCRKYLIWLVNCHILFTSIHYGVTGRPVY
FT                   RYRIQAEHYSLLKQYCQ"
FT   gene            complement(504037..505668)
FT                   /locus_tag="CR539_02550"
FT   CDS_pept        complement(504037..505668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02550"
FT                   /product="sensor histidine kinase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGN2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGN2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313134.1"
FT                   /protein_id="AUJ94413.1"
FT                   /translation="MRHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQIS
FT                   DMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQ
FT                   SLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVV
FT                   AIGLELSRVTQQINDSRWSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFE
FT                   QRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSE
FT                   VLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNY
FT                   ADALRERSHEFMNKLHVILGLLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAG
FT                   FLISKINRATDLGHTLILNSESQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEI
FT                   SVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGS
FT                   IAVESEPGIFTQFFVQIPWDGERSNR"
FT   gene            505849..506079
FT                   /locus_tag="CR539_02555"
FT   CDS_pept        505849..506079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02555"
FT                   /product="4Fe-4S mono-cluster protein YjdI"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGM7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313135.1"
FT                   /protein_id="AUJ94414.1"
FT                   /translation="MDQALLDGGYRCYTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKR
FT                   KPWIMPDEVDVATVVKVIDTCPSGALKYRHK"
FT   gene            506091..506363
FT                   /locus_tag="CR539_02560"
FT   CDS_pept        506091..506363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02560"
FT                   /product="N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGM2"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGM2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313136.1"
FT                   /protein_id="AUJ94415.1"
FT                   /translation="MEIREGHNKFYINDEQGKQIAEIVFVPTGENLAIIEHTDVDESLK
FT                   GQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRS"
FT   gene            506450..506665
FT                   /locus_tag="CR539_02565"
FT   CDS_pept        506450..506665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02565"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTT4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTT4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000532291.1"
FT                   /protein_id="AUJ94416.1"
FT                   /translation="MGRESVFLSQVIPFTEQKKEYLLYENHQSGLISFASPKRSILIGV
FT                   ILWKVKTSLILMLFLLIIHHLIPQCS"
FT   gene            506590..506886
FT                   /locus_tag="CR539_02570"
FT   CDS_pept        506590..506886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02570"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGL7"
FT                   /db_xref="InterPro:IPR022597"
FT                   /db_xref="InterPro:IPR038241"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGL7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313137.1"
FT                   /protein_id="AUJ94417.1"
FT                   /translation="MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYG
FT                   IPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDIDFDLNIMTVDDYFRQFYK"
FT   gene            506914..507087
FT                   /locus_tag="CR539_02575"
FT   CDS_pept        506914..507087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02575"
FT                   /product="DUF2566 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK20"
FT                   /db_xref="InterPro:IPR019689"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK20"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_588474.1"
FT                   /protein_id="AUJ94418.1"
FT                   /translation="MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWP
FT                   MSLPVALLFSLF"
FT   gene            complement(507206..508723)
FT                   /gene="lysS"
FT                   /locus_tag="CR539_02580"
FT   CDS_pept        complement(507206..508723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="CR539_02580"
FT                   /product="lysine--tRNA ligase heat inducible"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A061K9L0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061K9L0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313138.1"
FT                   /protein_id="AUJ94419.1"
FT                   /translation="MSEQETRGANEAIDFNDELRNRREKLAALRQQGVAFPNDFRRDHT
FT                   SDQLHEEFDAKNNQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSL
FT                   PEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLQDQ
FT                   EVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARP
FT                   FITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELY
FT                   MAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPET
FT                   DMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSP
FT                   LARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYD
FT                   EDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK"
FT   gene            complement(508960..510417)
FT                   /locus_tag="CR539_02585"
FT   CDS_pept        complement(508960..510417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02585"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3L3S774"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3L3S774"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313139.1"
FT                   /protein_id="AUJ94420.1"
FT                   /translation="MKTPSQPRAIYYIVAIQIWEYFSFYGMRALLILYLTHQLGFDDNH
FT                   AISLFSAYASLVYVTPILGGWLADRLLGNRTAVIAGALLMTLGHVVLGIDTNSTFSLYL
FT                   ALAIIICGYGLFKSNISCLLGELYDENDHRRDGGFSLLYAAGNIGSIAAPIACGLAAQW
FT                   YGWHVGFALAGGGMFIGLLIFLSGHRHFQSTRSMDKKALTSVKFALPVWSWLVVMLCLA
FT                   PVFFTLLLENDWSGYLLAIVCLIAAQIIARMMIKFPEHRRALWQIVLLMFVGTLFWVLA
FT                   QQGGSTISLFIDRFVNRQAFNIEVPTALFQSVNAIAVMLAGVVLAWLASPESHGNSTLR
FT                   VWLKFAFGLLLMACGFMLLAFDARHAAADGQASMGVMVSGLALMGFAELFIDPVAIAQI
FT                   TRLKMSGVLTGIYMLATGAVANWLAGVVAQQTTESQISGMAIAAYQRFFSQMGEWTLAC
FT                   VAIIVVLAFAARFLFSTPTNMIQESND"
FT   gene            complement(510476..512623)
FT                   /locus_tag="CR539_02590"
FT   CDS_pept        complement(510476..512623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02590"
FT                   /product="lysine decarboxylase inducible"
FT                   /EC_number="4.1.1.18"
FT                   /note="constitutive; catalyzes the formation of cadaverine
FT                   from lysine; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGK2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGK2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313140.1"
FT                   /protein_id="AUJ94421.1"
FT                   /translation="MNVIAILNHMGVYFKEEPIRELHRALERLNFQIVYPNDRDDLLKL
FT                   IENNARLCGVIFDWDKYNLELCEEISKMNENLPLYAFANTYSTLDVSLNDLRLQISFFE
FT                   YALGAAEDIANKIKQTTDEYINTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSLFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEQYIARVFNADRSYMVTNGTST
FT                   ANKIVGMYSAPAGSTILIDRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDFIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYEGKCGMSGGRVEGKVIYETQSTHKLLAAFSQASMIHVKGDVNEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLRTESDGWFFDVWQPDH
FT                   IDTTECWPLRSDSTWHGFKNIDNEHMYLDPIKVTLLTPGMEKDGTMSDFGIPASIVAKY
FT                   LDEHGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYRE
FT                   DPEFYENMRIQELAQNIHKLIVHHNLPDLMYRAFEVLPTMVMTPYAAFQKELHGMTEEV
FT                   YLDEMVGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKEESKK"
FT   gene            complement(512703..514037)
FT                   /gene="cadB"
FT                   /locus_tag="CR539_02595"
FT   CDS_pept        complement(512703..514037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadB"
FT                   /locus_tag="CR539_02595"
FT                   /product="cadaverine/lysine antiporter"
FT                   /note="antiporter protein responsible for lysine import and
FT                   cadaverine export; member of the lysine-dependent acid
FT                   resistance system 4 (AR4); inner membrane protein; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:Q7B9X2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:Q7B9X2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313141.1"
FT                   /protein_id="AUJ94422.1"
FT                   /translation="MSSAKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWII
FT                   SIIGAMSLAYVYARLATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPVLNDPVPAGIACIAIVWVFTFVNMLGGTWVSRLTTIGLVLVLIPVVMTAI
FT                   VGWHWFDAATYAANWNTADTTDGHAIIKSILLCLWAFVGVESAAVSTGMVKNPKRTVPL
FT                   ATMLGTGLAGIVYIAATQVLSGMYPSSVMAASGAPFAISASTILGNWAAPLVSAFTAFA
FT                   CLTSLGSWMMLVGQAGVRAANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLM
FT                   NSAGGKASDLFGELTGIAVLLTMLPYFYSCVDLIRFEGVNIRNFVSLICSVLGCVFCFI
FT                   ALMGASSFELAGTFIVSLIILMFYARKMHERQSHSMDNHTASNAH"
FT   gene            514267..514512
FT                   /pseudo
FT                   /locus_tag="CR539_02600"
FT   CDS_pept        514267..514512
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02600"
FT                   /product="hypothetical protein"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001348571.1"
FT   gene            complement(514403..515941)
FT                   /locus_tag="CR539_02605"
FT   CDS_pept        complement(514403..515941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02605"
FT                   /product="transcriptional regulator CadC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTB3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="InterPro:IPR040970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTB3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313142.1"
FT                   /protein_id="AUJ94423.1"
FT                   /translation="MQQPVVRVGEWLVTPSINQISRNGRQLTIEPRLIDLLVFFAQHSG
FT                   EVLSRDELIDNVWKRSIVTNHVVTQSISELRKSLKDNDEDSPVYIATVPKRGYKLMVPV
FT                   IWYSEEEGEEIMLSSPPPIPEAVPATDSPSHSLNIQNTATPPEQSPVKSKRFTTFWVWF
FT                   FFLLSLGICVALVAFSSLDTRLPMSKSRILLNPRDIDINMVNKSCNSWSSPYQLSYAIG
FT                   VGDLVATSLNTFSTFMVHDKINYNIDEPSSSGKTLSIAFVNQRQYRAQQCFMSIKLVDN
FT                   ADGSTMLDKRYVITNGNQLAIQNDLLESLSKALNQPWPQRMQETLQQILPHRGALLTNF
FT                   YQAHDYLLHGDDKSLNRASELLGEIVQSSPEFTYARAEKALVDIVRHSQHPLDEKQLAA
FT                   LNTEIDNIVTLPELNNLSIIYQIKAVSALVKGKTDESYQAINTGIDLEMSWLNYVLLGK
FT                   VYEMKGMNREAADAYLTAFNLRPGANTLYWIENGIFQTSVPYVVPYLDKFLASE"
FT   gene            516228..516446
FT                   /locus_tag="CR539_02610"
FT   CDS_pept        516228..516446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02610"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A066QD15"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000044747.1"
FT                   /protein_id="AUJ94424.1"
FT                   /translation="MSKRTDTFLFVLIQKISSVAVQTGVVLYGCVTLLMTSFDVQQHHG
FT                   VARHFTSVSAIAQEQIFPNWDMPANCW"
FT   gene            complement(516558..516633)
FT                   /locus_tag="CR539_02615"
FT   tRNA            complement(516558..516633)
FT                   /locus_tag="CR539_02615"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:516598..516600,aa:Phe,seq:gaa)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(516740..517315)
FT                   /locus_tag="CR539_02620"
FT   CDS_pept        complement(516740..517315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02620"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK72"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK72"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418558.2"
FT                   /protein_id="AUJ94425.1"
FT                   /translation="MQREDVLGEALKLLELQGIANTTLEMVAERVDYPLDELRRFWPDK
FT                   EAILYDALRYLSQQIDVWRRQLMLDETQTAEQKLLARYQALSECVKNNRYPGCLFIAAC
FT                   TFYPDPGHPIHQLADQQKSAAYDFTHELLTTLEVDDPAMVAKQMELVLEGCLSRMLVNR
FT                   SQADVDTAHRLAEDILRFARCRQGGALT"
FT   gene            complement(517352..519049)
FT                   /gene="dipZ"
FT                   /locus_tag="CR539_02625"
FT   CDS_pept        complement(517352..519049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dipZ"
FT                   /locus_tag="CR539_02625"
FT                   /product="protein-disulfide reductase DsbD"
FT                   /EC_number="1.8.1.8"
FT                   /note="two electrons are transferred from cytoplasmic NADPH
FT                   to thioredoxin and then to the inner membrane protein DsbD
FT                   which keeps the disulfide isomerase DsbC in a reduced state
FT                   in the oxidizing periplasm; DsbC in turns rearranges
FT                   incorrectly made disulfide bonds in the periplasm; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTU4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTU4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418559.1"
FT                   /protein_id="AUJ94426.1"
FT                   /translation="MAQRIFTLILLLCSTSVFAGLFDAPGRSQFVPADQAFAFDFQQNQ
FT                   HDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPV
FT                   TINQASAGATLTVTYQGCADAGFCYPPETKTVPLSEVVANNAASQPVSVPQQEQPTAQL
FT                   PFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLTFIYVQGMALTYT
FT                   ALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSMFGLFTLQLPSSLQTRLTLMSNR
FT                   QQGGSPGGVFIMGAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLYALGMGLPL
FT                   MLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLERVIGDIWGLRLWSALGVAFFG
FT                   WAFITSLQAKRGWMHVVQIILLAAALVSVRPLQDWAFGATHTAQTQTHLNFTQIKTVDE
FT                   LNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQD
FT                   VALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQP"
FT   gene            complement(519025..519363)
FT                   /locus_tag="CR539_02630"
FT   CDS_pept        complement(519025..519363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02630"
FT                   /product="divalent-cation tolerance protein CutA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGH7"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313145.1"
FT                   /protein_id="AUJ94427.1"
FT                   /translation="MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPG
FT                   ATSLYYWEGKLEQEYEVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYL
FT                   SWLNASLR"
FT   gene            complement(519479..520780)
FT                   /locus_tag="CR539_02635"
FT   CDS_pept        complement(519479..520780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02635"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuA"
FT                   /note="functions in anaerobic transport of C4-dicarboxylate
FT                   compounds such as fumarate; similar to dcuB; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:C3SGH2"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGH2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313146.1"
FT                   /protein_id="AUJ94428.1"
FT                   /translation="MLVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNI
FT                   PFDVISIIMAVIAAISAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGT
FT                   GNISLATLPVIAEVAKEQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGIS
FT                   YLHLLSVVIPSTLLAVLVMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSG
FT                   AKTSVWLFLLGVVGVVIYAIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDT
FT                   DNILNSSTFKAGMSACICILGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFA
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGKFVFNHPFFIPGTLGVALAVCFGFVLGSFML"
FT   gene            complement(520898..522334)
FT                   /gene="aspA"
FT                   /locus_tag="CR539_02640"
FT   CDS_pept        complement(520898..522334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="CR539_02640"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK76"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK76"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313147.2"
FT                   /protein_id="AUJ94429.1"
FT                   /translation="MSNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIP
FT                   EFVRGMVMVKKAAAMANKELQTIPKSVANAIIAACDEVLNNGKCMDQFPVDVYQGGAGT
FT                   SVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKL
FT                   VDAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTA
FT                   ELLLEVNLGATAIGTGLNTPKEYSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVH
FT                   GALKRLAVKMSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKE
FT                   VCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFS
FT                   VQNLMHPAYKAKRYTDESEQ"
FT   gene            522671..523147
FT                   /locus_tag="CR539_02645"
FT   CDS_pept        522671..523147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02645"
FT                   /product="membrane protein FxsA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTP7"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTP7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313148.1"
FT                   /protein_id="AUJ94430.1"
FT                   /translation="MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMS
FT                   LVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPV
FT                   QKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDDRDHLDHKDDRQD"
FT   gene            complement(523163..524419)
FT                   /locus_tag="CR539_02650"
FT   CDS_pept        complement(523163..524419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02650"
FT                   /product="L-methionine/branched-chain amino acid
FT                   transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J8XQ32"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J8XQ32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415275.1"
FT                   /protein_id="AUJ94431.1"
FT                   /translation="MSGLKQELGLAQGIGLLSTSLLGTGVFAVPALAALVAGNNSLWAW
FT                   PVLIILVFPIAIVFAILGRHYPSAGGVAHFVGMAFGSRLERVTGWLFLSVIPVGLPAAL
FT                   QIAAGFGQAMFGWHSWQLLLAELGTLALVWYIGTRGASSSANLQTVIAGLIVALIVAIW
FT                   WAGDIKPASIPFPAPGNIELTGLFAALSVMFWCFVGLEAFAHLASEFKNPERDFPRALM
FT                   IGLLLAGLVYWGCTVVVLHFDAYGEQMAAAASLPKIVVQLFGVGALWIACVIGYLACFA
FT                   SLNIYIQSFARLVWSQAQHNPDHYLARLSSRHIPNNALNAVLGCCVVSTLVIHALEINL
FT                   DALIIYANGIFIMIYLLCMLAGCKLLQGRYRLLAVVGGLLCVLLLAMVGWKSLYALIML
FT                   AGLWLFLPKRKTPENGITT"
FT   gene            524695..524988
FT                   /gene="groES"
FT                   /locus_tag="CR539_02655"
FT   CDS_pept        524695..524988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="CR539_02655"
FT                   /product="co-chaperone GroES"
FT                   /note="10 kDa chaperonin; Cpn10; GroES; forms
FT                   homoheptameric ring; binds to one or both ends of the GroEL
FT                   double barrel in the presence of adenine nucleotides
FT                   capping it; folding of unfolded substrates initiates in a
FT                   GroEL-substrate bound and capped by GroES; release of the
FT                   folded substrate is dependent on ATP binding and hydrolysis
FT                   in the trans ring; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:Q7BGE6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="PDB:4PKN"
FT                   /db_xref="PDB:4PKO"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BGE6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313150.1"
FT                   /protein_id="AUJ94432.1"
FT                   /translation="MNIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEVLAVGN
FT                   GRILENGEVKPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA"
FT   gene            525032..526678
FT                   /gene="groL"
FT                   /locus_tag="CR539_02660"
FT   CDS_pept        525032..526678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="CR539_02660"
FT                   /product="molecular chaperone GroEL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:Q548M1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PDB:4HEL"
FT                   /db_xref="PDB:4KI8"
FT                   /db_xref="PDB:4PKN"
FT                   /db_xref="PDB:4PKO"
FT                   /db_xref="UniProtKB/TrEMBL:Q548M1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005120975.1"
FT                   /protein_id="AUJ94433.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIA
FT                   EAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEA
FT                   AIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNC
FT                   GEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKNDAADLGAAGGMGGMGGMGGMM"
FT   gene            526816..527169
FT                   /locus_tag="CR539_02665"
FT   CDS_pept        526816..527169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02665"
FT                   /product="DUF4156 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK81"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418568.2"
FT                   /protein_id="AUJ94434.1"
FT                   /translation="MHVKYLAGIVGAALLMAGCSSSNELSAAGQSVRIVDEQPGAECQL
FT                   IGTATGKQSNWLSGQHGEEGGSMRGAANDLRNQAAAMGGNVIYGISSPSQGMLSSFVPT
FT                   DSQIIGQVYKCPN"
FT   gene            complement(527362..528231)
FT                   /locus_tag="CR539_02670"
FT   CDS_pept        complement(527362..528231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02670"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR031810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTC7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313153.1"
FT                   /protein_id="AUJ94435.1"
FT                   /translation="MAISIKGVNTGVIRKSNNFIVLALKIKEPRNKESLFFMSVMELRD
FT                   LLIALESRLHQKHKLDAAARLQYEQARDKVIKKMAENIPEILVDELKNADINRRVNTLE
FT                   LTDNQGENLTFVLTLHDGSKCELVVNELQIEMLARAIIHAINNAEMRELALRITSLLDF
FT                   LPLYDVDCQQNGNLEYDTYSQPEWKHNLFDHYLAVLYRFKDESGKEQFSGAVVKTREAT
FT                   PGKEIEAITRRMLDFSPRLKKLAGVPCQVYVRTVAANNAQPLTQDQCLRALHHLRVQST
FT                   SKTAPQAK"
FT   gene            complement(528466..529494)
FT                   /gene="epmB"
FT                   /locus_tag="CR539_02675"
FT   CDS_pept        complement(528466..529494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epmB"
FT                   /locus_tag="CR539_02675"
FT                   /product="EF-P beta-lysylation protein EpmB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTV4"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTV4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313154.1"
FT                   /protein_id="AUJ94436.1"
FT                   /translation="MAHIVTLNTPSREDWLTQLADVVTDPDELLRLLNIDADEKLLAGR
FT                   NAKKLFALRVPRSFIDRMEKGNPDDPLLRQVITSQDEFAIAPGFSTDPLEEQHSVVPGL
FT                   LHKYHNRALLLVKGGCAVNCRYCFRRHFPYAENQGNKRNWQTALEYVAAHPELDEMIFS
FT                   GGDPLMAKDHELDWLLTQLEAIPHIKRLRIHSRLPIVIPARITDALVERFSHSTLQILL
FT                   VNHINHANEIDETFRQAMAKLRRAGVTLLNQSVLLRGVNDNAQTLANLSNALFDAGVMP
FT                   YYLHVLDKVQGAAHFMVSDDEARQIMRELLTLVSGYLVPKLAREIGGEPSKTPLDLQLR
FT                   QQ"
FT   gene            529536..530102
FT                   /gene="efp"
FT                   /locus_tag="CR539_02680"
FT   CDS_pept        529536..530102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="CR539_02680"
FT                   /product="elongation factor P"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGD7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGD7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004871142.1"
FT                   /protein_id="AUJ94437.1"
FT                   /translation="MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRR
FT                   LLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNA
FT                   KWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            530154..530279
FT                   /locus_tag="CR539_02685"
FT   CDS_pept        530154..530279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02685"
FT                   /product="entericidin A"
FT                   /note="acts as and antidote to the bacteriolytic
FT                   entericidin B in the EcnAB toxin-antitoxin complex; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:E2QK85"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK85"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026283.1"
FT                   /protein_id="AUJ94438.1"
FT                   /translation="MMKRLIVLVLLASTLLTGCNTARGFGEDIKHLGNSISRAAS"
FT   gene            530390..530536
FT                   /locus_tag="CR539_02690"
FT   CDS_pept        530390..530536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02690"
FT                   /product="entericidin B"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK86"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK86"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_944583.1"
FT                   /protein_id="AUJ94439.1"
FT                   /translation="MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATK
FT                   AQQ"
FT   gene            530717..531034
FT                   /locus_tag="CR539_02695"
FT   CDS_pept        530717..531034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02695"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3WGG4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3WGG4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418572.4"
FT                   /protein_id="AUJ94440.1"
FT                   /translation="MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMAL
FT                   LAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLST
FT                   H"
FT   gene            complement(531031..531564)
FT                   /locus_tag="CR539_02700"
FT   CDS_pept        complement(531031..531564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02700"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK88"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK88"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415284.1"
FT                   /protein_id="AUJ94441.1"
FT                   /translation="MRLLPLVAAATAAFLVVACSSPTPPRGVTVVNNFDAKRYLGTWYE
FT                   IARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDREMWQQSEGKAYFTGAPTRAAL
FT                   KVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREG
FT                   FDVSKFIWVQQPGS"
FT   gene            complement(531653..532786)
FT                   /locus_tag="CR539_02705"
FT   CDS_pept        complement(531653..532786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02705"
FT                   /product="BlaEC family class C beta-lactamase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A246NUS8"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A246NUS8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001359668.1"
FT                   /protein_id="AUJ94442.1"
FT                   /translation="MFKTTLCALLITASCSTFAAPQKINDIVHRTITPLIEQQKIPGMA
FT                   VAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDP
FT                   ATKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQ
FT                   RLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREG
FT                   KAVHVSPGALDAEAYGVKSTIEDMARWVQINLKPLDINEKTLQQGIQLAQSRYWQTGDM
FT                   YQGLGWEMLDWPVNPDIIVNGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGS
FT                   YVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ"
FT   gene            complement(532849..533208)
FT                   /locus_tag="CR539_02710"
FT   CDS_pept        complement(532849..533208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02710"
FT                   /product="fumarate reductase subunit D"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGC2"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGC2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313159.1"
FT                   /protein_id="AUJ94443.1"
FT                   /translation="MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLF
FT                   PGDALSYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGL
FT                   AAILTVVTLIGVVTI"
FT   gene            complement(533219..533614)
FT                   /locus_tag="CR539_02715"
FT   CDS_pept        complement(533219..533614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02715"
FT                   /product="fumarate reductase subunit C"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGB7"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGB7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313160.1"
FT                   /protein_id="AUJ94444.1"
FT                   /translation="MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIF
FT                   GLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKM
FT                   GPEPIIKSLWAVTVVATIVILFVALYW"
FT   gene            complement(533625..534359)
FT                   /locus_tag="CR539_02720"
FT   CDS_pept        complement(533625..534359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02720"
FT                   /product="fumarate reductase iron-sulfur subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGB2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313161.1"
FT                   /protein_id="AUJ94445.1"
FT                   /translation="MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESSKDFLIATLKPR"
FT   gene            complement(534352..536160)
FT                   /locus_tag="CR539_02725"
FT   CDS_pept        complement(534352..536160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02725"
FT                   /product="fumarate reductase (quinol) flavoprotein subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SGA7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C3SGA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418578.1"
FT                   /protein_id="AUJ94446.1"
FT                   /translation="MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSH
FT                   TVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPW
FT                   SRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILV
FT                   DDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGL
FT                   AMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAE
FT                   CMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPP
FT                   AKRVYGGEADAADKAEAANKKEKANG"
FT   gene            536485..537462
FT                   /locus_tag="CR539_02730"
FT   CDS_pept        536485..537462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02730"
FT                   /product="elongation factor P lysine(34) lysyltransferase"
FT                   /EC_number="6.1.1.6"
FT                   /note="poxA; regulates pyruvate oxidase poxB; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUR2"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUR2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000004771.1"
FT                   /protein_id="AUJ94447.1"
FT                   /translation="MSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQ
FT                   ATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEM
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLS
FT                   ADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPLHPIDQ
FT                   NLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA"
FT   gene            537681..539183
FT                   /locus_tag="CR539_02735"
FT   CDS_pept        537681..539183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02735"
FT                   /product="glutamate/gamma-aminobutyrate family transporter
FT                   YjeM"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTQ8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTQ8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415291.1"
FT                   /protein_id="AUJ94448.1"
FT                   /translation="MPHTIKKMSLIGLILMIFTSVFGFANSPSAYYLMGYSAIPFYIFS
FT                   ALLFFIPFALMMAEMGAAYRKEEGGIYSWMNNSVGPRFAFIGTFMWFSSYIIWMVSTSA
FT                   KVWVPFSTFLYGSDMTQHWRIAGLEPTQVVGLLAVAWMILVTVVASKGINKIARITAVG
FT                   GIAVMCLNLVLLLVSITILLLNGGHFAQDINFLASPNPGYQSGLAMLSFVVFAIFAYGG
FT                   IEAVGGLADKTENPEKNFAKGIVFAAIVISIGYSLAIFLWGVSTNWQQVLSNGSVNLGN
FT                   ITYVLMKSLGVTLGNALHLSPEASLSLGVWFARITGLSMFLAYTGAFFTLCYSPLKAII
FT                   QGTPKALWPEPMTHLNAMGMPSIAMWMQCGLVTVFILLVSFGGGTASAFFNKLTLMANV
FT                   SMTLPYLFLALAFPFFKARQDLDRPFVIFKTRMSAMIATVVVVLVVTFANVFTIIQPVV
FT                   EAGDWDSTLWMIGGPVFFSLLAMAIYQNYCSRMANKPELALD"
FT   gene            complement(539334..542657)
FT                   /locus_tag="CR539_02740"
FT   CDS_pept        complement(539334..542657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02740"
FT                   /product="miniconductance mechanosensitive channel MscM"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1Y2XK18"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y2XK18"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313165.1"
FT                   /protein_id="AUJ94449.1"
FT                   /translation="MRLIITFLMAWCLSWGAYAATAPDSKQITQELEQAKAAKPAQPEV
FT                   IEALQSALNALEERKGSLERIKQYQEVIDNYPKLSATLRAQLNNMRDEPRSVSPGMSTD
FT                   ALNQEILQVSSQLLDKSRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLGTLT
FT                   GNTPLNQAQNFALQSDSARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYL
FT                   QALRNQLNSQRQLEAERALESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDL
FT                   VASQQRQAASQTLQVRQALNTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEM
FT                   AQLRVQRLRYEDLLNKQPLLRQIHQADGQPLTAEQNRILEAQLRTQRELLNSLLQGGDT
FT                   LLLELTKLKVSNGQLEDALKEVNEATHRYLFWTSDVRPMTIAWPLEIAQDLRRLISLDT
FT                   FSQLGKASVMMLTSKETILPLFGALILVGCSIYSRRYFTRFLERSAAKVGKVTQDHFWL
FT                   TLRTLFWSILVASPLPVLWMTLGYGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFA
FT                   RPNGLFIAHFGWPRERVSRGMRYYLMSIGLIVPLIMALMMFDNLDDREFSGSLGRLCFI
FT                   LICGALAVVTLSLKKAGIPLYLNKEGSGDNITNHMLWNMMIGAPLVAILASAVGYLATA
FT                   QALLARLETSVAIWFLLLVVYHVIRRWMLIQRRRLAFDRAKHRRAEMLAQRARGEEEAH
FT                   HHSSPEGAIEVDESEVDLDAISAQSLRLVRSILMLIALLSVIVLWSEIHSAFGFLENIS
FT                   LWDVTSTVQGVESLEPITLGAVLIAILVFIITTQLVRNLPALLELAILQHLDLTPGTGY
FT                   AITTITKYLLMLIGGLVGFSMIGIEWSKLQWLVAALGVGLGFGLQEIFANFISGLIILF
FT                   EKPIRIGDTVTIRDLTGSVTKINTRATTISDWDRKEIIVPNKAFITEQFINWSLSDSVT
FT                   RVVLTIPAPADANSEEVTEILLTAARRCSLVIDNPAPEVFLVDLQQGIQIFELRIYAAE
FT                   MGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQMRLESLNGKQTGRTLTSAGKGRQAGSL
FT                   "
FT   gene            complement(542679..543647)
FT                   /gene="psd"
FT                   /locus_tag="CR539_02745"
FT   CDS_pept        complement(542679..543647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="CR539_02745"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG87"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313166.1"
FT                   /protein_id="AUJ94450.1"
FT                   /translation="MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYY
FT                   KVDMKEAQKPDTASYRTFNEFFVRPLRDEVRPIDTDPNVLVMPADGVISQLGKIEEDKI
FT                   LQAKGHNYSLEALLAGNYLMADLFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGD
FT                   LFSVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GIIKRWTWPAGENDGSVALLKGQEMGRFKLGSTVINLFAPGKVNLVEQLESLSVTKIGQ
FT                   PLAVSTETFVTPDAEPAPLPAEEIEAEHDASPLVDDKKDQV"
FT   gene            complement(543744..544796)
FT                   /locus_tag="CR539_02750"
FT   CDS_pept        complement(543744..544796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02750"
FT                   /product="ribosome small subunit-dependent GTPase"
FT                   /note="EngC; RsgA; CpgA; circularly permuted GTPase;
FT                   ribosome small subunit-dependent GTPase A; has the pattern
FT                   G4-G1-G3 as opposed to other GTPases; interacts strongly
FT                   with 30S ribosome which stimulates GTPase activity; Derived
FT                   by automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EV46"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EV46"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415294.1"
FT                   /protein_id="AUJ94451.1"
FT                   /translation="MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVI
FT                   SRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERT
FT                   SVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKID
FT                   LLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSS
FT                   LLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDPE
FT                   QITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVK
FT                   TRKNFSDTDD"
FT   gene            544743..544865
FT                   /locus_tag="CR539_02755"
FT   CDS_pept        544743..544865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02755"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A228U0B3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001398277.1"
FT                   /protein_id="AUJ94452.1"
FT                   /translation="MIGVHAALLAFGEFIFTQSYRLLVAPDGQNIYDTRNCGSI"
FT   gene            544891..545436
FT                   /locus_tag="CR539_02760"
FT   CDS_pept        544891..545436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02760"
FT                   /product="oligoribonuclease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QK99"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E2QK99"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418586.4"
FT                   /protein_id="AUJ94453.1"
FT                   /translation="MSANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPT
FT                   IAVHQSDEQLALMDDWNVRTHTASGLVERVKASTMGDREAELATLEFLKQWVPAGKSPI
FT                   CGNSIGQDRRFLFKYMPELEAYFHYRYLDVSTLKELARRWKPEILDGFTKQGTHQAMDD
FT                   IRESVAELAYYREHFIKL"
FT   gene            545647..545722
FT                   /locus_tag="CR539_02765"
FT   tRNA            545647..545722
FT                   /locus_tag="CR539_02765"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:545680..545682,aa:Gly,seq:gcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            545759..545834
FT                   /locus_tag="CR539_02770"
FT   tRNA            545759..545834
FT                   /locus_tag="CR539_02770"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:545792..545794,aa:Gly,seq:gcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            545870..545945
FT                   /locus_tag="CR539_02775"
FT   tRNA            545870..545945
FT                   /locus_tag="CR539_02775"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:545903..545905,aa:Gly,seq:gcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(546215..547354)
FT                   /gene="queG"
FT                   /locus_tag="CR539_02780"
FT   CDS_pept        complement(546215..547354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queG"
FT                   /locus_tag="CR539_02780"
FT                   /product="tRNA epoxyqueuosine(34) reductase QueG"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG67"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG67"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313169.1"
FT                   /protein_id="AUJ94454.1"
FT                   /translation="MSEPLDLNQLAQKIKQWGLELGFQQVGITDTDLSESEPKLQAWLD
FT                   KQYHGEMDWMARHGMLRARPHELLPGTLRVISVRMNYLPANAAFASTLKNPKLGYVSRY
FT                   ALGRDYHKLLRNRLKKLGEMIQQHCVSLNFRPFVDSAPILERPLAEKAGLGWTGKHSLI
FT                   LNREAGSFFFLGELLVDIPLPVDQPVEEGCGKCVACMTICPTGAIVEPYTVDARRCISY
FT                   LTIELEGAIPEELRPLMGNRIYGCDDCQLICPWNRYSQLTTEDDFSPRKPLHAPELIEL
FT                   FAWSEEKFLKVTEGSAIRRIGHLRWLRNIAVALGNAPWDETILAALESRKGEHPLLDEH
FT                   IAWAMAQQIERRNACIVEVQLPKKQRLVRVIEKGLPRDA"
FT   gene            547353..548900
FT                   /locus_tag="CR539_02785"
FT   CDS_pept        547353..548900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02785"
FT                   /product="bifunctional ADP-dependent NAD(P)H-hydrate
FT                   dehydratase/NAD(P)H-hydrate epimerase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTE3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTE3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418588.1"
FT                   /protein_id="AUJ94455.1"
FT                   /translation="MTDHTMKKNPVSIPHTVWYADDIRRGEREAADVLGLTLYELMLRA
FT                   GEAAFQVCRTAYPDARHWLVLCGHGNNGGDGYVVARLAKAVGIEVTLLAQDSDKPLPEE
FT                   AALAREAWLNAGGEIHASNIVWPESVDLIVDALLGTGLQQAPRESISQLIDHANSHPAP
FT                   IVAVDIPSGLLAETGATPGAVINADHTITFIALKPGLLTGKARDVTGQLHFDSLGLDSW
FT                   LAGQETKIQRFSAEQLSHWLKPRRPTSHKGDHGRLVIIGGDHGTAGAIRMTGEAALRAG
FT                   AGLVRVLTRSENIAPLLTARPELMVHELTMDSLTESLEWADVVVIGPGLGQQEWGKKAL
FT                   QKVENFRKPMLWDADALNLLAINPDKRHNRVITPHPGEAARLLGCSVAEIESDRLLSAQ
FT                   RLVQRYGGVAVLKGAGTVVAAHPDLLGIIDAGNAGMASGGMGDVLSGIIGALLGQKLSP
FT                   YDAACAGCVAHGAAADVLAARFGTRGMLATDLFSTLQRIVNPEVTDKNHDESSNSAP"
FT   gene            548872..549333
FT                   /locus_tag="CR539_02790"
FT   CDS_pept        548872..549333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02790"
FT                   /product="tRNA
FT                   (N6-adenosine(37)-N6)-threonylcarbamoyltransferase complex
FT                   ATPase TsaE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG62"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG62"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313171.1"
FT                   /protein_id="AUJ94456.1"
FT                   /translation="MMNRVIPLPDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFS
FT                   RGFLQALGHQGNVKSPTYTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAI
FT                   CLVEWPQQGTGVLPDPDVEIHIDYQAQGREARVSAVSSAGELLLARLAG"
FT   gene            549352..550680
FT                   /locus_tag="CR539_02795"
FT   CDS_pept        549352..550680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02795"
FT                   /product="N-acetylmuramoyl-L-alanine amidase AmiB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUS3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUS3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415299.1"
FT                   /protein_id="AUJ94457.1"
FT                   /translation="MMYRIRNWLVATLLLLCAQVGAATLSDIQVSNGNQQARITLSFIG
FT                   DPDYAFSHQSKRTVALDIKQTGVIQGLPLLFSGNNLVKAIRSGTPKDAQTLRLVVDLTE
FT                   NGKTEAVKRQNGSNYTVVFTINADVPPPPPVVAKRVETPAVVAPRVSEPARNPFKTESN
FT                   RTTGVISSNTVTRPAARATANTGDKIIIAIDAGHGGQDPGAIGPGGTREKNVTIAIARK
FT                   LRTLLNDDPMFKGVLTRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNRSATGASVW
FT                   VLSNRRANSEMASWLEQHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQFGHSQRVGYD
FT                   VATSMISQLQRIGEIHKRRPEHASLGVLRSPDIPSVLVETGFISNNSEERLLASDDYQQ
FT                   QLAEAIYKGLRNYFLAHPMQSAPQGATAQTASTVTTPDRTLPN"
FT   gene            550690..552537
FT                   /locus_tag="CR539_02800"
FT   CDS_pept        550690..552537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02800"
FT                   /product="DNA mismatch repair endonuclease MutL"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTT5"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTT5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313173.1"
FT                   /protein_id="AUJ94458.1"
FT                   /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISS
FT                   VSRLTLTSRTAEQQEAWQAYAEGRDMDVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLE
FT                   QALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLG
FT                   ADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPL
FT                   DDEPQPAPRPIPENRVAAGRNHFAEPAAREPVASRYSPAPASGSRPAAPWPNAQPGYQK
FT                   QQGEVYRQLLQTPAPMQKPKAPEPQEPALAANSQSFGRVLTIVHSDCALLERDGNISLL
FT                   ALPVAERWLRQAQLTPGEASVCAQPLLIPLRLKVSGEEKSALEKAQSALAELGIEFQSD
FT                   AQHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIARNLMSEHAQWSMAQ
FT                   AITLLADVERLCPQLVKTPPGGLLQSVDLHPAIKALKDE"
FT   gene            552530..553480
FT                   /locus_tag="CR539_02805"
FT   CDS_pept        552530..553480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02805"
FT                   /product="tRNA (adenosine(37)-N6)-dimethylallyltransferase
FT                   MiaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG50"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG50"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415301.1"
FT                   /protein_id="AUJ94459.1"
FT                   /translation="MSDISKASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSAL
FT                   IYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQML
FT                   ASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKR
FT                   QITWLRGWEGVHWLDSEKPEQARDEVLQVVGAIAG"
FT   gene            553566..553874
FT                   /locus_tag="CR539_02810"
FT   CDS_pept        553566..553874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02810"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C1IFD2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="PDB:4PNO"
FT                   /db_xref="PDB:4QVC"
FT                   /db_xref="PDB:4QVD"
FT                   /db_xref="UniProtKB/TrEMBL:C1IFD2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313175.1"
FT                   /protein_id="AUJ94460.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE"
FT   gene            553951..555231
FT                   /locus_tag="CR539_02815"
FT   CDS_pept        553951..555231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02815"
FT                   /product="GTPase HflX"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG37"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG37"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313176.1"
FT                   /protein_id="AUJ94461.1"
FT                   /translation="MFDRYDAGEQAVLVHIYFTQDKDMEDLQEFESLVSSAGVEALQVI
FT                   TGSRKAPHPKYFVGEGKAVEIAEAVKATGASVVLFDHALSPAQERNLERLCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRNRIVQIQSRLERVEKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITEARV
FT                   YAADQLFATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQATLLL
FT                   HVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPIRV
FT                   WLSAQTGAGIPQLFQALTERLSGEVAQHTLRLPPQEGRLRSRFYQLQAIEKEWMEEDGS
FT                   VSLQVRMPIVDWRRLCKQEPALIDYLI"
FT   gene            555317..556576
FT                   /locus_tag="CR539_02820"
FT   CDS_pept        555317..556576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02820"
FT                   /product="protease modulator HflK"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG32"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG32"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313177.1"
FT                   /protein_id="AUJ94462.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIF
FT                   RKLSKKLGGLGGGKGTGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAE
FT                   RGVVTRFGKFSHLVEPGLNWKPTFIDEVKPVNVEAVRELAASGVMLTSDENVVRVEMNV
FT                   QYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEE
FT                   TIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANG
FT                   QAQRILEEARAYKAQTILEAQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRK
FT                   VLVNDKGGNLMVLPLDQMLKGGNAPAAKSDNGASNLLRLPPASSSTTSGASNTSSTSQG
FT                   DIMDQRRANAQRNDYQRQGE"
FT   gene            556579..557583
FT                   /locus_tag="CR539_02825"
FT   CDS_pept        556579..557583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02825"
FT                   /product="protease modulator HflC"
FT                   /note="with HflK inhibits proteolysis of lambda cII protein
FT                   by FtsH; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG27"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG27"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313178.1"
FT                   /protein_id="AUJ94463.1"
FT                   /translation="MRKSVIAIIIIVLVVLYMSVFVVKEGERGITLRFGKVLRDDDNKP
FT                   LVYEPGLHFKIPFIETVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDISQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGSAGTE
FT                   DEVTTPAADNAIAEAAERVTAETKGKVPVINPNSMAALGIEVVDVRIKQINLPTEVSEA
FT                   IYNRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQGRIMRGEGDAEAAK
FT                   LFADAFSKDPDFYAFIRSLRAYENSFSGNQDVMVMSPDSDFFRYMKTPTSATR"
FT   gene            557665..557862
FT                   /locus_tag="CR539_02830"
FT   CDS_pept        557665..557862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02830"
FT                   /product="DUF2065 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2I6EV58"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2I6EV58"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313179.1"
FT                   /protein_id="AUJ94464.1"
FT                   /translation="MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMSNLPDNILRRF
FT                   GGGLVVAGVVVYYMLRKTIG"
FT   gene            557966..559264
FT                   /gene="purA"
FT                   /locus_tag="CR539_02835"
FT   CDS_pept        557966..559264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="CR539_02835"
FT                   /product="adenylosuccinate synthetase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG17"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG17"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_019842885.1"
FT                   /protein_id="AUJ94465.1"
FT                   /translation="MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEAC
FT                   PLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLK
FT                   EVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPT
FT                   ELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLK
FT                   EVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNY
FT                   IKRIEELTGVPIDIISTGPDRTETMILRDPFDA"
FT   gene            559469..559894
FT                   /locus_tag="CR539_02840"
FT   CDS_pept        559469..559894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02840"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG12"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG12"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005134424.1"
FT                   /protein_id="AUJ94466.1"
FT                   /translation="MQLTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKI
FT                   INQLSRAGYVTAVRGKNGGIRLGKPASAIRIGDVVRELEPLSLVNCSSEFCHITPACRL
FT                   KQALSKAVQSFLTELDNYTLADLVEENQPLYKLLLVE"
FT   gene            559933..562374
FT                   /locus_tag="CR539_02845"
FT   CDS_pept        559933..562374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02845"
FT                   /product="ribonuclease R"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MUV0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUV0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418600.4"
FT                   /protein_id="AUJ94467.1"
FT                   /translation="MSQDPFQEREAEKYANPIPSREFILEHLTKREKPASRDELAVELH
FT                   IEGEEQLEGLRRRLRAMERDGQLVFTRRQCYALPERLDLVKGTVIGHRDGYGFLRVEGR
FT                   KDDLYLSSEQMKTCIHGDQVLAQPLGADRKGRREARIVRVLVPKTSQIVGRYFTEAGVG
FT                   FVVPDDSRLSFDILIPPDQIMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDIALRTHEIPYIWPQAVEQQVAGLKEEVPEEAKAGRVDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPPTPLDREARNRGTSVYFPSQVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTVSSKGRLTGYKFYEAVMSSHARLTYTKVWHILQGDQDLREQ
FT                   YAPLVKHLEELHNLYKVLDKAREERGGISFESEEAKFIFNAERRIERIEQTQRNDAHKL
FT                   IEECMILANISAARFVEKAKEPALFRIHDKPSTEAITSFRSVLAELGLELPGGNKPEPR
FT                   DYAELLESVADRPDAEMLQTMLLRSMKQAIYDPENRGHFGLALQSYAHFTSPIRRYPDL
FT                   TLHRAIKYLSAKEQGHQGNTTETGGYHYSMEEMLQLGQHCSMAERRADEATRDVADWLK
FT                   CDFMLDQVGNVFKGVISSVTGFGFFVRLDDLFIDGLVHVSSLDNDYYRFDQVGQRLMGE
FT                   SSGQTYRLGDRVEVRVEAVNMDERKIDFSLISSERAPRNVGKTAREKAKKGDAGKKGGK
FT                   RRQVGKKVNFEPDSAFRGEKKTKPKAAKKDARKAKKPSAKTQKIAAATKAKRAAKKKVA
FT                   E"
FT   gene            562555..563286
FT                   /locus_tag="CR539_02850"
FT   CDS_pept        562555..563286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02850"
FT                   /product="23S rRNA (guanosine(2251)-2'-O)-methyltransferase
FT                   RlmB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SG02"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C3SG02"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313183.1"
FT                   /protein_id="AUJ94468.1"
FT                   /translation="MSEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALES
FT                   QGVVIQLANRQYLDEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRM
FT                   LQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGICLFEAVRQRS"
FT   gene            complement(563257..563331)
FT                   /pseudo
FT                   /locus_tag="CR539_02855"
FT   CDS_pept        complement(563257..563331)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02855"
FT                   /product="transposase"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005082075.1"
FT   gene            563413..563814
FT                   /locus_tag="CR539_02860"
FT   CDS_pept        563413..563814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02860"
FT                   /product="DUF2170 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B1FY06"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313184.1"
FT                   /protein_id="AUJ94469.1"
FT                   /translation="MTWNPLALATALQTVPEQNIDVTNSENALIIKMNDYGDLQINILF
FT                   TSRQMIIETFICPVSSISNPDKFNTFLLRNQKMMPLSSVGISSVQQEEYYIVFGALSLK
FT                   SSLEDILLEITSLVDNALDLAEITEEYSH"
FT   gene            563833..564531
FT                   /locus_tag="CR539_02865"
FT   CDS_pept        563833..564531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02865"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:J7QB71"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418603.1"
FT                   /protein_id="AUJ94470.1"
FT                   /translation="MGILKSLFTLGKSFISQAEESIEETQGVRMLEQHIRDAKAELDKA
FT                   GKSRVDLLARVKLSHDKLKDLRERKASLEARALEALSKNVNPSLINEVAEEIARLENLI
FT                   TAEEQVLSNLEVSRDGVEKAVTATAQRIAQFEQQMEVVKATEAMQRAQQAVTTSTVGAS
FT                   SSVSTAAESLKRLQTRQAERQARLDAAAQLEKVADGRDLDEKLAEAGIGGSNKSSAQDV
FT                   LARLQRQQGE"
FT   gene            564582..565241
FT                   /locus_tag="CR539_02870"
FT   CDS_pept        564582..565241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02870"
FT                   /product="DUF2491 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR019621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTD1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418604.1"
FT                   /protein_id="AUJ94471.1"
FT                   /translation="MSGFFQRLFGKDNKPAIARGPLGLHLNSGFTLDTLAFRLLEDELL
FT                   IALPGEEFTVAAVSHIDLGGGSQIFRYYTSGNEFLQINTTGGEDIDDIDDIKLFVYEES
FT                   YGISKESHWREAINAKTMGAMTLNWQEKRWQRFFNSEEPGNIEPVYMLEKVENQNHAKW
FT                   EVHNFTMGYQRQVTEDTYEYLLLNGEESFNDLGEPEWLFSRALGVDIPLTSLHIIG"
FT   gene            565259..565657
FT                   /locus_tag="CR539_02875"
FT   CDS_pept        565259..565657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02875"
FT                   /product="DUF350 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFY2"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFY2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313187.1"
FT                   /protein_id="AUJ94472.1"
FT                   /translation="MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNT
FT                   AASLAFSGTLLGYVIPLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKI
FT                   INHNTAAGMFMGTAALAGGIFNAACMTW"
FT   gene            565667..566305
FT                   /locus_tag="CR539_02880"
FT   CDS_pept        565667..566305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02880"
FT                   /product="DUF1190 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B0V5W8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313188.1"
FT                   /protein_id="AUJ94473.1"
FT                   /translation="MARKRKSRNNSKIGHGAISRIGRPNNPFEPRRNRYAQKYLTLALM
FT                   GGAAFLIVKGWSESSDVDNDGDGTFYSTVQDCIDDGNNADICARGWNNAKAAFYADVPK
FT                   NMTQQNCQSKYENCYYDNVEQSWIPVVSGFLLSRVIRKDRDEQFVYNSGGSSFASRPVW
FT                   RNTSGDYSWRSGSGKKESYSSGGFTTRKASTVSRGGYGRSSSARGHWGG"
FT   gene            566308..567471
FT                   /locus_tag="CR539_02885"
FT   CDS_pept        566308..567471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02885"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTW2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313189.1"
FT                   /protein_id="AUJ94474.1"
FT                   /translation="MLRHNVPVRRDLDQIAADNGFDFHIIDNEIYWDESRAYRFTLRQI
FT                   EEQIEKPTAELHQMCLEVVDRAVKDEEILTQLAIPPLYWDVIAESWRARDPSLYGRMDF
FT                   AWCGNAPVKLLEYNADTPTSLYESAYFQWLWLEDARRSGIIPRDADQYNAIQERLISRF
FT                   SELYSREPFYFCCCQDTDEDRSTVLYLQDCAQQAGQESRFIYIEDLGLGVGGVLTDLDD
FT                   NVIQRAFKLYPLEWMMRDDNGPLLRKRREQWVEPLWKSILSNKGLMPLLWRFFPGHPNL
FT                   LASWFEGEKPQIAAGESYVRKPIYSREGGNVTIFDGQNNVVDHADGDYADEPMIYQAFQ
FT                   PLPRFGDSYTLIGSWIVDDEACGMGIREDNTLITKDTSRFIPHYIAG"
FT   gene            567555..569180
FT                   /locus_tag="CR539_02890"
FT   CDS_pept        567555..569180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02890"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTG3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTG3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418608.6"
FT                   /protein_id="AUJ94475.1"
FT                   /translation="MHWQTHTVFNQAIPLNNSNLYLSDGALCEAVTREGAGWDSDFLAS
FT                   IGQQLGTAESLELGRLANVNPPELLLYDAQGRRLDDVRFHPAWHLLMQALCTNRVHNLA
FT                   WEEDARSGTFVARAARFMLHAQVEAGSLCPITMTFAATPLLLQMLPAPFQDWTTPLLSD
FT                   RYDSHLLPGGQKRGLLIGMGMTEKQGGSDVMSNTTRAERLEDGSYRLVGHKWFFSVPQS
FT                   DAHLVLAQTAGGLSCFFVPRFLPDGQRNAIRLERLKDKLGNRSNASCEVEFQDAIGWLL
FT                   GQEGEGIRLILKMGGMTRFDCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHV
FT                   LSRMALQLEGQTALLFRLARAWDRRADAKEALWARLFTPAAKFVICKRGMPFVAEAMEV
FT                   LGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLSEAFVEVKG
FT                   QDRYFDRAVRRLQQQLRKPAEELGREITHQLFLLGCGAQMLKYASPPMAQAWCQVMLDT
FT                   RGGVRLSEQIQNDLLLRATGGVCV"
FT   gene            complement(569145..569237)
FT                   /pseudo
FT                   /locus_tag="CR539_02895"
FT   CDS_pept        complement(569145..569237)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02895"
FT                   /product="glutamate decarboxylase isozyme"
FT                   /note="incomplete; partial on complete genome; missing
FT                   start; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005021424.1"
FT   gene            complement(569297..569572)
FT                   /locus_tag="CR539_02900"
FT   CDS_pept        complement(569297..569572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02900"
FT                   /product="DUF1471 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QKC2"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:E2QKC2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418609.4"
FT                   /protein_id="AUJ94476.1"
FT                   /translation="MKQLLASPSLQLVTYPASATAQSAEFASADCVTGLNEIGQISVSN
FT                   ISGDPQDVERIVALKADEQGASWYRIITMYEDQQPDNWRVQAILYA"
FT   gene            complement(569721..570050)
FT                   /locus_tag="CR539_02905"
FT   CDS_pept        complement(569721..570050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02905"
FT                   /product="lipoprotein BsmA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:W8T6F9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418610.4"
FT                   /protein_id="AUJ94477.1"
FT                   /translation="MVSRKRNSVIYRFASLLLVLMLSACSALQGTPQPAPPVTDHPQEI
FT                   RRDQTQGLQRIGSVSTMVRGSPDDALAEIKAKAVAAKADYYVVVMVDETIVTGQWYSQA
FT                   ILYRK"
FT   gene            570232..570981
FT                   /locus_tag="CR539_02910"
FT   CDS_pept        570232..570981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02910"
FT                   /product="esterase"
FT                   /note="YjfP; esterase activity towards palmitoyl-CoA and
FT                   pNP-butyrate in vitro; unknown function and substrate in
FT                   vivo; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TAT9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:W8TAT9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313193.1"
FT                   /protein_id="AUJ94478.1"
FT                   /translation="MIEIESRELADIPVLHAYPVGQKDTPLPCAIFYHGFTSSSLVYSY
FT                   FAVALAQAGLRVIMPDAPDHGSRFSGDAARRLNQFWQILLQSMQEFTTLRAAIAEEKWL
FT                   LDDRLAVGGASMGAMTALGITARHPTVRCTASMMGSGYFTSLARSLFPPLIPETTAQQN
FT                   EFNNIVAPLAEWEATNHLEQLSDRPLLLWHGLDDDVVPADESLRLQQALSETGRDKLLT
FT                   CSWQPGVRHRITPEALDAAVTFFRQHL"
FT   gene            complement(570978..571733)
FT                   /locus_tag="CR539_02915"
FT   CDS_pept        complement(570978..571733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02915"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFV2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR023711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFV2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313194.1"
FT                   /protein_id="AUJ94479.1"
FT                   /translation="MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDE
FT                   SGKLKKVRNGAEAITQQRPRWTPMNLHQAQNHDEKVRIAKAASQLVNPGESVVINCGST
FT                   AFLLGREMCGKPVQIITNYLPLANYLIDQEHDSVIIMGGQYNKSQSITLSPQGSENSLY
FT                   AGHWMFTSGKGLTAEGLYKTDMLTAMAEQKMLSVVGKLVVLVDSSKIGERAGMLFSRAD
FT                   QIDMLITGKNANPEILQQLEAQGVSILRV"
FT   gene            complement(571841..572905)
FT                   /locus_tag="CR539_02920"
FT   CDS_pept        complement(571841..572905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02920"
FT                   /product="L-ascorbate-6-phosphate lactonase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8SXK3"
FT                   /db_xref="InterPro:IPR023951"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:W8SXK3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418613.2"
FT                   /protein_id="AUJ94480.1"
FT                   /translation="MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGC
FT                   TGIWLKSEGGTNVCVDFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDP
FT                   FAIRQVDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIV
FT                   VKPGDVVKVKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLY
FT                   HSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFH
FT                   HDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDD
FT                   CFTIEPDLPFKSFL"
FT   gene            573260..574657
FT                   /locus_tag="CR539_02925"
FT   CDS_pept        573260..574657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02925"
FT                   /product="ascorbate-specific permease IIC component UlaA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YCJ0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YCJ0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418614.4"
FT                   /protein_id="AUJ94481.1"
FT                   /translation="MEILYNIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKGT
FT                   IKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTYASMMATIERMGDAYSWV
FT                   GYAVLLALALNICYVLLRRITGIRTIMLTGHIMFQQAGLIAVTLFIFGYSMWTTIICTA
FT                   ILVSLYWGITSNMMYKPTQEVTDGCGFSIGHQQQFASWIAYKVAPFLGKKEESVEDLKL
FT                   PGWLNIFHDNIVSTAIVMTIFFGAILLSFGIDTVQTMAGKVNWTVYILQTGFSFAVAIF
FT                   IITQGVRMFVAELSEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGTIGQLIA
FT                   VGILVACGSSILIIPGFIPMFFSNATIGVFANHFGGWRAALKICLVMGMIEIFGCVWAV
FT                   KLTGMSAWMGMADWSILAPPMMQGFFSIGIAFMAVIIVIALAYMFFAGRALRAEEDAEK
FT                   QLAEQSA"
FT   gene            574673..574978
FT                   /locus_tag="CR539_02930"
FT   CDS_pept        574673..574978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02930"
FT                   /product="ascorbate-specific phosphotransferase enzyme IIB
FT                   component"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFT7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFT7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313197.1"
FT                   /protein_id="AUJ94482.1"
FT                   /translation="MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYK
FT                   SELSGADIIIASTHIAGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDVK"
FT   gene            574988..575451
FT                   /pseudo
FT                   /locus_tag="CR539_02935"
FT   CDS_pept        574988..575451
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02935"
FT                   /product="PTS ascorbate transporter subunit IIA"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313198.1"
FT   gene            575465..576115
FT                   /gene="ulaD"
FT                   /locus_tag="CR539_02940"
FT   CDS_pept        575465..576115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaD"
FT                   /locus_tag="CR539_02940"
FT                   /product="3-keto-L-gulonate-6-phosphate decarboxylase ulaD"
FT                   /EC_number="4.1.1.85"
FT                   /note="catalyzes the formation of L-xylulose-5-phosphate
FT                   from 3-keto-L-gulonate-6-phosphate in anaerobic L-ascorbate
FT                   utilization; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFS7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023942"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFS7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313199.1"
FT                   /protein_id="AUJ94483.1"
FT                   /translation="MSLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVR
FT                   AVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKE
FT                   FNGDVQIELTGYWTWEQAQQWRDAGIQQVVYHRSRDAQAAGVAWGEADITAIKRLSDMG
FT                   FKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELWG"
FT   gene            576125..576979
FT                   /locus_tag="CR539_02945"
FT   CDS_pept        576125..576979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02945"
FT                   /product="L-ribulose-5-phosphate 3-epimerase UlaE"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024L7R3"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR023492"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L7R3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313200.1"
FT                   /protein_id="AUJ94484.1"
FT                   /translation="MLSKQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDE
FT                   RLSRLDWSRDQRLALVNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQ
FT                   FAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMN
FT                   SISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKN
FT                   VPFGEGVVDFERCFETLKQSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGMV
FT                   EAA"
FT   gene            576979..577665
FT                   /gene="araD"
FT                   /locus_tag="CR539_02950"
FT   CDS_pept        576979..577665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="CR539_02950"
FT                   /product="L-ribulose-5-phosphate 4-epimerase UlaF"
FT                   /EC_number="5.1.3.4"
FT                   /note="catalyzes the isomerization of L-ribulose
FT                   5-phosphate to D-xylulose 5-phosphate in the anaerobic
FT                   catabolism of L-ascorbate; links the arabinose metabolic
FT                   pathway to the pentose phosphate pathway and allows the
FT                   bacteria to use arabinose as an energy source; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:W8SXJ9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR023499"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:W8SXJ9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418619.1"
FT                   /protein_id="AUJ94485.1"
FT                   /translation="MQKLKQQVFEANMELPRYGLVTFTWGNVSAIDRERGLVVIKPSGV
FT                   AYETMKAADMVVVDMSGKVVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQ
FT                   AGLAIPALGTTHADYFFGDIPCTRGLSEEEVQGEYELNTGKVIIETLGNAEPLHTPGIV
FT                   VYQHGPFAWGKDAHDAVHNAVVMEEVAKMAWIARSINPQLNHIDSFLMNKHFMRKHGPN
FT                   AYYGQK"
FT   gene            complement(577794..578069)
FT                   /locus_tag="CR539_02955"
FT   CDS_pept        complement(577794..578069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02955"
FT                   /product="DUF1471 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFR2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313202.1"
FT                   /protein_id="AUJ94486.1"
FT                   /translation="MFSRVLALLAVLLLSANTWAAIEINNHQARNMDDVQSLGVIYINH
FT                   NFATESEARQALNEETDAQGATYYHVILMREPGSNGNMHASADIYR"
FT   gene            578396..578791
FT                   /locus_tag="CR539_02960"
FT   CDS_pept        578396..578791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02960"
FT                   /product="30S ribosomal protein S6"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFQ7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFQ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_020456251.1"
FT                   /protein_id="AUJ94487.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERRDDFANETADDAEAGDSEE"
FT   gene            578798..579112
FT                   /locus_tag="CR539_02965"
FT   CDS_pept        578798..579112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02965"
FT                   /product="primosomal replication protein N"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFQ2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFQ2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001315977.1"
FT                   /protein_id="AUJ94488.1"
FT                   /translation="MTNRLVLSGTVCRTPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQ
FT                   AWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD
FT                   "
FT   gene            579117..579344
FT                   /gene="rpsR"
FT                   /locus_tag="CR539_02970"
FT   CDS_pept        579117..579344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="CR539_02970"
FT                   /product="30S ribosomal protein S18"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFP7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="PDB:4V85"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFP7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_012986941.1"
FT                   /protein_id="AUJ94489.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            579386..579835
FT                   /locus_tag="CR539_02975"
FT   CDS_pept        579386..579835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02975"
FT                   /product="50S ribosomal protein L9"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFP2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFP2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005134442.1"
FT                   /protein_id="AUJ94490.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIE
FT                   FFEARRAELEAKLAEVLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTTGEHEVSFQVHSEVFAKVIVNVVAE"
FT   gene            complement(579937..581214)
FT                   /locus_tag="CR539_02980"
FT   CDS_pept        complement(579937..581214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02980"
FT                   /product="MFS transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTE9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTE9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001033602.1"
FT                   /protein_id="AUJ94491.1"
FT                   /translation="MESLPNYRWHMIALVCFITVINYLDRTALGIAAPTIMETTGITKE
FT                   QYSWIVSAFQLAYTLGQPVMGFFIDTVGLKLSFAICAAIWGLATMGHALTGTWSGLAFM
FT                   RALMGFSEASAIPAGVKTASTWFPAKERGVATGVFNMGTSLGAMLAPPLIAWCIMFHSW
FT                   QFAFIVSGSLALLAALFWFFCYKDPKDAKRLSDEERHYIESGQEQHLKTDKKEKTSIKH
FT                   ILSQRNFWGIGIARFLADPAWGTINFWVPIFFVETLHFSLKEIAMFVWLPFLLGDLGCL
FT                   ASGFVAKFFHDRGVSLINSRRITFTIAAVIMMTIGLVSIVENPYIAVLLISIGAFSHQC
FT                   LSTVAATLGGDLFKKDEVATAVGMAGACAWSGQLIFNLFIGAFVHIIGFAPFFIALAFF
FT                   DIIGAIALWTLIKVKDEEPQVQLATS"
FT   gene            complement(581216..581913)
FT                   /pseudo
FT                   /locus_tag="CR539_02985"
FT   CDS_pept        complement(581216..581913)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02985"
FT                   /product="IS1 family transposase"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_076612230.1"
FT   gene            complement(581870..581968)
FT                   /pseudo
FT                   /locus_tag="CR539_02990"
FT   CDS_pept        complement(581870..581968)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02990"
FT                   /product="glycosyl transferase"
FT                   /note="internal stop; incomplete; partial on complete
FT                   genome; missing start; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_004200378.1"
FT   gene            complement(581972..582610)
FT                   /locus_tag="CR539_02995"
FT   CDS_pept        complement(581972..582610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_02995"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTG0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418627.4"
FT                   /protein_id="AUJ94492.1"
FT                   /translation="MPGRFELKPTLEKVWHAPDNFRFMDPLPPMHRRGIIIAAIILVVG
FT                   FLLPSDDTPNAPVVTREAQLDIQSQSQPPTEEQLRAQLVTPQNDPDQVAPVAPEPIQEG
FT                   QPEEQPQTTQTQPFQPDSGIDNQWRSYRVEPGKTMAQLFRDHGLPATDVYAMAQVEGAG
FT                   KPLSNLQNGQMVKIRQNASGVVTGLTIDTGNNQQVLFTRQPDGSFIRAQ"
FT   gene            complement(582650..582836)
FT                   /pseudo
FT                   /locus_tag="CR539_03000"
FT   CDS_pept        complement(582650..582836)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03000"
FT                   /product="hypothetical protein"
FT                   /note="frameshifted; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001337177.1"
FT   gene            582829..583449
FT                   /locus_tag="CR539_03005"
FT   CDS_pept        582829..583449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03005"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="FKBP-type; rotamase; catalyzes the cis-trans
FT                   isomerization of proline imidic peptide bonds in
FT                   oligopeptides; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8SVC4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:W8SVC4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313212.2"
FT                   /protein_id="AUJ94493.1"
FT                   /translation="MTTPTFDTIEAQASYGIGLQVGQQLSESGLQGLLPEALVAGIADA
FT                   LEGKHPAVPVDVVHRALREIHERADAVRRQRFQAMAAEGVKYLEENAKKEGVNSTESGL
FT                   QFRVINQGEGAIPARTDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIPGWIEALT
FT                   LMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELLEIL"
FT   gene            583751..585163
FT                   /locus_tag="CR539_03010"
FT   CDS_pept        583751..585163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03010"
FT                   /product="D-serine/D-alanine/glycine transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0K4TPH7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K4TPH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313213.1"
FT                   /protein_id="AUJ94494.1"
FT                   /translation="MVDQVKVVADDQAPAEQSLRRNLTNRHIQLIAIGGAIGTGLFMGS
FT                   GKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTG
FT                   WTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVASLAVIVLLLTLNLATVKMFGEMEFW
FT                   FAMIKIVAIVSLIVVGLVMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAV
FT                   FAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPDKS
FT                   PFVELFVLVGLPAAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSK
FT                   RAVPAKGLTFSCICLLGGVVMLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRK
FT                   QRPHLHEKSIYKMPLGKLMCWVCMAFFVFVIVLLTLEDDTRQALLVTPLWFIALGLGWL
FT                   FIGKKRAAELRK"
FT   gene            complement(585208..585870)
FT                   /locus_tag="CR539_03015"
FT   CDS_pept        complement(585208..585870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03015"
FT                   /product="iron-sulfur cluster repair protein YtfE"
FT                   /note="Involved in anaerobic NO protection and iron
FT                   metabolism; Derived by automated computational analysis
FT                   using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8TAR7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/TrEMBL:W8TAR7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418630.1"
FT                   /protein_id="AUJ94495.1"
FT                   /translation="MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKE
FT                   LDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERV
FT                   HADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEA
FT                   GELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE"
FT   gene            complement(585978..586943)
FT                   /locus_tag="CR539_03020"
FT   CDS_pept        complement(585978..586943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03020"
FT                   /product="EamA/RhaT family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A037YD84"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A037YD84"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418631.2"
FT                   /protein_id="AUJ94496.1"
FT                   /translation="MISGVLYALLAGLMWGLIFVGPLIVPEYPAMLQSMGRYLALGLIA
FT                   LPIAWLGRVRLRQLARRDWLTALMLTMMGNLIYYFCLASAIQRTGAPVSTMIIGTLPVV
FT                   IPVFANLLYSQRDGKLAWGKLAPALICIGIGLACVNIAELNHGLPDFDWARYTSGIVLA
FT                   LVSVVCWAWYALRNARWLRENPDKHPMMWATAQALVTLPVSLIGYLVACYWLNIQTPDF
FT                   SLPFGPRPLVFISLMVAIAVLCSWVGALCWNVASQRLPTVILGPLIVFETLAGLLYTFL
FT                   IRQQMPPLMTLSGIALLVVGVVIAVRAKPEKPLTESVSES"
FT   gene            complement(587052..587915)
FT                   /locus_tag="CR539_03025"
FT   CDS_pept        complement(587052..587915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03025"
FT                   /product="NAD(P)-dependent oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MUY1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001491469.1"
FT                   /protein_id="AUJ94497.1"
FT                   /translation="MIAITGATGQLGHYVIESLMKTVPASQQIVAIVRNPAKAQALAAQ
FT                   GITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKTAGVKFIAYTS
FT                   LLHADKSPLGLADEHIETEKMLADSGIVYTLLRNGWYTENYLASAPAALEHGVFIGAAG
FT                   DGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQN
FT                   LSEIDFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGRPTTTLAESVSH
FT                   LFNVNK"
FT   gene            588004..588384
FT                   /locus_tag="CR539_03030"
FT   CDS_pept        588004..588384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03030"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:W8SVC1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313217.2"
FT                   /protein_id="AUJ94498.1"
FT                   /translation="MSQVSLSQQLKEGNLFAEQCPSREVLKHVTSRWGVLILVALREGT
FT                   HRFSDLRRKIGGVSEKMLAQSLQALEQDGFLNRIAYPVVPPHVEYSLTPLGEQVSEKVA
FT                   ALADWIELNLPEVLAVRDERAA"
FT   gene            complement(588512..590475)
FT                   /pseudo
FT                   /gene="cpdB"
FT                   /locus_tag="CR539_03035"
FT   CDS_pept        complement(588512..590475)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="CR539_03035"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /note="periplasmic enzyme; functions during ribonucleic
FT                   acid degradation; 2',3'-cyclic nucleotides are first
FT                   converted to 3'-nucleotide and then cleaved to yield a
FT                   ribonucleotide and a phosphate; frameshifted; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418634.1"
FT   gene            590665..591405
FT                   /locus_tag="CR539_03040"
FT   CDS_pept        590665..591405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03040"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
FT                   /note="catalyzes the formation of AMP from
FT                   adenosine-3',5'-bisphosphate; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:A0A0K5LFQ7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K5LFQ7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415347.1"
FT                   /protein_id="AUJ94499.1"
FT                   /translation="MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAH
FT                   TVIMDGLRTLTPEIPVLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIAL
FT                   IDHGKPILGVVYAPVMNVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAEL
FT                   KEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHD
FT                   WQGKPLDYTPRESFLNPGFRVSIY"
FT   gene            complement(591395..591952)
FT                   /locus_tag="CR539_03045"
FT   CDS_pept        complement(591395..591952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03045"
FT                   /product="YtfJ family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G9FMA8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415348.1"
FT                   /protein_id="AUJ94500.1"
FT                   /translation="MTLSKILALTCLLLPMMASAHQFETGQRVPPIGITDRGELVLDKD
FT                   QFSYKTWNSAQLVGKVRVLQHIAGRTSAKEKNATLIEAIKSAKLPHDRYQTTTIVNTDD
FT                   AIPGSGMFVRSSLESNKKLYPWSQFIVDSNGVARGAWQLDEESSAVVVLDKDGRVQWAK
FT                   DGALTQEEVQQVMDLLHKLINK"
FT   gene            592277..592483
FT                   /locus_tag="CR539_03050"
FT   CDS_pept        592277..592483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03050"
FT                   /product="DUF1107 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:E2QL11"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418638.2"
FT                   /protein_id="AUJ94501.1"
FT                   /translation="MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILIPKVK
FT                   DKLHLSVMSEVNRQVMRLQTEMA"
FT   gene            complement(592545..593888)
FT                   /locus_tag="CR539_03055"
FT   CDS_pept        complement(592545..593888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03055"
FT                   /product="HlyC/CorC family transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFH7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFH7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313223.1"
FT                   /protein_id="AUJ94502.1"
FT                   /translation="MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQ
FT                   RVLNMQENPGMFFTVVQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFIL
FT                   SFSLVTGMFILFADLTPKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFR
FT                   IFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENV
FT                   IWFDLHEDEQSLKNKVAEHPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGV
FT                   QIRNTLIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   LEEQIVARDENSWLIDGGTPIDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDS
FT                   VKFAGYKFEVVDIDNYRIDQLLVTRIDSKATALSPKLPDAKDKEESVA"
FT   gene            complement(594211..594849)
FT                   /locus_tag="CR539_03060"
FT   CDS_pept        complement(594211..594849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03060"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="this stereospecific enzymes reduces the S isomer of
FT                   methionine sulfoxide while MsrB reduces the R form;
FT                   provides protection against oxidative stress; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:J7RCD1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:J7RCD1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418640.1"
FT                   /protein_id="AUJ94503.1"
FT                   /translation="MSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMTNVPDGMEI
FT                   AIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPS
FT                   VISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLA
FT                   ADDDRHITTEIANATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA"
FT   gene            594906..595085
FT                   /locus_tag="CR539_03065"
FT   CDS_pept        594906..595085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03065"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A1X0YK36"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001395215.1"
FT                   /protein_id="AUJ94504.1"
FT                   /translation="MHTITTVNRSKVKHKKYLGFSLLFNPYYWIFVKPFNGVPGAGKKD
FT                   IQEKMCAISDSYAV"
FT   gene            595055..596788
FT                   /locus_tag="CR539_03070"
FT   CDS_pept        595055..596788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03070"
FT                   /product="autotransporter assembly complex protein TamA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3J2G5K4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3J2G5K4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313225.1"
FT                   /protein_id="AUJ94505.1"
FT                   /translation="MRYIRQLCCVSLLCLSGSAVAANVRLQVEGVSGQLEKNVRAQLST
FT                   IESDEVTPDRRFRARVDDAIREGLKALGYYQPTIEFDLRPPPKKGRQVLIAKVTPGVPV
FT                   LIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEF
FT                   TKAQLGIALGLHKAFWDIDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKD
FT                   LAELNRRLSATGWFNSVVVAPQFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPR
FT                   VKATWKKPWMNSYGHSLTTSTSISAPEQILDFSYKMPLLKNPLEQYYLVQGGFKRTDLN
FT                   DTESDSTTLVASRYWDLSSGWQRAINLRWSLDHFTQGEITNTTMLFYPGVMISRTRSRG
FT                   GLMPTWGDSQRYSIDYSNTAWGSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGD
FT                   FDKVPPDLRFFAGGDRSIRGYKYKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGA
FT                   VFVDSGEAVSDIRRSDFKTGTGVGVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPE
FT                   L"
FT   gene            596785..600564
FT                   /locus_tag="CR539_03075"
FT   CDS_pept        596785..600564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03075"
FT                   /product="translocation and assembly module TamB"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MU26"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MU26"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313226.1"
FT                   /protein_id="AUJ94506.1"
FT                   /translation="MSLWKKISLGVVIVILLLLGSVAFLVGTTSGLHLVFKAADRWVPG
FT                   LDVGKVTGGWRDLTLSDVRYEQPGVAVKAGNLHLAVGLECLWNSSVCINDLALKDIQVN
FT                   IDSKKMPPSEQVEEEEDSGPLDLSTPYPITLTRVALDNVNIKIDDTTVSVMNFTSGLNW
FT                   QEKTLTLKPTSLKGLLIALPKVAEVAQEEVVEPKIENPQPEEKPLGETLKDLFSRPVLP
FT                   EMTDVHLPLNLNIEEFKGEQLRVTGDTDITVSTMLLKVSSIDGNTKLDALDIDSSQGIV
FT                   NASGTAQLSDNWPVDITLNSTLNVEPLKGEKVKLKVGGALREQLEIGVNLSGPVDMDLR
FT                   AQTRLAEAGLPLNVEVNSKQIYWPFTGEKQYQADDLKLKLTGKMTDYTLSMRTAVKGLE
FT                   IPPATITLDAKGNEQQVNLDKLTVAALEGKTELKALLDWQQAISWRGELTLNGINTAKE
FT                   IPEWPSKLNGLIKTRGSLYGGTWQMEVPELKLTGNVKQNKVNVDGTLKGNSYMQWMIPG
FT                   LHLELGPNSAEVKGELGVKDLNLDATINAPGLDNALPGLGGTAKGLVKVRGTVEAPQLL
FT                   ADITARGLRWQELSVAQVRVEGDIKSTDQIAGKLDVRVEQISQPDVNINLVTLNAKGSE
FT                   KQHELQLRIQGEPVSGQLNLAGSFDRKEERWKGTLSNTRFQTPVGPWSLTRDIALDYRN
FT                   KEQKISIGPHCWLNPNAELCVPQTIDAGAEGRAVVNLNRFDLAMLKPFMPETTQASGIF
FT                   TGKADVAWDTTKEGLPQGSITLSGRNVQVTQTVNDAALPVAFQTLNLTAELRNNRAELG
FT                   WTIRLTNNGQFDGQVQVTDPQGRRNLGGNVNIRNFNLAMINPIFTRGEKAAGMVSANLR
FT                   LGGDVQSPQLFGQLQVTGVDIDGNFMPFDMQPSQLAVNFNGMRSTLAGTVRTQQGEIYL
FT                   NGDADWSQIENWRARVTAKGSKVRITVPPMVRMDVSPDVVFEATPNLFTLDGRVDVPWA
FT                   RIVVHDLPESAVGVSSDVVMLNDNLQPEEPKTASIPINSNLIVHVGNNVRIDAFGLKAR
FT                   LTGDLNVVQDKQGLGLNGQINIPEGRFHAYGQDLIVRKGELLFSGPPDQPYLNIEAIRN
FT                   PDATEDDVIAGVRVTGLADEPKAEIFSDPAMSQQAALSYLLRGQGLESDQSDSAAMTSM
FT                   LIGLGVAQSGQIVGKIGETFGVSNLALDTQGVGDSSQVVVSGYVLPGLQVKYGVGIFDS
FT                   IATLTLRYRLMPKLYLEAVSGVDQALDLLYQFEF"
FT   gene            600567..600908
FT                   /locus_tag="CR539_03080"
FT   CDS_pept        600567..600908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03080"
FT                   /product="gamma-glutamylcyclotransferase YtfP"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFF7"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFF7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313227.1"
FT                   /protein_id="AUJ94507.1"
FT                   /translation="MRIFVYGSLRHKQGNSHWMTNAQLLGDFSIDNYQLYSLGHYPGAV
FT                   PGNGTVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVDGLKLIE
FT                   SGDWLDRDK"
FT   gene            complement(601288..601818)
FT                   /locus_tag="CR539_03085"
FT   CDS_pept        complement(601288..601818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03085"
FT                   /product="inorganic pyrophosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QL18"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E2QL18"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001739810.1"
FT                   /protein_id="AUJ94508.1"
FT                   /translation="MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLIAVPHTKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAK
FT                   AEIVASFERAKNK"
FT   gene            602128..603084
FT                   /locus_tag="CR539_03090"
FT   CDS_pept        602128..603084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03090"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QL19"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:E2QL19"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_005134480.1"
FT                   /protein_id="AUJ94509.1"
FT                   /translation="MWKRLLVVSAVSAAMSSMALAAPLTVGFSQVGSESGWRAAETNVA
FT                   KSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAE
FT                   IPVFLLDRSIDVKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASV
FT                   AIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDD
FT                   MVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMIDGEANASVELTPNMAGPAFDALE
FT                   KYKKDGTMPEKLTLTKSTLYLPDTAKEELEKKKNMGY"
FT   gene            603224..604726
FT                   /locus_tag="CR539_03095"
FT   CDS_pept        603224..604726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03095"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8SXH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:W8SXH4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026286.1"
FT                   /protein_id="AUJ94510.1"
FT                   /translation="MTTNQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENG
FT                   AGKSTLIKALTGVYHADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADN
FT                   LFIGREPKRFGLLRRKEMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLS
FT                   AKVLILDEPTASLDTQEVELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGS
FT                   FVGCRETCELPQIELVKMMLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDL
FT                   EVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGFC
FT                   PEDRKTDGIIAAASVRENIILALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQP
FT                   IEFLSGGNQQKVLLSRWLLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVI
FT                   SSELEELVGYADRVIIMRDRKQVAEIPLAELSVPAIMNAIAA"
FT   gene            604737..605762
FT                   /locus_tag="CR539_03100"
FT   CDS_pept        604737..605762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03100"
FT                   /product="ABC transporter permease"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1Y2ZTX9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y2ZTX9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313234.1"
FT                   /protein_id="AUJ94511.1"
FT                   /translation="MMPQSLPDTTPPKRRFRWPTGMPQLAALLLVLLVDSLVAPHFWQV
FT                   VLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAG
FT                   FSLPIVLLSALGTGILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITSGQIVTFN
FT                   SPDLSWFGSGSLLFLPTPVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNT
FT                   RIIVMLTYVLSGLCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFN
FT                   LLLSVVGALIIQGMNTGILLSGFPPEMNQVVKAVVVLCVLIVQSQRFISLIKGVRSRDK
FT                   T"
FT   gene            605749..606744
FT                   /locus_tag="CR539_03105"
FT   CDS_pept        605749..606744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03105"
FT                   /product="sugar ABC transporter permease YjfF"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:W8T6B7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:W8T6B7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415359.1"
FT                   /protein_id="AUJ94512.1"
FT                   /translation="MIKRNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFL
FT                   GIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAF
FT                   MGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLS
FT                   AMGLLMLAVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLAT
FT                   LAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTY
FT                   INFDGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQSSPVTRVNIAQR"
FT   gene            complement(606777..607775)
FT                   /locus_tag="CR539_03110"
FT   CDS_pept        complement(606777..607775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03110"
FT                   /product="fructose 1,6-bisphosphatase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:E2QL23"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:E2QL23"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_016233757.1"
FT                   /protein_id="AUJ94513.1"
FT                   /translation="MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGASGAENVQGEVQQKLDLFANEKLKAALKARDIVAGIASEEEDEIVVFEGCEHAK
FT                   YVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGNKQVAAGYVVYGS
FT                   STMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGKTYSINEGNYIKFPNGVKKYIK
FT                   FCQEEDKSTNRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAF
FT                   LAEQAGGKASDGKERILDIIPETLHQRRSFFVGNDHMVEDVERFIREFPDA"
FT   gene            607951..609324
FT                   /gene="mpl"
FT                   /locus_tag="CR539_03115"
FT   CDS_pept        607951..609324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="CR539_03115"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SFB2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFB2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313237.1"
FT                   /protein_id="AUJ94514.1"
FT                   /translation="MRIHILGICGTFMGGLAMLARQLGHEVTGSDANVYPPMSTLLEKQ
FT                   GIELIQGYDASQLDPQPDLVIIGNAMTRGNPCVEAVLEKNIPYMSGPQWLHDFVLRDRW
FT                   VLAVAGTHGKTTTAGMATWILEQCGYKPGFVIGGVPGNFEVSARLGESDFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIIWPEN
FT                   DINLKQTMAMGCWSEQELVGEQGHWQAKKLTTDASEWEVLLDGEKVGEVKWSLVGEHNM
FT                   HNGLMAIAAARHVGVAPADAANALGSFINARRRLELRGEANGVTVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARIIAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPAHIPWQVAEV
FT                   AEACVQPAHWSGDVDTLADMVVKTAQPGDHILVMSNGGFGGIHQKLLDGLAKKAEAAQ"
FT   gene            complement(609480..610031)
FT                   /locus_tag="CR539_03120"
FT   CDS_pept        complement(609480..610031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03120"
FT                   /product="DUF615 family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:C3SFA7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313238.1"
FT                   /protein_id="AUJ94515.1"
FT                   /translation="MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAE
FT                   IVDLGKNALDKIPLDADLRAAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKL
FT                   KNRHNQQVVLFHKLENLRDRLIDQGDDAIAEVLNLWPDADRQQLRTLIRNAKKEKEGNK
FT                   PPKSARQIFQYLRELAENEG"
FT   gene            610126..611478
FT                   /locus_tag="CR539_03125"
FT   CDS_pept        610126..611478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03125"
FT                   /product="metalloprotease PmbA"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0D7K192"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D7K192"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313239.1"
FT                   /protein_id="AUJ94516.1"
FT                   /translation="MALAMKVISQVEAQRKILEEAVSTALELASGKSDGAEVAVSKTTG
FT                   ISVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPQAIARTVQAALDIARYTS
FT                   PDPCAGLADKELLAFDAPDLDLFHPAEVSPDDAIELAARAEQAALQADKRITNTEGGSF
FT                   NSHYGVKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYAYTIGRAMSDLQTPEWV
FT                   GADCARRTLSRLSPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLG
FT                   KQILPDWLTIEEHPHLLKGLASTPFDSEGVRTERRDIIKDGILTQWLLTSYSARKLGLK
FT                   STGHAGGIHNWRIAGQGLSFEQMLKEMGTGLVVTELMGQGVSAITGDYSRGAAGFWVEN
FT                   GEIQYPVSEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMKIAGQ"
FT   gene            611533..611919
FT                   /locus_tag="CR539_03130"
FT   CDS_pept        611533..611919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03130"
FT                   /product="cytochrome b562"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3WFI9"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3WFI9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415364.1"
FT                   /protein_id="AUJ94517.1"
FT                   /translation="MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVVEKADNA
FT                   AQVKDALTKMRAAALDAQKATPPKLEGKSPDSPEMKDFRHGFDILVGQIDDALKLANEG
FT                   KVKEAQAAAEQLKTTRNAYHQKYR"
FT   gene            complement(611964..612428)
FT                   /locus_tag="CR539_03135"
FT   CDS_pept        complement(611964..612428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03135"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="activates anaerobic ribonucleoside-triphosphate
FT                   reductase under anaerobic conditions; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:C3SF92"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF92"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313241.1"
FT                   /protein_id="AUJ94518.1"
FT                   /translation="MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSGQ
FT                   PFTKAMEDQIINDLNDTRIKRQGISLSGGDPLHPQNVPDILKLVQRIRAECPGKDIWVW
FT                   TGYKLDELNAAQMQVVDLINVLVDGKFVQDLKDPSLIWRGSSNQVVHHLR"
FT   gene            complement(612588..614726)
FT                   /locus_tag="CR539_03140"
FT   CDS_pept        complement(612588..614726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03140"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066SYY9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066SYY9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418659.1"
FT                   /protein_id="AUJ94519.1"
FT                   /translation="MTPHVMKRDGCKVPFKSERIKEAILRAAKAAEVDDADYCATVAAV
FT                   VSEQMQGRNQVDINEIQTAVENQLMSGPYKQLARAYIEYRHDRDIEREKRGRLNQEIRG
FT                   LVEQTNASLLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVQAHERGDIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVTASYNKHRKTAEEWSIPDAEGYANSRTIKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRLIQESILRNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KKGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQI
FT                   HDGRNNLGVISLNLPRIALEAKGDEATFWKLLDERLVLARKALMTRIARLEGVKARVAP
FT                   ILYMEGACGVRLNADDDVSEIFKNGRASISLGYIGIHETINALFGGEHVYDNEQLRAKG
FT                   IAIVERLRQAVDQWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGVVPGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKIDFEAPYPPLANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYY
FT                   GTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDASRVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRVKHLGNGQIG"
FT   gene            complement(615120..616775)
FT                   /gene="treC"
FT                   /locus_tag="CR539_03145"
FT   CDS_pept        complement(615120..616775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="CR539_03145"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A2K4PEE3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4PEE3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313243.1"
FT                   /protein_id="AUJ94520.1"
FT                   /translation="MTNLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVIQRLGYLHKL
FT                   GVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDDFDELVTQAKSRGIRIILDMVFN
FT                   HTSTQHAWFREALNKESPYRQFYIWRDGEPETPPNNWRSKFGGSAWRWHAESEQYYLHL
FT                   FAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVVNLISKDPRFPDDLDGDGRRF
FT                   YTDGPRAHEFLHEMNRDVFTPRGLMTVGEMSSTSLEHCQRYAALTGSELSMTFNFHHLK
FT                   VDYPGGEKWTLAKPDFVALKTLFRHWQQGMHNVAWNALFWCNHDQPRIISRFGDEGEYR
FT                   VPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPHFTRITDYRDVESLNMFAELRNDGRDAD
FT                   ELLAILASKSRDNSRTPMQWSNGDNAGFTAGEPWIGLGDNYQQINVEAALADESSVFYT
FT                   YQKLIALRKQEAILTWGNYQDLLPNSPVLWCYRREWKGQTLLVIANLSREIQPWQPGQM
FT                   RGNWQLVMHNYEEASPQPCAMNLRPFEAVWWLQK"
FT   gene            complement(616825..618246)
FT                   /locus_tag="CR539_03150"
FT   CDS_pept        complement(616825..618246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03150"
FT                   /product="PTS trehalose transporter subunit IIBC"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SF77"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF77"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313244.1"
FT                   /protein_id="AUJ94521.1"
FT                   /translation="MMSKINQTDIDRLIELVGGRGNIATVSHCITRLRFVLNQPANARP
FT                   KEIEQLPMVKGCFTNAGQFQVVIGTNVGDYYQALIASTGQAQVDKEQVKKAARQNMKWH
FT                   EQLISHFAEIFFPLLPALISGGLILGFRNVIGDLPMSNGQTLAQMYPSLQTIYDFLWLI
FT                   GEAIFFYLPVGICWSAVKKMGGTPILGIVLGVTLVSPQLMNAYLLGQQLPEVWDFGMFS
FT                   IAKVGYQAQVIPALLAGLALGVIETRLKRIVPDYLYLVVVPVCSLILAVFLAHALIGPF
FT                   GRMIGDGVAFAVRHLMTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDLQMIQSMGGTP
FT                   VWPLIALSNIAQGSAVIGIIISSRKHNEREISVPAAISAWLGVTEPAMYGINLKYRFPM
FT                   LCAMIGSGLAGLLCGLNGVMANGIGVGGLPGILSIQPSYWQVFALAMAIAIIIPIVLTS
FT                   FIYQRKYRLGTLDIV"
FT   gene            complement(618365..619312)
FT                   /gene="treR"
FT                   /locus_tag="CR539_03155"
FT   CDS_pept        complement(618365..619312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="CR539_03155"
FT                   /product="HTH-type transcriptional regulator TreR"
FT                   /note="regulates genes involved in trehalose metabolism;
FT                   binds the intermediate trehalose-6-phosphate; binds a
FT                   dimer; regulates treBC operon; Derived by automated
FT                   computational analysis using gene prediction method:
FT                   Protein Homology."
FT                   /db_xref="GOA:J7QZ87"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:J7QZ87"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415369.1"
FT                   /protein_id="AUJ94522.1"
FT                   /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSQRTRERVEAVMNQ
FT                   HGFSPSRSARAMRGQSDKVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSP
FT                   QLVAEHLGVLKRRNIDGVVLFGFTGITEEMLAHWQSSLVLLARDAKGFASVCYDDEGAI
FT                   KILMQRLYDQGHRNISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGY
FT                   ENVAKVITPETTALLCATDTLALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVD
FT                   PGYAEAGRQAACQLIAQVTGRSEPQQIIIPATLS"
FT   gene            619691..622387
FT                   /gene="mgtA"
FT                   /locus_tag="CR539_03160"
FT   CDS_pept        619691..622387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="CR539_03160"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7QJU7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:J7QJU7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415370.1"
FT                   /protein_id="AUJ94523.1"
FT                   /translation="MFKEIFTRLIRHLPSRLVHRDPLPGAQQTVNTAVPPSLSAHCLKM
FT                   AVMPEEELWKTFDTHPEGLNQAEVESAREQHGENKLPAQQPSPWWVHLWVCYRNPFNIL
FT                   LTILGAISYATEDLFAAGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRVI
FT                   NDKGENGWLEIPIDQLVPGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKA
FT                   ATTRQPEHSNPLECDTLCFMGTTVVSGTAQAMVIATGANTWFGQLAGRVSEQESEPNAF
FT                   QQGISRVSMLLIRFMLVMAPVVLLINGYTKGDWWEAALFALSVAVGLTPEMLPMIVTST
FT                   LARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERV
FT                   LHSAWLNSHYQTGLKNLLDTAVLEGTDEESARSLASRWQKIDEIPFDFERRRMSVVVAE
FT                   NTEHHQLVCKGALQEILNVCSQVRHNGEIVPLDDIMLRKIKRVTDTLNRQGLRVVAVAT
FT                   KYLPAREGDYQRADESDLILEGYIAFLDPPKETTAPALKALKASGITVKILTGDSELVA
FT                   AKVCHEVGLDAGEVVIGSDIETLSDDELANLAQRTTLFARLTPMHKERIVTLLKREGHV
FT                   VGFMGDGINDAPALRAADIGISVDGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFAN
FT                   MLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLLYDVSQVAIPFDNVDDEQ
FT                   IQKPQRWNPADLGRFMIFFGPISSIFDILTFCLMWWVFHANTPETQTLFQSGWFVVGLL
FT                   SQTLIVHMIRTRRVPFIQSCASWPLMIMTVIVMIVGIALPFSPLASYLQLQALPLSYFP
FT                   WLVAILAGYMTLTQLVKGFYSRRYGWQ"
FT   gene            complement(622593..622979)
FT                   /locus_tag="CR539_03165"
FT   CDS_pept        complement(622593..622979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03165"
FT                   /product="reactive intermediate/imine deaminase"
FT                   /note="has endoribonuclease activity on mRNA; Derived by
FT                   automated computational analysis using gene prediction
FT                   method: Protein Homology."
FT                   /db_xref="GOA:E2QL34"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E2QL34"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418664.2"
FT                   /protein_id="AUJ94524.1"
FT                   /translation="MSKTIATENAPAAIGPYVQGVDLGNMIITSGQIPVNPKTGEVPAD
FT                   VAAQARQSLDNVKAIVEAAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(623052..623513)
FT                   /locus_tag="CR539_03170"
FT   CDS_pept        complement(623052..623513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03170"
FT                   /product="aspartate carbamoyltransferase regulatory
FT                   subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SF57"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="PDB:4WTO"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF57"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000148566.1"
FT                   /protein_id="AUJ94525.1"
FT                   /translation="MTHDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIG
FT                   LNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERID
FT                   NVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN"
FT   gene            complement(623526..624461)
FT                   /locus_tag="CR539_03175"
FT   CDS_pept        complement(623526..624461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03175"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SF53"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="PDB:4WTO"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF53"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313249.1"
FT                   /protein_id="AUJ94526.1"
FT                   /translation="MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIV
FT                   MRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGD
FT                   LKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAE
FT                   VDILYMTRVQKERLDPSEYANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT
FT                   PHAWYFQQAGNGIFARQALLALVLNRDLVL"
FT   gene            complement(624465..624599)
FT                   /locus_tag="CR539_03180"
FT   CDS_pept        complement(624465..624599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03180"
FT                   /product="pyrBI operon leader peptide"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SF42"
FT                   /db_xref="InterPro:IPR012602"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF42"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313250.1"
FT                   /protein_id="AUJ94527.1"
FT                   /translation="MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR"
FT   gene            624729..624911
FT                   /locus_tag="CR539_03185"
FT   CDS_pept        624729..624911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03185"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A152SHS0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152SHS0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001323028.1"
FT                   /protein_id="AUJ94528.1"
FT                   /translation="MILQGNGRSVSIIADISCFFLFHFHAIRYAFYSIHPTYRAECENE
FT                   RLTLLLTAQGCALSL"
FT   gene            complement(624880..625275)
FT                   /locus_tag="CR539_03190"
FT   CDS_pept        complement(624880..625275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03190"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0K3LDX9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418669.1"
FT                   /protein_id="AUJ94529.1"
FT                   /translation="MVERTAVFPAGQHSLYAEHRYSAAIRSGDLLFVSGQVGSREDGTP
FT                   EPDFQQQVRLAFDNLHATLAAAGCTFDDIIDVTSFHTDPENQFEDIMTVKNEIFSAPPY
FT                   PNWTAVGVTWLAGFDFEIKVIARIPEQ"
FT   gene            complement(625406..626119)
FT                   /locus_tag="CR539_03195"
FT   CDS_pept        complement(625406..626119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03195"
FT                   /product="SDR family oxidoreductase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066RIK9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066RIK9"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418670.1"
FT                   /protein_id="AUJ94530.1"
FT                   /translation="MGAFTGKTVLILGGSRGIGAAIVRRFVTDGANVRFTYAGSKDAAK
FT                   RLAQETGATAVFTDSADRDAVIDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFK
FT                   INIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARD
FT                   FGPRGITINVVQPGPIDTDANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEAS
FT                   FVTGAMHTIDGAFGA"
FT   gene            626190..626783
FT                   /locus_tag="CR539_03200"
FT   CDS_pept        626190..626783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03200"
FT                   /product="TetR/AcrR family transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A066RA53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A066RA53"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415377.1"
FT                   /protein_id="AUJ94531.1"
FT                   /translation="MVTKKQSRVPGRPRRFAPEQAISAAKVLFHQKGFDAVSVAEVTDY
FT                   LGINPPSLYAAFGSKAGLFSRVLNEYVGTEAIPLADILRDDRPVGECLVEVLKEAARRY
FT                   SQNGGCAGCMVLEGIHSHDPLARDIAVQYYHAAETTIYDYIARRHPQSAQCVTDFMSTV
FT                   MSGLSAKAREGHSIEQLCATAALAGEAIKTLLKE"
FT   gene            626928..627380
FT                   /locus_tag="CR539_03205"
FT   CDS_pept        626928..627380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03205"
FT                   /product="YhcH/YjgK/YiaL family protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:W8T6A4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313256.2"
FT                   /protein_id="AUJ94532.1"
FT                   /translation="MIIGNIHNLQPWLPQELRQAIEHIKAHVTAETPKGKHDIEGNRLF
FT                   YLISEDMTEPYEARRAEYHARYLDIQIVLKGQEGMTFSTQPAGTPDTDWLADKDIAFLP
FT                   EGVDEKTVILNEGDFVVFYPGEVHKPLCAVGAPAQVRKAVVKMLMA"
FT   gene            627503..628207
FT                   /pseudo
FT                   /locus_tag="CR539_03210"
FT   CDS_pept        627503..628207
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03210"
FT                   /product="DNA-binding protein"
FT                   /note="incomplete; partial on complete genome; missing
FT                   stop; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313257.1"
FT   gene            628493..628846
FT                   /pseudo
FT                   /locus_tag="CR539_03215"
FT   CDS_pept        628493..628846
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03215"
FT                   /product="hypothetical protein"
FT                   /note="internal stop; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001349259.1"
FT   gene            628833..629063
FT                   /locus_tag="CR539_03220"
FT   CDS_pept        628833..629063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03220"
FT                   /product="hypothetical protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="UniProtKB/TrEMBL:A0A061K9E4"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_001309158.1"
FT                   /protein_id="AUJ94533.1"
FT                   /translation="MKQPDFAKWYFYQLLKDYEGEQLYLNELGYVYGNEEKTNEIVKNN
FT                   PGYVVKIFEEKMVNELKIRTRMMKILRKIYV"
FT   gene            complement(629164..630168)
FT                   /gene="argF"
FT                   /locus_tag="CR539_03225"
FT   CDS_pept        complement(629164..630168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="CR539_03225"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:J7RCG8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:J7RCG8"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415379.1"
FT                   /protein_id="AUJ94534.1"
FT                   /translation="MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEAKLTG
FT                   KNIALIFEKDSTRTRCSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGI
FT                   QYRGYGQEIVETLAEYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLVYAG
FT                   DARNNMGNSMLEAAALTGLDLRLVAPQACWPEAALVTECRALAQQNGGNITLTEDVAKG
FT                   VEGADFIYTDVWVSMGEAKEKWAERIALLRDYQVNSKMMQLTGNPEVKFLHCLPAFHDD
FT                   QTTLGKKMAEEFGLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMVATLSK"
FT   gene            630330..630746
FT                   /locus_tag="CR539_03230"
FT   CDS_pept        630330..630746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03230"
FT                   /product="regulator of ribonuclease activity B"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SF07"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:C3SF07"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313259.1"
FT                   /protein_id="AUJ94535.1"
FT                   /translation="MANPEQLEEQREETRLIIEELLEDGSDPDALYTIEHHLSADDLET
FT                   LEKAAVEAFKLGYEVTDPEELEVEDGDIVICCDILSECALNADLIDAQVEQLMTLAEKF
FT                   DVEYDGWGTYFEDPNGEDGDDEDFVDEDDDGVRH"
FT   gene            complement(630792..631295)
FT                   /locus_tag="CR539_03235"
FT   CDS_pept        complement(630792..631295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03235"
FT                   /product="N-acetyltransferase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A0J3WGE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J3WGE1"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_026287.1"
FT                   /protein_id="AUJ94536.1"
FT                   /translation="MNNIAPQSPVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVAD
FT                   PNLDELYQVYSQPGHAYWVVEYEGEVVGGGGIAPLAGSESDICELQKMYFLPAIRGKGL
FT                   AKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEHIDYALGCTGHVDCEVRM
FT                   LREL"
FT   gene            631488..632684
FT                   /locus_tag="CR539_03240"
FT   CDS_pept        631488..632684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03240"
FT                   /product="DUF898 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A061K9X0"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061K9X0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:YP_002415382.1"
FT                   /protein_id="AUJ94537.1"
FT                   /translation="MAQVINEMDVPSHSFVFHGTGERYFLICVVNVLLTIITLGIYLPW
FT                   ALMKCKRYLYANMEVNGQRFSYGITGGNVFVSCLVFVFFYFAILMTVSADMPLVGCVLT
FT                   LSLLVLLIFMAAKGLRYQALMTSLNGVRFSFNCSLKGFWWVTFFLPILMAIGMGTVFFI
FT                   STKMLHANSSSSVIISVVLMAIVGIVSIGIFNGTLYSLVMSFLWSNTSFGIHRFKVKLD
FT                   TTYCIKYAILAFLALLPFLAVAGYIIFDQILNAYDSSVYANDDIENLQQFMEMQRKMII
FT                   AQLIYYFGIAVSTSYLTVSLRNHFMSNLSLNDGRIRFRSTLTYHGMLYRMCALVVISGI
FT                   TGGLAYPLLKIWMIDWQAKNTYLLGDLDDLPLINKEEQPDKGFLASISRGIMPSLPFL"
FT   gene            complement(632740..635595)
FT                   /gene="valS"
FT                   /locus_tag="CR539_03245"
FT   CDS_pept        complement(632740..635595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="CR539_03245"
FT                   /product="valine--tRNA ligase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A061K9E6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A061K9E6"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:WP_000416368.1"
FT                   /protein_id="AUJ94538.1"
FT                   /translation="MEKTYNPQDIEQPLYEHWEKQGYFKPNGDESQESFCIMIPPPNVT
FT                   GSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHD
FT                   YGREAFIDKIWEWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKE
FT                   DLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATT
FT                   RPETLLGDTGVAVNPEDPRYKDLIGKYVILPLVNRRIPIVGDEHADMEKGTGCVKITPA
FT                   HDFNDYEVGKRHALPMINILTFDGDIRESAQVFDTKGNESDVYSSEIPAEFQKLERFAA
FT                   RKAVVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVEN
FT                   GDIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDEAGNVYVGRNEDEVRKEN
FT                   NLGADVVLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIA
FT                   RMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPE
FT                   LLEKRTGNMMQPQLADKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRFVLMNTEGQDCGFNGGEMTLSLADRWILAEFNQTIKAYREALDS
FT                   FRFDIAAGILYEFTWNQFCDWYLELTKPVMNGGTEAELRGTRHTLVTVLEGLLRLAHPI
FT                   IPFITETIWQRVKVLCGITADTIMLQPFPQYDASQVDEAALADTEWLKQAIVAVRNIRA
FT                   EMNIAPGKPLELLLRGCSADAERRVNENRGFLQTLARLESITVLPADDKGPVSVTKIID
FT                   GAELLIPMAGLINKEDELARLAKEVAKIEGEISRIENKLANEGFVARAPEAVIAKEREK
FT                   LEGYAEAKAKLIEQQAVIAAL"
FT   gene            complement(635595..636038)
FT                   /locus_tag="CR539_03250"
FT   CDS_pept        complement(635595..636038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03250"
FT                   /product="DNA polymerase III subunit chi"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SEY7"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:C3SEY7"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313263.1"
FT                   /protein_id="AUJ94539.1"
FT                   /translation="MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACED
FT                   EKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFA
FT                   DFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK"
FT   gene            complement(636392..637903)
FT                   /locus_tag="CR539_03255"
FT   CDS_pept        complement(636392..637903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03255"
FT                   /product="cytosol aminopeptidase"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:C3SEY2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:C3SEY2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313264.1"
FT                   /protein_id="AUJ94540.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISA
FT                   LLRRGELEGKPGQTLLLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTG
FT                   SMEAVCFLTELHVKGRNNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPT
FT                   RRELTSGERAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRV
FT                   IGEQQMKELGMHSYLAVGQGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISI
FT                   KPSEGMDEMKYDMCGAAAVYGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTT
FT                   MSGQTVEVLNTDAEGRLVLCDVLTYVERFEPEAVIDVATLTGACVIALGHHITGLMANH
FT                   NPLAHELIAASEQSGDRAWRLPLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFT
FT                   RKYNWAHLDIAGTAWRSGKAKGATGRPVALLAQFLLNRAGFNGEE"
FT   gene            638170..639270
FT                   /locus_tag="CR539_03260"
FT   CDS_pept        638170..639270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03260"
FT                   /product="LPS export ABC transporter permease LptF"
FT                   /note="with LptBGC is involved in lipopolysaccharide
FT                   export; Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A1X1LN51"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1X1LN51"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313265.1"
FT                   /protein_id="AUJ94541.1"
FT                   /translation="MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPA
FT                   NLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMI
FT                   LAVFTAIVAAVNVMWAGPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIES
FT                   VDGSDFKDVFLAQIRPKGNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDF
FT                   RITDFQDYQAIIGHQAVALDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMAL
FT                   MVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLA
FT                   LAIVLNLWDAVPIRRLRASFSRKGAV"
FT   gene            639270..640352
FT                   /locus_tag="CR539_03265"
FT   CDS_pept        639270..640352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03265"
FT                   /product="lipopolysaccharide ABC transporter permease LptG"
FT                   /note="with LptABCF is involved in the transport of
FT                   lipopolysaccharides; Derived by automated computational
FT                   analysis using gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A3Q0MTM3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3Q0MTM3"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313266.2"
FT                   /protein_id="AUJ94542.1"
FT                   /translation="MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQG
FT                   SYDALGAGMYTLLSVPKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVAL
FT                   SVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYI
FT                   ARVKGDEELGGISIYAFNENRRLQSVRYAATAKFDPEHKVWRLSQVDESDLTNPKQITG
FT                   SQTVSGTWKTNLTPDKLGVVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQ
FT                   PLSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIG
FT                   ALLPSASFFLISLWLLMRKS"
FT   gene            complement(640513..642015)
FT                   /locus_tag="CR539_03270"
FT   CDS_pept        complement(640513..642015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03270"
FT                   /product="DUF853 domain-containing protein"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A2C1H0"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_313267.1"
FT                   /protein_id="AUJ94543.1"
FT                   /translation="MSEPLLIARTPDTELFLLPGMANRHGLITGATGTGKTVTLQKLAE
FT                   SLSEIGVPVFMADVKGDLTGIAQAGTASEKLLARLKNIGVNDWQPHANPVVVWDIFGEK
FT                   GHPVRATVSDLGPLLLARLLNLNDVQSGVLNIIFRIADDQGLLLLDFKDLRAITQYIGD
FT                   NAKSFQNQYGNISSASVGAIQRGLLSLEQQGAAHFFGEPMLDIKDWMRTDANGKGVINI
FT                   LSAEKLYQMPKLYAASLLWMLSELYEQLPEAGDLEKPKLVFFFDEAHLLFNDAPQVLLD
FT                   KIEQVIRLIRSKGVGVWFVSQNPSDIPDNVLGQLGNRVQHALRAFTPKDQKAVKAAAQT
FT                   MRANPAFDTEKAIQELGTGEALISFLDAKGSPSVVERAMVIAPCSRMGPVTEDERNGLI
FT                   NHSPVYGKYEDDVDRESAYEMLQKGFQASTEQQNNPPAKGKEVAVDDGILGGLKDILFG
FT                   TTGPRGGKKDGVVQTMAKSAARQVTNQIVRGMLGSLLGGRRR"
FT   gene            complement(642093..643091)
FT                   /locus_tag="CR539_03275"
FT   CDS_pept        complement(642093..643091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03275"
FT                   /product="transcriptional regulator"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A024L8R5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A024L8R5"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418685.1"
FT                   /protein_id="AUJ94544.1"
FT                   /translation="MRNHRISLQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIME
FT                   EINYIPNRAPGMLLNAQSYTLGILIPSFQNQLFADILAGIESVTSEHNYQTLIANYNYD
FT                   RDSEEESVINLLSYNIDGIILSEKYHTIRTVKFLRSATIPVVELMDVQGERLDMEVGFD
FT                   NRQAAFDMVCTMLEKRVRHKILYLGSKDDTRDEQRYQGYCDAMMLHNLSPLRMNPRAIS
FT                   SIHLGMQLMRDALSANPDLDGVFCTNDDIAMGALLLCRERNLAVPEQISIAGFHGLEIG
FT                   RQMIPSLASVITPRFDIGRMAAQMLLSKIKNNDHNHNTVDLGYQIYHGNTL"
FT   gene            complement(643158..644477)
FT                   /locus_tag="CR539_03280"
FT   CDS_pept        complement(643158..644477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CR539_03280"
FT                   /product="gnt-II system L-idonate transporter"
FT                   /note="Derived by automated computational analysis using
FT                   gene prediction method: Protein Homology."
FT                   /db_xref="GOA:A0A085P6Y2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A085P6Y2"
FT                   /inference="COORDINATES:similar to AA
FT                   sequence:RefSeq:NP_418686.1"
FT                   /protein_id="