(data stored in SCRATCH zone)

EMBL: CP029175

ID   CP029175; SV 1; circular; genomic DNA; STD; PRO; 2911466 BP.
XX
AC   CP029175;
XX
PR   Project:PRJNA450492;
XX
DT   17-APR-2019 (Rel. 140, Created)
DT   17-APR-2019 (Rel. 140, Last updated, Version 1)
XX
DE   Listeria monocytogenes strain NCCP 15743 chromosome, complete genome.
XX
KW   .
XX
OS   Listeria monocytogenes
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-2911466
RA   Kim J., Ryu S.;
RT   "Complete genome sequence of Listeria monocytogenes FORC_68 chromosome";
RL   Unpublished.
XX
RN   [2]
RP   1-2911466
RA   Kim J., Ryu S.;
RT   ;
RL   Submitted (01-MAY-2018) to the INSDC.
RL   Food Biotechnology College of Agriculture and Life Sciences, Seoul National
RL   University, 1 Gwank-Ro, Gwanak Gu, Seoul, Seoul 08826, Republic of Korea
XX
DR   MD5; f7ade70be7913f4e7323ba36d183bece.
DR   BioSample; SAMN08939842.
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: SMRT Analysis v. 2,3.0
CC   Coverage              :: 193x
CC   Sequencing Technology :: PacBio
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2911466
FT                   /organism="Listeria monocytogenes"
FT                   /host="Homo sapiens"
FT                   /strain="NCCP 15743"
FT                   /mol_type="genomic DNA"
FT                   /country="South Korea"
FT                   /lat_lon="37.12 N 126.56 E"
FT                   /isolation_source="blood"
FT                   /collected_by="NCCP"
FT                   /collection_date="2012"
FT                   /db_xref="taxon:1639"
FT                   /culture_collection="NCCP:15743"
FT   gene            1..1356
FT                   /locus_tag="FORC68_0001"
FT   CDS_pept        1..1356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /db_xref="GOA:L8DVH8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:L8DVH8"
FT                   /protein_id="QBZ17229.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
FT   gene            1550..2695
FT                   /locus_tag="FORC68_0002"
FT   CDS_pept        1550..2695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0002"
FT                   /product="DNA polymerase III beta component"
FT                   /db_xref="GOA:L8DR62"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:L8DR62"
FT                   /protein_id="QBZ17230.1"
FT                   /translation="MKFVIERDRLVQAVNEVTRAISARTTIPILTGIKIVVNDEGVTLT
FT                   GSDSDISIEAFIPLIENDEVIVEVESFGGIVLQSKYFGDIVRRLPEENVEIEVTSNYQT
FT                   NISSGQASFTLNGLDPMEYPKLPEVTDGKTIKIPINVLKNIVRQTVFAVSAIEVRPVLT
FT                   GVNWIIKENKLSAVATDSHRLALREIPLETDIDEEYNIVIPGKSLSELNKLLDDASESI
FT                   EMTLANNQILFKLKDLLFYSRLLEGSYPDTSRLIPTDTKSELVINSKAFLQAIDRASLL
FT                   ARENRNNVIKLMTLENGQVEVSSNSPEVGNVSENVFSQSFTGEEIKISFNGKYMMDALR
FT                   AFEGDDIQISFSGTMRPFVLRPKDAANPNEILQLITPVRTY"
FT   gene            2804..4147
FT                   /locus_tag="FORC68_0003"
FT   CDS_pept        2804..4147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A393DY66"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393DY66"
FT                   /protein_id="QBZ17231.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDYDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFARQFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGILFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYVGLWWATPVAWITATMLGVWRYKSGAWQKKAVIRRK"
FT   gene            4261..4548
FT                   /locus_tag="FORC68_0004"
FT   CDS_pept        4261..4548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MNH3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNH3"
FT                   /protein_id="QBZ17232.1"
FT                   /translation="MYYWQNFSKIEGSDKKRLGVKFLAETVKINSEFVTLGQLLQMIDV
FT                   VSTGGMAKAYLSENTIYINGEQDNRRGKKLRNGDVILVPGVGKVKIEQGK"
FT   gene            4552..5664
FT                   /locus_tag="FORC68_0005"
FT   CDS_pept        4552..5664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0005"
FT                   /product="DNA recombination and repair protein RecF"
FT                   /db_xref="GOA:A0A401AC14"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A401AC14"
FT                   /protein_id="QBZ17233.1"
FT                   /translation="MHLESIVLRNFRNYENLELEFSPSVNVFLGENAQGKTNLLEAVLM
FT                   LALAKSHRTTNDKDFIMWEKEEAKMEGRIAKHGQSVPLELAITQKGKRAKVNHLEQKKL
FT                   SQYVGNLNVVIFAPEDLSLVKGAPGIRRRFLNMEIGQMQPIYLHNLSEYQRILQQRNQY
FT                   LKMLQMKRKVDPILLDILTEQFADVAINLTKRRADFIQKLEAYAAPIHHQISRGLEALK
FT                   IEYKASITLNGDDPEVWKADLLQKMESIKQREIDRGVTLIGPHRDDSLFYINGQNVQDF
FT                   GSQGQQRTTALSIKLAEIDLIHEETGEYPVLLLDDVLSELDDYRQSHLLGAIEGKVQTF
FT                   VTTTSTSGIDHETLKQATTFYVEKGTVKKS"
FT   gene            5713..7653
FT                   /locus_tag="FORC68_0006"
FT   CDS_pept        5713..7653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0006"
FT                   /product="DNA gyrase component B"
FT                   /db_xref="GOA:Q7BSI8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI8"
FT                   /protein_id="QBZ17234.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
FT   gene            7748..10276
FT                   /locus_tag="FORC68_0007"
FT   CDS_pept        7748..10276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0007"
FT                   /product="DNA gyrase component A"
FT                   /db_xref="GOA:Q7BSI9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI9"
FT                   /protein_id="QBZ17235.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   gene            10411..11925
FT                   /locus_tag="FORC68_0008"
FT   CDS_pept        10411..11925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0008"
FT                   /product="Cardiolipin synthetase"
FT                   /db_xref="GOA:A0A3A7VV07"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7VV07"
FT                   /protein_id="QBZ17236.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYVLINQAAILFLVTSGIIQLCGVIIAI
FT                   RLLLFDQRNTSSKVAWVAVIFILPVLGTISYLVFGRNPATRKFSTAQVKEKTKLINAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDAISTEIRDILVEKAKSGVEVRFMFDGLGSSKLGKAFLAPLKEAGVSIHAFDPI
FT                   ASPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENQAGAADGFISESGLKQYFSPVDMGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGISFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFKKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
FT   gene            11941..12459
FT                   /locus_tag="FORC68_0009"
FT   CDS_pept        11941..12459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0009"
FT                   /product="Spermidine N1-acetyltransferase"
FT                   /db_xref="GOA:A0A1C7PVU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PVU7"
FT                   /protein_id="QBZ17237.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNMHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYREMDI"
FT   gene            12463..12579
FT                   /locus_tag="FORC68_0010"
FT   CDS_pept        12463..12579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MP38"
FT                   /protein_id="QBZ17238.1"
FT                   /translation="MIGAGKVAPVIVLGQKKFYNKVLVKKLWYHEVLKFVLF"
FT   gene            12601..13569
FT                   /locus_tag="FORC68_0011"
FT   CDS_pept        12601..13569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0011"
FT                   /product="Mevalonate kinase"
FT                   /db_xref="GOA:Q7BSJ0"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSJ0"
FT                   /protein_id="QBZ17239.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   gene            13526..14497
FT                   /locus_tag="FORC68_0012"
FT   CDS_pept        13526..14497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0012"
FT                   /product="Diphosphomevalonate decarboxylase"
FT                   /db_xref="GOA:A0A3T2HAL8"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAL8"
FT                   /protein_id="QBZ17240.1"
FT                   /translation="MKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDEKLTQDTFILNNEQKTDAKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSAS
FT                   AFAALALAGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVP
FT                   FTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFKNWVSAAEIDLEEMKQAILD
FT                   EDFIKVGEITERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAG
FT                   PNVKVICERANENIVAEKLSGLAKNVLICHAGKEASVVSDEK"
FT   gene            14478..15557
FT                   /locus_tag="FORC68_0013"
FT   CDS_pept        14478..15557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0013"
FT                   /product="Phosphomevalonate kinase"
FT                   /db_xref="GOA:A0A1U7AGL1"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AGL1"
FT                   /protein_id="QBZ17241.1"
FT                   /translation="MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLE
FT                   DSERNELWIPHYENPVSWPVGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMII
FT                   ETELIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCG
FT                   DIASCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTG
FT                   TPVSTGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSAIKENRRI
FT                   LQELGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEW
FT                   EKLGIKHLPFHTGRVQITE"
FT   gene            15902..17008
FT                   /locus_tag="FORC68_0014"
FT   CDS_pept        15902..17008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0014"
FT                   /product="AA3-600 quinol oxidase component II"
FT                   /db_xref="GOA:A0A4P7MNI4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNI4"
FT                   /protein_id="QBZ17242.1"
FT                   /translation="MSKVLKSLLLTALLGVTGLISGCGDLTVLNPKGPVAKGQSDLIIY
FT                   SIIFMLVIVLTIFVLFTIMLVKYRERKDISNYEPDMHGSKKLEIFWTLIPVAIVIALAI
FT                   PTVKTIYAGEEAPKVTSHKDPIIIYATSADWKWIFSYPDESIETVNYVNIPTDRPVLFK
FT                   LTSADTMTSFWVPQLGGQKYAMSGMTMNLYLQADEVGTYKGRNANFNGEGFADQRFDVV
FT                   AQSEKDFKKWAKETKASSPVITQDIYDRLLIPGSSKKKTYSGTHLAFVDVAADPEYVFY
FT                   AYKRFGYEMTNPHDPNTKSTISDKPMLPVRPVTVTNPQFERHDMKPQIIKNGEGYHEDK
FT                   HREDEMKKMEEDIQTNEFNKKESDDAGK"
FT   gene            17026..19005
FT                   /locus_tag="FORC68_0015"
FT   CDS_pept        17026..19005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0015"
FT                   /product="AA3-600 quinol oxidase component I"
FT                   /db_xref="GOA:A0A3T1NTN1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014233"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTN1"
FT                   /protein_id="QBZ17243.1"
FT                   /translation="MKWNEFIVTGDPMILGAQISIVLVSIGVVALLTYTKKWKWLMKEW
FT                   ISSVDHKKIGIMYLLAAVLMFFRGGVDALMMRTQLALPDMKFLDAQHYNEVFSTHGTIM
FT                   ILFMAMPFIIGLMNIAVPLQIGARDVAFPFLNNLSFWTFFMGAMLFNLSFVIGGSPDAG
FT                   WTNYAPLATDFSAGYGINFYLLGVQIAGIGTLMTGINFFVTILRMRTKGMTLMKMPMFT
FT                   WSSLITSLIIIFAFPVLTVALALMSFDRLFGTAFFTLTNGGLPMMWANLFWVWGHPEVY
FT                   IVILPAFGIFSEIISTFSRKKLFGYPAMVAAMAVISLLSFLVWVHHFFTMGSGALVNSF
FT                   FSITTMMIAIPTGIKIFNWLFTMYKGRITFTTPMLWSLAFIPNFVVGGVTGVMLAMAAA
FT                   DYQYHNTYFLVSHFHYVLIAGTVFSCFAGLTYWYPKMVGYRLNEKIGKWFFWIFVVGFN
FT                   VCFFPQYFLGLDGMPRRIYTYVQGDGWTTLNFISTVGGFLMGVAFLVLCYNIYYSYKNS
FT                   KREVTGDPWDARTLEWATSSAVPPKYNFAVLPEWNDLDDFWNRKQKGDPYVNDKNYKPI
FT                   HMPSNTMVGFVMSVFFFIAGFGLVFYWYWMGIIGLVGILGCMIYRSFQNNDGYHVEVDE
FT                   IKETEEHNARELATGVKEGNPWNL"
FT   gene            18993..19604
FT                   /locus_tag="FORC68_0016"
FT   CDS_pept        18993..19604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0016"
FT                   /product="AA3-600 quinol oxidase component IIII"
FT                   /db_xref="GOA:A0A1C7PVP4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PVP4"
FT                   /protein_id="QBZ17244.1"
FT                   /translation="MESVETNKNLPIEYRSEQGRLNILGFWIFLGAEIALFATLFATYF
FT                   VMRKAGSNAGHPPAEMFELWLVLIMTFLLLTSSFTCGLAIGEMRKGNVKMLTIYSIITL
FT                   ILGAGFVGFELYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIK
FT                   MHGLTPKTASKVFISSLYWHFLDVVWIFIFTGVYLLGMVN"
FT   gene            19606..19938
FT                   /locus_tag="FORC68_0017"
FT   CDS_pept        19606..19938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0017"
FT                   /product="AA3-600 quinol oxidase component IV"
FT                   /db_xref="GOA:A0A1D2J1B0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1B0"
FT                   /protein_id="QBZ17245.1"
FT                   /translation="MTQNNKSNAAHAEGGIPWKHIVGFALSVVLTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLL"
FT   gene            complement(19990..21108)
FT                   /locus_tag="FORC68_0018"
FT   CDS_pept        complement(19990..21108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0018"
FT                   /product="Capsule biosynthesis protein capA"
FT                   /db_xref="GOA:A0A477VNQ4"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A477VNQ4"
FT                   /protein_id="QBZ17246.1"
FT                   /translation="MKSRKKGIILVLSVILIFSIGLLVNNLMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHW
FT                   LQGFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFNQGKVTAHFDPGIISGNQIN
FT                   MLDGSAKTAQLNYLQSISPNATINSNGDISAK"
FT   gene            21334..22767
FT                   /locus_tag="FORC68_0019"
FT   CDS_pept        21334..22767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0019"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="GOA:A0A1C7PVZ7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PVZ7"
FT                   /protein_id="QBZ17247.1"
FT                   /translation="MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGR
FT                   WEALFNPSKALATDYGFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGD
FT                   ETTPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFC
FT                   EAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALA
FT                   TKLGHEINPENQIGCMLAAGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTK
FT                   RFFKEHNINIKMEDGDLDALRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNP
FT                   YLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYM
FT                   REHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSK
FT                   KKSFDWYKKVIETNGKDID"
FT   gene            complement(22814..23635)
FT                   /locus_tag="FORC68_0020"
FT   CDS_pept        complement(22814..23635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A460VSU5"
FT                   /protein_id="QBZ17248.1"
FT                   /translation="MGTFFSKWGKWILVLGLVFSVFSVSTAGQAAAKETVINKQMVTTA
FT                   SLNVRSTNSTSGKVIGWLKNNTKFKAIAKTSNNWYRFSFKGKNGYVSGKYVKAATATPT
FT                   PKPPTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNPN
FT                   YGFVGNPFSKSGWTIYPPALVNQVKKYTGSAKNMTGTNLAGIKNQLNKKRPVVAWVSNF
FT                   HGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWSKQAKRAISY"
FT   gene            23876..24616
FT                   /locus_tag="FORC68_0021"
FT   CDS_pept        23876..24616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0021"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A1D2J1C9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1C9"
FT                   /protein_id="QBZ17249.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGRFNRKTKITNEHTKVV
FT                   AINEIQDARIAKKLQIPPENMIVHFQRIRLIDDLPWTVQNNYMAKSNLINVDLTNFEKF
FT                   NSLSEVIKELYGINILHEAMKERIEVEFPVKDKNNFKLLEIDTELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
FT   gene            24632..25033
FT                   /locus_tag="FORC68_0022"
FT   CDS_pept        24632..25033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0022"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="GOA:A0A3A7UNX0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7UNX0"
FT                   /protein_id="QBZ17250.1"
FT                   /translation="MDYIIAAHGRYAQEVKDSCQMITGQTTNISAITFTEEMGVTDVLD
FT                   AYMAVYSPANETAIIVDIVGGTPCNAAQMFSTKHPEVKVVSGLSLGLIIPLSLGESLEE
FT                   AMLGAKDNIQFVEQKASHTIVSDDGEEED"
FT   gene            25033..25521
FT                   /locus_tag="FORC68_0023"
FT   CDS_pept        25033..25521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0023"
FT                   /product="PTS system, galactosamine-specific IIB component"
FT                   /db_xref="GOA:A0A1D2IRV7"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IRV7"
FT                   /protein_id="QBZ17251.1"
FT                   /translation="MGSNGIKHVRVDERLIHGQVATMWTNTIKATRIMIVDDAVVKNEM
FT                   EKVALKTAVPAGVKLSILTVKGAANNINNDKYAGQQVFLIVKSPHALRGLVDAGVELPQ
FT                   INVGNMSTKAGSRQIKKSVSVTDENLEDFDYLAQKGIKITAQMVPSEDAVEFANLLKK"
FT   gene            25544..26347
FT                   /locus_tag="FORC68_0024"
FT   CDS_pept        25544..26347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0024"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /db_xref="GOA:A0A1D2J1D7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1D7"
FT                   /protein_id="QBZ17252.1"
FT                   /translation="MDLAIWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
FT   gene            26328..27149
FT                   /locus_tag="FORC68_0025"
FT   CDS_pept        26328..27149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0025"
FT                   /product="PTS system, galactosamine-specific IID component"
FT                   /db_xref="GOA:A0A0D8X1F7"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X1F7"
FT                   /protein_id="QBZ17253.1"
FT                   /translation="MANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTGYL
FT                   YSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVVTG
FT                   LKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFTLL
FT                   PLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELKMQ
FT                   DMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
FT   gene            27177..27881
FT                   /locus_tag="FORC68_0026"
FT   CDS_pept        27177..27881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IRW6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR022951"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IRW6"
FT                   /protein_id="QBZ17254.1"
FT                   /translation="MGLTFFDKARELTEELEKTQAESIHQAAKLVADSIMNDGIIQAFG
FT                   SGHSYAAAIEVCGRAGGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISN
FT                   SGRNPMGIELAEWIKSQGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGD
FT                   AALELEGLEGKVCGTSSFSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFA
FT                   IEDKFADRIFHL"
FT   gene            27933..28577
FT                   /locus_tag="FORC68_0027"
FT   CDS_pept        27933..28577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0027"
FT                   /product="Cytoplasmic copper homeostasis protein CutC"
FT                   /db_xref="GOA:A0A4P7MDK9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDK9"
FT                   /protein_id="QBZ17255.1"
FT                   /translation="MMILKEVCIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGVAK
FT                   HVVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGL
FT                   LDKPAINELLKAAAGLEVTFHMAFDELVETEKLSAIDWLVEQGVTRILTHGGDGAKLPE
FT                   ETFVQWRKYIDYAAGRIIILPGGGIKSHNLEWIIKETGAAEIHGTDLFGER"
FT   gene            28782..30686
FT                   /locus_tag="FORC68_0028"
FT   CDS_pept        28782..30686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0028"
FT                   /product="PTS system, beta-glucoside-specific IIB
FT                   component, IIC component, IIA component"
FT                   /db_xref="GOA:L8DNR2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:L8DNR2"
FT                   /protein_id="QBZ17256.1"
FT                   /translation="MKYEQLAKDILKNVGGKENINSVFHCITRLRFKLKDENIANTKEI
FT                   EKLDGVISVIKSGGQYQVVIGNHVPDVFKAVLEVGGISAEGDEGSSAPATGNIFNRFID
FT                   MISGVFTPVLGVLAATGMIKGFTAMFVAFGWITVTSGTYQLLYAIGDCLFYFFPIFLGY
FT                   TAMKKFGGNIFIGMAIGGALVYPTLAGITAGDPLYTLFAGTIFESPIHVTFLGIPVILM
FT                   SYASSVIPIIVATYFGSKVEKGFKKIIPDVIKTFVVPFCTLLIVVPITFIVIGPIATWA
FT                   GQLLGAGTIWVYNLSPIIAGLILGGFWQVFVIFGLHWGLVPVAINNLTVLGHDPILAMT
FT                   FGASFAQIGAVLAVFFKSRNKKIKSLSIPAFISGIFGVTEPAIYGVTLPLKKPFIMSCI
FT                   AGGIGGGIIGFAGSQTYIMGGLGIFGLPNFFKPGSGISGEFWWVVIAIVISFILGFILT
FT                   YVVGFKDPADVVVEQSNTVEGETLIERETIPAPVVGEIVTLADVKDEAFSSGALGKGVA
FT                   IIPTVGRVVAPAAGTVTTIFPTGHAIGITTKDGAEVLIHIGMDTVQLEGKFFTAHVKQG
FT                   DVIEKGQLLTEFDIEGIKAAGYDVTTPVVVTNSNQYLDVMITDAKEAKLEERLITLVI"
FT   gene            30771..31646
FT                   /locus_tag="FORC68_0029"
FT   CDS_pept        30771..31646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0029"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="GOA:A0A1D2J1I9"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1I9"
FT                   /protein_id="QBZ17257.1"
FT                   /translation="MLVKGDTVGIICCSDGRKKEDENRIALLEQVLKTEFSLQVVFAET
FT                   IFQKAESPFSGTPQARAIELMKLYQRSDVQMIFDISGGDAANQVLPYLDFDIIRNAQKP
FT                   FVGYSDLTVILNAIYTKTEQMGYNYQLLHLVGKDSELQQSHFRKTFFENRVLISGEQLN
FT                   EFVWRGGEVIGGNIRCFLKLAGTNFMPDFTNKIILLESLGGKEAKLASYVAQLEQLGAF
FT                   SKCLGVIVGQHSEAEENGEYERIGRLYQQIGRKYKLPIFRTSEIGHSVDAKPCLIGAKV
FT                   NVSRETLTNF"
FT   gene            31880..32218
FT                   /locus_tag="FORC68_0030"
FT   CDS_pept        31880..32218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:B4XQI4"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:B4XQI4"
FT                   /protein_id="QBZ17258.1"
FT                   /translation="MKVEGLLGFLGAALGIGFSLMVLVIPDISQALEEESFFFYMLTIG
FT                   SLVLSGVGLAGSFIVSHKPRLGGAMMVAAAIGCTMSISIMFLLPIVLLAVGGLIALINY
FT                   EEAASVEE"
FT   gene            complement(32254..33063)
FT                   /locus_tag="FORC68_0031"
FT   CDS_pept        complement(32254..33063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0031"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /db_xref="GOA:A0A4P7MHE4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHE4"
FT                   /protein_id="QBZ17259.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFAKLVHPKADVIASNGGVVAVSGEIIQQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVFYTKNPPYYFTDEEDKGRVNATKLVAIKSREIFLEHADQFINGIVIEEEDFDK
FT                   LAVLRSDLEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKHLNR"
FT   gene            complement(33080..34135)
FT                   /locus_tag="FORC68_0032"
FT   CDS_pept        complement(33080..34135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0032"
FT                   /product="transcriptional regulator LacI family"
FT                   /db_xref="GOA:A0A1D2IS53"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IS53"
FT                   /protein_id="QBZ17260.1"
FT                   /translation="MKKITIQEIAKLSGVSVSTVSRVLNNSPSVSAAKRKKIQAIIDEH
FT                   NYTPSVFARGMVNKQTKNIGVILPDISNPYFISLITQIQKFALDYMFSTILFNTMLAEP
FT                   DNKNNQHPLTEEDYLKIILEKQVDGLLILGGEIDKEIVPKEYITALNQLNNAIPVVVIG
FT                   SKIPELNCLFIERNLKKGVTTLVSHLTALGHKNIGFIGGEAGVKITTYRLESFKEAMTS
FT                   YQHPVNDDWVVLSDYYTADGYAAMTHLLENSTTLPTALVAINDNVAIGAIRAINDAKLS
FT                   CPEDIAIVSCDQFMNGDYQTPRLTSMDQHNEYLGKMAILQLISAINGQVEPMIINHNPE
FT                   LIIRESCGSKL"
FT   gene            34337..35302
FT                   /locus_tag="FORC68_0033"
FT   CDS_pept        34337..35302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0033"
FT                   /product="Sugar kinase and transcription regulator"
FT                   /db_xref="GOA:A0A3A7FWE2"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FWE2"
FT                   /protein_id="QBZ17261.1"
FT                   /translation="MDIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   ETLLKVLDDYTQNIGFIAPKQTGIGVGLVGRVDHKSGVWLEIEPGKSNPTPLADILEAK
FT                   TGLPVSLGNDVVCATMAEKQFGWGRETNDFIYLNVGTGLAAGFVVDGRITQGGHFNAGE
FT                   VGHAVVDIHSDVLCGCGRRGCVERLASGLGIKEEALRHLNSYPTSILAETQTELTGKMV
FT                   LHAAEQKDELAEKIIDNATLQLANLIMNLVRTTDPECLILGGGVTRNEHFFQKIQDNLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMRLGNEGGKE"
FT   gene            35299..37701
FT                   /locus_tag="FORC68_0034"
FT   CDS_pept        35299..37701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0034"
FT                   /product="glycosyl hydrolase, family 9"
FT                   /db_xref="GOA:A0A3A7MBL0"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7MBL0"
FT                   /protein_id="QBZ17262.1"
FT                   /translation="MKPSMKRQIAQTGIIHRPLPIETEHALETLAKKKQVLSSRTLFSS
FT                   KQHVSLEFTHQGAGDFTISGQDEIKLSSPVVMPHWPAGAPDDGDYTNFGNVTISASIGN
FT                   EDWSGFNRVRIQVFPDFPGVTNPYLMISFKNDGTVKVPDIYGREGVHGVNLINHEWNDV
FT                   IFEIEGLPRDRMTEMSFSYYLNGPERLTAGTMELFINEIKLEQISEPEISKGWLPQDNT
FT                   LIYSHNGYSKDMPKVAFCANKHAATTFTIHDKETDKVVFTGKSYQNATETGNFIILDFS
FT                   DLQTVGEYYLKFADMQTEIFQIGTSEVIWESSIWKSLNFIFCERCGCPVFGKHTTCHAD
FT                   IIAEHDGKQLSFNGGWHDAGDVSQQLIQTAEVTMALYEMAASLPEKEETLRMRLLEEGE
FT                   WGLDFILKTRFGDGFRATSAGMTRWTDGLVGGMDDAIARVHNQAYENFYCAGIEAYIGS
FT                   QIADNATMQNHLLRIAEEDLLFAIKELEKHGTSQKPIFWEHTYQTSESLYYATASWAAS
FT                   MVYQLTNKEIYAEKAAEWLDLMLEAQEKAGIRDSETSELYKGFFYRDKSHKVIQHFNHQ
FT                   AREHLYLLALEAALETQPSHAEKQTWLQAVEMYGDYLKKVTRFTKPYPLIPAGLYKKDE
FT                   YLDEASFHLQHLLIDERAIEEYQLQFEQGIKINDEVALRKFPIWFSFRGNNAILLSAGK
FT                   AASIAGKILKDKALLDIAEGQLQWVIGMNPFGQSMMHGEGYRYAQQYSVLNGEITGEIP
FT                   VGMETFRNEDEPYWPEFNNATYKEVWVGNAGKWMSIVADLNKITGKS"
FT   gene            37714..39066
FT                   /locus_tag="FORC68_0035"
FT   CDS_pept        37714..39066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0035"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="GOA:A0A1D2J1E4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1E4"
FT                   /protein_id="QBZ17263.1"
FT                   /translation="MSSERSLSSRFIEGLSIFAQKISSQKHIMAIRDGFAAMIPITIIA
FT                   AFFLLVNNVLLQPENGLLKFIPNVENYLGVGIQVYNATLGIMAILAAFLIGNFLAKSYG
FT                   MEGRTEGVIAVAAYVVLIPASSHLMSVDGKAFEAGGVLTQEMTSSTGMFLAIIAALVSI
FT                   TMLAKFSKSKKLKISMPESVPPAIAKSFNILIPSFLVLSILAIIEVLVVSFVSMSIPEI
FT                   IVKVLQIPLVGGFQTLPGILLYVFLAGFLWVFGIHGAFVLGAISGPVLLTSLQQNIDAV
FT                   NAGTALPNIVTQPFLDAFVYMGGGGTIICLVIAIFIASKRPDHRMVTKFGLIPSIFNVS
FT                   EPLMFGLPVVFNPIYGIPLVIAPLASTAMAYFATSWGWISQTYILIPWVTPPVLSGYLA
FT                   TGGDIRASILQIAIIIVGTLIYLPFVLVANRAYVLEQKAAGKVEAVTNGEV"
FT   gene            39068..40153
FT                   /locus_tag="FORC68_0036"
FT   CDS_pept        39068..40153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0036"
FT                   /product="Glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="GOA:A0A1D2J1I8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1I8"
FT                   /protein_id="QBZ17264.1"
FT                   /translation="MKPTMMTYINEEEEMCRAILANFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENIADVRITVEEPFNHLYYEKLSNHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGL
FT                   HFAYKTAQIDETKFNNEINAFSRATNAIPATIAETEAFYERWQEEFATAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETESAVTERLVALR
FT                   NYESKYTPFTYTVKFGTAGNDRTLLIPADLDEYQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
FT   gene            40388..41413
FT                   /locus_tag="FORC68_0037"
FT   CDS_pept        40388..41413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0037"
FT                   /product="Putrescine carbamoyltransferase"
FT                   /db_xref="GOA:A0A1D2IS54"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024903"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IS54"
FT                   /protein_id="QBZ17265.1"
FT                   /translation="MNKKRDFIDTKDFSKEEILFMIEIGRKMKESIKNGHYPQLLKHKT
FT                   LGMIFEQSSTRTRVSFETAMTQLGGHAQYLAPGQIQLGGHESVGDTAKVLSRLVDILMA
FT                   RVERHQTVVELANTAAIPVINGMSDYNHPTQELGDAITMFEHLPKGKKIEDCKIVFVGD
FT                   ATQVCASTMFMATKLGMDFVQFGPKGFQLREEHLKVAEENCEVSGGSYLITEDVDIALK
FT                   DADFIYTDVWYGLYEAELSEEERMKTFYPKYQVNKELISKAAPHVKFMHCLPATRGEEV
FT                   TDEVLDAPYSVVIDEAENRLTAMRALLVYFMNPYVKEAGFAVAEKYDAELELLLRNGAG
FT                   L"
FT   gene            41486..42871
FT                   /locus_tag="FORC68_0038"
FT   CDS_pept        41486..42871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0038"
FT                   /product="Agmatine/putrescine antiporter, associated with
FT                   agmatine catabolism"
FT                   /db_xref="GOA:A0A1D2J1E2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1E2"
FT                   /protein_id="QBZ17266.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSILIQLIFVWIVVIVSCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAITKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGILIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKLDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTIVAVIVGEICIWLAGKRKDKGEIKN
FT                   END"
FT   gene            42858..43952
FT                   /locus_tag="FORC68_0039"
FT   CDS_pept        42858..43952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0039"
FT                   /product="Agmatine deiminase"
FT                   /db_xref="GOA:A0A3T1VET8"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1VET8"
FT                   /protein_id="QBZ17267.1"
FT                   /translation="MRTIDSSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQK
FT                   AFVDVATAISHFEPVTVVASSSQYVNARYMLPDEIRVVEMDNDDAWVRDSGPTFVVNDS
FT                   GDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLADFVLEGGSIHVDG
FT                   EGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFN
FT                   YVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEES
FT                   KGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFGDPNDELAREKLQQLYPNCEVV
FT                   GVKAREILLGGGNIHCITQQVPRG"
FT   gene            43965..44906
FT                   /locus_tag="FORC68_0040"
FT   CDS_pept        43965..44906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0040"
FT                   /product="Carbamate kinase"
FT                   /db_xref="GOA:A0A1D2J237"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J237"
FT                   /protein_id="QBZ17268.1"
FT                   /translation="MNQKIVVALGGNAILSSDASAEAQRSALEETAEYLVQFIENGDDL
FT                   IISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLD
FT                   KVAVSLITQVVVDKDDPAFEKPTKPIGPFLNKEEAEKEMAETGAIFLEDAGRGYRKVVP
FT                   SPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAEL
FT                   IDADLLVILTGVENVYINYNQPNQKKLEQVTVSELEKYIDEKQFAAGSMLPKIEAATAF
FT                   VKERPHAKAIITSLENIGAMLERGAGTVIVAG"
FT   gene            45008..46117
FT                   /locus_tag="FORC68_0041"
FT   CDS_pept        45008..46117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0041"
FT                   /product="Agmatine deiminase"
FT                   /db_xref="GOA:A0A3T2HAN9"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAN9"
FT                   /protein_id="QBZ17269.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVDDK
FT                   GDMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCELERIDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHVQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANKTDAKGRTFIIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDEPKDKDAQELLEKLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
FT   gene            46134..46913
FT                   /locus_tag="FORC68_0042"
FT   CDS_pept        46134..46913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0042"
FT                   /product="Sialic acid utilization regulator, RpiR family"
FT                   /db_xref="GOA:A0A1D2IS60"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IS60"
FT                   /protein_id="QBZ17270.1"
FT                   /translation="MDFYEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVNKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
FT   gene            47018..47677
FT                   /locus_tag="FORC68_0043"
FT   CDS_pept        47018..47677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0043"
FT                   /product="DedA protein"
FT                   /db_xref="GOA:B4XQK8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B4XQK8"
FT                   /protein_id="QBZ17271.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
FT   gene            47757..48989
FT                   /locus_tag="FORC68_0044"
FT   CDS_pept        47757..48989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0044"
FT                   /product="Arginine deiminase"
FT                   /db_xref="GOA:A0A4P7MNL0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNL0"
FT                   /protein_id="QBZ17272.1"
FT                   /translation="MKMEQALNITSEIGKLQTVLVKRPGSELENITPEYLESLLFDDIP
FT                   YLKMMQKEHDFFAKTMRDSNIEVLYLEKLAAEALREANNKESFLTKMIKESNQMDESAL
FT                   YVRDYLMSFDEEEMIRKLMSGLKKSEIPERKKKHLNEMMDEQYPFFLDPLPNLYFTRDP
FT                   AAVIGNGVTINRMFQPARRRESIFIELILKHHPRFSNQDIPVWSGRGEPFSLEGGDELV
FT                   LNEETVLVGVSERTDARAVERLAESLFSRSPKIKRVLAVEIPETRSFMHLDTVFTMVNF
FT                   AQFTIHPAIQNQQGELNIYILEKSENGLEITPRRDFQRVIAEVLDEPEIDFIPCGGEDV
FT                   IVSAREQWNDGANTLAIAPGEVITYDRNQVSNDLLRSAGIKVHEVISSELSRGRGGPRC
FT                   MTMPLVRENLK"
FT   gene            49268..49561
FT                   /locus_tag="FORC68_0045"
FT   CDS_pept        49268..49561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0045"
FT                   /product="SSU ribosomal protein S6p"
FT                   /db_xref="GOA:A0A0D8X1H9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X1H9"
FT                   /protein_id="QBZ17273.1"
FT                   /translation="MARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWG
FT                   KRRLAYEINDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA"
FT   gene            49617..50153
FT                   /locus_tag="FORC68_0046"
FT   CDS_pept        49617..50153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0046"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="GOA:L8DVN4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:L8DVN4"
FT                   /protein_id="QBZ17274.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
FT   gene            50197..50436
FT                   /locus_tag="FORC68_0047"
FT   CDS_pept        50197..50436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0047"
FT                   /product="SSU ribosomal protein S18p"
FT                   /db_xref="GOA:A0A0D8X1P4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X1P4"
FT                   /protein_id="QBZ17275.1"
FT                   /translation="MAGGRRGGRRRKKVCYFTSNGITHIDYKDVELLKKFVSERGKILP
FT                   RRVTGTSAKYQRKLTVAIKRSRQMALLPFVAEEK"
FT   gene            50590..51201
FT                   /locus_tag="FORC68_0048"
FT   CDS_pept        50590..51201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0048"
FT                   /product="Phosphonate ABC transporter phosphate-binding
FT                   periplasmic component"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTV5"
FT                   /protein_id="QBZ17276.1"
FT                   /translation="MYKKLATVGMTVLLVGALSACSFNDDKDTSSNNSNNETTSSKSSN
FT                   NESSSDSLQNKSFDMSYEDAINAFKDKHSDAEISSVELEKSLGKYVYKVDGISNDNEYE
FT                   MKFNAETKEQLSDETDRLDREDAGGVEKENEKLSLDGIKSPKEAMDKAVSEQAGDVTSW
FT                   KIERELDTTYYEVTVKQDNNKYEIKLNAKTLDVLQTEQDD"
FT   gene            51458..52072
FT                   /locus_tag="FORC68_0049"
FT   CDS_pept        51458..52072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0049"
FT                   /product="Accessory regulator protein B"
FT                   /db_xref="GOA:L8DNT3"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:L8DNT3"
FT                   /protein_id="QBZ17277.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLMMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
FT   gene            52056..52217
FT                   /locus_tag="FORC68_0050"
FT   CDS_pept        52056..52217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0050"
FT                   /product="Accessory regulator protein D"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:A8E0G2"
FT                   /protein_id="QBZ17278.1"
FT                   /translation="MKNMNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVK
FT                   MQEKNENK"
FT   gene            52313..53608
FT                   /locus_tag="FORC68_0051"
FT   CDS_pept        52313..53608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0051"
FT                   /product="Histidine kinase of the competence regulon ComD"
FT                   /db_xref="GOA:A0A3T2HAQ2"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAQ2"
FT                   /protein_id="QBZ17279.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNKVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLIVFVSALYWKNKNVVVSASITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DEIFNELLPTLIYCAGMLANLLVFSFLLRKLIEKVNISRFVEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDIPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
FT   gene            53627..54355
FT                   /locus_tag="FORC68_0052"
FT   CDS_pept        53627..54355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0052"
FT                   /product="Response regulator of the competence regulon
FT                   ComE"
FT                   /db_xref="GOA:A8E0G0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8E0G0"
FT                   /protein_id="QBZ17280.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
FT   gene            54522..56495
FT                   /locus_tag="FORC68_0053"
FT   CDS_pept        54522..56495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0053"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="GOA:L8DP80"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:L8DP80"
FT                   /protein_id="QBZ17281.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
FT   gene            56498..56944
FT                   /locus_tag="FORC68_0054"
FT   CDS_pept        56498..56944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0054"
FT                   /product="LSU ribosomal protein L9p"
FT                   /db_xref="GOA:A0A0D8X4W2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X4W2"
FT                   /protein_id="QBZ17282.1"
FT                   /translation="MKVIFLKDVKGKGKKGETKNVADGYANNFLIKNGYAVEANNAALS
FT                   TLSAQKKKEDKLAAEELAEAKALKEKMENLTVELKAKSGEGGRLFGSITSKQIAQTLEK
FT                   THGIKIDKRKMDLPEAIRALGHTKVPVKLHHEVTATLDVHVSEE"
FT   gene            56969..58321
FT                   /locus_tag="FORC68_0055"
FT   CDS_pept        56969..58321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0055"
FT                   /product="Replicative DNA helicase, DnaB"
FT                   /db_xref="GOA:A0A3T1NTS2"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTS2"
FT                   /protein_id="QBZ17283.1"
FT                   /translation="MDNNFQDRTPPQNIEAEQAVLGAIFLEPNALITASEILMPDDFYR
FT                   TGHQIIFETMLDLNDHGKAVDVLTVYEALAAKGNLEDAGGLPYLTELSGAVPTAANLEY
FT                   YAHIIEDKALLRRLIRTATQIATDGYSREDELDMLMDEAEKSILEVSQRKNVGAFKNIK
FT                   DVLVKTYDDIEILHNRKGDITGIPTGFNELDKMTAGFQRNDLIIVAARPSVGKTAFALN
FT                   IAQNVATKTDENVAIFSLEMGAEQLVMRMLCAEGNINAQNLRTGALTSDDWQKLTIAMG
FT                   TLSNSGIYIDDTPGVRVNEIRSKCRRLKQETGLGMIVIDYLQLIAGSGRGGENRQQEVS
FT                   EISRSLKALARELEVPVIALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRE
FT                   DYYDREGENDGTIEIIIAKQRNGPVGEVKLAFVKEYNKFVNLEVRYDDAMA"
FT   gene            58377..58526
FT                   /locus_tag="FORC68_0056"
FT   CDS_pept        58377..58526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MKG8"
FT                   /protein_id="QBZ17284.1"
FT                   /translation="MQKGNALLLIDFEIPLKGLKKRTIKLPYKSMFVNPLTILVANGTM
FT                   YSGK"
FT   gene            58580..59872
FT                   /locus_tag="FORC68_0057"
FT   CDS_pept        58580..59872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0057"
FT                   /product="Adenylosuccinate synthetase"
FT                   /db_xref="GOA:A0A466ZEB7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A466ZEB7"
FT                   /protein_id="QBZ17285.1"
FT                   /translation="MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKF
FT                   DGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHI
FT                   ILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHN
FT                   LGEKNRLLERFYELEGFKLEDILEEYYDYGQQFKEYVCDTSVVLNDALDDGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTEL
FT                   FDSIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETL
FT                   KICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMER
FT                   IAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA"
FT   gene            59911..60087
FT                   /locus_tag="FORC68_0058"
FT   CDS_pept        59911..60087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7ME55"
FT                   /protein_id="QBZ17286.1"
FT                   /translation="MGFFYMAFSLYKNKSDFGMVYNFLFQKLKKLTKENEVCEKHIFLY
FT                   RNVVMERPIIKAL"
FT   gene            60189..60482
FT                   /locus_tag="FORC68_0059"
FT   CDS_pept        60189..60482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0059"
FT                   /product="ESAT-6/Esx family secreted protein EsxA/YukE"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8WZE3"
FT                   /protein_id="QBZ17287.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
FT   gene            60631..63837
FT                   /locus_tag="FORC68_0060"
FT   CDS_pept        60631..63837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0060"
FT                   /product="Putative secretion accessory protein EsaA/YueB"
FT                   /db_xref="GOA:A0A3T1NTW4"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTW4"
FT                   /protein_id="QBZ17288.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSNYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLTLSQKENEEHMKNMDTYTKTQEENAPFGVEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQANAKMTSEFQILEDSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILQENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRGAFSEGFSFTTDPKTLPTDTLKSDTINRLKSEGVALE
FT                   SSSYTVESSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQTAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKVSSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREESKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGATVVFTGL
FT                   NLFVWHRSKEKVEEDDSDEI"
FT   gene            63827..64342
FT                   /locus_tag="FORC68_0061"
FT   CDS_pept        63827..64342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0061"
FT                   /product="Putative secretion system component EssA"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR034026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A475GWR8"
FT                   /protein_id="QBZ17289.1"
FT                   /translation="MKYKIVALLMLLCFAFAPGVLAADSDSYLENNGKMDIKTDRLQKT
FT                   EEEKTKELEQMEETELDKNGIPLFTDEMDEKIAKEKAAEKAEYDRIRDSLFEEESTSGE
FT                   TVKKTKEKLFTGEYETTAVNTETPTTTETTVEDETKKTKQKTVGGAIAGTLVALAGGIY
FT                   VAARNVFE"
FT   gene            64360..64611
FT                   /locus_tag="FORC68_0062"
FT   CDS_pept        64360..64611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0062"
FT                   /product="Putative secretion accessory protein EsaB/YukD"
FT                   /db_xref="InterPro:IPR014921"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8WZ66"
FT                   /protein_id="QBZ17290.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
FT   gene            64633..65829
FT                   /locus_tag="FORC68_0063"
FT   CDS_pept        64633..65829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0063"
FT                   /product="Putative secretion system component EssB/YukC"
FT                   /db_xref="GOA:A0A2Z5C170"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C170"
FT                   /protein_id="QBZ17291.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAKRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYVKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
FT   gene            65843..70348
FT                   /locus_tag="FORC68_0064"
FT   CDS_pept        65843..70348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0064"
FT                   /product="FtsK/SpoIIIE family protein, putative secretion
FT                   system component EssC/YukA"
FT                   /db_xref="GOA:A0A3T1NTU1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTU1"
FT                   /protein_id="QBZ17292.1"
FT                   /translation="MNREALLIVSNGQQCHKNHLSPEKVVTIGNTIEHEITYPELAESI
FT                   EVKYDEGSWNAGTTALQANQAVNVENLAFYLCQDLHTQVYDVVTNISVTFGVGIENDVT
FT                   LDDTKSDFILLRDAKEKLFKLQVLNGEVYHNFSLVTEDCVLEPGDQLYTDGVTITIGKE
FT                   DISVLAVKNRVTSKLAPLFAADNSFGEDYPDYHRSPRIIYRAPEEKISMAKPSSKPSKP
FT                   TDGLIKIILPPLIMVAITVMISIFQPRGLYIIMTIAMSAVTITMAILNYIKSRKKYKID
FT                   SKQRVESYDLYLKRKTKELHETSEKQRHALTYHYPDVTELEKMALRVDSRIYEKTMFHH
FT                   DFLTFRVGRGDEASSFSVEFQQEEFSQEKDELVEEAVKIKGQYLSINEVPVATDLMHGP
FT                   VGYIGPRRLVLEQLQMLVMQTSLFHSYYDLQFITIFPEEEKVDWDWMRWLPHANMRDVN
FT                   VRGFVYHERSRDQVLNSLYQILKERKQALTEQASKQEKLYFTPHYVVLITDEKLVLDHT
FT                   VMEFFNEDPSELGVSLVFVQDVMESLPEHVKTVVDIRDAKSGNIILEQGDLVNRAFVPD
FT                   HLPADFDKEVISRALAPLNHLQNLKNSIPESVTFLEMYGVERVEELNIAGRWAKNETYK
FT                   SLAVPLGLRGKDDIVQLNLHEKAHGPHGLVAGTTGSGKSEIIQSYIISLGVNFHPYEVA
FT                   FLLIDYKGGGMANLFKNMPHLLGTITNLDGAQSMRALASIKAELQKRQRLFGEHDVNHI
FT                   NQYQKLYKQGKATEPMPHLFLISDEFAELKSEQPEFMKELVSTARIGRSLGIHLILATQ
FT                   KPSGVVDDQIWSNSKFKLALKVQNASDSNEILKTPDAAEITLPGRSYLQVGNNEIYELF
FT                   QSAWSGADYVPDKESTDYIDTTIYAINDLGQYDILTEDLSGLDKKDDLTKLPSELDAVI
FT                   DHIHAYTEASGIEALPRPWLPPLPERIFAQDLHPVNFEEAWKEPKKPLQATIGLLDQPE
FT                   LQAQVPLTLDLTKDGHVAVFSSPGFGKSTFLQSLVMDLARQHNPEQLHVYLLDFGTNGL
FT                   LPLIDLPHVADTMMVDEVEKVQKFVRRISEVMKYRKKLLSKYRVANIEQYEKASKEEIP
FT                   NIVIVLDNFDAVREAGFGENFDKIMGQVSREGSSVGVFLATSASKYTSIKMQIVANIKL
FT                   MVSLFIIDISDTRAIVGRTDLSVEELAGRGLVNQDGVSVMQSILPADGEDVLEQISNLQ
FT                   SEAKSMRCAWKGHLPEDIPMMPDELTFTNFITKESVKNINNNEIAVGLDFEVVEGVRWD
FT                   LQKSDNILILGGSQAGKTTMQHTLLKGIERANLMKRDTNIIHIFDTNRGKLKEYKEKEI
FT                   VANYIVDKDAYGEFFNGLSELLEYRFNELLRIQDMDGEKAGEEFIQGEQKHFIFIQNIG
FT                   DFGNGLPTEIVKKLVYILDNNSKLGIHFIISGTSNNFGQNYSDFTNRVKQINSGIVIAG
FT                   YNEQSIVKMDNVNMYSPKLDVGDAYFVDNGRATRIRMPKH"
FT   gene            70361..70843
FT                   /locus_tag="FORC68_0065"
FT   CDS_pept        70361..70843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0065"
FT                   /product="Putative EsaC protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2GUQ2"
FT                   /protein_id="QBZ17293.1"
FT                   /translation="MANDAVEEAKKKRKADLEKYKSREKGEIKAQQDRLANYKKKQATI
FT                   EEQIETFNQHIKNIQNAVNTWSSPYSSFTSFKDSFFTPDIQGLYANDISENLNGLHKKI
FT                   KSMTDYSADLYFYTDSIKQNLENKRDDILSKINGCNNSIEYSIGKINDMNKILNSL"
FT   gene            70857..71171
FT                   /locus_tag="FORC68_0066"
FT   CDS_pept        70857..71171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FKN3"
FT                   /protein_id="QBZ17294.1"
FT                   /translation="MGQLTEGGGASPSDKISINLTAIEKQRQDLKDIHKNIRLALDNLD
FT                   KTFGKLEDHMKGEASDNIQDYVANIRQDIITPAYEYNDKVIVMLNAVEATYSEEALQVL
FT                   "
FT   gene            71196..71642
FT                   /locus_tag="FORC68_0067"
FT   CDS_pept        71196..71642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1TJB2"
FT                   /protein_id="QBZ17295.1"
FT                   /translation="MENNKISAFTMPIKNGGNAKSDSTVNPIQSINANASQMYRISTSS
FT                   STAIKYDIERIEATLYVDAAVGFAQLDKAISKLSNLIPVITENDWKGSSVNGYKEYVNE
FT                   YIVYLKGVRELLKGTSEKIIKGSEKMKEIDLQMGQQMGIEEWKI"
FT   gene            71642..72910
FT                   /locus_tag="FORC68_0068"
FT   CDS_pept        71642..72910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2PIE5"
FT                   /protein_id="QBZ17296.1"
FT                   /translation="MGGNPNARVLTTETVNFYNKYISQTMDDYFEFYSKVWKELKGIDQ
FT                   IIDESDIKGVFKVGYCPEGGSKFNNVADYGGELHNRFINYTARKDALTDKFKTAKEFYF
FT                   FADKTLYSKFMERKNEFIKLNSLLGKYGSFLQGDKINSVSYNSEMKTLRAEMYKISTVQ
FT                   EQVVRDIYDVYSNSMLGEGEIAKRIKDKYGNTVSKEQLDILIAYAQWIVLKQRSDGTWR
FT                   SDESLLAKDAKVCLVRGEDGNLKLMPQDEVKDKGEIQFTIPGVNVSKVVTAGFDFGVDK
FT                   KGNIVAPEDWKLPKKEVGFGAAVNFSALGVEFPNKYDESKQVQGFVGGEANIAHGRLGL
FT                   TATNDGVNASANISAAEVSSTILDLHGRDTGFRVKVNLSVLTAGAEAKITMADGVSFKL
FT                   GAGIIGAGFSAKTYDVIDERLRF"
FT   gene            72924..73496
FT                   /locus_tag="FORC68_0069"
FT   CDS_pept        72924..73496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1TJP6"
FT                   /protein_id="QBZ17297.1"
FT                   /translation="MMKKIFINIILLTMLVAILSGCGGAEQTTDKEPEIPKTNQNDIEL
FT                   SIPPVLQNSEGEVLEGDEEALKALKKFINETDTTEQGEVGLSVVDFIEIAGGSPTKYAF
FT                   MAALVNRSDQEGSDIEMKFTITNKATNVKIYDGDKITLSEEQFGFLKPNHAIPFKITIP
FT                   DTENITPEMTVQDYDFEWEITNSKMKE"
FT   gene            73525..73980
FT                   /locus_tag="FORC68_0070"
FT   CDS_pept        73525..73980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393PFE9"
FT                   /protein_id="QBZ17298.1"
FT                   /translation="MKLNWPKYMYEDADIKAQFLTKENQAVLQEYEQNVNAIQLELQEK
FT                   IMLVKGPVYIKEEFIDQTIILLNNSTTSIADVQLEIELTLHTGESLEGKFLLQTEKYGE
FT                   ILPNEGIVEFCRFPNNSKLAEMTLKSTEYEVKSELTYTNLLAEDGEG"
FT   gene            73983..74408
FT                   /locus_tag="FORC68_0071"
FT   CDS_pept        73983..74408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MHI6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHI6"
FT                   /protein_id="QBZ17299.1"
FT                   /translation="MRVLGGIITIVEGILLTIVFGKSMNDGITRDMDSVVAWIVFLGII
FT                   LVVTGIIGLMSRKKIIAVCWFIVGGILLVLPGAASNQLYVIQIPFLISVMSILAGILFL
FT                   VSLSNETRKDEIRLKRPTEEETKQSTAEYFKRITKGE"
FT   gene            74664..74891
FT                   /locus_tag="FORC68_0072"
FT   CDS_pept        74664..74891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MGT8"
FT                   /protein_id="QBZ17300.1"
FT                   /translation="MHGNKIVKTEANKSNLIYIFERNINAKIITDMDGTFVRSVFFRYH
FT                   KFLKKTGTGKKDGHNELMEIVLFIKKKRLK"
FT   gene            75322..75957
FT                   /locus_tag="FORC68_0073"
FT   CDS_pept        75322..75957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDB9"
FT                   /protein_id="QBZ17301.1"
FT                   /translation="MKSRNWLKGLGVTMIATTLILTGCGNGDAEKTDTEEQTKNVEEEG
FT                   KEVKIESNEGKPQHEQLITVKLPPEAEFINDATLEVYEKAKKKYDQTNQLITNDSITVL
FT                   VGDYGYYDSVWGSLDCSAVIINGTKSSIKDLSFEVSVEDNVLPGKVFLNSEALSLTKTQ
FT                   IGDFEPNTGVPIVIAFPEKNATGEGEDKKIDTKNIKIHISNIQYKVEK"
FT   gene            76025..76747
FT                   /locus_tag="FORC68_0074"
FT   CDS_pept        76025..76747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MNN8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNN8"
FT                   /protein_id="QBZ17302.1"
FT                   /translation="MKIDLEKIYTLQFTMGLRYRPMQIRHNIKLLLVALLFFSWIQGDF
FT                   MNGLPGDLSMFRVDMSLIVILGICFIILNPTKLAIRFQNSQYLLYIFCFQWLILLLIRF
FT                   FYFSMFYFFQNKVSLTNQTITKAYVLLFVLWIAVFIVCCFRFRKKLRKGDFRKDSALQN
FT                   KRGNLGLKLSKKAYISIGAFFAFILLSQLIGGVMIYVLFISIAVLCMAASFLGLVIFPE
FT                   QLFTGYCKYKFKEFHVEE"
FT   gene            76975..77748
FT                   /locus_tag="FORC68_0075"
FT   CDS_pept        76975..77748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0075"
FT                   /product="carboxyvinyl-carboxyphosphonate phosphorylmutase"
FT                   /db_xref="GOA:A0A3T1NTV2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTV2"
FT                   /protein_id="QBZ17303.1"
FT                   /translation="MTKNFKKLKSLHELPTPLILYNCWDVASARAIQQGGAPVIATSSY
FT                   AIAESLGVVDGEHLTFDEMFSVFSRIAENVSLPLTVDIETGYARNLEELAQNVERLLVI
FT                   GVCGVNLEDQLIGVTNPGLCSTEEQCDKIKTIKETAAKMSTEIFINARTDVFFQGRDET
FT                   ADLVEEAISRANAYKEAGADAIFIPELLSPNLIRAFVEKSPLPVNVMRMDGMLSNEDLQ
FT                   KIGVKRISYGPFSFFQANLAIQQEVERIFEGGKAL"
FT   gene            77745..78797
FT                   /locus_tag="FORC68_0076"
FT   CDS_pept        77745..78797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0076"
FT                   /product="ADA regulatory protein /
FT                   Methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="GOA:A0A3A7FJZ9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FJZ9"
FT                   /protein_id="QBZ17304.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRSGDSIINAQLDSGYESGNGF
FT                   RDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDDGLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTIIIQQIEAELAQYFNGELIDFKTPIRYIGSDFQQNVWDELRRIPI
FT                   GETISYKGLAEKLGRPTASRAVARANGTNQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPK"
FT   gene            complement(78820..79458)
FT                   /locus_tag="FORC68_0077"
FT   CDS_pept        complement(78820..79458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAU0"
FT                   /protein_id="QBZ17305.1"
FT                   /translation="MKKITAPRIPDGDLMVYPNDTYFIEDVGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGVN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGIDLSSCIFESITAMPQDLKGVSIDFSHAPALMPLFGIRVK"
FT   gene            79589..80545
FT                   /locus_tag="FORC68_0078"
FT   CDS_pept        79589..80545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0078"
FT                   /product="Glyoxylate reductase / Glyoxylate reductase /
FT                   Hydroxypyruvate reductase"
FT                   /db_xref="GOA:A0A3T1S9J9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1S9J9"
FT                   /protein_id="QBZ17306.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELIKNVTEV
FT                   DAIICPLSSPITANVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMKIIYSGHHPKEVAKEWDAEFVSQAELLKRSDVVTIHAAYSPSLKHLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALEAGVIAGAALDVFEFEPKIGEDLAKLDNVVL
FT                   TPHIGNATVETRAAMGKIAIGNVEAVLAGKAPLHSVY"
FT   gene            80633..80705
FT                   /locus_tag="FORC68_t001"
FT   tRNA            80633..80705
FT                   /locus_tag="FORC68_t001"
FT                   /product="tRNA-Lys"
FT   gene            80887..82368
FT                   /locus_tag="FORC68_0079"
FT   CDS_pept        80887..82368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="InterPro:IPR028912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAR2"
FT                   /protein_id="QBZ17307.1"
FT                   /translation="MSRIDIGEIQAFLYQLRAANEPGRKTIQSIKAAVTKYVGDNSLKG
FT                   KAVDASKNYYQMTYFPLCDAIIEAMDESEERLGQYIQDFHAEVDSSPDAKIDADGLYEL
FT                   GKMIDRIESKKEALAQRMNSGTEGQMQNYRSQLAIAYKQENILEKYLSFEQSHANFFDH
FT                   LIDLVQAVQQTIRELQSNIQFNSQTGTYDLSKLNHATVSHMRQALNKARGIKEDIIKEL
FT                   QDYTVLAVVYLDSNGKEQVMWLLERDGLGVENAELKAYLEKNGKYLNPEDYSIITNEDL
FT                   NKKINKAWRDGVYYLNGNKYDGLTGGVLSTSAYVEAGKGYIDKSGLADVVLGLGLSTAA
FT                   IRNATVIKSKSSQLDYVTNTGRLDGTLYSSKDLVLLENYLKKRGIELKIGDKYLPANKG
FT                   GAFNAETGTIILKDNPTRYEVLHEVSHYIQYKNIGKGAYKNLPRAGKTFDTKQFNAPEQ
FT                   FVYDMLSNNTRRWKSFTEAERMHANWYINNFGGIR"
FT   gene            82365..82616
FT                   /locus_tag="FORC68_0080"
FT   CDS_pept        82365..82616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418RX80"
FT                   /protein_id="QBZ17308.1"
FT                   /translation="MKHTHDSIRAIAIEYAEKNKTEYYSLEFISAKPSTFATGYWDVGF
FT                   SIKDSEGNELDGPQLLALNDNTGEIKAIEELINEKLND"
FT   gene            82795..82953
FT                   /locus_tag="FORC68_0081"
FT   CDS_pept        82795..82953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHJ6"
FT                   /protein_id="QBZ17309.1"
FT                   /translation="MATKEIQSDEIRFVIVPVEEKAIFKLEISLRFRKPTLLRNAETGY
FT                   APFKAIT"
FT   gene            83137..83358
FT                   /locus_tag="FORC68_0082"
FT   CDS_pept        83137..83358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MGV5"
FT                   /protein_id="QBZ17310.1"
FT                   /translation="MTKITHMNNKLIFENQEYTFEYPIQTLREDKNHVYVLLDIPANQE
FT                   YTFDDFHNIYAFSYTGERKWQIGETRWR"
FT   gene            83604..83930
FT                   /locus_tag="FORC68_0083"
FT   CDS_pept        83604..83930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2HAQ0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAQ0"
FT                   /protein_id="QBZ17311.1"
FT                   /translation="MKKLKWLTNRLFATSILLITTLFIIPLTFAIADGSKGSFYEYIYG
FT                   APLRWLTVISTTDKKGGFAEMFFSGKEGITIQWPNLIINFLLIFLAITIIFSLAKKLYD
FT                   KKNV"
FT   gene            complement(84013..84381)
FT                   /locus_tag="FORC68_0084"
FT   CDS_pept        complement(84013..84381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0084"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="GOA:A0A3T1NTW8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTW8"
FT                   /protein_id="QBZ17312.1"
FT                   /translation="MSFSIGEFSELVGIPSSTLRFYEKEGLITPDRDKNNLRTYSEEDA
FT                   NWLKFLLHLKGAGLSIEELKQYTIWRTAGDSTISERLNMLKKKKVILEQEIEDLQKNLD
FT                   TVVRKIGIYEEKVKTRRV"
FT   gene            complement(84437..85420)
FT                   /locus_tag="FORC68_0085"
FT   CDS_pept        complement(84437..85420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0085"
FT                   /product="Aldo-keto reductase"
FT                   /db_xref="GOA:A0A3H0QZC1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QZC1"
FT                   /protein_id="QBZ17313.1"
FT                   /translation="MKKRQLGNAGLVTSELGFGCMGLNYHRGPAKDRNEMIEVVRTAMD
FT                   AGITMFDTAEVYGPYTNEELVGEALVGKRNHVQIATKGGFKINGLNNEVDSRPESIKAA
FT                   VEGSLKRLKTDYIDLYYIHRIDPSIPIEEVAGTIQNLKQEGKILHWGLSEASAKTIRRA
FT                   HKVEPLAAVESEYSIWWREAEKEVFPVLEELGIGLVAYSPLGRGYLTGKLDINADFNAN
FT                   DNRGGLPRFQKEAMEANQVLLDFMKEIADEQNVTTAQLALAWILDQKPWIVPIPGTTRP
FT                   SRIEENIASTEIHFDDGARQKIADALSQIEIVGDRYSAAENKRIGK"
FT   gene            85811..86170
FT                   /locus_tag="FORC68_0086"
FT   CDS_pept        85811..86170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MKK9"
FT                   /protein_id="QBZ17314.1"
FT                   /translation="MKYIDYHDYMHKDAIIYAYLQNNFPYIRKRIKAWESFTLDREDIL
FT                   LVKSGAIFEEVNGKKKGIARCFFSKSLIFPTRDPIVLKAFETSEICFINAERAFGKLEE
FT                   DQILSNFFSADCGEK"
FT   gene            86579..92458
FT                   /locus_tag="FORC68_0087"
FT   CDS_pept        86579..92458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NTW2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTW2"
FT                   /protein_id="QBZ17315.1"
FT                   /translation="MKKNILVVIIVSVLAISAIVSAFFLMRDDAYAIETEGFTYSPKGK
FT                   VVDFSSEAKYNDTWINNEKTITDKKEMKPINLARTLFLKDGRIQFLGKSVAVKSASDLI
FT                   ELPSKTSITESKGSYKAKSDSNKTLAQLPKGTVVKLAEGRYIILDNAYLKNKQGLNKKL
FT                   PKNVLVSIDENKKVMLMGDKTIEELGGDDAYIEMENNHYHFDLKKEMLVSQTAKETDID
FT                   IRSIKVEIDDNAEKRSLKTAKETEKETTKDSTQKESEKQSNDASGQKSAQNNERSESKD
FT                   DQTQDASGNNTNGSANNNTARSNGTGGSNSDTNGSQPGGTQNKPNEGDVNKANEIIKKL
FT                   NEAENTNTFQVPIVDVNLTVKGQVAAAKLKLTDSSKRLNSLEAILYDSKNNVVKKEKLH
FT                   STKANQNFTFNNLKYGETYQVVVQGSYKSASNNNQDTIFFRQTVEAKPVVITPKVTERG
FT                   EDYMKAELTATELYGQIDKLVLKIKENNSNVITSQKVTVDASQLTKDGQVEVKFNSLSS
FT                   DKEYIIEMEELIVDGKNVTDDGWYFISSTLKAKPTIEGLNLSYSTDKGEFVASPVNLVD
FT                   RDESITSIRYVAYLEDDYKVNGSNAKEYAYSVVDANQKKTAVKVGRTVDMNDGNYIFVG
FT                   YISGNNGQSDYTFATPASNSVVVGKKTKPTVEFSLKEAEQDKLTINYEVFDADNTLLFD
FT                   NLTHPTLKLYKSDAQGMYSGNPVATVDLTKKSDITNLLEFDGLESEAYYVVVMTGSYNL
FT                   DDGAGIMVDELIGQSSVFRTTEITKVNASFSLDSVDTTKVAINVKLSDAAVNLNDANLK
FT                   IYEKKTNTLVKTVPLHGDFEKLMSDSGNSYLFENLSINKEYLVKVEDGYDSGMNHVPVE
FT                   GQFIFKTKKESPETDKVLLDYKASEMKLGGLAGIAATEKPLIDDYNAVSSITYSIYKAD
FT                   DLNTPLVEQEVSTAADFEKNVYFDLTNKLLGRGYSYVIKADVVWNDNYEDHHIEISSDT
FT                   IQIKKEKPTVEYEILSRTASEIKLNVYVEDEEESIVPGTLEITSTTGGNEQLQSGKNNV
FT                   TLPLSSEGTTTIKTTGDYIVTSGSSAISDIFMTKQLAALNTTAPQVGAKIALDASGKSM
FT                   TIAPEPNAVAKTSVMRTKYDLKDAASSKPDYSITKSGPNQFNTQNLNLPLGNIWFDNSY
FT                   QLTLDMKMNYTENKIDNQNLANNYYLSIGNGASFVSSLSGAVSTTNNVNSADVFKVTKA
FT                   STDSEGNISGVTFKNIWTDKYIAYRNGILISNSETPDSFKLIRQADGSYVPELSGRYVN
FT                   FSVGLVTDEAAGSKIDLYSTQEKLEQVSEAISVKALEEPAISAENIGVYDKRVKLDVIG
FT                   EDKDNTTVKKANKNELFVNVYKADGTTLVNSIRVDGLPTRDVSVTELSPDTDYVVKVEG
FT                   KYDLLDGNGEKDKVYYSETIKTEKSLPSMTSTDYSWSPAYGQRAIKGKIDFADESSVLT
FT                   NIEYRLYDAATISSSLSNLVALEQELGNKTPVSTFDNMTNNPEFSIYNGSGTQNFVSGK
FT                   TYVIAAYMKTSLTRAPIFLSDAKAVYISPPSNVSAPITLENVSTREATLKFSYNDPQSY
FT                   FVGGTNKDFQYVLKNTTTGTEVKKGSFQGGNTASWINTFEDLEPATGYTLTISTQYDNL
FT                   NGGLVRAWNTSFNFTTDDEYVTSNSLTIQLDAGAKAVKLQAKEVRPGSTTIENIKMEFY
FT                   ELIDYGGNNERTQLVETKNITLPSSYPATIAADFNVAGKKKNQSFLGKMIVTYRTPTNE
FT                   VKTYEKTSNFITLQEDIAAGLKSFKSVRATNDALEVKLDIPQDNSTDKGNYTYELKNEN
FT                   GNVIDTEKVAAKDISKTVSLSMEPTSNYTLTVINPDNHPVALYQGNNEENNLKAEIKKD
FT                   SFTLMSNNTADAKTTMTVTVEPKELTAWQTVQSWFGKDFTETYNIQKDELDTGVKIDTN
FT                   YQDTKVTVEETKSGKKFGIIELEESK"
FT   gene            92455..94761
FT                   /locus_tag="FORC68_0088"
FT   CDS_pept        92455..94761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NTW0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTW0"
FT                   /protein_id="QBZ17316.1"
FT                   /translation="MKPTWKIGIIVAAVPLIIIAVVLWGSFKEARYNLVSLPDDGVVLN
FT                   NEQETLQFQKGNTLYRSWNSDQLIAKNDKEDTRNEIMESTILYLNKEALMFTKSVPVID
FT                   TNGVSSKLKGRQVYQQTNSSYKYKNSEIAENSIVKLANRQYYLNADATLYLGGKEIKKV
FT                   TKPLLLIDKTGSVTIYENKKKSRFLGHMTLKVNDKTVLDASNETYTVGERKIDLASFGG
FT                   TDNEKIVVKEDEKKEDKKKTAESAKKTASNTSQSENESNQTTKGTGNQLNATKKYGNNL
FT                   NVGNGTSDSEPNDGKDTKNNGSGSNANGGTNQSGLNEIDDYEAVLRKIEDLNKKLERNI
FT                   PVLRIGYIAPGVTSVKVSYNYADPNNTLIGVTKISAVDEKTGKTVNTQYVSAVDTEATL
FT                   KGLSPNGKYHLEFTYQYDLGTNKGIQEVKMQSDSFTTQTVAAIYQMQSVTSTTMKVNIA
FT                   LDAQIDDVKRARIKVTKSDGDFFYMNVSANFLNGNGEILNATGLKPSTAYKFQTVIEMK
FT                   NGETIELNSSEKYYTMQATVLKNLKASQSVNKVLQVQYDWSSADYTLNQAIIELEDEED
FT                   NTEVDYQIVNQEKGNIHLVPDTKSELINLKAKLVLKTTNNNTKESKTFEYPVKQEIEYD
FT                   KQAKLTMDLTPFQTEENSEAQTEKQDVVAEKETNGNDLTAKMEDVLAPQNATYDMSFSM
FT                   QRKALETYQLAFERKIAGIDDDNWTMWKSQQVTTDEAGQVKVTETISKLAKDSFDYRVA
FT                   VYDAQGALQLYVYQK"
FT   gene            94818..95060
FT                   /locus_tag="FORC68_0089"
FT   CDS_pept        94818..95060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0089"
FT                   /product="ATP synthase F0 sector component c"
FT                   /db_xref="GOA:A0A0D8X500"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X500"
FT                   /protein_id="QBZ17317.1"
FT                   /translation="MDLVVACSVIGAALAIGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
FT   gene            95072..96103
FT                   /locus_tag="FORC68_0090"
FT   CDS_pept        95072..96103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0090"
FT                   /product="ATP synthase F1, delta component"
FT                   /db_xref="GOA:A0A3T1HM50"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HM50"
FT                   /protein_id="QBZ17318.1"
FT                   /translation="MEKMIQTIILYSVFAVGFLYLLHFTLRKLENILTSFFYEVSQDQS
FT                   LEKESLLRRLKRQKVATTQEEQKNRQLAIESEQKEVLFLEEIDQLIAQNKSYEQQLQAW
FT                   ENEQPKQIIEVPTFETTPHAPYKSLSSYINEIFQQVFIESEEDEARLFTEAIREFDALV
FT                   RTEKIRCALPYKVILHLFEMYSPEQLHLFAQSFQRYSERSSKLPVKQIYQSSYLSPEQK
FT                   LKVMQEEGTLDELDAEFIQFLFYMMTHYSYRQTRNLYRNFLEVYNIHFYRGLICIHVAS
FT                   KDSANHFEKLWQPAHRSYKIEYQVQKELIGGVIIQYGSKSIDMSYQELIKRSTEKMEAE
FT                   VKL"
FT   gene            96100..97596
FT                   /locus_tag="FORC68_0091"
FT   CDS_pept        96100..97596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0091"
FT                   /product="ATP synthase alpha chain"
FT                   /db_xref="GOA:A0A470EP56"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:A0A470EP56"
FT                   /protein_id="QBZ17319.1"
FT                   /translation="MKTIHFDMNKYETHVDLEYLKEHGRVEKISDGVIFCSGLENAALH
FT                   QAVLIDERHRGVILELNEEFVGIGLIDKTNDILEGMHVGVSGKFIEVDLFEEMAGRIID
FT                   TTGKMLYEESEEKPTATSPLFCVTPAIMTIDSVTRPLNTGLAVIDSITPIGRGQRQLIL
FT                   GNRQSGKTQIAVDTIINQHDQNVHCIYVAIGLKAAYIAEVIETLRNHGAMEYSTVVATA
FT                   ASDSLTAQYLTPYAGMALAEALRDQGKDVLIILDDLTKHADAYRAITLLFNRPPGREAY
FT                   PGDSFYIHSSLLERAVQMNEEHGGGSITAIPMIETLSDDVTAYIPTNVISITDGQLFLK
FT                   SDLFNRGQKPAVDVGVSVSRIGGDAQHPIIRKLSKNLTLILSQFEELKELLDFGNALDD
FT                   GSMKMVSDGRLLTELFKQKILSPLSVTELIVILYAFQNGFLTKIPPANIQTFKGLLLEK
FT                   AHMHKDFESFSAQIEAINELNESHVEMLEEIIRETGRLFS"
FT   gene            97593..98462
FT                   /locus_tag="FORC68_0092"
FT   CDS_pept        97593..98462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0092"
FT                   /product="ATP synthase gamma chain"
FT                   /db_xref="GOA:A0A1C7PW10"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PW10"
FT                   /protein_id="QBZ17320.1"
FT                   /translation="MSSIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSY
FT                   YETILKSLRWVRKTMYTSNNQIKEEKNVTAIAITSERGLCGAYNSEVFAEIDQLIESLG
FT                   DQVTINWVVVGEQGHRYLTKLGQNITSYLQFSLENIDLETTTAVTADFIDLIHSEQMDA
FT                   LYVIFTKYLNAVQSEAMCEKIYPEIPEDSDTELIEVDYVLDFETDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFDARKQALQQKTGELLDIISGA
FT                   QTIRKDEE"
FT   gene            98463..99833
FT                   /locus_tag="FORC68_0093"
FT   CDS_pept        98463..99833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0093"
FT                   /product="ATP synthase beta chain"
FT                   /db_xref="GOA:A0A4P7MDD6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDD6"
FT                   /protein_id="QBZ17321.1"
FT                   /translation="MKKHTGTIISISGFVLRIEFNESELPEIGFALEYHTHQGTYLAEV
FT                   VQHTGINTVSAIAIGEVSGLARGTEVVNLGHPIEVPVGETVQGRMLNVYGKAIDGKPEP
FT                   AAEVKWPIFRDQPLLRELDTNKEILYTGIKVIDLICPILKGGKTGLFGGAGVGKSVLMQ
FT                   ELINNISMLGGNSVFTGVGERVREGIGLYKELEASGVLPQTTVVLGQMNESPGVRMRVA
FT                   LTGLTIAEYLRDEEKKDVLLFIDNVFRFIQAGSEVSSLQGKIPITGGYQSTLSKEVGDF
FT                   QDRIASTKNGSITSIQCVFLPADDIDDPSAVATFSHLDSTIVLERSIAALGIFPAVNPL
FT                   QSFSRALNPTFVGERHYQLAVQVKFILQRYMELQEIINVLGMAELSDEDRKLVHRARKI
FT                   RNFLSQPFYVSEKFTGTEGTFVEIEDLLGSIERILNGDYDERSERDFLFIGSYKDLK"
FT   gene            99846..100169
FT                   /locus_tag="FORC68_0094"
FT   CDS_pept        99846..100169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0094"
FT                   /product="ATP synthase F1, epsilon component"
FT                   /db_xref="GOA:A0A1D2IS42"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IS42"
FT                   /protein_id="QBZ17322.1"
FT                   /translation="MKLKIVSPMGQFFEGEVEGFVINTKEGQQTVLEEHIDCLSFFDYS
FT                   EISILDAVASDPIFVALGYLHLVQNEANIMAQFASADAEQAERIFERLNKRKQTESRRS
FT                   NDK"
FT   gene            100159..100719
FT                   /locus_tag="FORC68_0095"
FT   CDS_pept        100159..100719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IS70"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IS70"
FT                   /protein_id="QBZ17323.1"
FT                   /translation="MTSEFFSTLLLIIGLLIGFFLAILLILAGIRRFFCSAEEPLKRIR
FT                   RYQVWHNRYQFNEEVTSFFTVIGATLLVSLITVQITAIPFQYTVLIFWSSWLFHLLSFW
FT                   KKIRVPKKMKNEMIQLAGFLLITALYFVGYFAMKSLHFSIIHVADFPGVIQFGIRTYLT
FT                   ICSLFVASGALIVWQRIYVKLLK"
FT   gene            100895..101527
FT                   /locus_tag="FORC68_0096"
FT   CDS_pept        100895..101527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A402X355"
FT                   /protein_id="QBZ17324.1"
FT                   /translation="MTFLEFHQLVKEDLLIYSWIIKNFHLTRQKLMAGGEITMNREQVI
FT                   VMEKGLLVQVNEEGKDDLYRVFIDQRIIFTTKGDITLTALEDTSYSIIRTDELIGKLED
FT                   QHLLPTFFLQIAEDFEKGLDWQRTLISVDPAERAEMILAKIIERYEINSENKPEFPRWL
FT                   RINVLARFAKCSVSTMSSVVNELVNEGDLNIKGTPWLLTRPYQASCA"
FT   gene            101825..102790
FT                   /locus_tag="FORC68_0097"
FT   CDS_pept        101825..102790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0097"
FT                   /product="PTS system, mannose-specific IIB component / PTS
FT                   system, mannose-specific IIA component"
FT                   /db_xref="GOA:A0A470UBI1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A470UBI1"
FT                   /protein_id="QBZ17325.1"
FT                   /translation="MVGIILATHGEFAEGILQSGTMIFGEQENVKAITLMPSEGPEDIK
FT                   AKMEAAIASFDSQDEVLFLVDLWGGTPFNQANGLYELHKDKWAIVAGLNLPMLIEAFSS
FT                   RFTMESAHEIAANILAPAQEGIRVKPEELQPQVTATEQPQAEIAAVGDGKIEFVLTRVD
FT                   SRLLHGQVATAWTKATHPTRIIVVSDAVAKDDLRKKLIEQAAPPGVKANVIPVQKMIEI
FT                   SKDPRFGNTKALLLFENPQDVLRAIEGGVEIEQVNVGSMAHSVGKVVVSKVLSMGKDDV
FT                   ETFEKLKEKGVKFDVRKVPNDSSANMEDIIKKAKHELKTQ"
FT   gene            102814..103620
FT                   /locus_tag="FORC68_0098"
FT   CDS_pept        102814..103620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0098"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /db_xref="GOA:Q7BC71"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BC71"
FT                   /protein_id="QBZ17326.1"
FT                   /translation="MSVISIILVVLIAFLAGIEGILDEFQFHQPLIACTLIGLVTGNLT
FT                   ACIILGGTLQMIALGWANIGAAVAPDAALASVASAIILVLGGQGVAGIPSAIAIAIPLA
FT                   VAGLFLTMIVRTLAVPIVHLMDRAAEKGNIRSVEWLHISAICMQGVRIAIPAAALLFIP
FT                   ADSVQSFLEAMPAWLTDGMAIGGGMVVAVGYALVINMMATKEVWPFFVIGFVVAAISQL
FT                   TLIAIGALGVALALIYLNLSKMGGGNSNGGGGGNSRDPLGDILNDY"
FT   gene            103642..104553
FT                   /locus_tag="FORC68_0099"
FT   CDS_pept        103642..104553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0099"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /db_xref="GOA:Q7BC70"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BC70"
FT                   /protein_id="QBZ17327.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSQALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
FT   gene            104680..105069
FT                   /locus_tag="FORC68_0100"
FT   CDS_pept        104680..105069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0100"
FT                   /product="Putative regulator of the mannose operon, ManO"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X1N3"
FT                   /protein_id="QBZ17328.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKRPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
FT   gene            105191..105541
FT                   /locus_tag="FORC68_0101"
FT   CDS_pept        105191..105541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:L8DRE4"
FT                   /protein_id="QBZ17329.1"
FT                   /translation="MKKPRIYTMSFASVYPLYIQKAEKKDRTKEEVDEIIFWLTGYDQD
FT                   SLQQAIDQAIDFETFFAEAPKMNPNASLITGVICGYRVEEIEDKLMQQIRYLDKLVDEL
FT                   AKGKKMEKILRK"
FT   gene            complement(105607..105900)
FT                   /locus_tag="FORC68_0102"
FT   CDS_pept        complement(105607..105900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0102"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="GOA:A0A3T1M432"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1M432"
FT                   /protein_id="QBZ17330.1"
FT                   /translation="MKKLNELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNQELVSLISHFFEECGEKDE"
FT   gene            106012..106302
FT                   /locus_tag="FORC68_0103"
FT   CDS_pept        106012..106302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3R0H1Q8"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H1Q8"
FT                   /protein_id="QBZ17331.1"
FT                   /translation="MLHIEAQITVKKEQTEAFLQAAKEVIAASRAEAGNHGYELVQSTE
FT                   NETVFYMLEKWADMDAIQQHNDSEHFKKFQKAAADFVAKELEISVLTPLAR"
FT   gene            106316..106948
FT                   /locus_tag="FORC68_0104"
FT   CDS_pept        106316..106948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0104"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="GOA:A0A3T2ETP8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2ETP8"
FT                   /protein_id="QBZ17332.1"
FT                   /translation="MTYLNNDFEDLMKNRRSIREYDETVKISQEEMKAILEDAVTAPSS
FT                   VNMQPWRFVVVESDAGKEKLSSLVRFNTRQNESSSAMILVFGDLQNFENGEKIYGESVE
FT                   RGLMPAEVKEQQMAKLSQYFASIPRSEAERVVLIDGGIVAMQLMLVARAHGYDTNPIGG
FT                   FERTEVAEAFNMDPERYVPVMIVSIGKAKNSGYQSYRLPITDVTTFA"
FT   gene            107044..107415
FT                   /locus_tag="FORC68_0105"
FT   CDS_pept        107044..107415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PWC0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWC0"
FT                   /protein_id="QBZ17333.1"
FT                   /translation="MTIKITRKTGIGSGITPVKIRIENEEIVKLDNHQSHFFMPKMEKT
FT                   KVCVTDWFYGSQEAVLENSNDVVVRINRKALLLNYSMFPFLFYGFVMTSLFATLIALGL
FT                   CLVSFFYSRKHWFEFVKIK"
FT   gene            107696..109978
FT                   /locus_tag="FORC68_0106"
FT   CDS_pept        107696..109978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0106"
FT                   /product="Chitinase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MKM8"
FT                   /protein_id="QBZ17334.1"
FT                   /translation="MNKKMKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNV
FT                   MYYGDWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGV
FT                   QWGGANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFV
FT                   KYTNMDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGV
FT                   DINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGN
FT                   PKDPNYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAE
FT                   KTNKDADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPY
FT                   LYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKTG
FT                   LFGTSAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFET
FT                   VKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSS
FT                   ASSVDVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALASSNVTD
FT                   KSATLTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYTYTVKAYDAAGN
FT                   FSAASSALTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQW
FT                   GPWLLIN"
FT   gene            110081..110983
FT                   /locus_tag="FORC68_0107"
FT   CDS_pept        110081..110983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0107"
FT                   /product="Sugar kinase and transcription regulator"
FT                   /db_xref="GOA:A0A1C7PW36"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PW36"
FT                   /protein_id="QBZ17335.1"
FT                   /translation="MYFVYDIGGTFVKFALMENNGTVKMKDKFPTTAKSAEELVAQMVE
FT                   KWRPYRTEVKGIAVSCPGVVDTEKGVIYQGGSLLFMHEKNLAEMLARECHVPVVLQNDA
FT                   KSAALAELWLGVAKNVHSAAILTLGSGVGGGIIMDGKLQSGYHLMAGEVSFMETSFDTK
FT                   KLRGTFFGRTGSAVELIKRIASKKNLPNKKDGEHVFELINQGDEEANAIFDAYIYELAS
FT                   QILNIQYLIDPEIIAIGGGISAQPVVVERLNDAVAEIKAANPYHAAQPKIVTCHFQNDA
FT                   NLYGALYNFFLQMDAQNKR"
FT   gene            complement(111008..112789)
FT                   /locus_tag="FORC68_0108"
FT   CDS_pept        complement(111008..112789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0108"
FT                   /product="Lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="GOA:A0A1D2ISC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2ISC9"
FT                   /protein_id="QBZ17336.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNMTQLFWIAVIFIVSVIVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDIPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
FT   gene            complement(112782..114524)
FT                   /locus_tag="FORC68_0109"
FT   CDS_pept        complement(112782..114524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0109"
FT                   /product="Lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="GOA:A0A3T1H3E3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1H3E3"
FT                   /protein_id="QBZ17337.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMATIDWKLTLALV
FT                   IVTPLIAVLTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMVTDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHTSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
FT   gene            114667..115500
FT                   /locus_tag="FORC68_0110"
FT   CDS_pept        114667..115500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0110"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="GOA:A0A3T2DT03"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2DT03"
FT                   /protein_id="QBZ17338.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVSHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAGKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVTVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
FT   gene            115536..116651
FT                   /locus_tag="FORC68_0111"
FT   CDS_pept        115536..116651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0111"
FT                   /product="Esterase/lipase"
FT                   /db_xref="GOA:A0A3T2HAV4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAV4"
FT                   /protein_id="QBZ17339.1"
FT                   /translation="MDYEKALAFIKSNSTLEQEEGTEVIFKQAQETARGNLDPFLLKDL
FT                   KQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQMRATMGSPNIDLSNGVTTEYRVVE
FT                   GDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTPAVVENFCKGIAEKLPAVVINVDY
FT                   HLAPEFPAPAAPKDCYRVLEWVVEQSNELGIDASKIGVSGDSAGGTLAAAVSYMDYEAE
FT                   TNYVGFQALLYPALTLVDEDNEKYQWDISKFGASEDTLPLIAPGIIGMNSSGELLRTAY
FT                   VRDENPASPIYSPLSAVDKSIYPPTLIASAEFDALRAFADIFAKELRASGVQTKAIVYQ
FT                   GMCHAFIDKYGIFPQAEDVADEIVQMMKEIF"
FT   gene            116755..117465
FT                   /locus_tag="FORC68_0112"
FT   CDS_pept        116755..117465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8R7Z7"
FT                   /protein_id="QBZ17340.1"
FT                   /translation="MMGLMKFQLFIQPKLDVLQGNIVEYEILLRDDSAVPRFPLSELEA
FT                   VLADEELYLAFSEWFSEAFLDVLKKYPNDRFAINIAPQQLFYIETLHWLDKLKSESHRI
FT                   TVEMTEDIFDVPGHKRHLNANDKNAFILNKIKVIHGLGYHIAIDDVSCGLNSLERVMSY
FT                   LPYIIEIKFSLIHFKNIPLEDLLLFIKAWANFAQKNKLDFVVEGIETKETMTLLESHGV
FT                   SIFQGYLVNKPFPV"
FT   gene            complement(117435..118130)
FT                   /locus_tag="FORC68_0113"
FT   CDS_pept        complement(117435..118130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2J1K9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1K9"
FT                   /protein_id="QBZ17341.1"
FT                   /translation="MLHTIDFSDIFSSDYSSKISFKKGEIIHSYRDYEEKAPQIGAILE
FT                   GTAVLEGPTNEGRWMINALIGQHALFGMESLLETKTAPELTEYRVRALENGTVLFIDRE
FT                   FLLNYLYANPQFFHLILDEVIVRYLFTSKNYKNINQAPIVKVTRILVEIIELLHLHQTE
FT                   GSIELPVYVTQTFLADYCRSSRARVTEVLEELRESGLLLSKKPITISSHENLLDQVDSF
FT                   QTGNGLLTR"
FT   gene            complement(118349..118801)
FT                   /locus_tag="FORC68_0114"
FT   CDS_pept        complement(118349..118801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0114"
FT                   /product="Phage protein"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J1L9"
FT                   /protein_id="QBZ17342.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGMIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVSHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
FT   gene            complement(118807..119142)
FT                   /locus_tag="FORC68_0115"
FT   CDS_pept        complement(118807..119142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0115"
FT                   /product="repressor protein"
FT                   /db_xref="GOA:Q9EXG5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EXG5"
FT                   /protein_id="QBZ17343.1"
FT                   /translation="MELNKFVGNKIKQYREERGLNQEALAEKLHTTRQTISRYENGDRK
FT                   ANQDVLFELAKIFNKRLDDFFPERNLPPVDERLVTIAAHIDDDVTEEEMRDILAYIEMK
FT                   KKLHRGM"
FT   gene            119359..119787
FT                   /locus_tag="FORC68_0116"
FT   CDS_pept        119359..119787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0116"
FT                   /product="Listeria protein LmaD"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NTX1"
FT                   /protein_id="QBZ17344.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEEEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRIIGVSRSSLAEWKRKKGLNRKKSQPVQQE
FT                   MIDVLAFHLDKTKEEIGALPASAIECQYVAFVINEANN"
FT   gene            119799..120215
FT                   /locus_tag="FORC68_0117"
FT   CDS_pept        119799..120215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0117"
FT                   /product="LmaC"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:O05549"
FT                   /protein_id="QBZ17345.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRMITGLSKKPHLLR
FT                   NGFLEEPQFEPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLELATLMGILVRK"
FT   gene            120512..120883
FT                   /locus_tag="FORC68_0118"
FT   CDS_pept        120512..120883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0118"
FT                   /product="antigen B"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEC1"
FT                   /protein_id="QBZ17346.1"
FT                   /translation="MRVLEAVRTMLQEKDGLDVSIVMRDQVEMPTTMIEMIDQEEEESQ
FT                   TAWKEKYRFAIHHYTNEQDLAGVEKIDTLIQMGFILPEGYKLVAVRHYGKQNLVKENTL
FT                   IHAKTSFEVSICRELKVKI"
FT   gene            120896..121408
FT                   /locus_tag="FORC68_0119"
FT   CDS_pept        120896..121408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0119"
FT                   /product="LmaA"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:O05551"
FT                   /protein_id="QBZ17347.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
FT   gene            121456..121758
FT                   /locus_tag="FORC68_0120"
FT   CDS_pept        121456..121758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HXP5"
FT                   /protein_id="QBZ17348.1"
FT                   /translation="MFEVNNTTYILRFNKQKVKTVELTSGISLVAALTANKGILSYQVI
FT                   ETLFVSGLVEEKGLVPVKQKEALEIFDKLVEEQGLISLNVAVIEKLQEDMGFLFR"
FT   gene            121800..122204
FT                   /locus_tag="FORC68_0121"
FT   CDS_pept        121800..122204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CQT1"
FT                   /protein_id="QBZ17349.1"
FT                   /translation="MDSEMNHDFDLEKQFAFFVVNFQMSKHDFEELTEVEKNFIMKEWE
FT                   NKVIFESTMLRNAVLNAEQNLNRKRNSRFIDLHKKRQKKADVNYTVNALQAISDNEAKE
FT                   GKAWIDRIYGANGLRRPKTKEERGKMNGGF"
FT   gene            122191..124059
FT                   /locus_tag="FORC68_0122"
FT   CDS_pept        122191..124059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0122"
FT                   /product="Phage tail length tape-measure protein"
FT                   /db_xref="GOA:A0A3T2HAV1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAV1"
FT                   /protein_id="QBZ17350.1"
FT                   /translation="MADSKSFTFELNESVLTAQVGRLDEMAMVVEQRFSELKMTIEDVG
FT                   NADPGSKISESLGGLQSGLGTISSAFGQLGSSSEAITSGFGTAVGSVGGITDAFKNLGS
FT                   SVQNGTLFSSLATGIGGMSTMLGGVSGGVQGITNLASGFMELKNHLGGLMSSIGGVGGI
FT                   MGKLTSPMGLVIIGIVALVAAFTYLMTTNESFRNTVMSVVTQVAQLFGQLVASLMPIIM
FT                   QIVTAVMQIGAALMPIVMQFISFFAQLLAQLMPFINMLISMLMPVIMQIVQVVMSLVSA
FT                   LLPSIMTVIQGIMSVIQFLIPIIMQIATVVVQIVVTIISYISKIMPIVMTIIGVIVSII
FT                   TTIISYVVIIATTIASVIGKIISFIASVITAVIGIVQPIIAFITNIFTTIVTIIGAAFQ
FT                   MVFTVASKIWNSIMSTISGIIEGIKAVITGISTTVSSVFNGVKRIITGVFDGIKSAWGG
FT                   LTDFVGNIFDGVSNAIQTVVDNVKGFVNVVIRGINGAIGLINKIPGVEIGKIPQLISGT
FT                   TNFQGGFARMNEGGRGEMVVLPSGSQVIPHDATMKYARESARGNKSMLYTSQGADLARV
FT                   ENLLERLLQKNPVIKMDDKVVAEVVSRNQANSFDQYNYTMGGAAYS"
FT   gene            124056..124874
FT                   /locus_tag="FORC68_0123"
FT   CDS_pept        124056..124874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0123"
FT                   /product="Phage tail fiber"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A240EUI0"
FT                   /protein_id="QBZ17351.1"
FT                   /translation="MSDLFLELNGKVHSLSETFPGLSVQEVSRQSPQLSMETAEIAGTD
FT                   GVIPGMTQFKPFIFSAKCNLQALDIPDYHLAVREIYEFLFQRDSYYIWSDQMPGIRYEV
FT                   HPKPVDFSRESDRVGLLTIEFDVFKGYAESRGTSLDPMTFEVDLWQMGMNLSNRDDLFY
FT                   VFRENTFRVYNAGSDRVNPLMRHELDIAMTANGTPTIHNLTTGESFEYRKELQKTDVLL
FT                   LNNIYPLVNNRRVGKDTNHGIITLEKGWNDFEIKGVTDVTIAFNFPFIYR"
FT   gene            124884..126020
FT                   /locus_tag="FORC68_0124"
FT   CDS_pept        124884..126020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0124"
FT                   /product="Putative tail, base plate protein"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CQU0"
FT                   /protein_id="QBZ17352.1"
FT                   /translation="MDYVIIQSMDKEVEEILTDIDYGSFSYDYEKNTSRAISFTVNKTK
FT                   QNAAIFDLVGNEAILTYQGQQFVIKKCTPKSIGGTLSKQITAQHICYTVQDHVQYNVKS
FT                   GRKKYSIQTVLEFALQDNVLGFSYEIQGSFPLVELEDLGNKNGLELVNLCLEEFGAILF
FT                   ADNKKLYFYDEKSWYVKTEKQFRYLYNTEEVSVDTNTDNLKTEIKCYGKQKENADKLTG
FT                   DNKYMAVVTYTSPNEAIYGKRMANAKSDDKITNNDDLLIFAKKQILDVPETALTIAYKG
FT                   KEPVSERDVWYFIHEPMGFETEVKVTKIKSSHPWSKKFQEIGFSNSRRDMVRIQTQIAN
FT                   QVKKASVDTNKINSFSSIAMNAYDSRILTEVVGVVDGD"
FT   gene            126010..126309
FT                   /locus_tag="FORC68_0125"
FT   CDS_pept        126010..126309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1A1J3"
FT                   /protein_id="QBZ17353.1"
FT                   /translation="MATEIRVLKNVDDTVFYPKTHVTAVEGLDSATTTTSGLMPASDKT
FT                   KLNGIEANAEKNNVTAIDIANWNKKQDAILVSENGSNFKITVTNAGELKATKVE"
FT   gene            126324..126899
FT                   /locus_tag="FORC68_0126"
FT   CDS_pept        126324..126899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1Q3A2"
FT                   /protein_id="QBZ17354.1"
FT                   /translation="MKLDLWKWEMLLQGREFRNKTNDNWQKLMDWSDFISTGLSAIYVY
FT                   VNKADATLNNKIDTVDKAVNARVNELISGTEQLSEVVDARSDAFGARYPVLRERLNQEQ
FT                   LNFSKKSTIQFDASTIINMEKQDIGLLTSKKISEAQTVCFLNISSLDEEADIVLEKTGE
FT                   TSFSENLTSLVFAKIGTNERYQMEPVGA"
FT   gene            126914..127393
FT                   /locus_tag="FORC68_0127"
FT   CDS_pept        126914..127393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDW1"
FT                   /protein_id="QBZ17355.1"
FT                   /translation="MTEIKRMLQTKEDNSKEQFYPETHVAGIVGLTEYVSGQLPTGVVS
FT                   VNGKAGRVLLDAEDVHAAKKSHNHEVATYTTDGFMSSFDKQKIDQLVSPEAGVTSINGK
FT                   TGIVDLFASDLDAAEINHTHAEATTTESGFLAKEDKEKLDAMQIIALETIKEVIE"
FT   gene            127390..127926
FT                   /locus_tag="FORC68_0128"
FT   CDS_pept        127390..127926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A458J8U4"
FT                   /protein_id="QBZ17356.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVTEEEKTTWGGK
FT                   ETTAGAEQKANAALNSAKDYVDTIGSGIVIFKGANLMGAGQAFKWDPDKLKFGMTLLFS
FT                   RYDATTNTPQDYYYHSVFLSRAQLLEIAGGGVLIQMPSLTYGDKKYFYVSTTGISGHAD
FT                   NSNYKAWALRQVTIM"
FT   gene            127945..128367
FT                   /locus_tag="FORC68_0129"
FT   CDS_pept        127945..128367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0129"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="GOA:A0A3D7WKB1"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WKB1"
FT                   /protein_id="QBZ17357.1"
FT                   /translation="MEVILKFGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGEDEEKHDKDMD"
FT   gene            128348..129076
FT                   /locus_tag="FORC68_0130"
FT   CDS_pept        128348..129076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0130"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="GOA:A0A3T2B7Y5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2B7Y5"
FT                   /protein_id="QBZ17358.1"
FT                   /translation="MTKIWIDAGHGGKDSGASGNGLVEKNWVLTVAKQLQTELVKAGFE
FT                   VGMTRTNDTFYELSDRAKKANSFKADLFISLHFNAGGGKGYEDYIYTSVPAATVEIQKI
FT                   IHKNIITKVTKHGMNDRGMKKANFAVLRETAMDAILLEAGFCDSTDALILEKKAYQTDY
FT                   CLGIVSAVQEVFGAMVTKYRAGKYLTSDDAISGTNIKGYLEAGTKVFVYKETEKTLNLT
FT                   TTKGVPGSWVLKTEVNTGKR"
FT   gene            complement(129115..131463)
FT                   /locus_tag="FORC68_0131"
FT   CDS_pept        complement(129115..131463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0131"
FT                   /product="5'-nucleotidase"
FT                   /db_xref="GOA:A0A4P7MHP8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHP8"
FT                   /protein_id="QBZ17359.1"
FT                   /translation="MNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILGIN
FT                   DFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVGAS
FT                   PAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAYPR
FT                   VKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIKDY
FT                   DFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMITKANE
FT                   LDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVTPPDAK
FT                   ITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKESEL
FT                   GNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGNIL
FT                   QVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTPLK
FT                   ADQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQKEG
FT                   RKVYKSQAEIDKETEDAAIKAIKDATKINKLAEKDKTLTGTTLPGATVSVQKATANARM
FT                   ALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPPDN
FT                   GNGNGGTDNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTSNTSTTGTSSNTSL
FT                   PTTGDTAGLATVFGVILTTTALYVLRKRS"
FT   gene            131657..132406
FT                   /locus_tag="FORC68_0132"
FT   CDS_pept        131657..132406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAW0"
FT                   /protein_id="QBZ17360.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDRSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEDIKEKYSFV"
FT   gene            complement(132476..133984)
FT                   /locus_tag="FORC68_0133"
FT   CDS_pept        complement(132476..133984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0133"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="GOA:A0A3T2HAV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAV6"
FT                   /protein_id="QBZ17361.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILDLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERIPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
FT   gene            134151..134384
FT                   /locus_tag="FORC68_0134"
FT   CDS_pept        134151..134384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CQV0"
FT                   /protein_id="QBZ17362.1"
FT                   /translation="MDEETLLELGYRKYRGAEVDIYFNTNVCEHSGNCVKGNAELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
FT   gene            134396..134674
FT                   /locus_tag="FORC68_0135"
FT   CDS_pept        134396..134674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0135"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A4V1C321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C321"
FT                   /protein_id="QBZ17363.1"
FT                   /translation="MEYKNGENRIYAVNDEGVKVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKSEGKKIVPLCPFAKAEFAKKPEYQEVQAAK"
FT   gene            135001..136575
FT                   /locus_tag="FORC68_0136"
FT   CDS_pept        135001..136575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0136"
FT                   /product="Oligopeptide ABC transporter, OppA"
FT                   /db_xref="GOA:A0A393VWU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393VWU2"
FT                   /protein_id="QBZ17364.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDNKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
FT   gene            136677..137627
FT                   /locus_tag="FORC68_0137"
FT   CDS_pept        136677..137627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0137"
FT                   /product="Oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="GOA:S5KGR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:S5KGR1"
FT                   /protein_id="QBZ17365.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPLGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
FT   gene            137635..138531
FT                   /locus_tag="FORC68_0138"
FT   CDS_pept        137635..138531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0138"
FT                   /product="Oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="GOA:A0A4P7MEE1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEE1"
FT                   /protein_id="QBZ17366.1"
FT                   /translation="MMRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSV
FT                   LILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLV
FT                   GVFAMMIAVVVGTLAGAVSGYFGGFVDNMVMRFLDIFMSIPSFFLLMILNAYLKPGISN
FT                   IIIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVA
FT                   ASLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTIL
FT                   SFNVLGDVLRKGLSRRY"
FT   gene            138732..139016
FT                   /locus_tag="FORC68_0139"
FT   CDS_pept        138732..139016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR021477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU16"
FT                   /protein_id="QBZ17367.1"
FT                   /translation="MSEIKVKEATLTKYATKLESKGKSAEYLPMKGGNMAYSQANSINH
FT                   FRTALFDLVDAVDNFQNVIGTDAKRLKELGASFTRKDQELERSMGLGGK"
FT   gene            139017..139385
FT                   /locus_tag="FORC68_0140"
FT   CDS_pept        139017..139385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU00"
FT                   /protein_id="QBZ17368.1"
FT                   /translation="MDAKSQQAEAQLQLLKKEQSAAEDFLQDLQRQQNEQEWLAEDVAR
FT                   VNQEERESLEFLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANEEECQQKITACRK
FT                   SIYQLENQQQGLRKELSQ"
FT   gene            139382..140788
FT                   /locus_tag="FORC68_0141"
FT   CDS_pept        139382..140788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU71"
FT                   /protein_id="QBZ17369.1"
FT                   /translation="MSRIDIGEIQTFAYQLHTANEAGRKSIKDIKNAVKNYTEDGSLKG
FT                   KAIDASKNYYQMTYFPLCDAIIEAMNESEERLAQYIADFHAQVDGSADARIDADGLYEL
FT                   GKMIDRIEAKKEALAQRMNTGTEGQMQSYRSQLSIAYKQENILEKYLAFEQSHGGFFDN
FT                   LTDLVRGIQQTIRELQSNIQFNSKTGTYDMSKLNFTTVTRMQNASGKALNDNAKTFNFD
FT                   EYQKTYRGQMWVLMKNGIVDVEATNAYNSAVLGGEMPHESNEAQEEAELLQAVIQSVKE
FT                   GTDPVTGQEISKAQGFSIISGLFFRYTTGGYKGKKFKIPKDWLRRRKKASGAKGFNIDE
FT                   IHPKLKTEPDTAFFWSGRTEGVGGADIAADVAKSKGGVTLESTIGNKNIEMPDWDFNNP
FT                   ESMKAWDLASGSYAEQVSGEVRAVVGSDLRKGNIWENVELPRLKNNPNVTKITTIDPKT
FT                   GLEKIIFERK"
FT   gene            140794..141027
FT                   /locus_tag="FORC68_0142"
FT   CDS_pept        140794..141027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MH13"
FT                   /protein_id="QBZ17370.1"
FT                   /translation="MKITGNSSHVKFDLENGYVVKADGEMLVGGKFVVFKDSMKNWEPP
FT                   YENKKLSESEVQEIIQQVKQSTNENTVQISFE"
FT   gene            141336..141773
FT                   /locus_tag="FORC68_0143"
FT   CDS_pept        141336..141773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDI5"
FT                   /protein_id="QBZ17371.1"
FT                   /translation="MKIKKILPQTIKSEVYFIDEIKNFDIVTEKMNDNFHTYRLGSNVM
FT                   MWLNDEGVIGEIECIFPAQTDNLITLWEEKNTVVQNGFPMIDTDIVENKTFIPKVRIFN
FT                   HGDYFILYFSNIYKYNKEIISENLTFYVKDTELIAIKAELT"
FT   gene            141773..142123
FT                   /locus_tag="FORC68_0144"
FT   CDS_pept        141773..142123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNU0"
FT                   /protein_id="QBZ17372.1"
FT                   /translation="MLKNYYTGFEGYPEIDFYTYINGEKTGIEMWEGYFDNIMNEFSPV
FT                   DGRWVSLAYYYHLYEGWYDESPWVIPDNKKALEQFETIDIKVLDNVTQKIMMKLIKLLK
FT                   DNLDSEIFIEYS"
FT   gene            142286..142819
FT                   /locus_tag="FORC68_0145"
FT   CDS_pept        142286..142819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C322"
FT                   /protein_id="QBZ17373.1"
FT                   /translation="MPHESNEAQEEAELLQAVIQSVKEGTDPVTGQEISKAQGFSITSG
FT                   VIFYYVGGGYKGKKFKIPRDWLHGRKKNNGVEVGTDFGKIGKLVNHPNIKINWSEYAEH
FT                   GMSRLKQRGLSKSQVDDFVEHGKVLSQNEGEKFAFITEDGVTIVSKDGKLVTAWGKKDF
FT                   DEGMKKIIEKLYGK"
FT   gene            142829..143071
FT                   /locus_tag="FORC68_0146"
FT   CDS_pept        142829..143071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MKZ1"
FT                   /protein_id="QBZ17374.1"
FT                   /translation="MYEKVEKIINDWDPIELFPLAPKDEYSQEINKIISIVQENPNIDM
FT                   NVLAKGIRKIFIDSFGENLIFKNNEDEIAGKILAI"
FT   gene            143179..143535
FT                   /locus_tag="FORC68_0147"
FT   CDS_pept        143179..143535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDX8"
FT                   /protein_id="QBZ17375.1"
FT                   /translation="MINSRLYEGFEGEAELSFVAGDNKLVIWNGYFETILDNLLDCNVE
FT                   REGVLKEYFNQEGWYDDSPWMIEDNSLTIIQLKCFDINKINQTSMKDDLEEVVKTIISF
FT                   LENNRFSKIYIEYE"
FT   gene            143843..144175
FT                   /locus_tag="FORC68_0148"
FT   CDS_pept        143843..144175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEF2"
FT                   /protein_id="QBZ17376.1"
FT                   /translation="MELKHVKNVAKEAGIGLDGVKIRIERDPSLVGRELFGYASPDGKT
FT                   ITLYPDAFTNKEILVKTLGHERMHIYQVKTFGPPLDFESSKLYEAGAWGSEKDWWNYYN
FT                   HMNGGN"
FT   gene            144176..144460
FT                   /locus_tag="FORC68_0149"
FT   CDS_pept        144176..144460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDK7"
FT                   /protein_id="QBZ17377.1"
FT                   /translation="MFNEWIRLASVIPDYIDKLDELKCPNCKHNEIDYVYVGDLESRIG
FT                   FEVVWCNNCLRGIQISRVRVPENVSMLSFKGTENLDEIIPKFKPVTPEE"
FT   gene            complement(144716..146371)
FT                   /locus_tag="FORC68_0150"
FT   CDS_pept        complement(144716..146371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0150"
FT                   /product="Oligopeptide ABC transporter, OppA"
FT                   /db_xref="GOA:A0A3T2NIW1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2NIW1"
FT                   /protein_id="QBZ17378.1"
FT                   /translation="MHFLKKTLPIFAILTVLLLTACGNDNDKSAAKTSPDKIKFLETSE
FT                   LLTLNTTAEEDFASFTAQNQVFEGLYTLDQKDNFVPGVADGMPEISTDQTKYTIKLKKN
FT                   AKWSDGSQVTADDFVYAWRRAVDPKTAPGYSALFKDSIKNATEINEGKLPVTDLGVVAT
FT                   DPTTLEITLKKPVPYFISLLSFETFFPQKESFVKKQGDKYGTDSAHTLYNGPFVMKDWG
FT                   GNITNKWTYAKNDQYWDKDNVKVNEIDVQVAKDINAGVNLYNTNEADRVPLSGDFAKQY
FT                   KDKKDFQTEKDALISYLRMNQKRDGKATPLANNSLRHALNLAVDKKQLTDRILGDGSFP
FT                   ANGLLPKDFVQNPTTGADFRTDSGDHLVYNKEEALKYWKQAQKELGTDKVTIELLGDDQ
FT                   ETTKTIFAYLKAQFEDNLPGVTIKVKNMPSKSATQLTSDGNYDLSLAAWMPDFKDPWTY
FT                   SSLFLSDYFNNHMSYNSPAYDKLVKSTDTTLATKPEERWNAFVASEKVLLDDDAAILPL
FT                   YQHQTAVLQRTDITGVQKHAFGSPYSYKFIRVEK"
FT   gene            146594..147535
FT                   /locus_tag="FORC68_0151"
FT   CDS_pept        146594..147535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0151"
FT                   /product="Zinc ABC transporter, periplasmic-binding protein
FT                   ZnuA"
FT                   /db_xref="GOA:A0A3T1I2D1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1I2D1"
FT                   /protein_id="QBZ17379.1"
FT                   /translation="MKKWSFLVVTVLAFVLVLAGCGTSNDTVSGDKDKLKVVTTFYPMY
FT                   DFTKNVAGDNASIEMLIDAGTEPHDYEPSAKDIAKIEAADVFVYNSEDMETWVPSVLKS
FT                   LDSKKLTVIDASKGIELVEGTEEEDHDHEHEEGHHHEHDPHVWLSPVLAEQEVTNIQNG
FT                   LTKADKINADTYKKNAETYKEKLKTLDNKFKTAFEGAKQRDFVTQHAAFQYLAKEYDLH
FT                   QVAIAGLSPDQEPSPARLAELQKYVKENNISTIYFEEVASPKVAETLANETGAKLEVLS
FT                   PIEGITDKEQKKGMDYIAYMEQNLQALQKTIK"
FT   gene            147548..148252
FT                   /locus_tag="FORC68_0152"
FT   CDS_pept        147548..148252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0152"
FT                   /product="Zinc ABC transporter, ATP-binding protein ZnuC"
FT                   /db_xref="GOA:A0A3A7SCI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7SCI3"
FT                   /protein_id="QBZ17380.1"
FT                   /translation="MKYIDIANIGFKYESEPVLENISFQVSAGEFIILTGENGAAKSTL
FT                   LRIILGILQPDKGSVTFAKKNADGGRLLTGYVPQQIASFNAGFPSTVLELVRSGRFPNG
FT                   KWFKRLTTKDHAHVEKALKSVEMWDYRHKRIGELSGGQKQRICLARMFATDPDILILDE
FT                   PQTAMDKQSKIRFYNLLKHEAQVHGKAILMVTHDSEEMEDFVDKHIRLIRKEDVSWKCF
FT                   SMDLCKEPSKRP"
FT   gene            148201..149007
FT                   /locus_tag="FORC68_0153"
FT   CDS_pept        148201..149007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0153"
FT                   /product="zinc ABC transporter permease"
FT                   /db_xref="GOA:A0A418RX23"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418RX23"
FT                   /protein_id="QBZ17381.1"
FT                   /translation="MEMFLYGFMQRAFQASMIIAIIAPLLGVFLIIRRQSLMADTLSHV
FT                   SLAGVAFGLVLNVNPSVTTLIVVVIAALGIEYLRGVYATYSELSIAILMAGGLAVALVL
FT                   MSLDQGGITTSVQQYLFGSIVTISKAQVQLLVILGVAIVVLFLVFKRFMFVLTFSEDVA
FT                   VAEGVPVRLISLLFSVVTGIAIAVIMPIAGALLVSALIILPAAIGMRISKGFLMCVISA
FT                   ILIGLVGMFSGLVSSYQLGTPPGATITLMFIILFIISTVVLKLIRK"
FT   gene            complement(149011..149691)
FT                   /locus_tag="FORC68_0154"
FT   CDS_pept        complement(149011..149691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0154"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2ISC8"
FT                   /protein_id="QBZ17382.1"
FT                   /translation="MPKNLYNYQEFIRLSHEGKIAYEQIDVPKNASLLTEKIDIDNHIY
FT                   LVVDGYIALILNDGSQNSKIYSIQGKGTFLNYFTLLDQSNNHFNFKTLSGCSLYKYSKA
FT                   DMEYFLSMFPENFGFQFFIMKNQTTHVYFKSLMASSPASEKLKTTFSNMALLHGVLSDD
FT                   GTVILPQAIKTSHLLSYSNLSKSCFYKDLQYLKTTNQIEKKEKCWIIHDQALYTMIQNG
FT                   QTSF"
FT   gene            149971..152310
FT                   /locus_tag="FORC68_0155"
FT   CDS_pept        149971..152310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0155"
FT                   /product="DinG family ATP-dependent helicase"
FT                   /db_xref="GOA:A0A3T1NU36"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR010643"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU36"
FT                   /protein_id="QBZ17383.1"
FT                   /translation="MRKVRISVRRLVEFVRRSGSIDNRMTSSDRALEGTKIHQLLQKEA
FT                   GEEYAAEVRLNLDRIVDGIAFSLDGRADGIINGRMIDEIKTTETPMDEITENFRPLHWA
FT                   QLICYGFMLAEKSDLAEVTLQLTYYQVVDKEVKQFQRVMSREELSVFVEDLLSQYAIWA
FT                   KASAAWEMKRNKTIQELTFPYDSYRSGQRELAIAVYRTISSEESLFCEAPTGIGKTMST
FT                   LFPGIKAMGEGKTDKLFYFTAKTITRQVAEDALDEMRRKGLAARSVTITAKDKICFLDE
FT                   RKCEPDHCQFARGYYDRLNEALFDMLQSEEAITRQVVESYARKYTLCPFELSLDVALFC
FT                   DVIVCDYNYLFDPVVYLKRFFAEGPGKYTFLVDEVHNLVDRARSMYSATLKKSAVMQVK
FT                   RGLDAKNNKRLLNAINVMNKDMIALNKKLKDLDGTIYVQKNELIDWNESVLKFTFVAKE
FT                   WLPQNTQSEIQADVLELYFESLRYVAIADFYDDRYVTQVTKSHGDLEIKQVCLDPSFLL
FT                   SERLKLGSSSVLFSATLRPIDYYTNLLGGQEDTSRMIFSSPFKQKNMHLLVADYISTKY
FT                   QMRENSMEAVVDALYALVSGENGNYLFFFPSFLYLQKVYDLFKEKYPNIRLQKQETAMD
FT                   EERREHFLERFQAENVETLIGFCVLGGVFSEGVDLRGNRLVGAAVVGVGLAQLNHESDL
FT                   IKDYYNETIGRGFDYAYQIPGMNKVLQAVGRVIRGESDRGVVLLIEERFSADRYRALFP
FT                   THWNHAKTVKSTDDISREVAGFWRNS"
FT   gene            152356..153168
FT                   /locus_tag="FORC68_0156"
FT   CDS_pept        152356..153168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0156"
FT                   /product="Cof-like hydrolase"
FT                   /db_xref="GOA:A0A3D7WLH2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WLH2"
FT                   /protein_id="QBZ17384.1"
FT                   /translation="MYKIIAIDIDGTLLNDTHEITPAVRDSIKAAKAKGVKVVLCTGRP
FT                   LAGIKKSLIELDLLDEGDYAITFNGAVVLETASEKTLADITLNKTELEEIYAFCHAENV
FT                   NVTYFDGKNMYVPSRKITEITCQDSLLLGTPLYHLPVEEAPESIHVSKVMLLDSPEKIT
FT                   DVIKKLPENIKEKFYVVRSVPYNLEFLQKGVNKGSALASLADKLGVDQSEVMSIGDQEN
FT                   DITMIEYAGMGVAMGNATEHIKEIANYTTTTNNEDGVAQAIQMLILDR"
FT   gene            153452..155803
FT                   /locus_tag="FORC68_0157"
FT   CDS_pept        153452..155803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0157"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A3T1NU03"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU03"
FT                   /protein_id="QBZ17385.1"
FT                   /translation="MSKNGNFLKKVGLAFLSILIVASTIFQTTVVKAATSYGSQFLNTV
FT                   ELLDKDGVPQTDFGYYDNMDVHYTWSIPNSTNVKAGDTMDFTLPSQLALATDLAFDVKD
FT                   SKGQVVGTATVKKATNQVTLVFSDYVEKHSDVKGELDFWTAFNQKVITGNETVDLVFPL
FT                   ENGTTVIDVEVGEKTPVSPTETLFKYGWVDASNPSLIHWVVRVNYAKVNIPNAVFTDII
FT                   GAKQTLNFDSIKAFHGTYSADRVFTAGAPISSTNFSATSDGFSVALGNLTDSVQISYTT
FT                   TTTDGGKSTQYDNTAKLAGTDFVTKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKAT
FT                   LAGAEFKLVDSKGTVLQESIKTDTNGKLSIADLKFDTYQLIETKAPTGYKLDTTPVEFT
FT                   IGENNQAITVTKENTLNTGSVELTKLDAATKATLAGATFELQDKEGNTLQTDLKTDEDG
FT                   VLKVTDLVPGSYQFVETSAPIGYKLDNSPVSFEVVAGETDQVVKVTKENTLEVGSVELT
FT                   KLDSATKATLAGATFELQDKEGNTLQTDLKTDEDGVLKVTDLVPGSYQFVETSAPIGYK
FT                   LDNSPVSFEVIAGETDQVVKVTKENTLEVGSVELTKLDSATKATLAGATFELQDKEGNT
FT                   LQTGLTTDENGVLKVTDLVPGTYQFVETKAPIGYELDTTPVSFEIVAGETDQIVKVTKE
FT                   NTLVPPTPVPPTPVPPTPLPPVPYEPTVPPTKPEVPVTPKKTENSEDSPKTTPIRITQS
FT                   LPKTGDTNSFAGLGVILIALSLSGLLLKRK"
FT   gene            155995..156807
FT                   /locus_tag="FORC68_0158"
FT   CDS_pept        155995..156807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0158"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A4P7MEG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEG1"
FT                   /protein_id="QBZ17386.1"
FT                   /translation="MKKRTTMMSNLKKFGLAFLSVILLVNVIFQTNFVKAATNYGSDFL
FT                   KTVELLDADGNPQTDFGYYDSIKVHYTWEIPNSTNVKEGDTMEFVLPPELKIVTDLDFS
FT                   LKDHDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVE
FT                   FPVNGTTETIDVGVGGKNQIDPDESLYKYGWANAEHPELINGSFELTIRNKTFKMPFMK
FT                   TLLDQNKSLILILSKHSTVNLTRMITLRQELRYHHQQLLKQRKDSKST"
FT   gene            156894..157709
FT                   /locus_tag="FORC68_0159"
FT   CDS_pept        156894..157709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0159"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A4P7MDL7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDL7"
FT                   /protein_id="QBZ17387.1"
FT                   /translation="MTGDNFIKQEIEVATPTSGGGGGGEGTTGSVELTKTDDSSQKNPL
FT                   EGAEFKLVNGAGATVQTGLKTNADGKLAISNLKYDTYQLIETKAPQGYVLDASPVKFTI
FT                   DDTHQSLFVSKENTAIKGSVSLEKVDRDTKSLLADAEFELQDKDGNTLKTNLKTDQKGK
FT                   LTVADLLPGEYQFVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPKVPVPP
FT                   KKPEKPDKIISEDSKQTALPKTGDSPLVNGWGLLLVAISASGLIALRRK"
FT   gene            complement(157751..158581)
FT                   /locus_tag="FORC68_0160"
FT   CDS_pept        complement(157751..158581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0160"
FT                   /product="STAS domain protein"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2ISS3"
FT                   /protein_id="QBZ17388.1"
FT                   /translation="MNESNGSMELYLREHTEEIINNWLSKIYENTYTSFVYSPQYKDEL
FT                   RADSEQTADLIISYFAGKKAFFEKLDKWLDNMYARRMENEVPLPEVITTLDKLRREFVT
FT                   AVGDFCIHNDEVSKCEFSSSMAMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIEEIST
FT                   PVISITDKLAILPLMGRVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALGEM
FT                   LTNLVTMLKLLGVEAFISGIQPKMAQQINRVDLNLSIPAYHSLKAVLQDQTRTI"
FT   gene            158798..159790
FT                   /locus_tag="FORC68_0161"
FT   CDS_pept        158798..159790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0161"
FT                   /product="DNA polymerase III component delta"
FT                   /db_xref="GOA:A0A3T1NU21"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU21"
FT                   /protein_id="QBZ17389.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLFEGTRGTGKKRTA
FT                   LWLAQSLFCLESTETELACGKCTNCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
FT   gene            159796..160629
FT                   /locus_tag="FORC68_0162"
FT   CDS_pept        159796..160629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0162"
FT                   /product="Signal peptidase-like protein"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2ISJ0"
FT                   /protein_id="QBZ17390.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRIATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGAEARVSGINLLSRILQVSLPEEETVIEYELDELRPYNEFLKQPAKS"
FT   gene            160640..161029
FT                   /locus_tag="FORC68_0163"
FT   CDS_pept        160640..161029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0163"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="GOA:A0A2A6A659"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A6A659"
FT                   /protein_id="QBZ17391.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
FT   gene            161066..161839
FT                   /locus_tag="FORC68_0164"
FT   CDS_pept        161066..161839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0164"
FT                   /product="tRNA (adenine37-N(6))-methyltransferase TrmN6"
FT                   /db_xref="GOA:A0A4P7MNV6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNV6"
FT                   /protein_id="QBZ17392.1"
FT                   /translation="MLEKVNHLEKLKLIGDERLDYLLAENLRIIQSPSVFSFSIDAVLL
FT                   AKFSYLPVRKGKIIDLCSGNGIIPLLLSTRTEAQIVGVEIQERLADMAKRSISYNQLEE
FT                   QIEMIEYDLKNITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDT
FT                   IRVAASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRIDKEANTVLVEGI
FT                   KDGKPGVKYVPPVIVYDELGEYTPVIKEILYGESE"
FT   gene            161823..162095
FT                   /locus_tag="FORC68_0165"
FT   CDS_pept        161823..162095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0165"
FT                   /product="putative endonuclease containing a URI domain"
FT                   /note="COG2827"
FT                   /db_xref="GOA:A0A1D2ISA5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2ISA5"
FT                   /protein_id="QBZ17393.1"
FT                   /translation="MAKASEHFFYVLKCSDNSYYGGYTTDVLRREAEHNAGIRCKYTKT
FT                   RRPVKVIHFEKFETRSEATKAEAAFKKLSRKNKDAYLIQREEESE"
FT   gene            162092..162973
FT                   /locus_tag="FORC68_0166"
FT   CDS_pept        162092..162973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0166"
FT                   /product="rRNA small component methyltransferase I"
FT                   /db_xref="GOA:A0A3T1NUA5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NUA5"
FT                   /protein_id="QBZ17394.1"
FT                   /translation="MIKSQKSFSGTSQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLGGEVVALVSDAGMPSISDPG
FT                   YELVQSALDANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIGKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNNRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EIRGEFCLIIEGNSNPPLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
FT   gene            complement(163018..163302)
FT                   /locus_tag="FORC68_0167"
FT   CDS_pept        complement(163018..163302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0167"
FT                   /product="Transition state regulatory protein AbrB"
FT                   /db_xref="GOA:A0A3T2HAY0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HAY0"
FT                   /protein_id="QBZ17395.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIIL
FT                   KKYSAGLVCDVTGEFSVDNKKFADGKLTLSKEGAAALMEEIKRRFGDTL"
FT   gene            163417..164274
FT                   /locus_tag="FORC68_0168"
FT   CDS_pept        163417..164274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0168"
FT                   /product="glucose uptake protein"
FT                   /db_xref="GOA:A0A3T1NU39"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU39"
FT                   /protein_id="QBZ17396.1"
FT                   /translation="MNIVIALIPAVMWGIMPLVVSKISGKPRQQIIGTTFGALAFAIGV
FT                   FIFTNPEYTATIIIASFISGAFWSLGQMNQFRAFTQVGVSKTMPLSTGMQLVGTSLFGV
FT                   FAFHEWGTTSKLVLGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVGYVG
FT                   YVVITRWFDISGWDAILPQAIGMVVAGLLFSIKSEEKRFTKQTWLNMIPGVMWATGNLA
FT                   LLFSNKLVGIATGFSLSQMGVVISTIGGILFLGEKKTKKELILVIIGVVLVIIGGTMIG
FT                   IAKS"
FT   gene            164342..165601
FT                   /locus_tag="FORC68_0169"
FT   CDS_pept        164342..165601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0169"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDM7"
FT                   /protein_id="QBZ17397.1"
FT                   /translation="MNANLEVNAELVKESYVYLLSRYLVLRQENFDTKEDKIPYNTLKH
FT                   NSVSPADANFVNPNFDVVYSEAWIAVDDEHAVVLEVPEIKNRYYTVQLLDGWGEVVTNI
FT                   NERNFPEHPHGKFAFVKKGTNPSIPSDAIKIELPSEKVKVLLRVEQKDDPEGAVKLQKA
FT                   FKFDAPDNIKIKEPLEIPHFTNAEFLLEEIYSNLEELLATYPDKMPKAAEFQDKARKVA
FT                   AYIELGDDQKAEVRNLIVKEALPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAIIN
FT                   YGGIWANSIQEALYFIGQKGTDDELLTGDKIYKIHFPADELPAELANAFWSVTLYSVPD
FT                   YHVIPNELNKFCINNYTGPKLSEDGSLTLYIASEKPADVDPGNWLPSKAGKEFSLNFRL
FT                   YVPKKEVLEGKVFLPPLEVF"
FT   gene            complement(165819..166004)
FT                   /locus_tag="FORC68_0170"
FT   CDS_pept        complement(165819..166004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MPG9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPG9"
FT                   /protein_id="QBZ17398.1"
FT                   /translation="MSILLGWSIVVGSVVSVVASLVIWSAVIVSALAYKLGLTRLKHKA
FT                   RETTTGIFLIFVSSRL"
FT   gene            165841..168339
FT                   /locus_tag="FORC68_0171"
FT   CDS_pept        165841..168339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0171"
FT                   /product="internalin"
FT                   /db_xref="GOA:A0A3T1NU30"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU30"
FT                   /protein_id="QBZ17399.1"
FT                   /translation="MRKIPVVVSLALCFSLVSPSLYASADTITADQITKEATTDTTEPT
FT                   TIDQPSRMDNSQTAPQKTTASSSEEAATTNSTEEENTPKNNLKSTSENSKTYAELFPDV
FT                   NLAKIIAKNISGTEDINAEVSEAELQTITNLVATNQNITSLTGIEHLTALENINVNNNE
FT                   LTTIDSLFNMPTLKSISANNNKITGNFSLVKTLPELHTLEVLGNAITELDIENQPNLVT
FT                   LSADELELKKLTLKNLSQLNGLGRIASSISIDWGELESVTLMNLPEIESIDISGNYLDS
FT                   DDINLENLPAVKNLDLSSNELTRLPKINDFPLLTTINVRSNKIDRLESSKLVDVPKLAT
FT                   LNADKQAVTLSKTIAAGNFTIPNNVENLAGQMVTPKIISNNGTYSDQSIAWASGELSGL
FT                   SKVSYTFDEVINSPAIAGKYTGTVNQPIEVKAVPVIVADKSVSYAPVNAKDEATFLQDI
FT                   RASASENAQITSDYSEVVDFATPGDYTVTLHAKNEFDLKADPVTVVVHINDIQKPQVAV
FT                   NSNDISFEVGTELTSEVLLAKSGAVVTDLYDEAIKMEVDLSEVDSSKLGTYEATIIAKS
FT                   KSGASSDPIKLSVKIVDTEKPIIQINNPEIIIEKGSELTEGQIIDQVGITATDNYDQDL
FT                   NIHMDLSKVDTSKPGSYEVTIYTEDSSGNRSETVTITVKVPEAKIGKITIQYMDSENNE
FT                   LAESNTITGEVGETYETLAKEIEGYTLKENPANSSGVFEETRQTIQYIYVKDIINPEFP
FT                   VYSENNVTPELPSNNNNSVNGSKQTPSKSVKKQSKAYSKINQMPMNLPETGDSTNLLFI
FT                   FMGVLLLAGLTLSKAKRKNQ"
FT   gene            168440..168745
FT                   /locus_tag="FORC68_0172"
FT   CDS_pept        168440..168745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0172"
FT                   /product="Mobile element protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MH44"
FT                   /protein_id="QBZ17400.1"
FT                   /translation="MSTRVMYPAEIKEKAIKMKLAGKSTKEIMRTLNIKNPTQVKTLWR
FT                   WYRNEETHRFHQGVGKQYKYQKGVPELPEIEQLKIALRQKELELEILKKYKALERK"
FT   gene            168742..169578
FT                   /locus_tag="FORC68_0173"
FT   CDS_pept        168742..169578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0173"
FT                   /product="transposase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDL0"
FT                   /protein_id="QBZ17401.1"
FT                   /translation="MNPAYFVLLVEELKTKYLVKDICQILQVPLSTYYRWKKKDFAQSS
FT                   LEKKIGQLCKAYQFTYGYRKIAALMKQEEQVGINKVQRIMQKYQWQCQVKVKKKNRPGS
FT                   AYYQTENHLNRNFQASQPLEKLTTDITYLYFGDCRLYLSSIMDLYNGEIVAYSIGEKQD
FT                   SELVLDTLNQLSLPEGSLLHSDQGSVYTSYEYYQCCKKKNVIRSMSRKGTPADNAPIEC
FT                   FHSSLKCETFYHKTAYKYAKSIVIQIVKDYIKYYNEERIQQKLGYQSPINFRKQAA"
FT   gene            complement(169644..170891)
FT                   /locus_tag="FORC68_0174"
FT   CDS_pept        complement(169644..170891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0174"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A3A2UDZ6"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2UDZ6"
FT                   /protein_id="QBZ17402.1"
FT                   /translation="MFNKKKTIASLIVLSSLASQIALTPISALADTHDTNNIALLQNTN
FT                   ENVPYKYTSTLTFPTLTNQTQEDYKLEIKLALPSGMNYTDLQVSVGGEDITNQVGTTSF
FT                   DNSTNTVTFKFDKVTSWNSLSKAKVKFDWKTSYSGEGGEAKIDSLVATATATSEDKAGN
FT                   KSTSTGSLKPKDISAPVVKAEETEITYSPGSNVTEEQFLTDIHASVTDNYDSTISLTSN
FT                   FTSAVNLAVSGDYSVNVQATDKAGNVSNTLNVTVHVSTPAPVAGANITVNYLDGNGNKI
FT                   AESDTLTGVINSNYQSESKKITGYTIETTPTNATGTFTDTPQTVDYIYKKDTVTPTPIT
FT                   VNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFG
FT                   ALLLLISAPLLLFKKK"
FT   gene            171169..172029
FT                   /locus_tag="FORC68_0175"
FT   CDS_pept        171169..172029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0175"
FT                   /product="glucose uptake protein"
FT                   /db_xref="GOA:A0A1D2IUP2"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUP2"
FT                   /protein_id="QBZ17403.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAIGMVISALIMTHSGGTEKRFNKRTLLLTIPGVIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIILLKEKKTQKEMLFVIVGVVLVVLGGILIG
FT                   VAKGA"
FT   gene            172098..174095
FT                   /locus_tag="FORC68_0176"
FT   CDS_pept        172098..174095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0176"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /db_xref="GOA:A0A1U7AH27"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AH27"
FT                   /protein_id="QBZ17404.1"
FT                   /translation="MLPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGY
FT                   DVFYLTGTDEHGQKIQAKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRH
FT                   KTSVEKIFEQLLEQGDIYLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGN
FT                   EVELVKEESYFFRMSKYADRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPGNPKHVVYVWIDALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKMVFGHGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLR
FT                   EVPFGSDGLFTPEDFVDRVNFDLANDLGNLLNRTVAMINKYFDGEIPAYQGNVTEFDQI
FT                   LVDFKNNVVKEYEGSMDHMQFSVALNQLWSLISRTNKYIDETAPWALAKDEDKRTELAS
FT                   VMTHLAENLRIIAVLLQPFLTRTPGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKK
FT                   GTPIFPRLDAEVEVTYIQDEMKGSAPAPAEEVAEVEALETPQIGIEDFDKIDLRVAEVK
FT                   QVDKVKKADKLLCFQLDLGEGKLRQVLSGIAEFYQPEELIGKKVIVVSNLKPVKLRGLM
FT                   SEGMILSGEKDGKLSVIEASSALPNGAKVK"
FT   gene            174259..175473
FT                   /locus_tag="FORC68_0177"
FT   CDS_pept        174259..175473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0177"
FT                   /product="Mlc, transcriptional repressor of MalT and manXYZ
FT                   operon"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R941"
FT                   /protein_id="QBZ17405.1"
FT                   /translation="MDILRKGNKDLIKDINRYTVLNLIREKGEITRTEIAKKCDFGMST
FT                   LTYILDDLQQEGIILEGAETSSTGGRRAKLVRFNKDYGFVVSVKVEEEQLLFALTDLNA
FT                   EIIENTSIPFSSEKKPEEAIELIAKNVKKMCGNRDMNHLLGVGIAISGLVNRKKGTVIR
FT                   STMLGWENVALEAMLHAHFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLG
FT                   LSVVINRQIYYGAQGGAGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEA
FT                   YPTSELNDFHFDKVAKSARAGDEMATELMGKMGEYLGYGIRNIINTFNPEKVIIVGEGL
FT                   HHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQGAALLVIHQLFQVPIYEEE
FT                   QTLLR"
FT   gene            175509..176387
FT                   /locus_tag="FORC68_0178"
FT   CDS_pept        175509..176387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0178"
FT                   /product="N-Acetyl-D-glucosamine ABC transport system,
FT                   permease protein 1"
FT                   /db_xref="GOA:A0A1D2IUL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUL8"
FT                   /protein_id="QBZ17406.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
FT   gene            176387..177235
FT                   /locus_tag="FORC68_0179"
FT   CDS_pept        176387..177235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0179"
FT                   /product="N-Acetyl-D-glucosamine ABC transport system,
FT                   permease protein 2"
FT                   /db_xref="GOA:A0A2A6A2Y5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A6A2Y5"
FT                   /protein_id="QBZ17407.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVIVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
FT   gene            177263..178519
FT                   /locus_tag="FORC68_0180"
FT   CDS_pept        177263..178519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0180"
FT                   /product="N-Acetyl-D-glucosamine ABC transport system,
FT                   sugar-binding protein"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A456NL24"
FT                   /protein_id="QBZ17408.1"
FT                   /translation="MKKGLLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQFSAPADGK
FT                   ALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKG
FT                   VLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVE
FT                   YPTADWTWKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTIN
FT                   SPENVEALTHLTNEVTDSKVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPF
FT                   KWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNWELP
FT                   ATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDST
FT                   PEKALKNSEDNINKTMGFK"
FT   gene            178602..181904
FT                   /locus_tag="FORC68_0181"
FT   CDS_pept        178602..181904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0181"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /db_xref="GOA:A0A3T2HEM1"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HEM1"
FT                   /protein_id="QBZ17409.1"
FT                   /translation="MSKFTKLMQGYLHLIEGKNEKIKPILLETKPNFTTDSVLETASWL
FT                   WLSSKINHYDREEVEPVIAFLVENWNRPEKSIWGSAENDIYLATISSVYSALLDVKNTF
FT                   PKPELQQTITIIRDYCFDNLLKGDSILTGFNTRKVSTDQLLSVLPFGLFSPEDLVMVAA
FT                   VGKMEQQLVQDDGVLPYSGAPRVNSFATALMALYFLEKSDQDKALHYLNMAMKMEDNDE
FT                   LGAIFIEINQAFRAMESEVTAHISHDPFGHENRYEQQLTERTPHYPETEMHFSAACEVI
FT                   SEVEPIQVELVLKEKDWTILCEKKEKNDVQIWEALVPPLEEVGEYTYYFQATMKDQTTL
FT                   TSDDYKVEPIWKHWSEEAAICETEQGLMVLFKENPSSIIPVEFTVKSDELVIGLKPSFE
FT                   ASNVKTKSSGQLKKDDLEIIVSNNPVRLEVHFKGKLILESHKIYPALQWYTDKTGTINK
FT                   VKLHLDAPKEEEYYGFGERYNALGQRGNVLDCFVYNQYRDQGTRTYIPMPFYHTNRDYS
FT                   VFVDTARYTSFDLGNQLADKHTITVEINGCDTDICLLMGDIRSAVANYMKKTGKPAMVP
FT                   VWALGPWMSSNNWDRESVVRNEVETTQELQIPSTVVVLEQWSDEATYYMFNDAEYDEKA
FT                   PSEAYNYDEIRFPSWGRWPDPKGMVDYIHDNKMKLILWQIPIQKYLNRQQHPLKDREEA
FT                   YMIEKGYVVKNPDGSPYRIPENWFTESLIMDFSNEEGKKWWFDKRQYLIDIGVDGFKTD
FT                   GGEFVFGEGLQFADGRRGDEMRNLYPNDYVEAYYQFAQQNEGMTFSRAGYTGAQNFPAH
FT                   WAGDERSTFDAFRRSLIAGLSAGFSGIPFWSFDFAGFNGDIPTAELFIRSAEMATFCPI
FT                   MQYHAESKAEFNQDRTPWNIASRTGDDSVIPIYRHFANVRMNILPYIYNESLKCVETGL
FT                   PMMRALLLDYKEDPRVSDMYDQYLFGEAMLIAPVIEDGVRSREVYLPEGTWYDFWNGTK
FT                   VSGPTLRKCKADKEEIPVFVRGGKAVLCNVDATLKLGSWVGNTVEEYDTPLLKVYLDGD
FT                   FTEEITDHLFGKWLVKVTENADEVIVFVQTNTASYEVEVIGTTKKVQIKKGR"
FT   gene            181907..184198
FT                   /locus_tag="FORC68_0182"
FT   CDS_pept        181907..184198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0182"
FT                   /product="Alpha-glucosidase"
FT                   /db_xref="GOA:A0A3T2HEL8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HEL8"
FT                   /protein_id="QBZ17410.1"
FT                   /translation="MDASTSFAILPSNVKQKTAFERKVNQVKAASWANNCLTGTLDIGQ
FT                   FSCYFVNEKIARVTVNPFGEVDLTPSIAAIHDNEKQAAKFTETNDCYELHFADKEVLVC
FT                   KNPFQIIMKQAGKRIFQTEGLAINRDKEHQISIQSEPGTAIFGLGEKTGALNKAGSIIS
FT                   MWNTDVYSPHNKDTVELYQSIPFMIADTAKTTYGLFYDNSHRTEFDFQSFEEMYTVLAE
FT                   GGQANLYIIFGEDVKEVVANYTDLTGKTPLPPKWSLGYHQSRYSYTSEKEVERIANTFK
FT                   EKEIPLDCVFMDIHYMDDFRVFTFNPDTFPNGPELIARLREQNIDVVPIVDPGIKKDVD
FT                   YSVYQEGIKNNYFCTKLEGSIYYGDVWPGVSAFPDFLSTTVQHWWGSLHKFYTDLGIRG
FT                   IWNDMNEPSVFNESKTMDLDVVHNLDGKNVTHKEAHNLYGLYMSKATFEGLKRLVPNER
FT                   PFSLTRAGYAGVQRYSAVWTGDNRSHWEHLEMSLPMIMNLGLSGVAFTGADVGGFSSDC
FT                   TKEMLIRWTQAGAFLPYFRNHCVQDSIYQEPWAFGADAEKIVKQYIELRYAFLPYIYTE
FT                   FQKTAESGLPLVRPLYMEFKDERDLIQVNDQFMLGENILVAPIVREGQAKRLVRLPKGL
FT                   WFNYWTKEQFVGGDYIIADAPIDTMPIYIKAGTILPVGSSVQNTKETQELTLEVYLDSE
FT                   TATGYVYNDDGKSYQYESGAVSKTKLTATFKNGEVLINATHQGEANLQQKVTTIQVFGE
FT                   KIDKITRAGI"
FT   gene            184202..185863
FT                   /locus_tag="FORC68_0183"
FT   CDS_pept        184202..185863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0183"
FT                   /product="Oligo-1,6-glucosidase"
FT                   /db_xref="GOA:A0A3A7FQB6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FQB6"
FT                   /protein_id="QBZ17411.1"
FT                   /translation="MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELG
FT                   VDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDRDMKLVMDLVVNH
FT                   TSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSK
FT                   KQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDA
FT                   GNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFE
FT                   HMNLDSDGDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDN
FT                   RFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGH
FT                   SHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSI
FT                   FYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISD
FT                   ENILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK"
FT   gene            185960..186733
FT                   /locus_tag="FORC68_0184"
FT   CDS_pept        185960..186733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0184"
FT                   /product="Putative deoxyribonuclease YcfH"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MNX7"
FT                   /protein_id="QBZ17412.1"
FT                   /translation="MLFDTHVHLNDEAFDDDIEEVIKRAQENDVTRMAVVGFNKETIDR
FT                   ALELAEKYDFISLIVGWHPTDAITFTDEDLEWLRDLALTHPKVVALGEMGLDYHWDTSP
FT                   KETQFEVFRKQIRLAKEVNLPIVIHNREATEDVVRILQEEHAEEVGGIMHCFGETVEVM
FT                   EACLAMNFYISFGGTVTFKNAKLPKIAAQAIPIDRLLIETDAPYLAPTPNRGKRNEPGY
FT                   VKLVAEKIAELKEMKYSEIATHSTENAKRLFRIKD"
FT   gene            187025..188251
FT                   /locus_tag="FORC68_0185"
FT   CDS_pept        187025..188251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0185"
FT                   /product="Cell wall-binding protein"
FT                   /db_xref="GOA:A0A1D2IUN3"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUN3"
FT                   /protein_id="QBZ17413.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGKKVVEYKVTFENGKEKKRDVIKENVTSNKTDKV
FT                   VVRGTKEKVVATPVSNVSTSSATSSSSSSASSTPSGGKTYKMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
FT   gene            188353..188928
FT                   /locus_tag="FORC68_0186"
FT   CDS_pept        188353..188928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0186"
FT                   /product="Ribonuclease M5"
FT                   /db_xref="GOA:A0A1D2IUH1"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUH1"
FT                   /protein_id="QBZ17414.1"
FT                   /translation="MSGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGAPTEKQFISKDILIHLGLLGGVGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEEQLVAACQKIMQEEENE"
FT   gene            188921..189808
FT                   /locus_tag="FORC68_0187"
FT   CDS_pept        188921..189808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0187"
FT                   /product="SSU rRNA
FT                   (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase"
FT                   /db_xref="GOA:A0A1D2J2R1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2J2R1"
FT                   /protein_id="QBZ17415.1"
FT                   /translation="MSKDIATPGRTTEILKKYGFLFKKSLGQNFLIDSNILTRITDTAE
FT                   ITKETNVIEIGPGIGALTEQLAKTANEVVAFEIDQRLLPILDDTLSAYNNVKVVHGDVL
FT                   KADVEEVIAEQFAKPELPLKIVANLPYYVTTPIILKLLHDNIPADSMTFMLQKEVADRI
FT                   SAVPSTKSYGSLTIAIQFYMEAELAFIVPKTVFMPQPNVDSAVIHLKRRKEPLAEVNDE
FT                   EFFFEVTRASFAQRRKTLWNNLASKFPALKPRKDELVEGLNAIGIDLIRRGETLDIPEF
FT                   AKLSNFLGDFLKEK"
FT   gene            189928..190185
FT                   /locus_tag="FORC68_0188"
FT   CDS_pept        189928..190185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0188"
FT                   /product="Veg protein"
FT                   /db_xref="GOA:A0A0D8X366"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X366"
FT                   /protein_id="QBZ17416.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
FT   gene            190324..191205
FT                   /locus_tag="FORC68_0189"
FT   CDS_pept        190324..191205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0189"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="GOA:A0A1D2IUP4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUP4"
FT                   /protein_id="QBZ17417.1"
FT                   /translation="MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNVIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNINY"
FT   gene            191227..191964
FT                   /locus_tag="FORC68_0190"
FT   CDS_pept        191227..191964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0190"
FT                   /product="Cellobiose phosphotransferase system YdjC-like
FT                   protein"
FT                   /db_xref="GOA:A0A1U7AH43"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AH43"
FT                   /protein_id="QBZ17418.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAV
FT                   EVAKENPGLDIGAHLTLTFGSPVLQGLETLTDDDGRFRRNYTSLENGLADVDMNEVERE
FT                   LTAQIEKILDAGITISHFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPD
FT                   LFATEFYADGVSFETIKKLVQKHIGTNDVVEVMTHPAFIDETLREISSYVEPRIKEVSI
FT                   LTSRELQAYLGQQEVEIISFRDL"
FT   gene            192128..192946
FT                   /locus_tag="FORC68_0191"
FT   CDS_pept        192128..192946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0191"
FT                   /product="PurR, transcription regulator associated with
FT                   purine metabolism"
FT                   /db_xref="GOA:L8DW56"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:L8DW56"
FT                   /protein_id="QBZ17419.1"
FT                   /translation="MKIRRSERLIDMTQFLLSHPRKLVPLTMFAERYGSAKSSISEDLV
FT                   IIKKTFEDRGIGTLETVPGAAGGVQYISIAGNDDVLDFVHTLCNRIAEPNRLLPGGYLY
FT                   LSDLLGEPVTLKAIGKILATKFNNQKIDAIMTVATKGIPIAQAVAEHLSVPFVIVRRDS
FT                   KVTEGSTVSINYVSGSSKRIEKMELSKRSLAEGSNVVIVDDFMKAGGTINGMKNLLEEF
FT                   NAHLVGIGVLVESEYAEERLVDDYVSLVKIKNVNMKEKQIEVVDGNYFNS"
FT   gene            193121..193798
FT                   /locus_tag="FORC68_0192"
FT   CDS_pept        193121..193798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0192"
FT                   /product="membrane fusion protein"
FT                   /db_xref="GOA:S5JW22"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:S5JW22"
FT                   /protein_id="QBZ17420.1"
FT                   /translation="MKKWVKWLIVIVIIAVVAVGAVFLLSKNSGSVTQEKLVTAKVKQG
FT                   DMKINATGTGAISPVNTQVPDYDELQLVAQMDELDIPNIKKDQEVKVTVTALPDKTYTG
FT                   KVKEIAEQGQVQNGVSSFSVIISLDKTDDLKAGMTADASILVNEKKDALYVPIEAVQKD
FT                   SDDKYYVLVPEEKDNGKTKKVKKFVETGLHNEDNIEITKGVKKGEKVILPTQETSTVPG
FT                   APS"
FT   gene            193847..194539
FT                   /locus_tag="FORC68_0193"
FT   CDS_pept        193847..194539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0193"
FT                   /product="ABC transporter ATP-binding protein YvcR"
FT                   /db_xref="GOA:A0A0D8X363"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X363"
FT                   /protein_id="QBZ17421.1"
FT                   /translation="MPKPLIDMKNLTKTYTLGGETFKALDDVTFTVEQGEFLSIVGPSG
FT                   SGKSTLMNMIGCLDVPDEGSYHLDDVDVFKLSDNKLSEIRNKKIGFIFQQFNLLPKLSA
FT                   FENVELPLIYAGLSVSAREKAAIECLEKVGLLEKRRNLPTQLSGGQQQRVAIARALAGK
FT                   PQILLADEPTGALDSKTGKEVMGILQELNRAGNTIVMITHDPTIASYGTRSIRIQDGKL
FT                   FHEEATQA"
FT   gene            194536..195744
FT                   /locus_tag="FORC68_0194"
FT   CDS_pept        194536..195744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0194"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="GOA:A0A3A7XH85"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7XH85"
FT                   /protein_id="QBZ17422.1"
FT                   /translation="MNVLQSMKMAWKQLKASKLRSFLTMLGIIIGVASVILLVSLGNGV
FT                   TQEVDDQMGDLGSNLITVVNSSVNPNDKYTYDEVMKYQNIDGVKSVSPELSGQVNATFD
FT                   YKSSSNKVIGTNDQYKAARSLEMKEGRFLLPIDTEYGQKVAVIGSTVASDLFGFGDPIG
FT                   ETIRLNGMPYKVVGVLKEKGASMMGSSDDQIFIPISSAQRLLKDTNVRTIYVETKSAED
FT                   VDFVVNTLESRLAIKFGDEKEQEKNASSAQMGPSYQVINQQEILNAFNTISTTLTTALG
FT                   AIAAISLVVGGIGIMNIMLVSVSERTREIGIRKALGAKKRAILLQFLIESIVISVCGGV
FT                   IGIIIGVSGALIFGSVAGISSGITAGTIIFSFVFSLCIGVIFGIAPANKASKLRPIDAL
FT                   RSE"
FT   gene            196429..196737
FT                   /locus_tag="FORC68_0195"
FT   CDS_pept        196429..196737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0195"
FT                   /product="Putative SpoVG"
FT                   /db_xref="GOA:A0A0D8X3A2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X3A2"
FT                   /protein_id="QBZ17423.1"
FT                   /translation="MEITDVRLRRVETDGRMKAISSITIDGEFVIHDIRVIDGNEGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRAKIQEAVLAAYEVADEPAVNEESSADESIVEEN"
FT   gene            196857..197165
FT                   /locus_tag="FORC68_0196"
FT   CDS_pept        196857..197165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0196"
FT                   /product="Putative SpoVG"
FT                   /db_xref="GOA:L8DRN3"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:L8DRN3"
FT                   /protein_id="QBZ17424.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE"
FT   gene            197552..198925
FT                   /locus_tag="FORC68_0197"
FT   CDS_pept        197552..198925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0197"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /db_xref="GOA:A0A3A2VSF3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2VSF3"
FT                   /protein_id="QBZ17425.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLN
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQDEQLGTAHAVLQAKAELAGKDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALENVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASKLMQRRINENHMRNGVTLVNPESTYIDIDVKIGQDTVIEPGVML
FT                   RGKTVIGDDCVVTSGSEIVNSVIGERVHVRTSSIFESKVGDDVQIGPYAHLRPESDIHD
FT                   HVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   NVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPEDALGIARAKQDNKLGYAKHLNHGK"
FT   gene            198976..199932
FT                   /locus_tag="FORC68_0198"
FT   CDS_pept        198976..199932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0198"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="GOA:Q547F8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q547F8"
FT                   /protein_id="QBZ17426.1"
FT                   /translation="MSNEYFDPKLKIFSLNSNRELAEEIAKEVGIELGKSSVTHFSDGE
FT                   IQINIEESIRGCHVYVIQSTSNPVNQNLMELLIMIDALKRASAATINIVMPYYGYARQD
FT                   RKARSREPITAKLVANLIETAGATRMITLDMHAPQIQGFFDIPIDHLNAVRLLSDYFSE
FT                   RHLGDDLVVVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVAEVMNIVGNVEGKVCI
FT                   IIDDIIDTAGTITLAAKALREAGATKVYACCSHPVLSGPAMKRIEESPIEKLVVTNSIA
FT                   LPEEKWIDKMEQLSVAALLGEAIVRVHENASVSSLFE"
FT   gene            complement(199975..200688)
FT                   /locus_tag="FORC68_0199"
FT   CDS_pept        complement(199975..200688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0199"
FT                   /product="Virulence regulatory factor PrfA /
FT                   Transcriptional regulator, CrP/Fnr family"
FT                   /db_xref="GOA:Q4TVQ0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q4TVQ0"
FT                   /protein_id="QBZ17427.1"
FT                   /translation="MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGI
FT                   TKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKE
FT                   LLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIK
FT                   ITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLD
FT                   EWFYLACPATWGKLN"
FT   gene            complement(200959..201912)
FT                   /locus_tag="FORC68_0200"
FT   CDS_pept        complement(200959..201912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0200"
FT                   /product="Phosphatidylinositol-specific phospholipase C"
FT                   /db_xref="GOA:Q6EA59"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EA59"
FT                   /protein_id="QBZ17428.1"
FT                   /translation="MYKNYLQRTLVLLLCFILYFFTFPLGGKAYSLNNWNKPIKNSVTT
FT                   KQWMSALPDTTNLAALSIPGTHDTMSYNGDITWTLTKPLAQTQTMSLYQQLEAGIRYID
FT                   IRAKDNLNIYHGPIFLNASLSGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQP
FT                   LINIYKDYFYTTPRTDTSNKIPTLKDVRGKILLLSENHTKKPLVINSRKFGMQFGAPNQ
FT                   VIQDDYNGPSVKTKFKEIVQTAYQASKADNKLFLNHISATSLTFTPRQYAAALNNKVEQ
FT                   FVLNLTSEKVRGLGILIMDFPEKQTIKNIIKNNKFN"
FT   gene            202154..203743
FT                   /locus_tag="FORC68_0201"
FT   CDS_pept        202154..203743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0201"
FT                   /product="Thiol-activated cytolysin"
FT                   /db_xref="GOA:A0A466Y9T4"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="InterPro:IPR035390"
FT                   /db_xref="InterPro:IPR036359"
FT                   /db_xref="InterPro:IPR036363"
FT                   /db_xref="InterPro:IPR038700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A466Y9T4"
FT                   /protein_id="QBZ17429.1"
FT                   /translation="MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASP
FT                   PASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKK
FT                   KKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTN
FT                   QDNKIVVKNATKSNVNNTVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFG
FT                   TAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQA
FT                   LGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKN
FT                   SSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAV
FT                   IKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNK
FT                   SKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLY
FT                   PKYSNKVDNPIE"
FT   gene            204074..205606
FT                   /locus_tag="FORC68_0202"
FT   CDS_pept        204074..205606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0202"
FT                   /product="Zinc metalloproteinase precursor"
FT                   /db_xref="GOA:Q6EAH5"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EAH5"
FT                   /protein_id="QBZ17430.1"
FT                   /translation="MKSKLICIIMVIAFQAHFTMTVKADSVGEEKLQNNTQAKKTPADL
FT                   KALPDSCEAKDFYKNFKILDMTKDKLGVTHYTLALSSGGYLTDNDEIKVHVTPDNKITF
FT                   INGDLQQGQLRITNQIKITEKNAIEKAFEAIGQSEAHVKSYVGNPVKEKEIILNSRTKR
FT                   LVYNIKLIFAEPEVASWIVQVDAETGAILKKQNMLSEVERADTHKDFQALGKGANRLLQ
FT                   RPLHVMKINDLFYLVDRTHKGLIRTFDLKHNTDTSFGKVVSNKTNMFTDPEFSSAVDAH
FT                   FYASEVYEYYKNVHQLESLDGKGGEIDSFVHYGLNCNNAFWDGQEILYGDGDKKNFKPF
FT                   SCAKTIVGHELTHAVIQYSAGLEYEGQSGALNESFADVFGYFIAPNHWLIGEDVCVRGS
FT                   RDGRIRSIKDPDKYNQAAHMKDYESLPITEEGDWGGVHYNSGIPNKAAYNTITKLGKEK
FT                   TEQLYFRALKYYLTKKSQFTDAKKALQQAAKDLYGEDASKKVAEAWEAVGVN"
FT   gene            205805..207724
FT                   /locus_tag="FORC68_0203"
FT   CDS_pept        205805..207724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0203"
FT                   /product="Actin-assembly inducing protein ActA precursor"
FT                   /db_xref="GOA:B0G056"
FT                   /db_xref="InterPro:IPR007752"
FT                   /db_xref="UniProtKB/TrEMBL:B0G056"
FT                   /protein_id="QBZ17431.1"
FT                   /translation="MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEE
FT                   EKTEEQPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKGPNNN
FT                   NNNGEQTGNVAINEEASGVDRPTLQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLT
FT                   YPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQPFFPKVFKKIKDA
FT                   GKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPET
FT                   PMLLGFNAPATSEPSSFEFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPT
FT                   EDELEIIRETASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEELNGGGDRPTSE
FT                   GFSSMNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNAGFLPLNPFISSPVPSLTP
FT                   KVPKISAPALISDITKKAPFKNPSQPLNVFNKKTTTKTVTKKPTPVKTAPKLAELPATK
FT                   PQETVLRENKTPFIEKQAETNKQSINMPSLPVIQKEATESDKEEMKPQTEEKMVEESES
FT                   ANNANGKNRSAGIEEGKLIAKSAEDEKAKEEPGNHTTLILAMLAIGVFSLGAFIKIIQL
FT                   RKNN"
FT   gene            207760..208629
FT                   /locus_tag="FORC68_0204"
FT   CDS_pept        207760..208629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0204"
FT                   /product="phospholipase C"
FT                   /db_xref="GOA:B0G057"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:B0G057"
FT                   /protein_id="QBZ17432.1"
FT                   /translation="MKFKKVVLGMCLTASVLVFPITIKANACCDEYLQTPAAPHDIDSK
FT                   LPHKLSWSADNPTNTDVNTHYWLFKQAEKILAKDVNHMRANLMNELKKFDKQIAQGIYD
FT                   ADHKNPYYDTSTFLSHFYNPDRDNTYLPGFANAKITGAKYFNQSVTDYREGKFDTAFYK
FT                   LGLAIHYYTDISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVAKRFCSDD
FT                   VKDWLYENAKRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLE
FT                   FWSKKTNE"
FT   gene            208701..209024
FT                   /locus_tag="FORC68_0205"
FT   CDS_pept        208701..209024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0205"
FT                   /product="hypothetical protein"
FT                   /note="viral glycoprotein gp160 of HIV type 1 like protein"
FT                   /db_xref="GOA:A0A393B332"
FT                   /db_xref="InterPro:IPR035131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393B332"
FT                   /protein_id="QBZ17433.1"
FT                   /translation="MYIKGRLIFFFVMFVIALCSVLILLIIKISVWKDEPFHLSDAKEI
FT                   ECLGSCEIKNTNQKIHFFSIKENLFEEKGDIAGILNEDEQKVADKSIFIVILDDEKGIA
FT                   NEE"
FT   gene            209159..209620
FT                   /locus_tag="FORC68_0206"
FT   CDS_pept        209159..209620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009736"
FT                   /db_xref="InterPro:IPR036699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUL2"
FT                   /protein_id="QBZ17434.1"
FT                   /translation="MKMLKKGTAVLFVMIMAVMLVACGDKEETKTYTLSQNGVDSKLTY
FT                   TYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIE
FT                   TLEVDYTKISSEDMNKIPGMSSNGDTSKGISMEESAKMLESQGYKEVSK"
FT   gene            complement(209671..210003)
FT                   /locus_tag="FORC68_0207"
FT   CDS_pept        complement(209671..210003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0207"
FT                   /product="virulence protein B VclB"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B2L5P5"
FT                   /protein_id="QBZ17435.1"
FT                   /translation="MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
FT                   RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVV
FT                   IEAQDY"
FT   gene            complement(210070..210744)
FT                   /locus_tag="FORC68_0208"
FT   CDS_pept        complement(210070..210744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0208"
FT                   /product="virulence protein A VclA"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWI5"
FT                   /protein_id="QBZ17436.1"
FT                   /translation="MITFDQLDTELQALENPNTIKIFRNHGCPDSLDLYGLKIGDLKKI
FT                   IRREKLTKNHELAVKLIESNNSDLIYLGLLAINPNKITTEQIEKWNIAFRETWSQLTFG
FT                   LASIVSKRDDALLFAKTWIESDYDLTKSMGWQIYSEHINNLPEAETLLQRAKETLQTET
FT                   NRTRYSMNGFIITCGIYKDDLHEKAMEAAKSVGKVHVNLGNTACKVPDAISYIEKARNR
FT                   TK"
FT   gene            complement(210821..211762)
FT                   /locus_tag="FORC68_0209"
FT   CDS_pept        complement(210821..211762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0209"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="GOA:A1E154"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1E154"
FT                   /protein_id="QBZ17437.1"
FT                   /translation="MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGD
FT                   AMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIV
FT                   DEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKV
FT                   DARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIIN
FT                   KKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHI
FT                   VEMNLNDKEKEQMKNSADTLKKVLDDAMKQID"
FT   gene            212056..212679
FT                   /locus_tag="FORC68_0210"
FT   CDS_pept        212056..212679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0210"
FT                   /product="LSU ribosomal protein L25p"
FT                   /db_xref="GOA:A1E155"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A1E155"
FT                   /protein_id="QBZ17438.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFSVTVDGKKLNVLLHEYQVDPLKDVLVHVDLLAVDMNEEVETDV
FT                   RVVLVGDAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDISSLEIGDVLTTNDLPENK
FT                   DYVVQAEEEETVVTVSAPRAEEEPTTTEAPEPEAVHGKDEEPVE"
FT   gene            212769..213353
FT                   /locus_tag="FORC68_0211"
FT   CDS_pept        212769..213353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0211"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A3T1IIN6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1IIN6"
FT                   /protein_id="QBZ17439.1"
FT                   /translation="MLDKSVPHISVIMVNHDATNYPEFHLPAGYSFCFYKDGLEEDWCR
FT                   LQLETGQVLSMDSIRARFETEFGNEKEKLTKRCIFVKAPNGEIIGTAMLWDGNTFGKME
FT                   SRIHWVAVLDSHGGKGIAKALLSKILGLNKSKFVYLTTQTGSYQAIYLYRKFGFEKYVG
FT                   KTPENWKTVNFQEEKETAWQIIENKIAEHQA"
FT   gene            213460..214020
FT                   /locus_tag="FORC68_0212"
FT   CDS_pept        213460..214020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0212"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /db_xref="GOA:A0A3T2HEU8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HEU8"
FT                   /protein_id="QBZ17440.1"
FT                   /translation="MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGM
FT                   TSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNISIEDVVIVYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVINYVLGDFPKAEQPDIIAAIQK
FT                   SADAIEDFAQTPFIEVMNKYNQK"
FT   gene            214135..217674
FT                   /locus_tag="FORC68_0213"
FT   CDS_pept        214135..217674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0213"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="GOA:A0A3T2HEQ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HEQ5"
FT                   /protein_id="QBZ17441.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNALDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMDVDRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLLSGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTTRVEEFR
FT                   LLPATEIILDQSYYPDIVKRLEKKMTHTLNELKENEDKQALVENLEEDLEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYLPKNTAILLDEFGRILETEESLEREEAEWQTETLSRMETV
FT                   RDVQVSHSFKKLLEGNHSPKIYLSLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNLERAEKMQQTLTDYDMESTILKKESDVPKYGMVQFVIGTFQN
FT                   GFELPLAKVAIISETELFNKKIKKVKKRQKLSNAERIQSYSELKVGDYVVHVNHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVESITQKADEISAMVPDARVATAHGQMGE
FT                   SELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIETLSELEDLQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTAGIRGDIVMQIIGEFGRMVGVGMEGTQLKITINVQNKPLKEWLYQVKSLAEK
FT                   LRGAMKEKASTEN"
FT   gene            217705..219294
FT                   /locus_tag="FORC68_0214"
FT   CDS_pept        217705..219294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0214"
FT                   /product="Stage V sporulation protein"
FT                   /db_xref="GOA:A0A3T1NU68"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NU68"
FT                   /protein_id="QBZ17442.1"
FT                   /translation="MSERSMKRLMKGAAWLTAASLISKILSAIYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDVRRQQIIMRAVSRMLRIVSIVIFAFL
FT                   FLFANLIAIMMGDPALSELIRVISFVFLLMPQLAFMRGFFQGEGDMIPTAISQTVEQII
FT                   RVAIILIGAGLALHFNFDLYDAGSMAMSGAFFGGVSGIFILRHFYNKKVRLGEGIQPAV
FT                   FTNKEEKVGIGRTFLRQSVAICVVSSMLILFQLVDSFQVYRLMSDSGIPGFIAKSLKGV
FT                   YDRGQPILQLGLVISTGLALALVPMITAARVQGQQKELKRSVLLAIKITLILSGAETIG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKIAVPAVGVGIGL
FT                   IVKWVTGGILIPRLATVGASVSTCVGLLVILLICYVSLKQTIRVPFVEKTMLFRLVAAL
FT                   VLMAVFPCLFEWLAPLDTRLGSAFQAIVSALVGGGIFLVFALRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
FT   gene            219318..219596
FT                   /locus_tag="FORC68_0215"
FT   CDS_pept        219318..219596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0215"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S component"
FT                   /db_xref="GOA:A0A0D8X5H8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X5H8"
FT                   /protein_id="QBZ17443.1"
FT                   /translation="MATTMRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNV
FT                   KSGDELVIRFGPKIVTAKIERLEENAKKEQATEMYTIIKEERTDESR"
FT   gene            219825..220211
FT                   /locus_tag="FORC68_0216"
FT   CDS_pept        219825..220211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0216"
FT                   /product="Cell division protein DivIC (FtsB), stabilizes
FT                   FtsL against RasP cleavage"
FT                   /db_xref="GOA:A0A3T1NUB9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NUB9"
FT                   /protein_id="QBZ17444.1"
FT                   /translation="MKKAKSKVARIENRYIKDTATMKKTRSRRRIALFRRLVFMAIIFA
FT                   VVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHNDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
FT   gene            220362..220790
FT                   /locus_tag="FORC68_0217"
FT   CDS_pept        220362..220790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0217"
FT                   /product="RNA binding protein, contains ribosomal protein
FT                   S1 domain"
FT                   /db_xref="GOA:A0A2A6A1Q7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A6A1Q7"
FT                   /protein_id="QBZ17445.1"
FT                   /translation="MSIEVGNKLQGKVTGITNFGAFVELEGGKTGLVHISEVADNYVKD
FT                   INDILTVGDEVTVKVMNIGDDGKIGLSIRKAVDRPDRPEKSYDRKPKYNKKPAGNYVKP
FT                   AESFEDIMSKFLKDSDERLTTIKRQTESKRGGRGAKRG"
FT   gene            220897..222843
FT                   /locus_tag="FORC68_0218"
FT   CDS_pept        220897..222843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0218"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="GOA:A0A3T2HEQ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HEQ4"
FT                   /protein_id="QBZ17446.1"
FT                   /translation="MDDTEKRVHKYIEKHDLIRSDDKLLVAVSGGPDSLALLHFLWNSN
FT                   LVPKEAISVAHLNHQLRENAAKEQRVVETFCERQGIPFYIEEVDIKSRAQSLQKGLEET
FT                   ARIVRYDFFEKVMAEKNINKLVLAHHADDQIETILMRLVRGSASIGWSGIQPKRELKGG
FT                   QAIRPFLPITKAEIIDYAQKHELAYEIDESNTSQEYTRNRYRAQLLPFLKQENPAVYSH
FT                   FERFSEETSEDFQFLEALASDLLKKNLIKNGKQTTLLLSSFKNEANPLQRRAIHLLLRY
FT                   LYNEDASFITVNHIYQIIQMIQSDNPSSSIDLPNKLIAIRAYDKLHFQFGEREAPSEFY
FT                   HQLELNDRIELDNKASIRLKLKSSVVQTNGLNGMLLDAEEITLPLIVRNRVNGDRMTMK
FT                   GQAGSKKLKDIFIDAKIPRQERDKLPVITDYTGKILWVPGVKKSAYDREFSRSKKQYII
FT                   RYTRNIGGNESMHNDIQKVLISEDELQEKIRELGRELTTEYEGRNPLVVGVLKGATPFM
FT                   TDLLKRVDTYLEMDFMDVSSYGNGTVSSGEVKIIKDLNASVEGRDVLVIEDIIDSGRTL
FT                   SYLVDLIKYRKAKSVKLVTLLDKPAGRNVEIEADYVGFVVPNEFVVGYGLDYAERYRNL
FT                   PYIGILKPEIYSE"
FT   gene            223189..225264
FT                   /locus_tag="FORC68_0219"
FT   CDS_pept        223189..225264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0219"
FT                   /product="Cell division protein FtsH"
FT                   /db_xref="GOA:A0A3D7WLN1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WLN1"
FT                   /protein_id="QBZ17447.1"
FT                   /translation="MNRFFRNAIFYVIIFLVIIGIVASFNSNKEAAKDISYSEFVSKLE
FT                   DGKVKSVEIQPDRSVYTINGEFKSSDKSSDDKKTGLGQSKTSSTAFTTYALNSDTSLGD
FT                   LQKTLDKEDVKMNVVPAKQNSGWVTFLTSIVPFVIIFILFFFLMSQSQGGGGGKVMSFG
FT                   KSKAKLYNDDKKKVRFTDVAGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPP
FT                   GTGKTLLARAVAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEI
FT                   DAVGRQRGAGMGGGHDEREQTLNQLLVEMDGFGGNEGIIIIAATNRADVLDPALLRPGR
FT                   FDRQIMVDRPDVKGREAVLRVHARNKPLAKSVDLKAIAQRTPGFSGADLENLLNEAALV
FT                   AARSDKKEIDMSDLDEASDRVIAGPAKKNRVISEKERRTVAYHEGGHVIVGMVLDEAEV
FT                   VHKVTIVPRGQAGGYAVMLPKEDRFLMTKAELMDRITGLLGGRVAEEVTFGEVTTGASN
FT                   DFERATELARRMVTEWGMSDKIGPLQFTSGNGQVFMGRDFGSDKGYSDKIAYEIDTEVQ
FT                   SLIRYCYDRAKTIITEHQEQHKLIAETLLKVETLDARQIRSLFDDGVMPPDIDTIDVEA
FT                   EYPSEKDEEVAGKSFEEEREELKEEEKVEETQEEPKEVTSEDAPNIEQTPNDKKDE"
FT   gene            225380..226159
FT                   /locus_tag="FORC68_0220"
FT   CDS_pept        225380..226159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0220"
FT                   /product="Pantothenate kinase type III, CoaX-like"
FT                   /db_xref="GOA:A0A1D2IUM2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUM2"
FT                   /protein_id="QBZ17448.1"
FT                   /translation="MILVIDVGNTNCTVGVYEKQKLLKHWRMTTDRHRTSDELGMTVLN
FT                   FFSYANLTPSDIQGIIISSVVPPIMHAMETMCVRYFNIRPLIVGPGIKTGLNLKVDNPR
FT                   EIGSDRIVNAVAASEEYGTPVIVVDFGTATTFCYIDESGVYQGGAIAPGIMISTEALYN
FT                   RAAKLPRVDIAESSQIIGKSTVSSMQAGIFYGFVGQCEGIIAEMKKQSNASPVVVATGG
FT                   LARMITEKSSAVDILDPFLTLKGLELLYRRNKPTTEK"
FT   gene            226175..227059
FT                   /locus_tag="FORC68_0221"
FT   CDS_pept        226175..227059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0221"
FT                   /product="Chaperonin, heat shock protein 33"
FT                   /db_xref="GOA:A0A393DBX7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393DBX7"
FT                   /protein_id="QBZ17449.1"
FT                   /translation="MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGR
FT                   TMTGTLFLGAMQKEDQKITVKIEGDGPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAG
FT                   KLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIVSGEIGEDFTYYLATSEQINSSVGVGV
FT                   LVNPDDTIEAAGGFMLQLLPGATDEIIDEIEKNLMALPTVSRMIEAGETPESILAKLAG
FT                   GEDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYDF
FT                   SEEELETLYEEAK"
FT   gene            227175..228101
FT                   /locus_tag="FORC68_0222"
FT   CDS_pept        227175..228101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0222"
FT                   /product="Cysteine synthase"
FT                   /db_xref="GOA:A0A1D2IUM4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IUM4"
FT                   /protein_id="QBZ17450.1"
FT                   /translation="MTIANSITDLIGKTPIVKLNRLPEAGSADVYVKLEFQNPGGSVKD
FT                   RIANAMIESAEKSGALKPGDTIIEPTSGNTGIGLAMVAAAKGYQAIFVMPETMSLERRK
FT                   LLQAYGAKLVLTPGPDGMKGAIAKAEELAKENNYFVPQQFHNPANPAVHEETTGPEIVE
FT                   AFGKDGLDAFIAGVGTGGTVTGVGHVLKKNYPDVKIYALEPEESPVLSGGSPSPHKIQG
FT                   IGAGFVPDTLDTKVYDGILKVSSEDALETAREVAKKEGILVGISSGATIKAALDLAKEL
FT                   GAGKKVLAIVASNGERYLSTPLYNFED"
FT   gene            complement(228788..228955)
FT                   /locus_tag="FORC68_0223"
FT   CDS_pept        complement(228788..228955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDR1"
FT                   /protein_id="QBZ17451.1"
FT                   /translation="MILAHKKTDAEKGVNRIGQKREFGIFILEGGRRMKMFCLLLAYDY
FT                   ILTKFSVDTL"
FT   gene            229027..229812
FT                   /locus_tag="FORC68_0224"
FT   CDS_pept        229027..229812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0224"
FT                   /product="Dihydropteroate synthase"
FT                   /db_xref="GOA:A0A4P7MP22"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MP22"
FT                   /protein_id="QBZ17452.1"
FT                   /translation="MVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGI
FT                   STRPGFSEVTPDEELARIIPVIKAVRTKLPNIWISVDSWRAEVAEQAILAGADMINDQW
FT                   GAKKEPKIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHII
FT                   LDPGFGFVKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGAT
FT                   TVYGFSKGCTITRVHDVLPIARMVRMTDAITGKLDITNL"
FT   gene            229826..230200
FT                   /locus_tag="FORC68_0225"
FT   CDS_pept        229826..230200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0225"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="GOA:A0A3H0QZS2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QZS2"
FT                   /protein_id="QBZ17453.1"
FT                   /translation="MDKIYLNELVFYGYHGVLKEETKLGQTFRVSLILGLSTKKAGISD
FT                   SVEDTVSYADVYETVKEIVEGKPFKLIEALAEKIASEVLTGYPLLEEVTVKLIKPNPPI
FT                   PGHYDSVAVEIERKRSDLNG"
FT   gene            230193..230672
FT                   /locus_tag="FORC68_0226"
FT   CDS_pept        230193..230672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0226"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="GOA:A0A3A7Q0D0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7Q0D0"
FT                   /protein_id="QBZ17454.1"
FT                   /translation="MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDA
FT                   VGYEDQAAFLNIAVEIETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDV
FT                   KTDTEKLKIPHPYMKERAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW"
FT   gene            230749..231744
FT                   /locus_tag="FORC68_0227"
FT   CDS_pept        230749..231744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0227"
FT                   /product="tRNA dihydrouridine synthase B"
FT                   /db_xref="GOA:A0A0B8QYI5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8QYI5"
FT                   /protein_id="QBZ17455.1"
FT                   /translation="MFKIGNVEIKNQVVVAPMAGISNSAFRLTVKEFGAGLVCCEMISD
FT                   KGIAYRNAKTLDMLYIDEKEKPLSLQIFGGEKETLVEAAKFVAENTTADIIDINMGCPV
FT                   NKIIKCEAGAKWLLDPNKVYDMVAAVVDAVDKPVTVKMRIGWDEEHVFAIENALAAERA
FT                   GAAAVAMHGRTRVQMYEGSANWDVLRDVKRELKIPFMANGDVRTPEDAKRILEHTGADG
FT                   VMIGRAALGNPWMIYRTVKFLETGELLPEPEPREKMQTAMLHLNRLVELKGENIAVREF
FT                   RQHAAYYLKGARGSTRAKVAANQATKQSEMEAILNEFVLQYEEKALAKQD"
FT   gene            231859..233355
FT                   /locus_tag="FORC68_0228"
FT   CDS_pept        231859..233355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0228"
FT                   /product="Lysyl-tRNA class II synthetase"
FT                   /db_xref="GOA:A0A476SIX5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A476SIX5"
FT                   /protein_id="QBZ17456.1"
FT                   /translation="MSNENHEELNDQLIVRREKVDTLREEGIDPFGEKFIRSISPEEIE
FT                   TKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMDLVEGLVSTVCKQVNGTTEITYGEYKVDLTPNWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEALELAKKHDVPVTEHMTYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DERFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHRD"
FT   gene            complement(233794..235320)
FT                   /locus_tag="FORC68_r013"
FT   rRNA            complement(233794..235320)
FT                   /locus_tag="FORC68_r013"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(235600..238531)
FT                   /locus_tag="FORC68_r014"
FT   rRNA            complement(235600..238531)
FT                   /locus_tag="FORC68_r014"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(238609..238724)
FT                   /locus_tag="FORC68_r015"
FT   rRNA            complement(238609..238724)
FT                   /locus_tag="FORC68_r015"
FT                   /product="5S ribosomal RNA"
FT   gene            238733..238807
FT                   /locus_tag="FORC68_t002"
FT   tRNA            238733..238807
FT                   /locus_tag="FORC68_t002"
FT                   /product="tRNA-Val"
FT   gene            238815..238890
FT                   /locus_tag="FORC68_t003"
FT   tRNA            238815..238890
FT                   /locus_tag="FORC68_t003"
FT                   /product="tRNA-Thr"
FT   gene            238932..239005
FT                   /locus_tag="FORC68_t004"
FT   tRNA            238932..239005
FT                   /locus_tag="FORC68_t004"
FT                   /product="tRNA-Lys"
FT   gene            239010..239092
FT                   /locus_tag="FORC68_t005"
FT   tRNA            239010..239092
FT                   /locus_tag="FORC68_t005"
FT                   /product="tRNA-Leu"
FT   gene            239106..239177
FT                   /locus_tag="FORC68_t006"
FT   tRNA            239106..239177
FT                   /locus_tag="FORC68_t006"
FT                   /product="tRNA-Gly"
FT   gene            239198..239285
FT                   /locus_tag="FORC68_t007"
FT   tRNA            239198..239285
FT                   /locus_tag="FORC68_t007"
FT                   /product="tRNA-Leu"
FT   gene            239297..239371
FT                   /locus_tag="FORC68_t008"
FT   tRNA            239297..239371
FT                   /locus_tag="FORC68_t008"
FT                   /product="tRNA-Arg"
FT   gene            239381..239454
FT                   /locus_tag="FORC68_t009"
FT   tRNA            239381..239454
FT                   /locus_tag="FORC68_t009"
FT                   /product="tRNA-Pro"
FT   gene            239474..239549
FT                   /locus_tag="FORC68_t010"
FT   tRNA            239474..239549
FT                   /locus_tag="FORC68_t010"
FT                   /product="tRNA-Ala"
FT   gene            complement(239815..241341)
FT                   /locus_tag="FORC68_r016"
FT   rRNA            complement(239815..241341)
FT                   /locus_tag="FORC68_r016"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(241621..244552)
FT                   /locus_tag="FORC68_r017"
FT   rRNA            complement(241621..244552)
FT                   /locus_tag="FORC68_r017"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(244630..244745)
FT                   /locus_tag="FORC68_r018"
FT   rRNA            complement(244630..244745)
FT                   /locus_tag="FORC68_r018"
FT                   /product="5S ribosomal RNA"
FT   gene            244890..245348
FT                   /locus_tag="FORC68_0229"
FT   CDS_pept        244890..245348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0229"
FT                   /product="Transcriptional regulator CtsR"
FT                   /db_xref="GOA:Q48757"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q48757"
FT                   /protein_id="QBZ17457.1"
FT                   /translation="MKNISDIIEAYLKQVLESSEAVEIKRSEIADKFECVPSQINYVIN
FT                   TRFTMERGYIVESKRGGGGYIRIIKVKMNDKLQLLEAIISMVHDKKVSQSFSEDVILRL
FT                   LEEEVITKKEARLMVAALDREVLILPLPDRDILRSRILEAMLVALKYD"
FT   gene            245361..245879
FT                   /locus_tag="FORC68_0230"
FT   CDS_pept        245361..245879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0230"
FT                   /product="Nucleotide excision repair protein, with
FT                   UvrB/UvrC motif"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0RC53"
FT                   /protein_id="QBZ17458.1"
FT                   /translation="MICQRCGENKAVIALQQLNELGKVESLYLCENCATDEALSSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENTQKEVVCENCQLSFEEFLKTNRVGCPECYSAFEAQL
FT                   VPIIGRVQNGYKKHIGKVPAEVERAEGVQNEISRLQEKLAKLVKNEEFEEAAVVRDEIK
FT                   ALKAGGEDK"
FT   gene            245876..246898
FT                   /locus_tag="FORC68_0231"
FT   CDS_pept        245876..246898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0231"
FT                   /product="Putative ATP:guanido phosphotransferase YacI"
FT                   /db_xref="GOA:A0A3T2HDT7"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDT7"
FT                   /protein_id="QBZ17459.1"
FT                   /translation="MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPIYEQKD
FT                   EIVDNIAEVFDDNFTLIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTEA
FT                   EIVEDLTQVMEQIIMQERVARTTLKQKFHIALEDRVFRSYGLLMNCRIISMKEAADAIS
FT                   DIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIRDILGDK
FT                   "
FT   gene            246927..249389
FT                   /locus_tag="FORC68_0232"
FT   CDS_pept        246927..249389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0232"
FT                   /product="ATP-dependent Clp protease, ATP-binding component
FT                   ClpC"
FT                   /db_xref="GOA:A0A1D2IZ23"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IZ23"
FT                   /protein_id="QBZ17460.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGISSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PTVEESIQILHGLRDRYEAHHRVAITDEALEAAVRLSDRYISDRFLPDKAIDVIDESGS
FT                   KVRLKSFTTPKNVKEMENNLSDLKKEKDAAVQGQEFEKAASLRDKEQKLKKSLEETKAN
FT                   WQEKQGLDHSEVTEDIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVTDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLAERDIHVKLTEGAKSKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDYVEIGVKDGKLEVRKKDAPKKKT
FT                   TSKKVKAK"
FT   gene            249535..250908
FT                   /locus_tag="FORC68_0233"
FT   CDS_pept        249535..250908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0233"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="GOA:L8DQ47"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:L8DQ47"
FT                   /protein_id="QBZ17461.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD"
FT   gene            251042..252115
FT                   /locus_tag="FORC68_0234"
FT   CDS_pept        251042..252115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0234"
FT                   /product="Membrane-associated protein containing
FT                   RNA-binding TRAM domain and ribonuclease PIN-domain"
FT                   /db_xref="GOA:A0A3T1NWT7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWT7"
FT                   /protein_id="QBZ17462.1"
FT                   /translation="MLTWVIRVCFLILGGTTGVFSLPTLWVKLGIGHILLINNPYTDAL
FT                   IGALIFYLITFWAVKYVEAALNWLEEKLAKIAIATLVYGGLGLFVGLVIAFFASNALSQ
FT                   TNIPLLNSVVPVILTLVLGYLGFRIGISRRNEFGNFVNNRNAKKRTPEEEKTEEKSKKT
FT                   YKILDTSVIIDGRIADILTTGFLDGTVVIPLFVLAELQHIADSSDTLKRTRGRRGLDIL
FT                   NRIQKEDAIQVEMYEGDFEDTPEVDSKLVKLAKVMGGIVVTNDYNLNKVCEFQNVPVLN
FT                   INDLANAVKPVVLPGEKMTVLMVKDGKEHNQGVAYLDDGTMIVVEDGRKFINETIQVEV
FT                   TSVLQTSAGRMIFAKPS"
FT   gene            252135..252833
FT                   /locus_tag="FORC68_0235"
FT   CDS_pept        252135..252833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0235"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="GOA:A0A393FGQ5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393FGQ5"
FT                   /protein_id="QBZ17463.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVCQEEERKHVKELMSQLNVAEHRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITLDIIDRLLIGVEQSKAAICAVKVKDTVKRVVNGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERIPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
FT   gene            252826..253299
FT                   /locus_tag="FORC68_0236"
FT   CDS_pept        252826..253299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0236"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="GOA:A0A3A2QYC3"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2QYC3"
FT                   /protein_id="QBZ17464.1"
FT                   /translation="MIRIGQGYDVHKLAYDRDLIIGGVKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMTFKDADSAELLEEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK"
FT   gene            253318..254793
FT                   /locus_tag="FORC68_0237"
FT   CDS_pept        253318..254793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0237"
FT                   /product="Glutamyl-tRNA synthetase, Glutamyl-tRNA(Gln)
FT                   synthetase"
FT                   /db_xref="GOA:A0A1D2IPN1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPN1"
FT                   /protein_id="QBZ17465.1"
FT                   /translation="MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRI
FT                   EDTDAKRNIADGEESQMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDK
FT                   DLAYKCYCTEEELDAEREKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPA
FT                   NETITFNDMVKDDVSFESNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHIS
FT                   NTPKQILIYNAFGWEPPIFGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFN
FT                   FIAMLGWSPEGEEEIFSKEEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVV
FT                   ELSLPHLQKAGVVSAELNQAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFD
FT                   EEETAVLAEETVPTVISAFKKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIV
FT                   TTGEMHGPELPLAIEVLGREKVLNRLDTWLKNN"
FT   gene            255193..255807
FT                   /locus_tag="FORC68_0238"
FT   CDS_pept        255193..255807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0238"
FT                   /product="Serine acetyltransferase"
FT                   /db_xref="GOA:A0A0B8R8K5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8R8K5"
FT                   /protein_id="QBZ17466.1"
FT                   /translation="MPTRLKEDIATIIKNDPATKSFFDAFLTNPGLHALWWHRVANFFY
FT                   RHKMVLFGKVLSQNARFWTNIEIHPGATIGRRLFIDHGAGIVIGETAEIGDDVTIFHGV
FT                   TLGGTGKDCGKRHPTVGDGALVSAGAKVLGPVEIGAGARIGAGAVVLKDVPPGATVVGI
FT                   PAKVVRLNGRTVGHAVPKMDELTLRIAELENIVEKLLKEKE"
FT   gene            255814..257229
FT                   /locus_tag="FORC68_0239"
FT   CDS_pept        255814..257229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0239"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="GOA:A0A468C439"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A468C439"
FT                   /protein_id="QBZ17467.1"
FT                   /translation="MSIQIFNTLKREKQPFKPLKDGEVKMYVCGPTVYNYIHIGNARPI
FT                   IVFDTVRRYFTYRGYDVKFVSNFTDVDDKLIRAANELKLTVPEVADRFIGAYFDDVDQL
FT                   NVAKASVNPRVTENMDEIIQMISTLIEKGYAYESAGDVYFQTKKFKDYGKLSGQELSEL
FT                   QHGARVEYNERKQDELDFTLWKAAKPGEIFWESPFGNGRPGWHIECSALAKKYLGDTID
FT                   IHAGGQDLVFPHHEDEIAQSEAATGKTFANYWMHNAFLNIDGEKMSKSLGNFITLHDVL
FT                   KDNDPNVIRFFMLSVHYRKPITLNDAILEDAKNGLERLMIAYQNIDHRIQTDDGEYVEE
FT                   AHEDEWLEQLTELKQAFEDDMDDDFNTANAITTFHELAKRANIYLAKETVSINVLREFL
FT                   SMMRLFAEVLGLKLENTQTDSLDDSEVEALIEERLQARNERNFARADEIRDILKEKNII
FT                   LEDTAQGTRFRRG"
FT   gene            257233..257643
FT                   /locus_tag="FORC68_0240"
FT   CDS_pept        257233..257643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0240"
FT                   /product="Ribonuclease III family protein"
FT                   /note="COG1939"
FT                   /db_xref="GOA:A0A3A7UAB8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7UAB8"
FT                   /protein_id="QBZ17468.1"
FT                   /translation="MAEVKEYKQLNGLALAYMGDAVYEKFIREYLLAAGKTKPNQLHKT
FT                   ATKFVSAKGQAVALKAMIAEGFLTEEEDRIAKRGRNAKSYTVPKNTDPGTYSMSTSFEA
FT                   VLGYLYLAGDVDRLQEWMEKALEIVEKGVETN"
FT   gene            257643..258398
FT                   /locus_tag="FORC68_0241"
FT   CDS_pept        257643..258398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0241"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase
FT                   rlmB"
FT                   /db_xref="GOA:S5KCD7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:S5KCD7"
FT                   /protein_id="QBZ17469.1"
FT                   /translation="MEQENEQEWIGGRNPVLEVLRSDRDIHKIYVQEGSQKGVLKQVLT
FT                   LAKERKIQVQFVPKQKIEKVVSGAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIIL
FT                   DELEDPHNLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVR
FT                   TMEELQKRGLWIFGTDAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPM
FT                   RGKVTSLNASVAASLLLYEVYRKRFPLEK"
FT   gene            258401..258913
FT                   /locus_tag="FORC68_0242"
FT   CDS_pept        258401..258913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WHC0"
FT                   /protein_id="QBZ17470.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSYLKDRDLEAARDKLVEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSKKYQVEVVFTHEDETADEYIEQKAIEWKNVRTQIMVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKQIGKKIKRIQEEMPKSNLNLDSDVISQLE
FT                   KWRRGEE"
FT   gene            258994..259599
FT                   /locus_tag="FORC68_0243"
FT   CDS_pept        258994..259599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0243"
FT                   /product="RNA polymerase sporulation specific sigma factor
FT                   SigH"
FT                   /db_xref="GOA:A0A3D7WIJ3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WIJ3"
FT                   /protein_id="QBZ17471.1"
FT                   /translation="MDNSVNQEELAMLELARSGDTEALEYFFSKYQSVIYWKSTQYFLQ
FT                   GAERDDLIQEAMIGLFKAIRDYDKTKEASFRSFAEMCINRQLLSAVKRASRQKNIPLNN
FT                   SVSLDTPMAEDDVDWTLLDVISEKAAETPEDFLIKNEDLTHVARQLEQVTSEFEKEVLK
FT                   QYLEGKSYQEMALFFNKKEKAIDNALQRVKKKMMKQLE"
FT   gene            259872..260051
FT                   /locus_tag="FORC68_0244"
FT   CDS_pept        259872..260051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0244"
FT                   /product="Preprotein translocase component SecE"
FT                   /db_xref="GOA:A0A3H0FXF4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0FXF4"
FT                   /protein_id="QBZ17472.1"
FT                   /translation="MSAIAKFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFM
FT                   LIDFGIEQIIKLIV"
FT   gene            260181..260714
FT                   /locus_tag="FORC68_0245"
FT   CDS_pept        260181..260714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0245"
FT                   /product="Transcription antitermination protein NusG"
FT                   /db_xref="GOA:S5JW77"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:S5JW77"
FT                   /protein_id="QBZ17473.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEE
FT                   TEVKNGKTKTIKRKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPE
FT                   EADRILKSMGMVEKRAEADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGR
FT                   ETPVEVDFNQIEKL"
FT   gene            260769..261239
FT                   /locus_tag="FORC68_0246"
FT   CDS_pept        260769..261239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR028952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393P5Y1"
FT                   /protein_id="QBZ17474.1"
FT                   /translation="MDKAKQIYLEFKREADFFELDFPLFLGDGPGFGELCMDYSEQDGY
FT                   MLYGYERGKRNSEFKTTDFDEFKYEVFLHICWYMGMEFELRHRKEDIERDDNILETDTR
FT                   KIAFEKTLQLLKMVNPAWIDKAAIGYSNYLNLWRKNKNVYFDKEAMQFKVNL"
FT   gene            261366..261791
FT                   /locus_tag="FORC68_0247"
FT   CDS_pept        261366..261791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0247"
FT                   /product="LSU ribosomal protein L11p, L12e"
FT                   /db_xref="GOA:S5KF05"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:S5KF05"
FT                   /protein_id="QBZ17475.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
FT   gene            261831..262520
FT                   /locus_tag="FORC68_0248"
FT   CDS_pept        261831..262520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0248"
FT                   /product="LSU ribosomal protein L1p, L10Ae"
FT                   /db_xref="GOA:A0A0B8QUP9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8QUP9"
FT                   /protein_id="QBZ17476.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   KVDPASL"
FT   gene            262768..263268
FT                   /locus_tag="FORC68_0249"
FT   CDS_pept        262768..263268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0249"
FT                   /product="LSU ribosomal protein L10p, P0"
FT                   /db_xref="GOA:A0A0P6SFW1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0P6SFW1"
FT                   /protein_id="QBZ17477.1"
FT                   /translation="MSKVLEAKQSAVEEIKTKLSASASTVIVDYRGLNVGEITDLRKQL
FT                   RDAGIEFKVYKNSLTRRAVEANGYEGLEGALTGPNAIAFSNEDVVAPAKILNDFAKDHE
FT                   ALEIKAGVIEGKVASLEEIKALATLPSREGLLSMLCNVLQAPVRGLAIATKAVADQKEG
FT                   QEA"
FT   gene            263347..263709
FT                   /locus_tag="FORC68_0250"
FT   CDS_pept        263347..263709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0250"
FT                   /product="LSU ribosomal protein L7/L12"
FT                   /db_xref="GOA:A0A3A2M6F2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2M6F2"
FT                   /protein_id="QBZ17478.1"
FT                   /translation="MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGIAKDEAE
FT                   EIKAKLEEVGANVEVK"
FT   gene            263867..264253
FT                   /locus_tag="FORC68_0251"
FT   CDS_pept        263867..264253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0251"
FT                   /product="Transcriptional repressor, BlaI/MecI family"
FT                   /db_xref="GOA:A0A3T1NWV9"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWV9"
FT                   /protein_id="QBZ17479.1"
FT                   /translation="MAIKSISKSELEVMKIIWDFGRAVQYADVAGKLEEKNYSWKKNTI
FT                   LTFLTRLVEKNLLSVKKVGRKNEYYALVSENEYLERQTETFVEDIYEGDVKGLITNLVQ
FT                   NDLISPDELEDLQQFWKRMKSPNE"
FT   gene            264246..265286
FT                   /locus_tag="FORC68_0252"
FT   CDS_pept        264246..265286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0252"
FT                   /product="Regulatory sensor-transducer, BlaR1/MecR1 family"
FT                   /db_xref="GOA:A0A3T1NWW9"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWW9"
FT                   /protein_id="QBZ17480.1"
FT                   /translation="MNELLKIFLSMALTSVILIPLVWILQRIFNRYLSKGKIYYSWMIV
FT                   FFFLTIPFAYFFFRFAKDSAFMWRNKTEFDGVTSIVVDQSGVVLQHDFKTVFWMTVLDY
FT                   LWVAWLVIFLLTFIYRIASYRNFKKYVFSGARRVDDLEQLDLLAETMEELNIKRPVELM
FT                   INPLISSPIFLGLKKNVIVIPDETFLNDELHYIFKHELVHCKRKDMYYVWMVQFFTCVY
FT                   WFNPLMYLMNKRIQMDRELACDEAVLATLSKSKYIGYGDTLLSSLAKSGNYKESYVAVS
FT                   LHENTKALKERLMFIANYKAQNKKHNILFSISMIVLCIVGVLFSAFQADVFTLEKKKGI
FT                   TIERRK"
FT   gene            265331..265453
FT                   /locus_tag="FORC68_0253"
FT   CDS_pept        265331..265453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDT7"
FT                   /protein_id="QBZ17481.1"
FT                   /translation="MILTFQTTCRSIKKHNKLLEGRRRNVWSKKGFYTRGISAI"
FT   gene            265404..266066
FT                   /locus_tag="FORC68_0254"
FT   CDS_pept        265404..266066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWS0"
FT                   /protein_id="QBZ17482.1"
FT                   /translation="MFGRKKVSIPEEYQRFNQFSADKERLLCIGAFTTECKHKVETKLD
FT                   GSNKMLKLYYPKNQAAKVMKYWLPMFGINDSYSAIEVITNWTKANDYSGMIAANTTNKV
FT                   IRIVTKASQKEGLDETSLVAAANKVKTYGAFDLDRLGYIVRVCYSLDLINEEQAWDFFE
FT                   ELWGAATMHFDDWDEYCVSYLNGEEGLDTNWYSDGVKAYVALRKDAASLLNKYQLKK"
FT   gene            266091..266594
FT                   /locus_tag="FORC68_0255"
FT   CDS_pept        266091..266594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009736"
FT                   /db_xref="InterPro:IPR036699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDU0"
FT                   /protein_id="QBZ17483.1"
FT                   /translation="MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYVADI
FT                   NGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLEEQVASQYSAYKE
FT                   SKGASLETKFTDEALELTMSVDLYKADKDSVASLLGGTTDPKNVSLKETVKQFEAQGFK
FT                   KKES"
FT   gene            266709..267314
FT                   /locus_tag="FORC68_0256"
FT   CDS_pept        266709..267314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0256"
FT                   /product="Ribosomal RNA small component methyltransferase
FT                   C"
FT                   /db_xref="GOA:A0A3T1NWT3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWT3"
FT                   /protein_id="QBZ17484.1"
FT                   /translation="MTNNHYYTNDETIKHNRKTWQVMLKGFNMSFTSDNGVFSKNTVDF
FT                   GSKLLIESFELETKIGKILDVGCGYGPMGLTVAKAFPDSQIEMVDVNLRALELAKENAG
FT                   INKTTNTHIYESSVYDNVTANDYQAIISNPPIRAGKKVVHAILEGAYDHLRENGELWIV
FT                   IQKKQGGPSAEKKMEEVFGNVETVAKDKGYFIFRSVKN"
FT   gene            267661..268839
FT                   /locus_tag="FORC68_0257"
FT   CDS_pept        267661..268839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0257"
FT                   /product="RNA-2',3'-PO4:RNA-5'-OH ligase"
FT                   /db_xref="GOA:A0A3T2HDP4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDP4"
FT                   /protein_id="QBZ17485.1"
FT                   /translation="MLTLKGKYNEAKVYTDNVDDNTIGQIITLCNQPFAKDSKIRIMPD
FT                   THGGKGCVIGTTMTIQDKIVPNLVGVDIGCGLYVVKLKPGKLKMDFDKLDKVIRERVPS
FT                   GSKTHDKPVDEFDLEGVVAPIHRGWVARSIGTLGGGNHFIEVNQGSDGIYLVIHSGSRV
FT                   LGKEIAEYHQEVAYKRLDILRKELKLDATAAKKRGNLEMANNLNGEREQVKLDYDLSYV
FT                   TGSDLNHYLNDMEIAQKFAARNRYIMAETILKAMKWNKAVVSAFDCVHNYIDIDNRMLR
FT                   KGATSAQLGEQIIVPLNMRDGSILATGKGNADWNYSAPHGAGRMLSRSKAKAQISLESY
FT                   QAAMKDVWTTSVSKKTIDEAPKAYKSAKQLLVDVEDTMDIQEIIKPLYNFKA"
FT   gene            269340..272894
FT                   /locus_tag="FORC68_0258"
FT   CDS_pept        269340..272894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0258"
FT                   /product="DNA-directed RNA polymerase beta component"
FT                   /db_xref="GOA:A0A0D8X3G9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X3G9"
FT                   /protein_id="QBZ17486.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
FT   gene            273065..276670
FT                   /locus_tag="FORC68_0259"
FT   CDS_pept        273065..276670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0259"
FT                   /product="DNA-directed RNA polymerase beta component"
FT                   /db_xref="GOA:A0A3H0R3N7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R3N7"
FT                   /protein_id="QBZ17487.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREKAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIAVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANREAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
FT   gene            276747..277292
FT                   /locus_tag="FORC68_0260"
FT   CDS_pept        276747..277292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2HDQ3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDQ3"
FT                   /protein_id="QBZ17488.1"
FT                   /translation="MITHVIWDMGETLNTVPNTRYDHYPLDTYPEVVLRNNAKETLEKV
FT                   KQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDF
FT                   TLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERQPLVAPPFVIPV
FT                   WDLADVPEALLLLNKVST"
FT   gene            277358..278818
FT                   /locus_tag="FORC68_0261"
FT   CDS_pept        277358..278818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0261"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="GOA:A0A3T2HDQ8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDQ8"
FT                   /protein_id="QBZ17489.1"
FT                   /translation="MTEVKKQFPKGFLWGGATAANQVEGAYDIDGKGLSTADMVKFIPK
FT                   EERTRDLELDVSKAEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAG
FT                   HHQFVASALATKLAHEIIPGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVH
FT                   ARGEYPSFMNRFFQENDIHIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETNGEDLD"
FT   gene            279188..280834
FT                   /locus_tag="FORC68_0262"
FT   CDS_pept        279188..280834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0262"
FT                   /product="Internalin C2, LPXTG motif"
FT                   /db_xref="GOA:A0A3T2HDN1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDN1"
FT                   /protein_id="QBZ17490.1"
FT                   /translation="MKKRWNSVFKLVLMVTAILSISLYVTTSQGAEVRAESITQPTPIN
FT                   VIFPDPALANAIKTATGKSNVTDTVTQADLDGIVTLSAFNTGVTTIEGIQYLNNLISLE
FT                   LKDNQITNLTPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGL
FT                   SNLQVLYLDLNQITDISPLAGLTNLQYLSIGNTQVSDLTPLANLSKLTNLRADDNKISD
FT                   ISPLAGLPNLIEVHLKDNQITDISPLANISNLFIVTLTNQTITNQPVYYQNNLVVPNVV
FT                   KGPSGAPIAPATISDNGTYASPNLTWNLTSFINNVSYTFNQSVTFKNTTVPFSGTVTQP
FT                   LTEAYTAVFDVDGKQTSMTVGANELIKEPTAPTKEGYTFTGWYDAKTGGNKWDFSTDKM
FT                   PAENITLYAQFTINSYTASFDNDGKITTQKVTYQSLLEEPAAPTKTGYTFKGWYDAKTG
FT                   GNKWDFATGKMPAGNITLYAQFTKNDSPNPNDPTPNTPTGNGDGTSNPSNSGGNTTLPT
FT                   AGDENTMLPIFIGVLLLGTATLILRKSIKVK"
FT   gene            281030..282736
FT                   /locus_tag="FORC68_0263"
FT   CDS_pept        281030..282736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0263"
FT                   /product="Internalin D, LPXTG motif"
FT                   /db_xref="GOA:A0A3T2HDP0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDP0"
FT                   /protein_id="QBZ17491.1"
FT                   /translation="MKRNKTALRILVTLAVVMAISFWVGTSSKEEVQAAVIAQPTPINE
FT                   IFTDENLANAIKATLNKPNTTSDVSQTELDSISEVTAESSNIASLEGTQYLNNLDTLVL
FT                   NNNKITTLNPLAGLTKLSILEASNNQLSDISVLSNVTNLHQLRLDGNQIKQLNGVSNLI
FT                   NLETIELSNNQITAISPVSGLKNLVGLGIDNNKISDLSPISGLSKLNHLTADSNQISDL
FT                   RPLSNLAAMEVMRLDGNQISDVTPIANLANLNYVFLAENQISDISSLQPLFNSPNFFGI
FT                   TLDNQKITSEPVLYQQELVVPNNIKDEMGALIAPATISDNGVYASPNINWNLPNYTNQV
FT                   SYTFNKQLAYGSFSGTVTQPLHNAYTATFDVDGVKTNEAVEETKLLQEPTAPTKEGYTF
FT                   TGWYDAKTGGIKWDFATDKMPAEDITLYAQFTINSYTATFDIDGKLTTQKVTYQSLLEE
FT                   PVAPTKDGYTFTGWYDAKTGGTKWDFATGKMPAGNITLYAQFTKNDNPNPDDPTTNTPT
FT                   GNGDGTSNPSNSGGNTTLPTAGDENTMLQIFIGVFLLGTATLILRKTIKVK"
FT   gene            282945..284444
FT                   /locus_tag="FORC68_0264"
FT   CDS_pept        282945..284444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0264"
FT                   /product="Internalin E, LPXTG motif"
FT                   /db_xref="GOA:A0A3T2HDP6"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDP6"
FT                   /protein_id="QBZ17492.1"
FT                   /translation="MKRNKTALRILVTLAVVLAITFWVGMSSKEVQAAVIEHPTPINEI
FT                   FTDPVLTDNVKTLLGKADVTDEVTQTDLDSVTHLSAKSAGITTIEGLQYLTNLSELELI
FT                   DNQVTDLNPLKNLTKITELRLSGNPLKDVSALAGLKNLKTMDLIYTDITDVTPLAGLSN
FT                   LQVLNLDINQITDITPLAGLSNLQFLSFGSTQVSDLTPLANLSKLTTLNAMNSKVSDVS
FT                   PLTGLSNLTEVYLEENQISDVSPLAKLPNLSIVTLTNQTITNQPVFYQNKPIVPNVVTG
FT                   LSGELIAPDTISDNGTYTSPNLTWDLNSFINSVSYTFNQSVTFKNTTAPFSGTVTQPLT
FT                   EVYAVVFDVDGEQTSAMVGVNELINEPTAPAKEGYIFDGWYDAKTDGNKWDFGIDKMPA
FT                   SDITLYAKFTENEEPNASSPINVEPNDNNSENAEPNASSSINVQENGTNEGINNLNSSG
FT                   EDKVNIKLPITGDELNVLPIFVGAVLIGIGLVLFRKKRQTK"
FT   gene            284580..285719
FT                   /locus_tag="FORC68_0265"
FT   CDS_pept        284580..285719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0265"
FT                   /product="Acetylornithine deacetylase"
FT                   /db_xref="GOA:A0A3T2I4T4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I4T4"
FT                   /protein_id="QBZ17493.1"
FT                   /translation="MDQQKKIQILKDLVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQ
FT                   YDVDRASLVSEIGSSNEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDM
FT                   KSGLAAMVIAMIELHEEKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGE
FT                   PSGHRIVYAHKGSINYTVKSTGKNAHSSMPEFGVNAIDNLILFYNEIEKYVASIHATNE
FT                   ILGDFIHNVTVINGGNQVNSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHV
FT                   KLELLFDYDKQPVFSDRNSSLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKQFP
FT                   VIIFGPGNETPHQVNENVSIGNYLEMVDVYKRIATEFLS"
FT   gene            285866..286282
FT                   /locus_tag="FORC68_0266"
FT   CDS_pept        285866..286282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0266"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="GOA:A0A1C7PY58"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PY58"
FT                   /protein_id="QBZ17494.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAAGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
FT   gene            286289..287248
FT                   /locus_tag="FORC68_0267"
FT   CDS_pept        286289..287248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0267"
FT                   /product="Glyoxalase family protein"
FT                   /db_xref="GOA:A0A3T2HDN4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDN4"
FT                   /protein_id="QBZ17495.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISGLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQITEVVSWEDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGNVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDIGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLEERREDILAHLKPLDTDK"
FT   gene            287320..287955
FT                   /locus_tag="FORC68_0268"
FT   CDS_pept        287320..287955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0268"
FT                   /product="Phosphoglycerate mutase family"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A461AIG7"
FT                   /protein_id="QBZ17496.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDMQIDAVYTSTSKRTQDTAAYILGDREIEIQPLEELKEMGFGTWEGIRVTEIDEKH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGVEKIIADNPNGNILVVSHGMSLTLL
FT                   LYLLQGGTIEDHRKEAPRILNTSISIVEYQNGEFSLKKINEIGHLDLK"
FT   gene            288039..289925
FT                   /locus_tag="FORC68_0269"
FT   CDS_pept        288039..289925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0269"
FT                   /product="Oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="GOA:A0A3T1NWP2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWP2"
FT                   /protein_id="QBZ17497.1"
FT                   /translation="MKRIVKIFLHYLLGILGIILISCVPAIFSKVTSWSSSTYWEALKS
FT                   IFTAIFHPTKWEISYQGSAEVFHVSLADFITGPYFYSMKIIVASLLISALIAYLLMIAT
FT                   FRGPKWLRRGLSGFLSILQAFPDFSFIFLIQMAVVYIYQQTGVFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMENEWQADYIQLARGKGLTDRAILLRHATPNMMQSLFYQ
FT                   SKTIVWFILSAYLVVEFLFGIEGVLYYLLAGFSPLNIFLVLALVFTPFYFFYALIDLWI
FT                   SRGKNTESANVTRIPLHWNSFQKTFTEKVNLKSKWRNFVVTTGQLLKRPSFSIPLVTLS
FT                   ILLIASLIYGLMGDKINSLKFISDATGRVTAMAPFKPNAQVWLGTDQAGNSILDQLLVG
FT                   IKYTLLIAVVIATLRVVIGYLLAVPLAFFSKPRTRNFVQSIADGMHYLPLSLLVFIIMV
FT                   NEFISYSGVFETSLFTRITFQILIMVVIVLPITTNRISSEISQVLKKEFVLSALVFGGN
FT                   ARWILTKHINPQIWSKLILIWIEQLIQTLQMFVHLAIFGIFIGGAIMGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPPLVVFMILILCFQMMANSLLKREEDSKKA"
FT   gene            complement(289939..290571)
FT                   /locus_tag="FORC68_0270"
FT   CDS_pept        complement(289939..290571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPR3"
FT                   /protein_id="QBZ17498.1"
FT                   /translation="MMANLQDRLARIQAKITALKEKDPDLNLFGSESHTYKLNQPLSNQ
FT                   TLTEFENEHQITLPQDYRAFLEQIGNGGMGPYYGLETLVDGLCASLDYKDKKYGVQTLS
FT                   EPFPHTDDWTAPGYKEGMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPS
FT                   YGEIWVDDRNNDNGVYPDFYFGNEERLGFLEWYELWLDKSIEEFEKA"
FT   gene            complement(290572..292008)
FT                   /locus_tag="FORC68_0271"
FT   CDS_pept        complement(290572..292008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0271"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="GOA:A0A0E0ZYE1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E0ZYE1"
FT                   /protein_id="QBZ17499.1"
FT                   /translation="MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIP
FT                   GTTFKGTNGDVAVDHYHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFY
FT                   DNLIDELLKYDIEPLVTLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVK
FT                   YWVSLNEQNIFVGMGYGQALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIG
FT                   PSFAYTPHYPIDTDPKNVQAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIE
FT                   DGDMELLASAKPDFMGVNYYQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKK
FT                   VVNPFVKTTNWDWTIDPKGLQIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRI
FT                   DYLSAHATAIRDAISDGVDMLGYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTR
FT                   IPKKSYYWYKQVIETNGADL"
FT   gene            complement(292128..292940)
FT                   /locus_tag="FORC68_0272"
FT   CDS_pept        complement(292128..292940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0272"
FT                   /product="Promiscuous sugar phosphatase YidA, haloacid
FT                   dehalogenase-like phosphatase family"
FT                   /db_xref="GOA:A0A3A2PS58"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2PS58"
FT                   /protein_id="QBZ17500.1"
FT                   /translation="MYKLIAIDIDGTLLTDDHKVTDEVKEAIRQAKLKGVKVVLCTGRP
FT                   LVGVENYLTELELREEGDYVISFNGAFVQDTFTKEVISHLTLGIDDLKEIYQVSLDSNL
FT                   HMHFFDDKALYTPNREIGKYTIVEAYLTGSQLIYKEIENVPEDFIMSKAMFIEEAPELE
FT                   VGIAKIPESFREKYHLVRSTPFYLEILNRDASKGNAVKELSEKLGIKQSEVICIGDQEN
FT                   DVTMLEFAGLGIAMGNAPERIKQLADYTTASNNDSGVAKAIQKFVLDK"
FT   gene            293040..293579
FT                   /locus_tag="FORC68_0273"
FT   CDS_pept        293040..293579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0273"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A4P7MDV9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MDV9"
FT                   /protein_id="QBZ17501.1"
FT                   /translation="MTWKLDKEKSEIMKRNYHVKFLNEKDVELAEAVCAASEDYYLIEQ
FT                   DKPASKSDALKIITEIPDGKTRFDKFVLAVLDENEKPIGLVDIVSDYPRKGRWFIGLLL
FT                   LTPDARHNGLGKVLHQTIKEWASDGGADSLALGVLAENEKGRGFFEYLGYTKEETKQAS
FT                   YGGKEQEVSIFTLAIK"
FT   gene            complement(293616..294278)
FT                   /locus_tag="FORC68_0274"
FT   CDS_pept        complement(293616..294278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I4U3"
FT                   /protein_id="QBZ17502.1"
FT                   /translation="MAYPFNHKEFVAMMEQYNLKSNSITIPEHTILNDLVTENRDCVYL
FT                   LKSGILAGYIDFDNDKIYSIFTSNFFMGYYTIFDNASLVLTYQTLTECELIIYKKKDIE
FT                   YSLSLFPENFSFQYTIMRTIAKHGYYKSLLQYRDKKDQLAFVFEMLVKILDIPVEDGVA
FT                   VLPKSISTTVIKNYCTLSKAFFYSQLKELKEAGIISKVKLQWRINMEALLEKNNSIN"
FT   gene            complement(294537..295379)
FT                   /locus_tag="FORC68_0275"
FT   CDS_pept        complement(294537..295379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0275"
FT                   /product="ComEC like protein"
FT                   /db_xref="GOA:A0A3A2PCV4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2PCV4"
FT                   /protein_id="QBZ17503.1"
FT                   /translation="MKKGILNVLLVFALIAGLSVPSSMQVEAAAPTIKVHFIDVGQGDA
FT                   IYIKAPSGEDILIDAGNKGKGKTVVNYLKKLKVKDIEIMIASHSDADNIGGLPEVMNNI
FT                   KVKNLYAPKSTNTTAAYKNFVNTAKKKKLTIKTAKAGVKLPVKGVNAQFVGPVKTYGKT
FT                   DRNNWSAVLHVAYKKNTFLFTGDAQTKAENDMIKAKKTLRADVLKVSTQGSKAATSKAF
FT                   VNVVKPKYAIISVGKNGYGHPTSQTVNTLKKAKAKVYRTDRNKTVVVTGNGSSYSIGK"
FT   gene            complement(295396..296217)
FT                   /locus_tag="FORC68_0276"
FT   CDS_pept        complement(295396..296217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0276"
FT                   /product="Haloacid dehalogenase-like hydrolase"
FT                   /db_xref="GOA:A0A3T2HDM3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDM3"
FT                   /protein_id="QBZ17504.1"
FT                   /translation="MTKKYLICSDIDGTLLRQDQTVSKKTRDLIQTLEKDGHIFSISTG
FT                   RMYRSAREVGFQVSNSGHVIASNGSYAAIRDEQLLKTTLEEKAIRSTYDIMSDFDLPLF
FT                   FFSTNTLFYTKEPPAFFQNLADKSRLDTGHNSFSLVSINEKGIFDENMHQFLNAIVVAE
FT                   EDASKLTEVRAALNEANGIRVLSSHHNNLEILPASSDKKTAVEALGKHYNIPRERIITF
FT                   GDGENDIGMLQYAGTGVAMANASDNVKAAANHLTDTNEADGVYKFLKEFIS"
FT   gene            296331..297305
FT                   /locus_tag="FORC68_0277"
FT   CDS_pept        296331..297305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0277"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEA5"
FT                   /protein_id="QBZ17505.1"
FT                   /translation="MMGNLNWAILGPGSIAHEFAEGMRGMNREIYAVGARSLEKGQAFA
FT                   SQYGIENVYDDFDKMLADPAIDVVYIATPHSNHYEFIMKSLHNGKHVLAEKAITVSSKE
FT                   LNEINVLAKEKGLIVKEAMTIFHMPLYKKLREIVDSGAIGKLKIIQVAFGSAKEKDPKN
FT                   RFYNMDLAGGALLDIGTYALSFARYFLSETPDEVLTTMKKFETGVDEQSGILLKNKEEE
FT                   LAVVSLSFRAKMPKRGVIACEEGFITVDEYPRASRATVTHTATGKVEEIEAGETSKALE
FT                   YEILAMEESVATGENTTYQLTNDVIAIMSDVRTQWGIKFPFEK"
FT   gene            complement(297344..298444)
FT                   /locus_tag="FORC68_0278"
FT   CDS_pept        complement(297344..298444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0278"
FT                   /product="Multiple sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="GOA:A0A3A7UCS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7UCS5"
FT                   /protein_id="QBZ17506.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDDIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKNIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
FT   gene            298735..300885
FT                   /locus_tag="FORC68_0279"
FT   CDS_pept        298735..300885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0279"
FT                   /product="Ribonucleotide reductase of class III
FT                   (anaerobic), large component"
FT                   /db_xref="GOA:A0A476T826"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A476T826"
FT                   /protein_id="QBZ17507.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKANFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDATEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGEDVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKE
FT                   AKNFTLDIVKELKAYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECDFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
FT   gene            300878..301429
FT                   /locus_tag="FORC68_0280"
FT   CDS_pept        300878..301429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0280"
FT                   /product="Ribonucleotide reductase of class III
FT                   (anaerobic), activating protein"
FT                   /db_xref="GOA:A0A2Z5C522"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C522"
FT                   /protein_id="QBZ17508.1"
FT                   /translation="MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLAAGEVVLYEL"
FT   gene            301572..301655
FT                   /locus_tag="FORC68_0281"
FT   CDS_pept        301572..301655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI71"
FT                   /protein_id="QBZ17509.1"
FT                   /translation="MVYNERHKNEDGIDTNKKYPSDFGLKK"
FT   gene            complement(301687..302358)
FT                   /locus_tag="FORC68_0282"
FT   CDS_pept        complement(301687..302358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0282"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWU2"
FT                   /protein_id="QBZ17510.1"
FT                   /translation="MDALFNYKEFVRLSHEGNIKYEKLKVPKHTDLVDTASQRNNHVYL
FT                   IVEGFVSISMNPQSNSIYTVLGKGSFVNYYSLFQGNVDDFLFTTISPCTIYKYSFKDLE
FT                   YFLSMFPENFGFQFFIMRDLARHAFFKSLFAETSSSDKLELSFSNMGKLHGTLYEKDSV
FT                   ILPKEMRTSTIAAYSNLSKSSFYKQLTLLKEHGKIWKKGKEWIVKDKGLYNYVKVRQFD
FT                   D"
FT   gene            complement(302520..303299)
FT                   /locus_tag="FORC68_0283"
FT   CDS_pept        complement(302520..303299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0283"
FT                   /product="Aliphatic amidase AmiE"
FT                   /db_xref="GOA:A0A3T1NWP7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWP7"
FT                   /protein_id="QBZ17511.1"
FT                   /translation="MWKLALCQTDVVFKYPDANYARIEKAIVEAAKNGADIAVLPEMWN
FT                   TGYALNELAGVADLNGERTKEFLATLSEKHQIAIIGGSVSISEGTKFSNTMYAFDKYGG
FT                   LLSSYKKVHLFQLMNEHLYLEAGNDKNLFRLDGVSCAGFICYDIRFPEWIRKHTSEGSE
FT                   VIFVSAQWPAERVTQWEQLLIARAIENQAFVVAVNRVGDDPNNHFNGHSLVIDPLGNIV
FT                   AHGGKDEGNIYAEIDLNLVAETRGIIPVFTDRRPELY"
FT   gene            complement(303389..304051)
FT                   /locus_tag="FORC68_0284"
FT   CDS_pept        complement(303389..304051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0284"
FT                   /product="Methionine ABC transporter permease protein"
FT                   /db_xref="GOA:A0A1U7ANY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7ANY6"
FT                   /protein_id="QBZ17512.1"
FT                   /translation="MSLFFEEWGPILWQGFLETLTMTGITLVISLAIGLPLGVFLTLTR
FT                   KGGQSENLVAYSILNWVINILRSLPFIILLFLMIPVTRFVVGTTIGIQGVIMPLVVFTA
FT                   PYIARLMESALLEVDRGVVEAYQAMGISTPKIIWSVVIREARSGIVLGLTIATIGLIGA
FT                   TAMAGLVGAGGLGTIAYQYGFQRFEPTVMYTTIIILIIMVQALQSFGNFLSRRLKKD"
FT   gene            complement(304048..305064)
FT                   /locus_tag="FORC68_0285"
FT   CDS_pept        complement(304048..305064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0285"
FT                   /product="Methionine ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A0A1C7PXT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXT5"
FT                   /protein_id="QBZ17513.1"
FT                   /translation="MIELHQVSKSFNVNGKTVEAVKNVSITVEKGEIFGVVGYSGAGKS
FT                   TLVRCINLLERPDAGQVVIDGKNLSTLSSKELRVARRKIGMIFQGYNLLKTATVYDNIA
FT                   KPLKLEGVPKNEIETRVNKYLSIVGLEDKRNNYPSQLSGGQKQRVAIARALAHEPEILL
FT                   SDEATSALDPETTEAILQLLLKINAELGITIFLITHELDVIQRICDRVAVMENGHLVEQ
FT                   GTVLDIFTKAKHATTKRFVGSEASFDIPQDLLEKYVATGKLVSLHFIGDEADEPALALV
FT                   SRKFDVLPSILAGGIDHLKNGTLGKLLVHLKGDEVEYSKAISYLKESGVVVEEVELL"
FT   gene            complement(305079..305900)
FT                   /locus_tag="FORC68_0286"
FT   CDS_pept        complement(305079..305900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0286"
FT                   /product="Methionine ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXT3"
FT                   /protein_id="QBZ17514.1"
FT                   /translation="MKKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGVIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
FT   gene            306283..307464
FT                   /locus_tag="FORC68_0287"
FT   CDS_pept        306283..307464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0287"
FT                   /product="Glutamine-dependent 2-keto-4-methylthiobutyrate
FT                   transaminase"
FT                   /db_xref="GOA:A0A3A7UPH2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7UPH2"
FT                   /protein_id="QBZ17515.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAEGHDVINLGQGNPDQPTP
FT                   KHIVEAMKTASEKPLNHKYSLFRGKQELKQAAADFYAREYNVTIDPNTEVAILFGTKTG
FT                   LVELPMCLMDPGDTMLLPDPGYPDYLSGVVLGEVQFEKMPLIAANNFLPDFTKIPEDIA
FT                   EKTELMYLNYPNNPTGAVATADFFEDTVAFAKNHNIVVAHDFAYGGIGFDGKKPISFLE
FT                   TNGAKEVGIELYTLSKTYNMAGWRVGFAVGNSEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALTGDQTCVRELTARYENRRDAFISACREIGWEAVAPAGSFFAWMPVPEDFTSSEFADY
FT                   LLEEVSVAVADGSGFGEFGEGYVRVGLLMDEERLEEAVTRVSKLHLFDKVTQQ"
FT   gene            307677..308390
FT                   /locus_tag="FORC68_0288"
FT   CDS_pept        307677..308390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0288"
FT                   /product="Two-component response regulator SA14-24"
FT                   /db_xref="GOA:A0A1D2IYV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYV7"
FT                   /protein_id="QBZ17516.1"
FT                   /translation="MAEKKILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEE
FT                   VQPDLILLDIMLPGRDGIEVCREVRKKYDMPIIMVTAKDSEIDKVIGLELGADDYVTKP
FT                   FSNRELIARVKANLRRHSQVSSSTAEEEENSELEIGSLIIHPDAYVASKRGETIELTHR
FT                   EFELLHYLAKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPAWLV
FT                   TRRGVGYYLRNPEQE"
FT   gene            308575..310407
FT                   /locus_tag="FORC68_0289"
FT   CDS_pept        308575..310407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0289"
FT                   /product="Two-component sensor kinase SA14-24"
FT                   /db_xref="GOA:A0A1D2IPI6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPI6"
FT                   /protein_id="QBZ17517.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDYSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGQV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIVEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTL
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKNKGTIIKFTLPYSDLPEDDWE"
FT   gene            310404..311726
FT                   /locus_tag="FORC68_0290"
FT   CDS_pept        310404..311726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0290"
FT                   /product="YycH protein"
FT                   /db_xref="GOA:A0A1T1FG49"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="InterPro:IPR042274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T1FG49"
FT                   /protein_id="QBZ17518.1"
FT                   /translation="MMKKTGFRSFILTILVVLSIVLSYFIWKGQPDYEAINVKEVEKTT
FT                   IDKTMTTSQVFKPYKLAVNANENNYQSLDADLLNELMAQGKAFSFSEVVLASKKSSEDY
FT                   EKLIHKNGTIEIIFPNNIPFSIFAQIFQVEGEGLESAFFNRIVFDINKTDTGLHSVYFT
FT                   NDDQENIYQSSLQNKDIDKIEKIVKKNESKLTQNDKLISNKRNLFLSSEKTKLNRKKYI
FT                   IDSLEINLFTSALFQDSGTVKSEGNTYTDGSSVIEMDTDNKVLEYVNPSQERTNPEDLS
FT                   SVKRAGLIQDSFNFVNDHAGWTGDGAYYFTGYAAESATTNFSLFIDNLQVYNENGMADI
FT                   SVTEGLEAVYKYMRPFFRLDTDVPGEKKEVTLPSSYSVYSALAQNPNVKAEEIEDIVPG
FT                   YHMTRSESSGMNRLVTLEPTWLYKYHDKWFIFQPDAEKAGE"
FT   gene            311729..312568
FT                   /locus_tag="FORC68_0291"
FT   CDS_pept        311729..312568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IZ05"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="InterPro:IPR042274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IZ05"
FT                   /protein_id="QBZ17519.1"
FT                   /translation="MDWRKTQMIFIVTLLILNVFLAVIFFNKQLSDDPDTLGNETLEER
FT                   LKADNISHPDLSTKPTSGSIFTTERAAFTTKDVSDLTGQAITLKDNNKQIYSVLQTPVK
FT                   AGKKGSNPEFQKFMESDVYRGESYQFWNYDKDARTLTFNQLINNNMVLFDEAGQITFYL
FT                   DQDDRVISYEQTWMSKQDDLKDKTNLMSATDALEAVYQHGELKQDSDVVSATFGYYTTV
FT                   QLPSGNVYFPVWCFEVKHSGETNYVLVNAKDEQVINQSENKSTTEPGAELSSRQKAK"
FT   gene            312688..313518
FT                   /locus_tag="FORC68_0292"
FT   CDS_pept        312688..313518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0292"
FT                   /product="Zn-dependent hydrolase YycJ/WalJ"
FT                   /db_xref="GOA:A0A3A6YIQ6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A6YIQ6"
FT                   /protein_id="QBZ17520.1"
FT                   /translation="MFANKILTEKDTDQIRFSILASGSSGNATLVETGDQKILIDCGLS
FT                   GKKMEGLFAQVGRDMNDLDAILITHEHSDHIKGLGVLARKYKLPIYANAKTWKAMDNMI
FT                   GEVSSDQKFQFDMETVKTFGSMQVESFGVSHDAIEPMFYIFHKGNKKFVMITDTGYVSD
FT                   RMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRRILGDEGHVSNEDAAIAMSEVITDQ
FT                   TKRIYLGHLSKDNNMKELARMSVTQTLMAEGIDVGGKLEIFDTDPDNATSIFTI"
FT   gene            313616..315118
FT                   /locus_tag="FORC68_0293"
FT   CDS_pept        313616..315118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0293"
FT                   /product="Serine protease, DegP/HtrA"
FT                   /db_xref="GOA:A0A3T2CTH1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CTH1"
FT                   /protein_id="QBZ17521.1"
FT                   /translation="MDEKEKNLNENSENESTPKREVEDTLHTPESAQPVQETPIVEGVT
FT                   PEGEKFAGATEDAAEASSTNAFFEEASNKESEPARPAPGPRRAGTTGGGAVPPNRVNNG
FT                   GSGNGNGEPPKRGKHYIGYFLTALIGVIIGGLIIFFVAWDNGDNADTTSNSNNKATKVE
FT                   KVSVDTTSDVTKAVDKVQDAVVSVLNYQSSSSLDGTTTSEQEASSGSGVIYKKANGKAY
FT                   IVTNNHVVADANKLEVTFTNGKKSEAKLLGTDEWNDLAVLEIDDKNVTTVAAFGDSDSL
FT                   KLGEPAIAIGSPLGTEFSGSVTQGIISGLNRAVPVDTNGDGTEDWEADVIQTDAAINPG
FT                   NSGGALINIEGQVIGINSMKISMENVEGISFAIPSNTVEPIIEQLETKGEVERPSLGVS
FT                   LRDVDTIPETQQKNILKLPDSVDYGAMVQQVVSGSAADKAGLKQYDVIVELNGQKVTNS
FT                   MTLRKILYGNDVKIGDKVKVKYYRDGKEKSTDIKLEAAKTTT"
FT   gene            315268..315381
FT                   /locus_tag="FORC68_0294"
FT   CDS_pept        315268..315381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MP91"
FT                   /protein_id="QBZ17522.1"
FT                   /translation="MDNLCVSSEYLVEKNNFDNLINKHRFIFEKNTFFAKI"
FT   gene            315793..316272
FT                   /locus_tag="FORC68_0295"
FT   CDS_pept        315793..316272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0295"
FT                   /product="LSU m3Psi1915 methyltransferase RlmH"
FT                   /db_xref="GOA:S5LMR4"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:S5LMR4"
FT                   /protein_id="QBZ17523.1"
FT                   /translation="MNIQIVTVGKLKEKYLVQGIAEYLKRLSAYAKVTIVEVPDEKAPE
FT                   VLSDAEMKQVKDKEGARILAKIPDDAHVIALAIDGKMKSSEEFAADLDKLATYGKSKVT
FT                   FVIGGSLGLSEAVLKRSNERISFGRLTLPHQLMRLVLVEQVYRAFRIVRGEPYHK"
FT   gene            complement(316304..317167)
FT                   /locus_tag="FORC68_0296"
FT   CDS_pept        complement(316304..317167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0296"
FT                   /product="Chromosome initiation inhibitor"
FT                   /db_xref="GOA:A0A475BJG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A475BJG2"
FT                   /protein_id="QBZ17524.1"
FT                   /translation="MDIENMKAFNKVAELKSISAAANELHHLQSNMSNKIKNIEKQFQT
FT                   QLFFRHSNGVELTKEGEKIYQQFKKMILLWEETIDIINNEEETISIGITQSSLPMEFNT
FT                   IIKKFYQQFPNKKLSIVSGSTSELIPKIANRELTIAYVAELEKENLFQDSQIISQTLSW
FT                   DKLVFAGNTAGKSVQKILAEERLYVFSKQCYSYRALATLINDFNIPNVSISEINIPETL
FT                   VEICNNELGIGIIPESIALNYHFLNYETLPTEYAALRKTLIYHADHTISNGEKWLIEKS
FT                   KPAFKS"
FT   gene            317286..318023
FT                   /locus_tag="FORC68_0297"
FT   CDS_pept        317286..318023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0297"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="GOA:A0A3T2I4X2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I4X2"
FT                   /protein_id="QBZ17525.1"
FT                   /translation="MNTTIQQLVKHVSVREFKNERLSDEIKQHLLTAARSASSSHFVQS
FT                   FSILEITDEKLRKELAEITNSASYVNQTGTFYVFVGDLYRQSKLLLENNRTLDGLRNME
FT                   SLLVSVIDATIAAQNMVIAAESLDLGICYIGGIRNDIGKVAELLYLPPFTIPVFGLTVG
FT                   VPEYKNQVKPRLLLENQVGENQYPHEQFTDLKAYEELTKDYYALREKNQHQTSWGDKNV
FT                   EFFEEIRRPEIASFLKKQGFTLD"
FT   gene            318234..318872
FT                   /locus_tag="FORC68_0298"
FT   CDS_pept        318234..318872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0298"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A473MRV4"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A473MRV4"
FT                   /protein_id="QBZ17526.1"
FT                   /translation="MKFLKKYGFYFLLLGVLSDFLTPYILGIFYPELNQMTRVMSVFGD
FT                   VASPVRGAFLVWSVVSGVFFVLALPAIYQSVVKTSRTLAILLASAIGLYGIGDCIFTGL
FT                   FSIDTEQASWTFSTWVHNIGSGLGYAGFLIFPLFLVILYRKTGDKTRSNVYLVLLIVSL
FT                   LSAGVYGLARIPAVNDLPVLDKIGFCQRISFFFNYLPIVVFGIDRIRKP"
FT   gene            complement(318878..320749)
FT                   /locus_tag="FORC68_0299"
FT   CDS_pept        complement(318878..320749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0299"
FT                   /product="Transcriptional antiterminator of lichenan
FT                   operon, BglG family, cellobiose-specific IIA component"
FT                   /db_xref="GOA:A0A473MRT1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A473MRT1"
FT                   /protein_id="QBZ17527.1"
FT                   /translation="MTISERQRSLLEKLNDSQKTVTAKALSEMLGVSSKTVRNDIMQIN
FT                   QSFSSTIIASKAGKGYFLMPNEQLSQMNLTKNNENLHFELLRHIIEQDYTNFYDLADQF
FT                   FISESTLARIIKELNIVIAEKDESLCIIRKNNELLTEGGEEEKRRIFNLFLNQEIENHQ
FT                   LSLDKYADYFDYCNLKQLSELIIAYHKKHEFFMNDFSTISFILHIAVLIERISMGSYIE
FT                   RTALLEQDKTSLEMAAHLAETLENELQINIPTQELSYIARLYSGKLTTTSTIDAQVFGS
FT                   VVTRLLEAVDQNFHIDFSADEKIATYLVAHISALYKRANHKQYLTNPLTEELKNKFPFI
FT                   YNVSVYASAFIQKELAITFPDDEIAYIALHFLSASETINHGKKRKILLVTPYGAGSQRL
FT                   IHNQLKKIPDFSIDLLVSQSIFDIKQFTLDKEIHLILTAEPLNLTTDIPVYHYDLLLAE
FT                   SDLQKIKHILETKQKTESISRKFFKKELFFPKQNFKSKEETITFLCEQLTAFDYCDPDY
FT                   VAKVFEREQLSSTCYGNYYAIPHAIQRSAKKNAVAVCSLDKPIDWGGNRVKLVLLLTMK
FT                   EERDNSFEELFGQLVTILNERSFVKKLAKQEDFQQFIELCEQKTLDS"
FT   gene            complement(320848..322161)
FT                   /locus_tag="FORC68_0300"
FT   CDS_pept        complement(320848..322161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0300"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="GOA:A0A0D8X3K4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X3K4"
FT                   /protein_id="QBZ17528.1"
FT                   /translation="MRFNTISEKMDQYISPLANKLSQQRHLKATRDAFMSMLPITLFGS
FT                   IPIILKAAPVTDDTKNGFLLAWANFAEKYDLILNWISGITLGAMSLYICVGITYYLCKH
FT                   YHEDFLRPLMFSIAGFFMLVLNPIKMGWDGKEVDISFLDGRGILLSIFVAIVTVEGYHW
FT                   MRKKNVGRITMPDSVPASLSETFAALVPGIILMTFFSIIFIIFNLLDTTAIQFLYEKMA
FT                   PSFKAADSLPFTILSIFLVHLFWFFGVHDAALAGILGPIRDGNLSINAAEKMAGQDLTN
FT                   IFTTPFWTYFVIIGGSGSVLALAFLMMRSKSKQLSTVGKVGFLPSIFGISEPLIFGTPL
FT                   MLNPIFFFPFIFTSVFNGVITYLCMYFGIVGKTFAVFSWQMPAPIGAFLSTMDWRAIVL
FT                   VFILIFLNGLMYYPFLKVYEKNLVALEKEAEEENIAAN"
FT   gene            complement(322166..322456)
FT                   /locus_tag="FORC68_0301"
FT   CDS_pept        complement(322166..322456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0301"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /db_xref="GOA:C6ZVG3"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6ZVG3"
FT                   /protein_id="QBZ17529.1"
FT                   /translation="MKNIMLVCNAGMSTGMLAKKIEAASGNTLNVTAYSESEYTDYLDG
FT                   VDLVLIGPQIRFLMPQIKQAVSVPVHAISPVKYGIMDGKGVYEDIQKLIGG"
FT   gene            complement(322473..323864)
FT                   /locus_tag="FORC68_0302"
FT   CDS_pept        complement(322473..323864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0302"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="GOA:A0A3T2HDI9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDI9"
FT                   /protein_id="QBZ17530.1"
FT                   /translation="MNNNFLWGGATASYQCEGAWNVDGKAESMWDYYLHEAGLENGDVA
FT                   SDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDI
FT                   EPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKIMNWTTFNEPKWFVA
FT                   NGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKKGGYPGQIGIVHSYTPVNGVDE
FT                   SIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVD
FT                   FIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIY
FT                   PKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVPQVDDAYRIAFMNDHINAIFNAIDA
FT                   GCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLI
FT                   KRREF"
FT   gene            complement(323857..324198)
FT                   /locus_tag="FORC68_0303"
FT   CDS_pept        complement(323857..324198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0303"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /db_xref="GOA:A0A1T1FG65"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T1FG65"
FT                   /protein_id="QBZ17531.1"
FT                   /translation="MTDSNELTTELDSMAIILHAGNAKSCAFEALKEVKLQNIEAFTQK
FT                   ITEAKDEIKLAHRAHAELLRKLSSENRMREVDLLLVHAEGHLSSTDIAVEMIRELGEIY
FT                   QWKWSLSNE"
FT   gene            324263..324367
FT                   /locus_tag="FORC68_0304"
FT   CDS_pept        324263..324367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MP98"
FT                   /protein_id="QBZ17532.1"
FT                   /translation="MPLWKWKLVLIDFYFIRLNKINFLGEVKMAFLKK"
FT   gene            324493..324792
FT                   /locus_tag="FORC68_0305"
FT   CDS_pept        324493..324792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2NKA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2NKA3"
FT                   /protein_id="QBZ17533.1"
FT                   /translation="MGDGVWEAVYTFVTAIYQSVVKTSRRLMSLLATAIGDCELFSVIT
FT                   EQASWTFSKGVHNNGLGNVEFLIFLLFLVILHRKTGNKTLNNVYLVLKSAKCFI"
FT   gene            complement(324831..326498)
FT                   /locus_tag="FORC68_0306"
FT   CDS_pept        complement(324831..326498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0306"
FT                   /product="Type II restriction enzyme Sau3AI"
FT                   /db_xref="GOA:A0A3T1NWR7"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWR7"
FT                   /protein_id="QBZ17534.1"
FT                   /translation="MKRIYDTKEKVHNRALEAIGKTLGEIDENNLKNVNNKSYPGNVIE
FT                   QIWYDHPADNISEPDFKEAGVELKVTPIDKQSKGNKDKKVTRLIAGERLVLNKIHYKNE
FT                   YKKSFEESSFWHKNKVIELIQYYRRDTSDKKKFSRKELIEDKKQFKIAYATLLSMVDLT
FT                   DFNLPKDTVLEISDKDFEIIKQDWEKISKLINESKAEELSEGMTNYLGACTKAATGAEF
FT                   TTQVGSEIKPKPRAYSFKTKFINELINTQIIGNDHSAAINSIVKDANELKNNSLEEIII
FT                   SRFLPFYPTNKKVWSQQDLIENFKIKTNRKSQKNLNNMIIRRILNLPTSKAEVTSEEIK
FT                   KAEIRLKTITLRDGKPKEHFKFQNIPSFESLVSENWEESSVADFLDRTKFLLLVFNDLN
FT                   DKHPGKNTYETNPEKIFFVGAKFWNMPASDIYGPCKAVWESDVDKLKKGVELTYTKDSS
FT                   GKVKILNNFIKPSLENVLHLRPGASKSQYNAPYYKTIIENGKEKKKYMNNSSKLPCNSK
FT                   WINRPESEKDIYTDNYMVKQAWWLSKDYIFAQIKDLLR"
FT   gene            326626..326832
FT                   /locus_tag="FORC68_0307"
FT   CDS_pept        326626..326832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0307"
FT                   /product="transcriptional regulator"
FT                   /db_xref="GOA:A0A3T2HDI5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDI5"
FT                   /protein_id="QBZ17535.1"
FT                   /translation="MIRLRINEILKEREMSQKALCELSGLRPTTVSEMCRGVRTTVNLQ
FT                   HLETLIDALEIKDFNQILKRDKV"
FT   gene            326829..328244
FT                   /locus_tag="FORC68_0308"
FT   CDS_pept        326829..328244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0308"
FT                   /product="5-methylcytosine methyltransferase"
FT                   /db_xref="GOA:A0A4P7MEW2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEW2"
FT                   /protein_id="QBZ17536.1"
FT                   /translation="MTMSLNIFSMFDGVGGFIVGLNDANEAIEKEMFRTTYSNQFEPSK
FT                   KAQDAYEVGVYRFPEMNHIPDDIMTVSDNKFQEMHDAGVNMIVGGFPCQDYSVARSLKD
FT                   EQGIAGKKGVLFWEIIRAIKKIQPKYLILENVDRLLKSPSTQRGRDFAIMLGAFNKLGY
FT                   SVEWRVINAAEYGRAQRRRRVFFFVYRNDTKWAKRIDEKYENDKLEEGLLEDIVIASNR
FT                   YDNYIFQEGLFARQFPIENKIKYDGKRPRHASHFLGKDADYDDYILNISDNFTGTVWNT
FT                   GIMRHGRYFTADTTPIEEPPISLGTIVEKAKQSFIGQYDNLDLGIKEYNFYIEQYVISD
FT                   EIKIEKFKTLRGSKKIPRKRPDGSEYFYAEGAMSPYDSFDLPARTMLTSEASVNRSTHL
FT                   LFENNKYRLITPIEAELLQDFPINWTKYKMNEETNEVSEVSDRMRYFFMGNALVTGIVK
FT                   RIGIELAKIESHE"
FT   gene            328494..329348
FT                   /locus_tag="FORC68_0309"
FT   CDS_pept        328494..329348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0309"
FT                   /product="Glycerate kinase"
FT                   /db_xref="GOA:Q4ZJH6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZJH6"
FT                   /protein_id="QBZ17537.1"
FT                   /translation="MYNFRVISANEDIFIKTKYRFISELEDFKEFAQTLTDDAGKAKVK
FT                   SGKASSYTRYLIRLIIFYCETHRDNLEELSSFEAVKKLEKIRLDESFKAFNQESNRFYS
FT                   ATLSCYLAYVTFKNSDAEEIIDNQIISGLNNFENQAQVVKENKSTYLVRVPKSRASKRK
FT                   NNNVYSYPRNYVEAIEARRRCGWICEFNQEHKTFINIKDGKPYVEGHHLIPMAVQDYYD
FT                   NTIDFADNIICLCPTCHRKIHYAVQSEKKEMLIKIFNEREKFYLQHGIEIDRKTLLSFY
FT                   GIF"
FT   gene            329569..330123
FT                   /locus_tag="FORC68_0310"
FT   CDS_pept        329569..330123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0310"
FT                   /product="lipoprotein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDJ2"
FT                   /protein_id="QBZ17538.1"
FT                   /translation="MSKKLVSIIFLGICLLLVGCGKEVVDSKYTGKWKLESSGIGMSDG
FT                   SNYKETDAAGKVSLDLDIDAEGNVKELYIDDAVAITNSYKLKKKGDDEYQYDGTLISKK
FT                   VYSYETESDKENVETMLKFLKSKDNVKITKNEQKGDEYHIEVKADEKDFVFSLEMQSGK
FT                   LIFKKVDTKEKVLIKETYKKN"
FT   gene            330314..331390
FT                   /locus_tag="FORC68_0311"
FT   CDS_pept        330314..331390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0311"
FT                   /product="L-allo-threonine aldolase"
FT                   /db_xref="GOA:A0A3T2HDK2"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDK2"
FT                   /protein_id="QBZ17539.1"
FT                   /translation="MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGN
FT                   GAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQ
FT                   DGLKELQQITPLLLGTANRLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEEIS
FT                   EYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDD
FT                   FVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAGRFNSCPGVKT
FT                   VPEVPVSNMFHVYFEKSADEVGAILTKIQDETGVGISGYLQGKSADVCAFEVSVGDAFV
FT                   EIPAKNLELVFRCLEKEL"
FT   gene            complement(331478..331837)
FT                   /locus_tag="FORC68_0312"
FT   CDS_pept        complement(331478..331837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MHK1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHK1"
FT                   /protein_id="QBZ17540.1"
FT                   /translation="MSKRTKVIILVIVTGLFILVRLLFIKHQENRALFNEQKEKVTLYL
FT                   KHNIPDFKTVTFTNEEFNPIGISIDGYINTDKNLSFTAGKDVKIFSCSDELDKMFKEPR
FT                   KGYDEILSGLKSYED"
FT   gene            331970..332755
FT                   /locus_tag="FORC68_0313"
FT   CDS_pept        331970..332755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0313"
FT                   /product="Cellobiose phosphotransferase system YdjC-like
FT                   protein"
FT                   /db_xref="GOA:A0A3T2HDH8"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDH8"
FT                   /protein_id="QBZ17541.1"
FT                   /translation="MPKLIIDADDFGLSKAINHGIIESYKTGITTSTLLMPNLETAEHA
FT                   ITLAKDHPDLFIGQHTNFLLGKPCADPAEIPSLVDENGEFYRSKYYRSNPELKFQYEDV
FT                   RTETIAQMERFKALTGHYPEHIDCHSIGDETVDQAFFDIAHEFGIHTTLKYSGDKKWSD
FT                   QEGYLPITKLLESGALPYTNGGVSVENFLNDDFGLLKLAPNEIAEMHFDVGFLDQFVLD
FT                   NSSYTLMRCRELATICDVRVRDWLLENGFELITFGDLQR"
FT   gene            332978..333652
FT                   /locus_tag="FORC68_0314"
FT   CDS_pept        332978..333652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0314"
FT                   /product="Thiaminase II"
FT                   /db_xref="GOA:A0A3T1NWR6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWR6"
FT                   /protein_id="QBZ17542.1"
FT                   /translation="MFVHGFQEEVGDLWQETLRHPFVRSLADGTLEKEAFHFYLLQDDY
FT                   YLSHFEKVIEKSVEQAGTAELAAEMREVQVRLRQSELLMRKQFYPRVGLTQRDFSERKP
FT                   APTAYHYTSHLYRMADFGSFGVTIAALLPCYALYADMGKMYEGARSSEPFYQELLESYV
FT                   DGNYQQVVLQQKRLVEQAASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVN
FT                   YV"
FT   gene            333645..334454
FT                   /locus_tag="FORC68_0315"
FT   CDS_pept        333645..334454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0315"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /db_xref="GOA:A0A3T2HDJ6"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDJ6"
FT                   /protein_id="QBZ17543.1"
FT                   /translation="MFDFMTLEKVQERGPLVHNITNIVVANDSANGLLAIGASPIMASA
FT                   KEEMAELAKMADVLVINIGTLDGELVEAMKIAGRAANVAGTPVVLDPVGVGATSYRRKV
FT                   VQELLAEIQFAAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLSIAGKVANEWSTVVII
FT                   SGEVDVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFIAVQDDAFRASVEACASYA
FT                   VASEYAEIELERKLPGSFRPLFLDALASWSVEKTHAKAKIQESGEHK"
FT   gene            334451..335254
FT                   /locus_tag="FORC68_0316"
FT   CDS_pept        334451..335254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0316"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /db_xref="GOA:A0A3T2HDM8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDM8"
FT                   /protein_id="QBZ17544.1"
FT                   /translation="MIFPQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIRLHNFPNIVI
FT                   DPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDLGVKAVVIKGGHSEMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVVVAKEFITSAIKYPLGIGHGHGPTNHFAYRMEDGK"
FT   gene            335251..335895
FT                   /locus_tag="FORC68_0317"
FT   CDS_pept        335251..335895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0317"
FT                   /product="Thiamin-phosphate pyrophosphorylase"
FT                   /db_xref="GOA:A0A3T1NWN2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWN2"
FT                   /protein_id="QBZ17545.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPGVLEEALKAGITCFQYREKGAGS
FT                   LQTASERKEMALKCQQLCAKYQVPFIINDEVALALEIGADGIHVGQNDEEIRQVIASCA
FT                   GKMKIGLSVHSVSEAVEAERLGSVDYIGVGPIFPTISKADAEPVSGTAILEEIRRAGIK
FT                   LPIVGIGGINETNSAEVLTAGADGVSVISAITQSDDCHSVIKQLKNPGSPS"
FT   gene            complement(335921..337336)
FT                   /locus_tag="FORC68_0318"
FT   CDS_pept        complement(335921..337336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0318"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="GOA:A0A3T2HDI0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDI0"
FT                   /protein_id="QBZ17546.1"
FT                   /translation="MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFG
FT                   HITDGPTPDNLKLEGIDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAG
FT                   LQFYDDLFDELLAHNIEPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYK
FT                   GKVKYWLTFNEINSILHAPFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIM
FT                   PEAQIGCMVLAMPTYPLTSNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNI
FT                   ELDVTEEDLEILKNTVDFISFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGW
FT                   QIDPKGLRVVLNEFWDRYQKPLFIVENGLGAIDQLEQDENGNYTVNDDYRINYLSAHLS
FT                   QVKEAIKDGVDLMGYTSWGCIDLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFD
FT                   WYKNVIATNGEDL"
FT   gene            complement(337550..338749)
FT                   /locus_tag="FORC68_0319"
FT   CDS_pept        complement(337550..338749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0319"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A3T2HDH3"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDH3"
FT                   /protein_id="QBZ17547.1"
FT                   /translation="MNKYFKNLATILFTVSVLTTSIIASPAMASAYEESHNVSTIYTSP
FT                   LDTPHVGDTKITGKTTPLSSFSIAIYTSEGRLTGTFFGTTNTDGTYSVDLSDFTVYHPS
FT                   GYVTTGKVIYEENSFVRSGTETGGDKVIKVTVSYDYIQTAINELFLNNNPTGTILTITD
FT                   QNAINAVQEQINTVTSSEKESFQEQLNNAQQQLDARIAQEQAAIQAVNQLFLEDSPVNS
FT                   IKAETTQDLIDQAQTLVDVLPASELKDTLQANIVKAQTELDERSKPVTPPKNDPEPDNP
FT                   EEPVTPVDPATPIPDEPSTPTDPATPEKPEITTPENPESTVVEADSSENEPEKSADSKI
FT                   VNNPIQITSQTTKTATKQAKSSATKTTLPLPKAGDTETTSSILFGTLMLSSLVLFKRKK
FT                   "
FT   gene            339077..339736
FT                   /locus_tag="FORC68_0320"
FT   CDS_pept        339077..339736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0320"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A3A2WGL6"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2WGL6"
FT                   /protein_id="QBZ17548.1"
FT                   /translation="MGSAFSAILSPAVGILISPFPIVGLILILLSNKARINSIFYTVGW
FT                   IVGNIAIFFIGLFLMSSAVSSSGDQSTLVKVVLIVLGALLILLGAHDFTKRPKNGEKAA
FT                   TPKWFEKMSNIKPGGAMIFAFVLSAVNPKNMLLSLTAGVSVGALNLSGGQETTATIIFG
FT                   IIACCSIYVPTIAFLLAGSKLNNVLDSTRKWLIQNNSVIMAVLFLFIGLSVISKAF"
FT   gene            339920..340312
FT                   /locus_tag="FORC68_0321"
FT   CDS_pept        339920..340312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T1FG61"
FT                   /protein_id="QBZ17549.1"
FT                   /translation="MFDKLMGKAAIVTESSYGIERFLDEDEQIIQIFKFIRDEVIITSK
FT                   GIFNIDAQGITGKKVEYKFFPKKALKYVSIETAGTLDRDFDLKIGVDGNTVVTQNTSFS
FT                   APISLKVHKNDTEMGFALYKMIKGML"
FT   gene            complement(340358..341128)
FT                   /locus_tag="FORC68_0322"
FT   CDS_pept        complement(340358..341128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0322"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="GOA:A0A3T1NWP1"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWP1"
FT                   /protein_id="QBZ17550.1"
FT                   /translation="MFSVTTFNIRFDDTSERKKSWELRKTLTKSLLDKYQWDFMGVEEP
FT                   LLPQMRDMKEMQDWDYFGVGRDDGFEKGEFTAVFYNSTRFTLLQEGHFWLSETPDVPSI
FT                   HSTAMFPRICVWGKFADSDGKQFYIFNTHLDHISEEARLFASQLLLKKAATIAENSPVI
FT                   ILGDFNTEPDTPTYNFITKKYQDAQLISQKRAKGPIGSFHDFRPLRPINELEKIDYIFV
FT                   SKEFQVCTYETIVDEVDGFSASDHFPVTANLDWK"
FT   gene            341283..341765
FT                   /locus_tag="FORC68_0323"
FT   CDS_pept        341283..341765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7ME10"
FT                   /protein_id="QBZ17551.1"
FT                   /translation="MLRKSRWLLILLLLIVLVALSACEDSGNGDISGVPAKREKQHFPP
FT                   NDTKKGWIELLATDGISSQGDLPCVYEEAESVEKLEIHMKELSTASLTYIYIDGYIVQM
FT                   EQGGNELSFQIQLSKTELRKGIHELAVVQYQENNPETKKVEFLKRAKYEVKQIKND"
FT   gene            342026..342928
FT                   /locus_tag="FORC68_0324"
FT   CDS_pept        342026..342928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0324"
FT                   /product="Transcriptional regulator, MutR family"
FT                   /db_xref="GOA:A0A477M0B1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A477M0B1"
FT                   /protein_id="QBZ17552.1"
FT                   /translation="MGSYGELIREIRLSKGLTQKEVYTGIISRSYAIGFEKGKHEITLS
FT                   LFEEILKRIMVPLDEFFFIYRDFSSTEDDSFWIDFVELSGKNDVVGMQALLDKITLERT
FT                   EQTEVRKAILHTRIQTINHYLRTNVFDESNISDEYKKIIHDYLWKMQTWTLEEVRIFSN
FT                   GISFFEEEVQIHFYQIMLKSYEKYRYYDRGRLLFCHLFANLTDELIIQNKINYANLVLE
FT                   KLKEASETSGSFNSAFYRIVANYYQGAIWMKEGKVEKGYHQAKRAIQTWKELHYGAIAD
FT                   LYSVVLKQFLEKENIQVED"
FT   gene            343091..343963
FT                   /locus_tag="FORC68_0325"
FT   CDS_pept        343091..343963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0325"
FT                   /product="transcriptional activator"
FT                   /db_xref="GOA:A0A3T1NWQ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWQ4"
FT                   /protein_id="QBZ17553.1"
FT                   /translation="MISYGELIRQIRQSKKISQKEVYTGVISKSYAIEFEKGTHAISSL
FT                   LLEKIVAKLMVSMEEFFLMYHQEELPEKEDFWETYARTCKTNEASAWESLYQKISLEKG
FT                   KVNQVKSAAIKLELDHIKGKQVADKKAVQILENYLIEAVFWTLQDIFLFTRMMHYLPLK
FT                   SRVPFYYKLLNTLDRYRHFERGRSILQSALASIMDDFIERNEIEHMELMIKSLEKISED
FT                   CDGTYFKILCMYYRGIVRWGEGEKREGSEEIEQVVAILRALGYENKAAEYETMYRQFAR
FT                   ENNDIKTME"
FT   gene            344270..348211
FT                   /locus_tag="FORC68_0326"
FT   CDS_pept        344270..348211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0326"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A4P7MLI1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MLI1"
FT                   /protein_id="QBZ17554.1"
FT                   /translation="MNSNEPFIQEIEHATGKTRANITQTDLEAITTLQVRGASDIPTNI
FT                   DMLTHLTKLDLAQGTLSAVSNSVGNLKELKILNLNTNHLSTFPTIVFQLPKLEELLLND
FT                   GTIEEIPATITNMASHLKFLSVNNNHLVKVPTAIFTTNWSNSTTGELDLFSTGNQIVTD
FT                   IPANYVSNFNNGQNMLEFYDGQFQKQDQLTTTAGYTIDVPVGTDFNQLTPDKTKLALTS
FT                   GRTLLAQHEFEYYDDGSSSLIHNGVAAAPGQATIFIKSKFSTQSNKFARTQVTVNITAL
FT                   NGGPITVKHEDTKGQELAPPVILNGKDGDPYTTTQKTFPGYTLVATPANQNGTFTMNPA
FT                   TVNYVYSANDYKLTSTFKDAQGQELKAPVVDTKDYHIQDNYTTTAATIPGYSLVSTPAN
FT                   QNGTFGAGNVTVNYVYKKDDYTLTSTYKDTNGQELKAPVVDATTYHYQDTYTTTAAVFP
FT                   GYTLVATPTNATGTFGSSNITVNYVYQANGYQLTSTFKDQQGKTIAPDDVDAKTYHVND
FT                   PYTTTAKTIPGYTLVTTPANDQGNFGTSDITVDYVYKAEDYTLTSTYKDAQGKELKPPV
FT                   VDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLTSTYKD
FT                   AQGTELKPPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAV
FT                   AYKLTSTYKDQQGNDLALPKVDSKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASD
FT                   VTVNYVYKANDYTLTSTYKDAQGKELKTPVIDSQKYHINDTYTTTGATIPGYTLVAAPA
FT                   NQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKAPVVDSKTYHTKDNYSTSAATI
FT                   PGYTLVAAPANQTGTFNTSNVTVNYVYKANEYTLTATFKNVQGTELKPAIVKKGFIIKD
FT                   GYATSGVTIPGYTLVATPSNKKGTFGASNVTVNYVYKANGYALITTYKDTQGKDLKPLA
FT                   IDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLTTTYKD
FT                   ANGKELQAPKVDAKTYHIQDTYKTTAAVIPGYTLVATPKNDQGTFGANNVTVNYVYQTN
FT                   DYTLTSTFKDAQGNKLKAAEIDAQKYHIHDTYTTKAAVIPGYTLEKTPTNETGTFNASD
FT                   IQVNYVYKANGYQLTSTFKDQQGNEIALPTVDAKTYHIHDAYTTKARLIPGYSLVAAPK
FT                   NQIGAFGTSDVTVNYVYKKDAIIKPITPAKPTILTIKTPASKVIKTKVVKQTLPKTGDD
FT                   DAGLLNLLRLIGLVLILGVFLAVGSKKLR"
FT   gene            348349..349032
FT                   /locus_tag="FORC68_0327"
FT   CDS_pept        348349..349032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2KM12"
FT                   /protein_id="QBZ17555.1"
FT                   /translation="MLEKKYQIHLQNHYDATSRQVQKKEIKVLKKRRNLLIGEVFPYQI
FT                   CLESTMEYSRFMLWFEKEVQKIVKELWNQHFIIKLTLSQLHFRETILFLEHLKDFSKRI
FT                   TIEFIGEGTPEIKKHFSVQEQEAFFIGKLRMLKKWKFIISKHIEGCSVEQTLAFTPCLH
FT                   EIKYTMSQQARMEENIIDLHIFIDFWEYWASHKKLKFVIEVLKEDFITKSLMYKNKQIK
FT                   FINVQ"
FT   gene            349089..350594
FT                   /locus_tag="FORC68_0328"
FT   CDS_pept        349089..350594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0328"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T1NWI7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWI7"
FT                   /protein_id="QBZ17556.1"
FT                   /translation="MNKKRSLFFKSILTAMLFIIATTWISSNHGIKVQAASINHPTSIK
FT                   QIFPDTILAEVMKNALGKSDVQDVVSQADLDQVTSIIGTSEGIRSLEGIEYLPNLTQVY
FT                   LEDNNLSDISLLGGLVNLTDVYLDANPLSDISSLAKLKNLTNLYVSDCQVKDISALVSL
FT                   SKLESLTADNNQISDVRALKGLTNLTTLVLYNNQIEDISALGNLRNIVQLELENQVGIN
FT                   NAINYQSQITIVNKVKDVTGALIIPSTISHNGVYQNQNITWSLNHYSKDVTYTFQKQVK
FT                   IGVSTATFSGTIHQPLKAVPSYNGITYQLITTYKDEKGKELSTSKVGSKKYQANDVYSA
FT                   SPKNIPGYSLVAFPSNQAGKFGQSNIIVNYIYKANNYQLTSTFKDEKGKEISASVIDNR
FT                   KYNINDMYSTKKVTIPGYSLIAIPRNQNGFFGTNNITVNYVYKKDSFSEKYSKEDKNMS
FT                   PKVKLKKILPKTGDNGDSLNVMVGLLLILSTICINKVCHKPSK"
FT   gene            350978..351595
FT                   /locus_tag="FORC68_0329"
FT   CDS_pept        350978..351595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0329"
FT                   /product="Recombinase"
FT                   /db_xref="GOA:A0A3T1RVW1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1RVW1"
FT                   /protein_id="QBZ17557.1"
FT                   /translation="MKVAYARVSSTDQNLDRQIEAFKNHGAEKIFVEKKSGADMIHREE
FT                   FNKALAFVREGDFLMVEAIDRLGRNYQEVIQTVNVLKEKKIGLMVTSVPLLSEPLGDPL
FT                   LDRFVKDLLLQLLAMIAEREREESKRRQAQGIAIAKEKGVYKGRPLLYSPNAKDPQKQA
FT                   VYYQIVRMLEEGMAIKTIAEKNRVTRPTVYRIKKDLYNIEET"
FT   gene            352606..353658
FT                   /locus_tag="FORC68_0330"
FT   CDS_pept        352606..353658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPX0"
FT                   /protein_id="QBZ17558.1"
FT                   /translation="MLVREVIDISTVVTFPIGVRSNRVKPGLLITPIIADYIAREFQIP
FT                   SVIALNVLDSYEKRFEYIKPYLKILKEMDIEFNRIWIDEENKNQLTNNLHILYKKQILK
FT                   KKMNMVYSCDCGKVQFVESAFKNIHKGARLYEVKDTEVICNSCNSSCDKVEQEVLTISF
FT                   SKETIKKEIFPKLMVKEVKELDNRLTSMEYLVSRNRDTGIIFTIEGKKFNIDVDFFWLG
FT                   YLNQFSDNHYILVGSNHVTWHLCLASRVVQSLNPETKITLVLTPYVYNKNNVDENSIPL
FT                   KKEIFKWIVYSHITWKKQDTNWNQSLISQISRIEQLKSMCKHEKYHYSYEKLENSLSFL
FT                   NANNCLKKMK"
FT   gene            353669..354091
FT                   /locus_tag="FORC68_0331"
FT   CDS_pept        353669..354091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2AAP6"
FT                   /protein_id="QBZ17559.1"
FT                   /translation="MLLKTMNNKLVRDNSHKWGEFLEVPVTERFIMRSIRIFDGGKSSI
FT                   HRHETTELLTVESGTIICLKGFDEANLIEYILNEGDTIFIDAFEWHRIEYVKGEFKEEN
FT                   VSFAQIVELMFGDNKNGDYFIDRFKDAKPSKKWLSR"
FT   gene            354088..354702
FT                   /locus_tag="FORC68_0332"
FT   CDS_pept        354088..354702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0332"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="GOA:A0A3T2HDG9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDG9"
FT                   /protein_id="QBZ17560.1"
FT                   /translation="MTKIYLIRHGESQANYDNKNNHAYFSGQLDSPLTAKGINSAKKLR
FT                   DYFNNIEMNIIYSSDSIRARETCKHGFSSDTPLIISKLLRERSLGDFEGKRIEDVKKDQ
FT                   RYIKFFNDSNFTEFRHSFYQKAPFGENYLDVYKRIQIFFNQIFLNENHSSVIIAHQTTI
FT                   RCCLLYLREISKEEVFNLRIPNCEPIVVDIKKGVIYERCIE"
FT   gene            354683..355309
FT                   /locus_tag="FORC68_0333"
FT   CDS_pept        354683..355309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NWK5"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWK5"
FT                   /protein_id="QBZ17561.1"
FT                   /translation="MRDVLNDIVNYIVKEKCNLIRICGNGAGGKSYLTSILIKSLQENG
FT                   ICTNYLCTDDYLLDAYIRKNINSEVTNRRITANNPKSYFYPALKRDISMLKKHFTLITI
FT                   YQGKLLDCDYRSISFIDGLGTAFLEKELFDLSIFIYSDKDTELEMRLQRDFEVRNIEKS
FT                   KIMDDFENRREEFEKIIQPLKTNFDVILRNEINQIILEKVPGKME"
FT   gene            355315..356055
FT                   /locus_tag="FORC68_0334"
FT   CDS_pept        355315..356055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPC1"
FT                   /protein_id="QBZ17562.1"
FT                   /translation="MDLRQRVSDSIRCFIENSDNCNIVSVYGIGSLAKDKAKINDIDLN
FT                   VFVSNSKYETILYITSFQEFLVNELGRSVDFNIIDMDVVTDGFINSDLFPHKNRHSLFL
FT                   YELVQVECHLYGEKVLQEYIYENKDIQTEALKLLLTLVQRANKEILTKFTLNTRKNIRK
FT                   FARYAIEFSLINKGYMNPYIGLTPKKIYSYLPFLNTNYTTTINQILNDQNPEIDQSYNL
FT                   IVDLAHVLKAEFMNISLRGEKQND"
FT   gene            356048..356689
FT                   /locus_tag="FORC68_0335"
FT   CDS_pept        356048..356689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDF5"
FT                   /protein_id="QBZ17563.1"
FT                   /translation="MIDSFNTTNSNIADRLFHKYFSTLKKNNSNCKPSFIMFIGVPGVG
FT                   KTTISKIFETNYSFKSIATDEIKYNLQQMGIEYTIEDLFDIQKLMFMKLAEYRVNIISD
FT                   SNSAKNWQREILINFCKRYRYIFKIVYLTCEREILNKRLFIRKINYLPKRNYVSSDKLN
FT                   YYINEIEIPNSCSLTIDTGKTSLKQIRDIVDKFIDREGITYEQKTNGSSK"
FT   gene            356658..358604
FT                   /locus_tag="FORC68_0336"
FT   CDS_pept        356658..358604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0336"
FT                   /product="Transketolase"
FT                   /db_xref="GOA:A0A4P7MLJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MLJ1"
FT                   /protein_id="QBZ17564.1"
FT                   /translation="MNRKQMEVVNNIRCLVAETVEHSGTGHPGMGMGAAGIGYAVWKNL
FT                   NISKEVPLWGKRDRLIFSAGHGIVLQYVLLYLNGYISLEELKTFRTMYSKLPGLSEYKS
FT                   LPYIESTTGSLGQGIANAVGMAISLKRAHETKKVENKEAIQSNVYCIVGDGCLMEGISY
FT                   EASSLAGTLALSNLIVLYDSNNITIDGPTDKTFNENIEKRFTSMNWDYLLVKDGDDVEA
FT                   INDSIQEAKLRDKPVLIEVGTRIARSSLNKENSADAHGKPLGKEEVELIKQQFKLLKPF
FT                   EICEASVKEFTKIENQRKQYQRDLSYVNNENRGVNKNILEWNTIKDIKIPDNLTMIEKF
FT                   SHIINRIKENGTDILVGSADLAASTKLWIEKGGYISKGSYLGANIAFGIRESAMAAIAT
FT                   GIYQGTCLKTLISTYFAFSDIMKNPIRMSALMNIPNIYVFTHDGFSLGLDGGTHIPVEQ
FT                   INMLRDIPNLNVYRPGNDDELKVACYESILNPSTPSAIILTRDVISIQSDIPISSIKKG
FT                   GYLFKSKKNAKLKIFSTGSELAIAIEVQDMLNKEGINADVISIPCHEKLMEQSDEYISN
FT                   LFLKDTKKVFIEIGGKSIWPIYGDKDSIYICLDNYVSPGPPESLKEKYGYTPKKVFERI
FT                   RNHYNIGDEDKLK"
FT   gene            358601..359776
FT                   /locus_tag="FORC68_0337"
FT   CDS_pept        358601..359776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0337"
FT                   /product="Phosphoribosylglycinamide synthetase"
FT                   /db_xref="GOA:A0A3T2HDF4"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDF4"
FT                   /protein_id="QBZ17565.1"
FT                   /translation="MKKNVLFFSGANYSHKGFYNNNYDIFLVTDDSQEAKLQDAIYKQI
FT                   IFLPDFDDFERARSTILTINQDFPLSLVTTFSEKKQPLVSKICDSLNLNGPSKTSVELL
FT                   NNKYLMRKKLENKNLLETKFSLVNCRDDIYRFIEYTDFPVVLKPIDGIGGEGITLIENE
FT                   QNLNEVEEDIKNYIVEEFIQGKEFSIEAVGFKGEHQIFTITEKIKDSKMNEIGHIIPYN
FT                   QKFFCLERAQEYINTLFSILAIDQGITHTEIIVNEDGIYLVESHLRMGGNHIGEMIEMT
FT                   LGINMSDIYAKSMIRGSLYRGKIEWNGTYAEVLSIFPNESGVIEEILAPEKIENCNKIF
FT                   YLKSVGDFVLNKGNSNRILSFIKESHSYNHLKDSVKSDIEKFRIKIDTKYV"
FT   gene            359730..360989
FT                   /locus_tag="FORC68_0338"
FT   CDS_pept        359730..360989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0338"
FT                   /product="MFS transporter"
FT                   /db_xref="GOA:A0A3T2AAM2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2AAM2"
FT                   /protein_id="QBZ17566.1"
FT                   /translation="MILKNLELRLILNMFSNIINLPKNIRYRFLISFFNRIFSSCYIPV
FT                   LPIYMSGYISSSEVSLALALILCLNILGNFIGGVLGDNYNLKQLIALIRGIETIIFVSL
FT                   AVCIWASINIWTIIILFSLVTFTSSLRVPLFDMLVFNAVSSENQNYVFSLSYWINNIGF
FT                   SVGYLLSAFVFKGNMFSIICMGIIVNIISIPAINSLEDDYTSQSKSNVKANLIEVIKIY
FT                   QNKKFIIFSFGSILLLFLELQLSNFIGIFLNRNFIDTIFHYKVTGIQALGIIQFINVFL
FT                   TVLIPILSKKMMKSISTYSFIIGIILYGIGFLSLVWFYSYGVIAMVISTIIFTIGELLF
FT                   FPNQQVVFKNIMPEKHRGKYLAARQINTQISRLIASVSLVLFLSVSYVLVGFIYFIVAI
FT                   VGGAFIIYLRKITLRLEHEK"
FT   gene            360986..362188
FT                   /locus_tag="FORC68_0339"
FT   CDS_pept        360986..362188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0339"
FT                   /product="Nikkomycin biosynthesis protein, carboxylase"
FT                   /db_xref="GOA:A0A3T2FM14"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2FM14"
FT                   /protein_id="QBZ17567.1"
FT                   /translation="MTILFLNSSSYSHTPIDKWTDDTDETIICITPAKNVAEYKEKLSE
FT                   GKFEIVAIKDWEDKTTIDIAINTIYNKKIFNKVISMREKDIIHAAYIREHFELMGQTIS
FT                   SAMAFRDKYVMKNLAIQNNIKVPIFSKVNTFFDVVNFTNKNKFPVVVKPRLGAGSVDTF
FT                   IINNSLEMEENLRGVDLKNFIIEEFIDGSIFHVDGLIKDGEIEFIIPSKYINECIEYKI
FT                   GKSTSSFTLEKNNILYTKLIKYTLILLKKFPTPQNTTFHLEVFITHDGEIILCEVASRT
FT                   AGGKIPKCIEYRTGTDMNRTWFRNQLGLLTEENSVKREMLYGSIQCAPKHGKLTSIPKE
FT                   LPFDWVKLYEVYAKEGDFYQGATSSVFAIASVIVEGESEQDVTKRLNQVDEYIKLNTIY
FT                   I"
FT   gene            362428..362556
FT                   /locus_tag="FORC68_0340"
FT   CDS_pept        362428..362556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NXU2"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NXU2"
FT                   /protein_id="QBZ17568.1"
FT                   /translation="MLSKVKAKNKLPKTGDNGDSLYVMFGSLLLSFSIVHVNKANK"
FT   gene            362800..363471
FT                   /locus_tag="FORC68_0341"
FT   CDS_pept        362800..363471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0341"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="GOA:A0A3T2I508"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I508"
FT                   /protein_id="QBZ17569.1"
FT                   /translation="MNISDLKGQLIVSCQALENEPLHSSMIMARMALAAKEGGAKGIRA
FT                   NSPEDIREIKATVDLPVIGIWKRDYEDSNVYITPTRYEVEALLETEVEIIALDATKQKR
FT                   PNDESIGDLLALIHRKNRLAMADISTLEEAIEAERLGFDLISTTLAGYTPYSKATTEPD
FT                   FELLEEIVQKVAVPVIMEGHTSKPEQVTEGLKRGAFAVVVGSIITRPKLITERYVNATK
FT                   W"
FT   gene            363465..364283
FT                   /locus_tag="FORC68_0342"
FT   CDS_pept        363465..364283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0342"
FT                   /product="haloacid dehalogenase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHN4"
FT                   /protein_id="QBZ17570.1"
FT                   /translation="MVGYKMNNVLLVCDLDGTLLDSSGQIDQLSFNKIKKFCEDGGHFV
FT                   ICTGRMDTDIQYVEQKLGFAGEYRISQNGAVIKDKHNQSILLETIPSEFIPKLTHAIFT
FT                   KGLRTEVSDENNRHFPSPRKPEEVAEFVDSSKVIEDLATYILAGEINPTVYLTFGNEKA
FT                   FKSIKLAINESLGADKVTVIQTSPSSLEVFSNKVSKGKAVELIQQKLGVSSNNLYVVGD
FT                   AESDVSMFTLTKHAYAVQEAERAICEKASYYQKTVGDVVADIYQKKEERI"
FT   gene            364280..365806
FT                   /locus_tag="FORC68_0343"
FT   CDS_pept        364280..365806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1RVW2"
FT                   /protein_id="QBZ17571.1"
FT                   /translation="MNILYVPLDERPCNAIYPEQTAAVNQTMNVLSVPQALLGNKKKPA
FT                   NIYGIRSFIKKNIVNCSYAIISTEMLLYGGLLPSRLHHLTEADLNEYEVFLRGIKKEFP
FT                   DKKIFLSNLIMRTPKYNSSDEEPDYYEQYGEAIFRYGWLKDKAARDTLDEREESEWNQL
FT                   KETLPKDVIFDYETRRAFNVQVNLLHVQLVAENIVSFVSVPQDDSAPYGYTAMDQSKVY
FT                   SEIANKRLKDRIMVYPGADEVGFTLLARAYNDHLGKTPSLFVRYSATFGAQIVPLYEDR
FT                   PINESLKAHVLAAGFRLVDDVKDAEFVLEYNTPGKKMQESWDQLATKDVTYDSYRHLLS
FT                   FVLEIQADLAVGKKVGICDAAFANGGEMELIELLDEKGILEEILSYKAWNTNCNSLGSS
FT                   LAGLAFCQATFNKEKVKENLLANIYEDLFYQAIIRKQITDNVLPEKGLNYFYLGDKADE
FT                   ISGLVVSLIQKYHRFTLKNSFIDDAFTIDQVTFPWNRMFEICCTVKNKES"
FT   gene            365809..367113
FT                   /locus_tag="FORC68_0344"
FT   CDS_pept        365809..367113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0344"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="GOA:A0A3T1RVY5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1RVY5"
FT                   /protein_id="QBZ17572.1"
FT                   /translation="MNKSNVFIDKLLVFANKFSSQRHIAAIRDGFVTLIPMTIIASFWV
FT                   LVNNLILSPTNGLLKNYSAAVKWADLGNQIYNGTLGIMALMIAVTIGYKLAVSYGDEGL
FT                   IGAVMGLVSYMIVLPAQIIITDVEGKTFTAAAALTQTQTSATGMFLAIIATLLSVTWLS
FT                   KFSKIERLKIKMPESVPPSIAKSFNVLIPIFFVTLILGLIEVLIVWVFNTNIPALILTF
FT                   FQAPLISSFQSIGGILLYVCFSNLLWAFGLHGTFILGSIGEPIMLTAIQENMEALKNGL
FT                   ALPNIVTKPFLDAFGWMGGGGMIICLVIAIMIASRREDYRSITKVGIIPSLFNVSEPLM
FT                   FGLPVVFNPLLAVPLIIVPAVTVTIAYYATALGWIAKTSVLIPWTTPPVISGYLATNGD
FT                   WRAAVLQIFLIAIGVLIYLPFVKASNRTVIKENAK"
FT   gene            367128..367451
FT                   /locus_tag="FORC68_0345"
FT   CDS_pept        367128..367451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0345"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /db_xref="GOA:A0A3T2FM37"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2FM37"
FT                   /protein_id="QBZ17573.1"
FT                   /translation="MSKKTIMLICSAGMSTSLLVTKMQKAAAEKSLELDIFAVAASDAD
FT                   NQLASKTIDVVLLGPQVRFMEKQMEEKLAPKNIPSAVINMADYGTMNGQNVLNLALNLI
FT                   KGA"
FT   gene            367460..367774
FT                   /locus_tag="FORC68_0346"
FT   CDS_pept        367460..367774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0346"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /db_xref="GOA:A0A3T2HDE8"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDE8"
FT                   /protein_id="QBZ17574.1"
FT                   /translation="MDNKNLEAIMGLIMHGGNAKSNAMEAIQAAKNGAFELAEEKISEA
FT                   EQSIVEAHHSQTGLLTEEAKGNHMEVILLTVHSQDHLMTAMTFTDLAKELIDVYRKLLK
FT                   "
FT   gene            367908..368729
FT                   /locus_tag="FORC68_0347"
FT   CDS_pept        367908..368729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0347"
FT                   /product="Sialic acid utilization regulator, RpiR family"
FT                   /db_xref="GOA:A0A3T2AAQ8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2AAQ8"
FT                   /protein_id="QBZ17575.1"
FT                   /translation="MDLLATISSYFPSLSKSEQKVAQLILSNPDEVENLSINDLALMAN
FT                   VGESTIVRFSRKIGLTGFQDLKIALVKYQTSQKQNITDESNEAKDLVYRQFVDGLQDTK
FT                   SFIEQEKLEQAAKMIHRAEHVYILSVGTSAFIAMQLSNRLKRLGKFVEFVPDGHLQSIY
FT                   VTMVKKTDIVIGISKSGNTKEVIQNIELASQSGAPVVTLSNFINSKISQMGDVSLVASS
FT                   KEFLSDAGSFSAEVSQLYLLDTLIKVLVDINPSSYHNIRSLTNKALVKRIE"
FT   gene            complement(369076..370272)
FT                   /locus_tag="FORC68_0348"
FT   CDS_pept        complement(369076..370272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0348"
FT                   /product="ATPase component BioM of energizing module of
FT                   biotin ECF transporter"
FT                   /db_xref="GOA:A0A3T1NXT1"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NXT1"
FT                   /protein_id="QBZ17576.1"
FT                   /translation="MYKRPHYLKQLIQFKDSDFIKVITGVRRSGKSVLLMLYKEYLLQE
FT                   GIHENHIIHINFESFEYQTITTEEKFRQKLDELLPEDDTKIYLLFDEIQMVEGWQRIVN
FT                   GIRVSFNSDIIITGSNANMLSGEIATLLSGRYIEIPIYPFSFSEFLHVKDIESDSRKVD
FT                   SAYGEYEKYGGFPSVVIAEESIKDTILSGIFDTIVLNDVALRAGVKDATALKSIIRFLA
FT                   DNVGQLVNTSKIVNTLKSEGVDTTVHTVNRYLDLLENGYLFYRAKQYDIRGREYLRTNG
FT                   KYFIIDTGLRRNAVGKKDGNYSNRLENIVYIELLRRGYTVDVGKLDSKEIDFVARKLDE
FT                   TLYIQVAYELPNNMHETDNLLNIKDNYKKIVITGRYYETTQIDGIPIIYIVDWLLSEK"
FT   gene            complement(370588..370965)
FT                   /locus_tag="FORC68_0349"
FT   CDS_pept        complement(370588..370965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NY03"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NY03"
FT                   /protein_id="QBZ17577.1"
FT                   /translation="MNKRYYTALVVLSCFNILWLLSLIFATGRGNGIKLDDNQLPGYII
FT                   ICLCLCILTYAYFVNHIQLRKIIIAILALLDALFVFLAWGNINIINFNEGMFIFIGPIY
FT                   LLIIICIFCIVDFYLSTCKNE"
FT   gene            complement(370986..371438)
FT                   /locus_tag="FORC68_0350"
FT   CDS_pept        complement(370986..371438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NXT2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NXT2"
FT                   /protein_id="QBZ17578.1"
FT                   /translation="MTHFNIERQKKLGRTVEFCLGLCGGIFGVLAATTMLGFTIPDIGD
FT                   DIDFSYWLLSILLTSIFSISGVVGSLFVRKHHLLGGVLMLGAAIGGVLSQNMFFIMYLA
FT                   FPLLLIGGLVALIRGGEFLKLFSKWWFYIVLALSIFVPLLLFWGYY"
FT   gene            complement(371467..371931)
FT                   /locus_tag="FORC68_0351"
FT   CDS_pept        complement(371467..371931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2HDD7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDD7"
FT                   /protein_id="QBZ17579.1"
FT                   /translation="MKKVKISIVSFLGVIILSLIVYFGYINYQTYQANKLMNDAIKKAG
FT                   IPISEVITIQATNYNQQGLFGPEWYGEDITTKKDYKHWRQVVKKRGKYLSGKPLGDTAA
FT                   LSNPKNCELTYGLLLQDGVARIGPVYAGTSATSSQLDEFAYHFPNQFPEE"
FT   gene            complement(373277..373906)
FT                   /locus_tag="FORC68_0352"
FT   CDS_pept        complement(373277..373906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0352"
FT                   /product="Mobile element protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHP5"
FT                   /protein_id="QBZ17580.1"
FT                   /translation="MKQEEQVGINKVQRIMQKYQWQCQVKVKKKNRPGSAYYQTENHLN
FT                   RNFQASQPLEKLTTDITYLYFGDCRLYLSSIMDLYNGEIVAYSIGEKQDSELVLDTLNQ
FT                   LSLPEGSLLHSNQGSVYTSYEYYQCCKKKNVIRSMSRKGTPADNAPIECFHSSLKCETF
FT                   YHKTAYKYAKSIVIQIVKDYIKYYNEKRIQQKLGYQSPINFRKQAA"
FT   gene            complement(374109..374414)
FT                   /locus_tag="FORC68_0353"
FT   CDS_pept        complement(374109..374414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0353"
FT                   /product="Mobile element protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7ME41"
FT                   /protein_id="QBZ17581.1"
FT                   /translation="MSTRVMYPAEIKEKAIKMKLAGKSTKEIMRTLHIKNPTQVKTWWR
FT                   WYRNEETHRFHQGVGKQYKYQKGVPELPEIEQLKIALRQKELELEILKKYKALERK"
FT   gene            complement(374521..376446)
FT                   /locus_tag="FORC68_0354"
FT   CDS_pept        complement(374521..376446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0354"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T2HDF0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDF0"
FT                   /protein_id="QBZ17582.1"
FT                   /translation="MKLSKIFTIIALSATVTSSLPIPMVNADSTTVNETKTESQLLTTD
FT                   LKETKADEVTKTPKEKTTDNNLKNQLVQAGTKTYNDYFPDDNLAKAVAEKMNSEVNATV
FT                   TVEELAKITKLDARSQDIEDSTGIEFLTGLEVLNLEDNQLKSIDVSKNLNLKELTCSNN
FT                   PLANLDVSKNLALEELTCENNELTQLDVSQNTALEYLYCPRNQLTKLDVSKNSALRYLA
FT                   CDVNQLTNLDVSKNPALTNLGCTKNQLTDLDVSQNPNLSTLVCSDNQLTNLDVSQNQSL
FT                   AYLACDNNKLKNIDIDQNLALIELSCENNQLTNLDTTQNLALEILYCDDNQLTDLDVSK
FT                   NVNLLILFCNNNQLTSLAVGDTILNVRCNNNQLKDISFLPDYFTDDNDDYQAMDQTLVS
FT                   PTQTTQNNTLVYAVPTDLLDKDGNIVSIIKPESGGIYDAATRTITWENLPDNGEVSYTF
FT                   ENEDYGRFSGRVTVPYTGKETISISSDDEISYKEGTTKTEAAFLADIHASVTPATETIT
FT                   SNFADVVDFQTPGKYVVTLSVAGSDVTKDIIVYVTAEPSEDNPVAPTPPKDKDDTDVNN
FT                   EQSPGNDKDGTDVNSGKSTDKQPVKVVEKQLPKTGDITSLSLSLAGIVCLSFGILFFIK
FT                   RKKKTV"
FT   gene            377114..380413
FT                   /locus_tag="FORC68_0355"
FT   CDS_pept        377114..380413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0355"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T2HDF7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDF7"
FT                   /protein_id="QBZ17583.1"
FT                   /translation="MKSKAKYIIIVGVVLFQSLVAYPLITMAEENDSKSVNIETTLEPK
FT                   EVESTTSETEMEASTKEVVEEKTSQKSIITNNLTQEKSVLQAGETYESTFPDAALATVI
FT                   AKAATGSEDITQEVSQTDLNKITSLTATSKGIVDLTGINLLSKLAYLSMSGNQISDISA
FT                   LNGLANLSNLNVSSNQITSFNLNANSNLPMLNTVDIRSNDLNNINVQDQSKLRTIKCDT
FT                   GSSSELTEVMLKNLPTLIAASNSSNPVADDIAFSSTPGLSKVILENLPSTSSSVQLDRC
FT                   VIEELVINNLPKVSIVTINNNKITTLEGLEDLATLSSLNAGNNELTEIENMHTFPSLQT
FT                   LNLSSNALTNMVMNQATAEKFPLLRTMDIRSNNLIKIDIQNQSKLATIICDTGSSSELI
FT                   EVTLKNLPELIAASNGSNQVKDDIAFLSTPGLSKVILENLPSTSSSVQLDRCVIEELVI
FT                   NNLPKVSIVTINNNKITTLEGLEDLAALTSLNAGNNELTEIESMHAFPKLQTLTLISNK
FT                   LTSIILNQATANGTPNLTSIDSRSNDLTKIDIQDQPKLTKIICDTGSSAELTELTLRNL
FT                   PELIAASNGSNAVSDDIAFSATPGLSKVTLENLLATNVTIQLDHCVIEELVINNVPQVA
FT                   FIYINNNKITTLEGLGNLTAVTNLNAENNELTELENIPAFPKLKTLTVNNNHISVLPTS
FT                   LKTKNPVLTTLSATNQTITLKQKVIVSDLVLDNEVKNFGQTTTAKSISNNGTYQNNQVT
FT                   WLFEDVQGVNAVDYQFSEPIQEATIQGTFSGKVTQPIKVSTVPVITADTEMTYPKNATI
FT                   SEAAFFKDISASVTDDAILTSDFESVVDFVKAGTYEVTLNAMNEDGVEAVSVTVLVHIA
FT                   KSPAPVITADKEITYTQSTEVSTTEFLVAIHATTNDGSPIESDLDTTVNWSKVGDYTVT
FT                   LSATNEDGVEAIPVKVAVHIVEPPAPTISNVIFDVDGVQTTESHEVGELVSEPLTPTKE
FT                   GYTFIGWYDEKTGGNKWDFTTDKMPGYNITLYAQFSKDTNKGEDGDGGKASVASSMEVT
FT                   PSGQSQSENSKNSSNIKLPATGDDNATVLLVGLGLLMLGLFIRLTQKKHTK"
FT   gene            complement(380924..382342)
FT                   /locus_tag="FORC68_0356"
FT   CDS_pept        complement(380924..382342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0356"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T1NXV2"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032179"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NXV2"
FT                   /protein_id="QBZ17584.1"
FT                   /translation="MKKILVILAFTLTIILGFKLPAQANTQVVPDDNLRLAINQSLGQA
FT                   DTHEPTQEEIATIEKLSISGYDVMSLEGLQYATNLKELFANHNDISDFSPISNLTGLTK
FT                   LQIDETKITDTKQLTNLVNLKELDISNNNLNEIDGVKNMTKLESIYAYNNNISDLSPLA
FT                   NCTALASVDFINNEINDVSVFRNLDSLITGRFAYNHISNISYFRHDIPHAGNLNFENQT
FT                   ITLPAQRVSLVKKSLTMVDPIKGAAGQNVTLANISNSGTFANKELSFVNLATDTNQVTY
FT                   DFDHFFTYNNYYMNFSGTVIQPLEWFADNAPVIHVDDIVIDQNSTFDPTDYITADDEED
FT                   GDITDKIVIIENNVNPAVPGTYDIIISVTDADSNVTEKTVTVTVEETAKTPANNNDTGK
FT                   TTPQAPTKDEAKDAPKTTLKVVDKQPTKNTTSSNSNLTNASKLPKTGDDPANSLVAIGG
FT                   LLLLSSAFLLRRRY"
FT   gene            complement(382558..382935)
FT                   /locus_tag="FORC68_0357"
FT   CDS_pept        complement(382558..382935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEI6"
FT                   /protein_id="QBZ17585.1"
FT                   /translation="MVCSYHVIYCQLKQPHSTKHQIVRNNINIITFPTAVKSGPTVLKV
FT                   LIFIPIIPSKSCAPIITKDNATKKASDLNINNPNATISNDKLLDTAYFAFINASPFTFL
FT                   DFKSASSENLKLTDALFAQIY"
FT   gene            383305..388641
FT                   /locus_tag="FORC68_0358"
FT   CDS_pept        383305..388641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0358"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T2HDD9"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDD9"
FT                   /protein_id="QBZ17586.1"
FT                   /translation="MKKKFSIVIISVLLLGYLAPFDTLLVGADETTVSEDTAVKTAEAD
FT                   SATEGIESETSSDDETAEEPKEAKEAEASKETTEKEEKAKTEEPASNIKTEINTDKSQL
FT                   KQTSLKAAVPAGSTYNSLFPDDNLAKKLAVIITGNVAATGNESVDSAALLAISQLDLSG
FT                   ETGNDPTDISNIEGLQYLENLTSLNLSENNISDLAPLKDLVNLVSLNLSSNRTLVNLSG
FT                   VEDLVNLQELNVSANKALEDISQVASLPVLKEISAQGCNIKTLELKNPAGAVLPELETF
FT                   YLQENDLTNLTSLAKLPKLKNLYIKGNASLKSLATLNGATKLQLIDASNCTDLETLGDI
FT                   SGLSELEMIQLSGCSKLKEITSLKNLPNLVNITADSCAIEDLGTLNNLPKLQTLVLSDN
FT                   ENLTNITAITDLPQLKTLTLDGCGITSIGTLDNLPKLEKLDLKENQITSISEITDLPRL
FT                   SYLDVSVNNLTTIGDLKKLPLLEWLNVSSNRLSDVSTLTNFPSLNYINISNNVIRTVGK
FT                   MTELPSLKEFYAQNNSISDISMIHDMPNLRKVDASNNLITNIGTFDNLPKLQSLDVHSN
FT                   RITSTSVIHDLPSLETFNAQTNLIANIGTMDNLPDLTYVNLSFNRIPSLAPIGDLPNLE
FT                   TLIVSDNNSYLRSLGTMDGVPKLRILDLQNNYLNYTGTEGNLSSLSDLTNLTELNLRNN
FT                   VYIDDISGLSTLSRLIYLNLDSNKIEDISALSNLTNLQELTLENNKIENISALSDLENL
FT                   NKLVVSKNKIIDISPVANMVNRGAIVTASNQTYTLPTVLSYQSSFTIDNPVIWYDGTLL
FT                   APSSIGNSGNYKDGKITWTNMTATSSSTLFNFNRLKDGLTFSGTVTQPYKSAAKVTADA
FT                   EQTYTIGDTISEEQFLKDVNAKSSDGAPVTSDFATVVDLNTFGEYEVTLTSEKDGIQGD
FT                   SCKVIVKVLHGAPVISADQTISYDKHATITEKQFLEDIHASTDLDTAITTNFSTAVNLN
FT                   KGGDYTVALNSENEDGVKAETVYVTVTVNKDPAPIISAKTEITYDKFSKKTEAAFLDDI
FT                   DADTNDGSIVTSNFATAVNLDKAGDYTVTLNSINSDGVAGTPTAIIVHVEKEKIATIST
FT                   NTAQQYEKYAKINETQFLKDVHASINASPTTAVLESDFETVVKLDVPGTYTVTITATNE
FT                   DGGVSAPKEVSVIVRKIPAPEITADKEITYPKFDEVSEAEFLSDIHAAINEKNVAITSN
FT                   FSTDVNLNKAGDYTVTLNATNEDGVKATPVEVIVHVQQGERPVITADATISYDKFANIT
FT                   EAKFLEDIHATSSDGQSSTVITSNFQTATNFKTAMSYTVTLNAVNEDGISAEPVAVTVT
FT                   INKEPAAVLKADAEVSYAKNEAVTESDFFKDVHLEGTEAPSTAKATSNFDSVVDRSKTG
FT                   DYTVTINATNEDGAVSTPIEVIVHIEAESAPVITANAEVKYNKHEQTDERRFLYDSEAK
FT                   IDEANVEIKTDFAEKVDINKVGTYTVTLTATNEDGQAANPVEVSVIVSDAAAEKVNVKY
FT                   VDENGSEISAAETLTGNLDETFSIDAKSIAGYKCDATLSGVFSTVEQTVVFHYKAIKPG
FT                   VVTIKYEDTNGKAVAEDKQITGEVGDDFEAEAQTVSGYSCRAIASGKITEEPQTITFTY
FT                   STATPSKKSGEITVQYVDESGKKLADSKKVTGNIDDSYSVEAKAIEGYSVVGDDSAKGV
FT                   FTEKSQTVTFKYKKNTQVSKDDPKVKGITNQPTSTDTKLKVDNNSLPATGDTENMILAV
FT                   LIGFNMLIVASIFLFRKPKTNQ"
FT   gene            388831..389403
FT                   /locus_tag="FORC68_0359"
FT   CDS_pept        388831..389403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7ME71"
FT                   /protein_id="QBZ17587.1"
FT                   /translation="MEAYEEYLYEEGSRKMMNKMIIYSSQYGTSKQYATELSQKKAIPM
FT                   YSVESIPESIVEADEIIYVGSIYMGKVLGFDKFSKKYKTLSSKLIVISAGMYDPTRKEN
FT                   TDNIELTVKENLQKTNFLLKDIFCLKGKLDTQQLRLKHKILVNALYKSAKRKKESDLND
FT                   NERDIVRAYEDDSQIDLNKLDGVLDRL"
FT   gene            389612..389902
FT                   /locus_tag="FORC68_0360"
FT   CDS_pept        389612..389902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ17"
FT                   /protein_id="QBZ17588.1"
FT                   /translation="MQMREIKVDERTFQQHATKLASESTGSYLPLKNGNMAYSRANSID
FT                   QLRSALIELVDVVEDFQHVTKKDASRLKKMGIAYAKQDQLMGQKINQLEVR"
FT   gene            389903..390271
FT                   /locus_tag="FORC68_0361"
FT   CDS_pept        389903..390271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MIF1"
FT                   /protein_id="QBZ17589.1"
FT                   /translation="MDSAHSQLEQQLQQIKKAKITAETDVDQTRRKQNEQDWLEEDSNQ
FT                   LTQEKLVLLDFLRSGWQGEEASGFHRYLEEQQHEESQAWRRDLQDKRTDLDKELQENKD
FT                   KLHTLETKQATLQKEWSK"
FT   gene            390268..391743
FT                   /locus_tag="FORC68_0362"
FT   CDS_pept        390268..391743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWI2"
FT                   /protein_id="QBZ17590.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKEMIRKIKEAAMDYAQDDRLKG
FT                   EAVTTSKRYFKSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVSQLQRKEEDLHRQLTAPNTKPDMQQVYVVKSRSIHTQLLKAIEQENILEKYLAFE
FT                   QSHGQFFNALAELIQATGRAVQELLHHVTFNDKTGTYAVPKSAANSLLLMKRALDNART
FT                   ENDKDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDT
FT                   LLYTSLSGEELERKVNDSWKEGINYLNGQKVSGLSGATLRSSAYVASMKDWTDDAGLTD
FT                   MALSLGFGIAAARNKPVIKEKLNPAETKQTVNGEKWNNYFKEKYGAGNVQWKPSSFEDI
FT                   IINPERLYGSTKKEVRQMLGEGWKEETYGSAGNGWKFTNEGDGMVFYHPGEGIHKGSYY
FT                   GFSSGDTGKVKIVGKDYIDFSKDKATIIKFGGE"
FT   gene            391747..392127
FT                   /locus_tag="FORC68_0363"
FT   CDS_pept        391747..392127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S031"
FT                   /protein_id="QBZ17591.1"
FT                   /translation="MKKLTVGGKFDWYIDTLEKSGMFILELSNEEIETFIFEDFIVGVT
FT                   SFFSKNNLSELKANEIIDEDMEKNAYLLREKVLKIDNTDLWNINSVRQSSEWLDIFRRS
FT                   DELKRQLKERWSDEEIEYLKTL"
FT   gene            392402..392773
FT                   /locus_tag="FORC68_0364"
FT   CDS_pept        392402..392773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0364"
FT                   /product="Inorganic pyrophosphatase"
FT                   /db_xref="GOA:A0A418S015"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S015"
FT                   /protein_id="QBZ17592.1"
FT                   /translation="MVSRKQSIQKTQLSKTKKQTLNVTIDRPIGYTDKFGNVYPLNYGF
FT                   VEGVIGGDGEEQDVYVLSRKISEPIDTFQGDLIAVITRNDDVEDKWVVAAPNENFTIEE
FT                   IREKVHFIEQYFDSEIKLI"
FT   gene            392786..393004
FT                   /locus_tag="FORC68_0365"
FT   CDS_pept        392786..393004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S004"
FT                   /protein_id="QBZ17593.1"
FT                   /translation="MQPPKKEAEKMDERFEKIYTQGKLNIMEIWVDKETGVQYVYHLAG
FT                   YAGGMSPLLDVDGKPLLADLSKLNGAE"
FT   gene            393021..393134
FT                   /locus_tag="FORC68_0366"
FT   CDS_pept        393021..393134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MLM6"
FT                   /protein_id="QBZ17594.1"
FT                   /translation="MVLLQARQIKTGILYLDVEDSCFLQFILIAWKLISHI"
FT   gene            complement(393102..393434)
FT                   /locus_tag="FORC68_0367"
FT   CDS_pept        complement(393102..393434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HWC5"
FT                   /protein_id="QBZ17595.1"
FT                   /translation="MKKNTPEALIDLFEELKNLFETDTSLNNQNPSQLQEILTTAIIRV
FT                   KKASQTVELEARSVYQNIHTLCFVEKIHLNPEEANVLKEIEKIALSKGFWGGMNTLNVT
FT                   NQFPSN"
FT   gene            complement(393500..395497)
FT                   /locus_tag="FORC68_0368"
FT   CDS_pept        complement(393500..395497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0368"
FT                   /product="Transketolase"
FT                   /db_xref="GOA:A0A3T2HE40"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HE40"
FT                   /protein_id="QBZ17596.1"
FT                   /translation="MSRIDEQMVNSIRVLSMDMIEKANSGHPGLPMGAAPMAFSLWKNH
FT                   LKFNPEHPTWFNRDRFVLSAGHGSAMLYSLLHLFGYDLPMSELKNFRQTGSKTPGHPEF
FT                   GHTVGVDATTGPLGQGFAMGVGMAMAEAHLGAKFNQPEFPVVDHNTYVLCGDGCLMEGI
FT                   SYEAASLAGHLKLGKLVVLYDSNDISLDGDLNESFSEDIELRFRAAGWQTLRVDDGNDL
FT                   DALDAAIHLAKTEKSRPTLIEVKTVIGYGSPGKAGKSAAHGSPLGEKELKLAKEAYDWQ
FT                   MPPFELPKTVENQKEFYHSKGRASESSWLRTFNAYKQKYPALAESLQQLMDDNLDTDWD
FT                   AELPVFDENADKPVATREVSGIVLQELEKKLPNLFGGAADLASSNKTHLKASERFAPSN
FT                   YAAKNISFGVREFAMGAAVNGMTLHGGVQAFGATFFVFSDYLRSAIRSAALMGIPSTFI
FT                   MTHDSIAVGEDGPTHEPIEHLASFRAMPGLHVIRPADGNETVEAYRFAFTQKEQPTMLV
FT                   LSRQNLPILPNSAAKAKTGLAKGAYILADSPLDKLDIILLASGSEVHLMTAVRDNLAKK
FT                   GFGARVVSMPSFDLFDKQSPEYKESILPKAVKKRFAAEMGASYGWHKYLGDSGEILAID
FT                   SFGMSGPGDELAERFGFTVENLTELALKQL"
FT   gene            complement(395499..396155)
FT                   /locus_tag="FORC68_0369"
FT   CDS_pept        complement(395499..396155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0369"
FT                   /product="Transaldolase"
FT                   /db_xref="GOA:L8DQD7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:L8DQD7"
FT                   /protein_id="QBZ17597.1"
FT                   /translation="MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKE
FT                   ICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKT
FT                   NVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISA
FT                   SIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN"
FT   gene            complement(396202..396966)
FT                   /locus_tag="FORC68_0370"
FT   CDS_pept        complement(396202..396966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0370"
FT                   /product="Short chain dehydrogenase"
FT                   /db_xref="GOA:A0A0B8R5F2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8R5F2"
FT                   /protein_id="QBZ17598.1"
FT                   /translation="MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD
FT                   IKEDVKDVAAKINPSRTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKA
FT                   EDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCAS
FT                   KAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYP
FT                   EEVAACALFLVSDAASLITGENLIIDGGYTIK"
FT   gene            complement(396990..397436)
FT                   /locus_tag="FORC68_0371"
FT   CDS_pept        complement(396990..397436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0371"
FT                   /product="Ribose 5-phosphate isomerase B"
FT                   /db_xref="GOA:A0A3H0R437"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R437"
FT                   /protein_id="QBZ17599.1"
FT                   /translation="MKIAIGCDEMGYELKQTLITRLKEKNIEFTDFGSFEDEKVLYPSI
FT                   AEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIM
FT                   TMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQKNR"
FT   gene            complement(397443..398207)
FT                   /locus_tag="FORC68_0372"
FT   CDS_pept        complement(397443..398207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0372"
FT                   /product="Triosephosphate isomerase"
FT                   /db_xref="GOA:A0A3T2HE28"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HE28"
FT                   /protein_id="QBZ17600.1"
FT                   /translation="MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSM
FT                   GTLETTANLLAGTSFGFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFH
FT                   EKTSEIAKKIKLALDEKITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNV
FT                   VLAYEPEWAIGKANSADTDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIV
FT                   RQKNVDGLFVGRFGHKPQNFADIVSIVSKTKG"
FT   gene            complement(398211..398861)
FT                   /locus_tag="FORC68_0373"
FT   CDS_pept        complement(398211..398861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0373"
FT                   /product="Phosphoenolpyruvate-dihydroxyacetone
FT                   phosphotransferase, ADP-binding component DhaL"
FT                   /db_xref="GOA:A0A1C7PXT7"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXT7"
FT                   /protein_id="QBZ17601.1"
FT                   /translation="MSELVMDSAFFGHVLQDMGALIEKERDYLTGLDSDIGDGDHGINL
FT                   SIGFREVNKQLDELLAVSPDIATLLKKSGMILLGKVGGASGPLYGSFFMKCGADIPGKT
FT                   EVNFDELCGMIINGAAAVQHRGKAELGDKTMMDAFLPGVEVLQNRDANAEPIETFSTFV
FT                   DAMHAGAQSTIPLIAKKGRALRLGERAIGHLDPGSESSWMLMNIILENLKKAV"
FT   gene            complement(398883..399878)
FT                   /locus_tag="FORC68_0374"
FT   CDS_pept        complement(398883..399878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0374"
FT                   /product="Phosphoenolpyruvate-dihydroxyacetone
FT                   phosphotransferase, binding component DhaK"
FT                   /db_xref="GOA:A0A1C7PXK0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXK0"
FT                   /protein_id="QBZ17602.1"
FT                   /translation="MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEE
FT                   PRVRIIVGGGSGHEPLFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYM
FT                   YGNYAGDVMNFDMGAEMAADDGIRVETVLVTDDIYSAEKVEDRRGVAGDLIVFKAAASA
FT                   AAKGLDLDAVKQAAEKANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPG
FT                   IKRTSIEPADKVVDQIMGYLIEEMKLTSDEEVHVLINGLGGLPVMDQYICYRRVDEILK
FT                   EKGVHIHNPLVGNYATSMDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD"
FT   gene            complement(399900..400241)
FT                   /locus_tag="FORC68_0375"
FT   CDS_pept        complement(399900..400241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IPG5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPG5"
FT                   /protein_id="QBZ17603.1"
FT                   /translation="MSIGIALATIAGGFLFPFAIRMMWGKMVDEWGAIGGWMAAAFIVG
FT                   TVWTINHGIPKSMIYQSGTVWVDMAVAAGIGVFTASLLTGGKFSKSIVNLAAAVVGGVV
FT                   GGFLLSLFL"
FT   gene            complement(400257..400688)
FT                   /locus_tag="FORC68_0376"
FT   CDS_pept        complement(400257..400688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0B8RGX8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8RGX8"
FT                   /protein_id="QBZ17604.1"
FT                   /translation="MKFFRGMIGFCIAGMIVMSVWTPLAENYGIFGGYLAAFIIIGPMW
FT                   FMNHYVGLIENDEDAAFVDMAVGIGICGIMRDVFMQGGGELVSSLPTIGLVAIGAVLAG
FT                   IVAAAIEKDMAKKQEAKQEKTEPGMNMKEEERLNENQLV"
FT   gene            complement(400773..401150)
FT                   /locus_tag="FORC68_0377"
FT   CDS_pept        complement(400773..401150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0377"
FT                   /product="Phosphoenolpyruvate-dihydroxyacetone
FT                   phosphotransferase, component DhaM"
FT                   /db_xref="GOA:A0A1D2IPF4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPF4"
FT                   /protein_id="QBZ17605.1"
FT                   /translation="MISIVLVSHSQKITEGLQEMIVEMVGDTVHIISSGGTGDGRLGTN
FT                   AIMIADNIATCTNSEHIYIFCDIGSAILSAETALELLDTDLLEKTTIIDAPLVEGAFTA
FT                   AVQSLVNPSKEAILQELTNVH"
FT   gene            401333..402097
FT                   /locus_tag="FORC68_0378"
FT   CDS_pept        401333..402097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0378"
FT                   /product="Transcriptional regulator of rhamnose
FT                   utilization, DeoR family"
FT                   /db_xref="GOA:A0A1C7Q1F8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7Q1F8"
FT                   /protein_id="QBZ17606.1"
FT                   /translation="MFPFERQNKIIHLLDQNSKITVPELSRILDVSISTIRNDLSSLEE
FT                   SGMIKKVHGGAVLLKSEEKFTNFNDRIIRNIEEKEAIAKEAATLVKNNQTIILDASSTA
FT                   LALAKELHGFSRLTVITSGLYTAIELKDNPNISVILTGGIVTTNSFTLEGILGANLIEN
FT                   IHADLCFMSAKGFTMEEGLTDFNIYETELKRLLAKRTNKLIALLDHTKMGVISTASITS
FT                   AENIDLLITDNKINKALYKKFQDAGLPVKVAE"
FT   gene            402163..402576
FT                   /locus_tag="FORC68_0379"
FT   CDS_pept        402163..402576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0379"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A418S052"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S052"
FT                   /protein_id="QBZ17607.1"
FT                   /translation="MDYVITTELPSAEEFVQLRVDAGLSFRAIEASRKALLKSVYFVGL
FT                   RSKENGKLIGMGRLVGDGIMFIVSDIAVFPSFQGKGFGKVIMTHIKDYIEANLDKTACV
FT                   TLLADVPADGLYKQFGFRESAPASLGMIYQVGN"
FT   gene            complement(402622..404148)
FT                   /locus_tag="FORC68_0380"
FT   CDS_pept        complement(402622..404148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0380"
FT                   /product="Acyl-coenzyme A synthetases/AMP-(fatty) acid
FT                   ligase"
FT                   /db_xref="GOA:A0A3T2HE43"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HE43"
FT                   /protein_id="QBZ17608.1"
FT                   /translation="MTIKKYEPLNLYTNFKKSAERYPEMPIHFDEELVTFPELGLHTTY
FT                   KKCEEAIIQKAAHLHKFGVRKEEKVIVYKSAKFDSYILAVAISYIGAVPIMVSPHLPAS
FT                   TIDIFVNRLDQPWLLFDSETSDKSHQLNNLPDSRLINAEQLFKAPLDGYTCEQEELPKD
FT                   MIAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRGLVAFHISPVHSRFNIG
FT                   VSSLMSLGFPLLPIANPSKANVEKVLREYKPYVLETHPNHFVQWASLAREKPDVFQSIK
FT                   FYHSTFDAINKETMAVFLRTSEYKKPLFLQIYGQSECGPMILRGHTLQSIETLNARDMG
FT                   IGVPGLTEVRIVDQDGNPVPAGVSGNIQMLSKGRALTYYKEEARFEENVYGPWWDSGDY
FT                   GMKDEKGRLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGENGSPQPIIAVH
FT                   NDGEMNWDAWWKAVSDLPHMNEPLVMKYDEIPRTATMKVQRLQMERELKK"
FT   gene            404384..405904
FT                   /locus_tag="FORC68_0381"
FT   CDS_pept        404384..405904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0381"
FT                   /product="Fumarate reductase flavoprotein component"
FT                   /db_xref="GOA:A0A3A7WLR9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7WLR9"
FT                   /protein_id="QBZ17609.1"
FT                   /translation="MKKRLATTIIMLLSLALIIAGCGNNDTSKSDTAKTKEKEKTEVTS
FT                   GASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKAS
FT                   SGMNASETKFQKEEGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDI
FT                   KLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGK
FT                   VTGVKVKLNNKDEKTISSDAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIK
FT                   MIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVT
FT                   ASINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTL
FT                   DTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDG
FT                   KPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ"
FT   gene            406078..407094
FT                   /locus_tag="FORC68_0382"
FT   CDS_pept        406078..407094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0382"
FT                   /product="oxidoreductase, YhhX family"
FT                   /db_xref="GOA:A0A3A7HXF0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7HXF0"
FT                   /protein_id="QBZ17610.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERDNIEVKTIYNRNPKTATWDKI
FT                   EGVHYTTDLDELLKDPEIQLITISTTQSSHFDYAKMVLENGKNVLVEKPFMMTYAEAKE
FT                   IFELAKERGLLVQCYQNRRFDSDFLTAQKVIESGKLGELLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDNIHYDVRQLLGEGRMNDYFDLDLYYGVTKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNPDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDGLYEAIVNGKPKQVTDEETLLQMEILEKGVEACK"
FT   gene            407294..407740
FT                   /locus_tag="FORC68_0383"
FT   CDS_pept        407294..407740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0383"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /db_xref="GOA:A0A3T1NWG1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWG1"
FT                   /protein_id="QBZ17611.1"
FT                   /translation="MNISNLINEDRIIFDNRIQTKQLLFEKVAEVLVKEGSITNSKKFI
FT                   RDLYNREEETSTGIEAGFGIPHAKSKYVKEPLIVFVHSGIIIDYFGLDDSLIECSFIIG
FT                   VPKKATDVHLQILSELSRKLMNDEFREKLKNSKNENEIKTILSN"
FT   gene            407754..409148
FT                   /locus_tag="FORC68_0384"
FT   CDS_pept        407754..409148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0384"
FT                   /product="PTS system, fructose-specific IIBC component"
FT                   /db_xref="GOA:A0A402X1S1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A402X1S1"
FT                   /protein_id="QBZ17612.1"
FT                   /translation="MKIVGVTACPTGIAHTYMSAEKLTITAEALGYEVKIETQGAKVEN
FT                   VLTKEDIATADYVILAVDKEIDTSRFAGKKIKKVSTSRAIKEADVVIDETVSGKGLISL
FT                   EAKSSDVSSEQPSKASLYNHFMNGVNYMLPFVIAGGILIAISFAFGIDASNPDSDSYNA
FT                   LAAAFSKIGGDTAFGLMVPALAAGIAVSVAGRAGFAPGLVAGTLATVGGSGFLGGMIGG
FT                   ILAGYVAHFFANKVNVTKSLASIYQLIVVPLLGITIVGLAMVFIIDTPIAWVLNALTGW
FT                   LNGLGETSGVVFGLLIGVMMAADMGGPINKSISTFSIGLMSAGVTAPIAACMAAGMVPP
FT                   LGLALATLLFKNKFTKEEKTAGNSCWVLGASYITEGAIPFAVADPLRVIPSLMLGSATA
FT                   AAISMGAGVTSMAPHGGIWVMFIPNVINHLFIYLLAIAAGTVVTAISVGLLKTPLNKRK
FT                   NKEEMI"
FT   gene            409148..410008
FT                   /locus_tag="FORC68_0385"
FT   CDS_pept        409148..410008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0385"
FT                   /product="Fructose-bisphosphate aldolase class II"
FT                   /db_xref="GOA:A0A1D2IPF6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPF6"
FT                   /protein_id="QBZ17613.1"
FT                   /translation="MLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVI
FT                   LEIHPDEIEYLGDNFVATVREYAYRSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDAS
FT                   RASYEENVALTTQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVSR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVSESVQ
FT                   YGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKDVVRHKLDILNTTG
FT                   QADKY"
FT   gene            410065..410835
FT                   /locus_tag="FORC68_0386"
FT   CDS_pept        410065..410835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0386"
FT                   /product="Transcriptional regulator of sugar metabolism,
FT                   deoR family"
FT                   /db_xref="GOA:A0A1C7PXU3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXU3"
FT                   /protein_id="QBZ17614.1"
FT                   /translation="MLSTAKERQLKIVNRLKVEQFMRIIDLVEFVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETSKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLHLIDVLSKFDGLQIITNGVMTASMLSEFTNARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGIDYDKGATETHEGEALIKQAFRRQSSSLVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDPDVEEQFKTHQITCLY"
FT   gene            complement(410819..411046)
FT                   /locus_tag="FORC68_0387"
FT   CDS_pept        complement(410819..411046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IPE4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPE4"
FT                   /protein_id="QBZ17615.1"
FT                   /translation="MYKIFSFVSLILSMLCFMGLQVLNVIQKNVILLSLFDSQDFNDIH
FT                   FFGSLLVVPVLFLILAIIFAYLSIKSNTNK"
FT   gene            complement(411175..411909)
FT                   /locus_tag="FORC68_0388"
FT   CDS_pept        complement(411175..411909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0388"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /db_xref="GOA:A0A468BEY8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A468BEY8"
FT                   /protein_id="QBZ17616.1"
FT                   /translation="MTEVSMSLTGHLKELRTRLLIILLSFFLAFFVGLFVSKPLILFLQ
FT                   KDDLPKEVILHVFKVTDAFQIYIEMAFVIGLVLVFPVILYQLWAFVKPGLHASEQRITL
FT                   RYIPITFLLFLFGVVFSYLITFPFILKFMFQFAAELGVETTIGLATYFQFLLQIVLSFG
FT                   VLFELPMVIMLLTRLSLITPNGMRHSRKYAYFCLLIIAAFIAPPEILSHLMITVPLIGL
FT                   YEISIVVSGLTVRRMDKEMNNV"
FT   gene            complement(411906..412085)
FT                   /locus_tag="FORC68_0389"
FT   CDS_pept        complement(411906..412085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0389"
FT                   /product="Twin-arginine translocation protein TatAd"
FT                   /db_xref="GOA:A0A3D7WGZ1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WGZ1"
FT                   /protein_id="QBZ17617.1"
FT                   /translation="MIGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMM
FT                   DDSKEETKKEDLRP"
FT   gene            complement(412181..412801)
FT                   /locus_tag="FORC68_0390"
FT   CDS_pept        complement(412181..412801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0390"
FT                   /product="Alpha-aspartyl dipeptidase Peptidase E"
FT                   /db_xref="GOA:A0A4P7MQ44"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ44"
FT                   /protein_id="QBZ17618.1"
FT                   /translation="MMKNLFLTSSFKDVVPLFTEFESNLQGKTVTFIPTASTVEEVTFY
FT                   VEAGKKALESLGLLVEELDIATESLGEITTKLRKNDFIYVTGGNTFFLLQELKRTGADK
FT                   LILEEIAAGKLYIGESAGAVITSPNIAYIQTMDSTKKAVNLTNYDALNLVDFSTLPHYN
FT                   NTPFKEITQKIVTEYAGKSQIYPISNHEAIFIRGKEVITKRLS"
FT   gene            412897..413841
FT                   /locus_tag="FORC68_0391"
FT   CDS_pept        412897..413841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0391"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H3J7"
FT                   /protein_id="QBZ17619.1"
FT                   /translation="MKKSERLNDMMLFLNDKNVFQLSDIMTKYDISRSTAIRDVKSLEE
FT                   IGMPIYSERGRNGHYQVLRNRLLSPIVFNIDEVFALYFSMLTLKAYETTPFHLSVEKLK
FT                   TKFERCLSAEKIEMLRKTEEVFSLGYIKHNNQCEFLDVILQFTMEEKVCQINYDKKGIE
FT                   KTYVVQFYNISSAYGQWYVTSYNFETKRMQVFRCDRILELEENHAFEAKKLTDLKSETD
FT                   YLYKKKDAINFEVEIASNGVDLFFKENYPSMKLNQEQGRNVIRGFYNRGEEPFIINYLL
FT                   GFGDKINMVQPDSLKEMLLNELKSLQNHLQKLS"
FT   gene            413877..413975
FT                   /locus_tag="FORC68_0392"
FT   CDS_pept        413877..413975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHT0"
FT                   /protein_id="QBZ17620.1"
FT                   /translation="MGENIKKFIDFFELGEYDNDNHFQLERRMNGI"
FT   gene            413972..415456
FT                   /locus_tag="FORC68_0393"
FT   CDS_pept        413972..415456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0393"
FT                   /product="Ferrous iron transport permease EfeU"
FT                   /db_xref="GOA:A0A3T1NWD9"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWD9"
FT                   /protein_id="QBZ17621.1"
FT                   /translation="MSHRLLGRVMLLLGALGVILTMSFSYVAAAEKPNIDKPVKGLEQT
FT                   EKAIVADDYNKAKDAFQEDKLWWSENKQVVKEKSYDLAGQIDRQIAEISLGILNNDKQQ
FT                   AMDGITSLHNLLKTYQDGTYTDNEGNTNITLSSYIAKLTATKKLVDEKEWAKAATQIQD
FT                   LKTEWLAVEGDVVSQSQAAYDNTERDLMLLDAYINDPAKQAKTADVLDGMTDELKPFAD
FT                   VTYTWFDAALIPFREGLEALLIIATLLTYTKRTKTPTAKRWIIGGTAAGLVVSLALGMV
FT                   VAFWLSALAFGDNNNLINGWAGLIASIMMLYVSYWLHRNSDITRWNNYMEGKSNQALSN
FT                   GKMISFAFLAFLAILREGLETVVFLIGMVGRMSNFELLMGILAGLGVLLIIAFVMLRYS
FT                   VHIPVKPFFMISSAIVFYLCFKFMGSGIHSLQLAGVIPTSVEDYLPSIPALSIYPSWYS
FT                   FLPQVLLVIFGLIILIKQQIKKRANSKKELAQGGKL"
FT   gene            415453..416613
FT                   /locus_tag="FORC68_0394"
FT   CDS_pept        415453..416613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0394"
FT                   /product="Ferrous iron transport periplasmic protein EfeO"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWF1"
FT                   /protein_id="QBZ17622.1"
FT                   /translation="MKKLIIVMLTIFTAVLVVGCSGTGAADKAETKKETTKESKQANAV
FT                   KKEVKEMKSNLDDVKKAISDKDKSALQSSAAELHKHWLEFENNVRDLYPLQYTDVEKYE
FT                   TPIFYESKNDNPNFDTLNDNATGLDGALDTLEKAKETKAKTSEVLDKAVDNYSKYVTEQ
FT                   VDEFVAQTEIFTNAVKSGDIEKAKAAYVSPRLNYERIEPIAESFGDLDPKIDARINDVE
FT                   NEADWTGFHVIERALWEKKSLEGMDVYADKLLTDAKALQAEVKNLKLEPKPMVAGAMEL
FT                   LNEAATTKITGEEEAYSHTDLDDLNANVEGSKVVYQAIIPALNAQDKKLADQIDAAFNK
FT                   MEDTLANYKNGDSFVLYTTLTKDQIREISDQLSHLSELMAQTGKIF"
FT   gene            416631..417896
FT                   /locus_tag="FORC68_0395"
FT   CDS_pept        416631..417896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0395"
FT                   /product="Ferrous iron transport peroxidase EfeB"
FT                   /db_xref="GOA:A0A3T2HE21"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HE21"
FT                   /protein_id="QBZ17623.1"
FT                   /translation="MTDKKSENQTEKTEAKENKGMTRREMLKLSAVAGTGIAVGATGLG
FT                   TILNVVDHVDKALTPKEKAETGLPFYATNQAGIITAQQTYCYIASFDIQTESRQILQDL
FT                   FVKWTKFADLTASGGVLRDVDNDMLPPNDTGEADGLGISNFTVTLGYGPTFFEKDGKDR
FT                   FGVKAKKPKYLEKIPHMAHDSLDEAYSDGDLCIQVCADDQQVAFHGIRNFIRLASGVAV
FT                   VRWIEEGFLSAPKNETPRNLFGFKDGTANVDHDSNKGYKDVVWAEEDEPEWMRNGSYLG
FT                   YRKIQMLIEIWDRSSLLDQEDTFGRKKVSGAPYHKRHEHDKVDPSKLPADSHVRLAKDT
FT                   KQQMHRRAYSYTNGIDKSTGTIDAGLLFICFTQNPAKQFLPMLSIMGKMDKLNEYTVPI
FT                   GSAMFACQGGLAPGEVFGEKLL"
FT   gene            417969..418478
FT                   /locus_tag="FORC68_0396"
FT   CDS_pept        417969..418478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0396"
FT                   /product="Putative Nudix hydrolase YfcD"
FT                   /db_xref="GOA:A0A3R0H8B9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H8B9"
FT                   /protein_id="QBZ17624.1"
FT                   /translation="MEEWDLLNENRELTGKTHIRGEKLAPGELHLVIHVCIFNEKGQLL
FT                   IQKRQKDKEGWPNYWDLSAAGSALKGETSQQAAEREVQEELGIMIDLSGTRAKFSYHFE
FT                   EGFDDYWFITKDVQLSDLTLQKEEVADARFVTKEELEALRSSGEFIPYFFLNQLFNLKN
FT                   ATTIHF"
FT   gene            418575..419294
FT                   /locus_tag="FORC68_0397"
FT   CDS_pept        418575..419294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3D7WGN2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WGN2"
FT                   /protein_id="QBZ17625.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHSNQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEADIDVRDILD
FT                   EDGQAIIYAEPEDFHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFERLIDAL
FT                   EDLEDVQKVYHNVELED"
FT   gene            419331..419666
FT                   /locus_tag="FORC68_0398"
FT   CDS_pept        419331..419666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0398"
FT                   /product="Alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A402X1T7"
FT                   /protein_id="QBZ17626.1"
FT                   /translation="MSKLPNCPECNSEYAYEDRGLLICPECGHEWSAAAEEASEEKVFK
FT                   DANGNVLTDGDSVTVIKDLKVKGASNPIKMGTKVKNIRLVDGDHDIDCKVDGFGPMKLK
FT                   SEFVKKI"
FT   gene            complement(419708..420421)
FT                   /locus_tag="FORC68_0399"
FT   CDS_pept        complement(419708..420421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0399"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A3H0RCK2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0RCK2"
FT                   /protein_id="QBZ17627.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYEINEKLPDGDSLARVYDCSKLT
FT                   VKKALDMLVQEGMVIRRRGAGTFVKSHSTNGGEFALGPMSGLVNTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMQDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIRDDLKLKMQSAHVWVRGDKSNQEDSKLLDLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
FT   gene            420578..422020
FT                   /locus_tag="FORC68_0400"
FT   CDS_pept        420578..422020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0400"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="GOA:A0A3T2HE03"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HE03"
FT                   /protein_id="QBZ17628.1"
FT                   /translation="MKELLTFPKDFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEITTDHFNRYKEDVQWMKKTGQNSFRISISWARMFPDDGVGEVNQKAIAFYR
FT                   DLLTEMNENGVKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQAGFNTILAHALAIKAFKKLNLSSKIGVI
FT                   LNLSPTYPRSQNEYDLEAAEICDAFYTRSFLDPMVKGSFPEKLVEIMREYDQMPEYTEE
FT                   DLTIIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNEEGQIQDDYRIQFVKDHLAY
FT                   VHQAIAEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVETGKRTMKKSGEFYKKMSD
FT                   MNGFEYETSKLVGTKREETTNG"
FT   gene            422013..423347
FT                   /locus_tag="FORC68_0401"
FT   CDS_pept        422013..423347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0401"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="GOA:A0A1D2IPJ8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPJ8"
FT                   /protein_id="QBZ17629.1"
FT                   /translation="MAETKKKSIVNGFINVAQRLGGQIHLRSLRDAFASIMPFMILAGF
FT                   VTLINYVILEPTGFMGKIVNPDTLRTWQEIGISIGNGTLSVITLLVTVAISYHLCLNRG
FT                   YKNVIAPILVALSSFIVVTPIAMTFLPEGASKSIEVPNVIPVSYTGASGMFVGIIVGLI
FT                   ATDLFIKLSKNKRMQINLTGNIPPAVIKSFNVLIPIMITVIIFSVMSFAVNQIFSMDFN
FT                   TLVTTIITKPLSYVTTSLPGFLLITSIANLFFGLGIHQAVISGPLLDPFLLQNMQENMV
FT                   AYANHQEIPHIINMAFKDTFAVMGGSGNTIGLLIAIFIFGKRKDYKDISKLSAAPSLFN
FT                   ISEPIIFGLPIVFNPLLIIPFVLAPIFSLTTAYYATAAGWINHVVVQTPWTTPPIISGF
FT                   LATGGDWRASVLQVIIIVVTVFIYLPFLRMDEKVAFATAQKSDAK"
FT   gene            423365..423667
FT                   /locus_tag="FORC68_0402"
FT   CDS_pept        423365..423667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0402"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /db_xref="GOA:L8DS76"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:L8DS76"
FT                   /protein_id="QBZ17630.1"
FT                   /translation="MKNILLVCNAGMSTSFLVEKMKAAGAEQGVEANIWAVSDAELHEN
FT                   WEKADVILLGPQVGYLKGNTEKVVGGKIPVEVINMLDYGRVNGAAVLERAIELIG"
FT   gene            423754..423948
FT                   /locus_tag="FORC68_0403"
FT   CDS_pept        423754..423948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXM4"
FT                   /protein_id="QBZ17631.1"
FT                   /translation="MKYVKSQMKELVKDSVDLQERLQKLMKEMDLEKTFALKALYHSEV
FT                   ADGGAYQTAYQDLDYKYKD"
FT   gene            complement(423987..424907)
FT                   /locus_tag="FORC68_0404"
FT   CDS_pept        complement(423987..424907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0404"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPI3"
FT                   /protein_id="QBZ17632.1"
FT                   /translation="MKIERLIGIIMLLLQRELVSASEMATMFEVSKRTIFRDIDTLAMA
FT                   NIPIYTIAGTKGGIGIMPTYKVDKKLLTVDDLTAIIASLDGMEQLLSSAETKKTLQKMK
FT                   NMLDHSSEPPKSSISLDFSNLSMKNELNAKVESLYLAIKKHQLVELSYIDRTGNQTIRK
FT                   TEPYHLLFRNRSWYLQGYSLERSDFRTFKMSRIVELKTLEETFEARPFSVKPFGAPPDR
FT                   PMFLMHEVSLIVDKIAREQIIERFDLVEISQQDDAHFLAKVTLPDHEAGYRFLLQLGTH
FT                   VTIQNRDDFYDNFVDYLKEIQGKYI"
FT   gene            425010..425429
FT                   /locus_tag="FORC68_0405"
FT   CDS_pept        425010..425429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWK3"
FT                   /protein_id="QBZ17633.1"
FT                   /translation="MAFEIVELKKETFTGDKVEIPEFDPQKGFGPMSEIKESAYTKFAK
FT                   NEKDYVGINASLDGLQYYIVASAKGENGDTTFDIPEGKYAKFVTSETDRPALDGFIGAA
FT                   YGEVSQSDTVGIAGSFNLEDLREAEFTLYIPVVSK"
FT   gene            425648..426094
FT                   /locus_tag="FORC68_0406"
FT   CDS_pept        425648..426094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A456FID8"
FT                   /protein_id="QBZ17634.1"
FT                   /translation="MRKLDFSYNNANYNAEFLMKILTTLKDITKVEQFTIEIIDAVPND
FT                   QEQFKEEKGLFSKEVFDFNNLVKESHGIKIDFKEITNILKQCRTVWELSMLVVTSENEL
FT                   NDSGKVLCEVELIEGDLFAILYSEDFNIDLFLEKFSTDEITIEG"
FT   gene            426112..426567
FT                   /locus_tag="FORC68_0407"
FT   CDS_pept        426112..426567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A460WIT1"
FT                   /protein_id="QBZ17635.1"
FT                   /translation="MFKIIESKIKSQGQLSYFKDSHEFISEPRINSDTTILVGYIYIGF
FT                   DSEYNESTQIWGFHHDFNWKSSKLTPPKFIQGKIILNEDDINPGDSKRIGAANSWETIY
FT                   DESSGWLRFGGVNNSVETCYVEFFPNTIMGIDENGEITELWLCPTLK"
FT   gene            426601..426714
FT                   /locus_tag="FORC68_0408"
FT   CDS_pept        426601..426714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF56"
FT                   /protein_id="QBZ17636.1"
FT                   /translation="MKYFLFIQHKSLKKYYKDDKEKMLILGDKTKKMLNEL"
FT   gene            427082..427363
FT                   /locus_tag="FORC68_0409"
FT   CDS_pept        427082..427363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEB8"
FT                   /protein_id="QBZ17637.1"
FT                   /translation="MVRIKSQYKTYINEMEMQENIVNNILFFSDDEYDISCLKNTINKP
FT                   DLSVHPIDSNYEVITIYMDGDAGMYDWDGIVIIDNNAYLKIDTHYYIN"
FT   gene            427590..427976
FT                   /locus_tag="FORC68_0410"
FT   CDS_pept        427590..427976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A5UR05"
FT                   /protein_id="QBZ17638.1"
FT                   /translation="MINELQKKIDEINYWDLLVLDIQSKYFGDEVYIYIEKDEEICWKL
FT                   SFTSCYKVSYETDAKWRGDFKVRNTGPKSGYYAQDISLNRYAENEDFIECSFDASIMTM
FT                   NIICKEIIVEEVSVIENSFFWKNY"
FT   gene            complement(428049..428810)
FT                   /locus_tag="FORC68_0411"
FT   CDS_pept        complement(428049..428810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0411"
FT                   /product="Transcriptional repressor of the myo-inositol
FT                   catabolic operon DeoR family"
FT                   /db_xref="GOA:A0A3T2HDZ4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDZ4"
FT                   /protein_id="QBZ17639.1"
FT                   /translation="MKVQRIQAIENLIHEKGSVSLDDLCEQFNVSKNTVRRDIAKLLQK
FT                   NTIQKVYGGVVSVYNNPEEIRPFENRDTENHTEKQLIGKAAADFIEENDLIFIDSGTTT
FT                   SCLAAALPTDKEITIITNSLDVINFASEMDNVKLIVIGSTFKPSTKSFVGVENWGFFEK
FT                   YNITKAFMAATALSTTHGVMNSDILEYEIKRHMMEKATEKFLLVDHTKVDKSALLTYGE
FT                   LAEFDWLVTSKKMAGGCLGYCEDVGVLVRLV"
FT   gene            429006..430472
FT                   /locus_tag="FORC68_0412"
FT   CDS_pept        429006..430472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0412"
FT                   /product="Methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="GOA:A0A3A2VBC2"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR023510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2VBC2"
FT                   /protein_id="QBZ17640.1"
FT                   /translation="MADVRKLKNYINGEWVESKTDKYEDVINPATGEVLCQVPISTRAE
FT                   LDQAAVIAEQAFEKWSQVAVPRRARVLFGFQQLLIQHKEELARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PMAIALGNSFILKPSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEGIADEFLEALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIE
FT                   KGIEEGAKLTVDGRETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEA
FT                   VRVANQSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
FT   gene            430485..431306
FT                   /locus_tag="FORC68_0413"
FT   CDS_pept        430485..431306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0413"
FT                   /product="5-deoxy-glucuronate isomerase"
FT                   /db_xref="GOA:A0A460MPK8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR023770"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:A0A460MPK8"
FT                   /protein_id="QBZ17641.1"
FT                   /translation="MGKLLRKPLNERIAPGVTLVQDINQGNSPLSYVGFRLIELEEDAV
FT                   YQETLDGLECCIVALTGKISVSEGDHVFSEIGTRANVFEKIPTDSVFISGGRAFQVKAD
FT                   AEKARVALCYSPADRNLPTTLIKASDNSIEQRGKYQNKRLVHNILPDVSEVASSLLVVE
FT                   VYTDGGNFSSYPPHKHDHDNLPAESLLEESYYHEINPKQGFIFQRVYTDDRALDETMAV
FT                   EHQNAVIVPEGYHPVGVPDGYDSYYLNVMAGPKRVWKFHNDPDHEWILERD"
FT   gene            431323..432300
FT                   /locus_tag="FORC68_0414"
FT   CDS_pept        431323..432300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0414"
FT                   /product="5-keto-2-deoxygluconokinase"
FT                   /db_xref="GOA:A0A3T1NWB6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022841"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWB6"
FT                   /protein_id="QBZ17642.1"
FT                   /translation="MNLKKHSERKFDLITVGRACIDLNAVEYNRPMEETMTFSKYVGGS
FT                   PANIAIGTAKLGLKVGFIGKISDDQHGRFIEKYMRDLAINTDGMVKDTEGRKVGLAFTE
FT                   IKSPDECSILMYRENVADLYLTPEEISEDYIKEARVLLVSGTALAQSPSREAVLKAVSL
FT                   AQKNDVVVAFELDYRPYTWKNTEETAVYYSLVAKQADVIIGTRDEFDMMENQVGGKNEA
FT                   TKAYLFQHQAKIVVIKHGVEGSFAYTKAGETFQAQAYKTKVLKTFGAGDSYASAFLYGL
FT                   FNDESIETALKCGSAAASIVVSKHSSSDAMPTADEIKALIAQAE"
FT   gene            432310..434229
FT                   /locus_tag="FORC68_0415"
FT   CDS_pept        432310..434229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0415"
FT                   /product="Epi-inositol hydrolase"
FT                   /db_xref="GOA:A0A4V1C349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C349"
FT                   /protein_id="QBZ17643.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTVFGHGN
FT                   VVGIGQALEEDPGHLNVYQGKNEQGMAHAAIAYAKQKNRKRIYACSASAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSAAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPTTICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAVRLIQASKTPVIIVGGGARYSDAREELITLSEQSNIPLVETHAGKSTVEFDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFGLATKFININVSRMQTYKLD
FT                   AFQVVGDAKATLAELAPLLKGYQTQFGDRIAAYKAEWLAERTRLQNTKFNREAFTPEIK
FT                   DQFDQATLNEYADSLQTEFTQTEALITINDTVAPDSIVVCSAGSLPGDLQRLWNPAIPN
FT                   TYHLEYGYSCMGYEINGALGAKMAAANNQEVYSIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   INALEDAKKQTKTTLIDMKVLPKTMSEGYLNWWNVGVSEVSNKASIKQAYEEKQANLKN
FT                   ARLY"
FT   gene            434363..434734
FT                   /locus_tag="FORC68_0416"
FT   CDS_pept        434363..434734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A471N8C2"
FT                   /protein_id="QBZ17644.1"
FT                   /translation="MEVFAEYLAEIENPDHRARTQEVLTWVAETFPDLKPEIKWNTPMF
FT                   TKNDTFIIGFSIAKQHMSVSPEAAGIERFEAELKEAGYSHTKGIFRITWAKPVDFDLLT
FT                   KVIEFNIQDKANYTSFWRV"
FT   gene            434828..435196
FT                   /locus_tag="FORC68_0417"
FT   CDS_pept        434828..435196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:L8DS90"
FT                   /db_xref="UniProtKB/TrEMBL:L8DS90"
FT                   /protein_id="QBZ17645.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMVLAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPIVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
FT   gene            complement(435220..436335)
FT                   /locus_tag="FORC68_0418"
FT   CDS_pept        complement(435220..436335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0418"
FT                   /product="Low temperature requirement protein A"
FT                   /db_xref="GOA:A0A3T2HDY1"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDY1"
FT                   /protein_id="QBZ17646.1"
FT                   /translation="MTERKVSWLELFFDLIFVTAVASTTHLLLSVDNHPDKTAAYFGEY
FT                   LLMVTPMFWAWVGQTMFFNRFGEKIKWPELYMLSQMFFLILMTASFDLTFSNTYYTFLI
FT                   GYLGIRFITVIQYFVISKQLTGNAQKVALLLGSVFLLGVLTTATSVFFEGFARYLVMYL
FT                   GIAVDIILPLFLAKTLRKVPVDFPHLAERFGLFVIITFGESIVAITTILVGHTLDLYTI
FT                   CYTLLGFLIICTLWASYFYSFEKIVDHHKVTHGQFLIYGHFFIIVSVMLLAVNLHLLFE
FT                   GHLQRDVLLLLLFSSVAVFFISKQFVFAAHKKAEVTFSFWKDALLLLLLVGLFFVNLYI
FT                   NLPLFVSFVSIWICALVDLGLQFGTSRSVRM"
FT   gene            436421..437131
FT                   /locus_tag="FORC68_0419"
FT   CDS_pept        436421..437131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0419"
FT                   /product="Uracil-DNA glycosylase, family 1"
FT                   /db_xref="GOA:A0A4P7MEC6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEC6"
FT                   /protein_id="QBZ17647.1"
FT                   /translation="MEGQNHGTTETGELKMVKTWEEFLKQEAKQPYFIELMEAVKDARA
FT                   KGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNI
FT                   YKELKTDLDIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEEL
FT                   NNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLE
FT                   EHERKPIDWDLNEQ"
FT   gene            437299..437598
FT                   /locus_tag="FORC68_0420"
FT   CDS_pept        437299..437598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A255BU83"
FT                   /protein_id="QBZ17648.1"
FT                   /translation="MKHNFTEDDFVYGESWGLVHRGVLEDKEVERMKALRDKVVGKKGV
FT                   AQTTLKPIGSVRIDGEVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK"
FT   gene            437595..438539
FT                   /locus_tag="FORC68_0421"
FT   CDS_pept        437595..438539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0421"
FT                   /product="DUF1432 domain-containing protein"
FT                   /db_xref="GOA:L8DWR0"
FT                   /db_xref="InterPro:IPR022853"
FT                   /db_xref="UniProtKB/TrEMBL:L8DWR0"
FT                   /protein_id="QBZ17649.1"
FT                   /translation="MTMIGPIIIAVLIIIFLIVFFTLVPVGLWISALSARVPVGLGTLI
FT                   GMRLRRVVPSRVVKPLIKAVKAGLDLEVNQLESHYLAGGDVDNTVDALIAAHRANIELD
FT                   FSRAAAIDLAGRDVLEAVQTSVTPKVIRTPEFTGVAQNGVEVKVITQITVQSNIERIVG
FT                   GAGEDTVIARVGEAVVSTVGETREHTDVLENPNSISKKVQEQGLGDGTAYTILSIDIAE
FT                   MRIGDNIKAKLDIEKANADMEVAQAAASKRKAEAIALEQENRAAVVAAEAEVPRALSRA
FT                   LEEGNLGVMDYYKMENVQSDTAMRESIAHEDEK"
FT   gene            438574..439023
FT                   /locus_tag="FORC68_0422"
FT   CDS_pept        438574..439023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PXL7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXL7"
FT                   /protein_id="QBZ17650.1"
FT                   /translation="MDLSDFLNSGWESVLVVLGIVGVIINFLSKAGKGTEEENKKAPQP
FT                   RPNLRSMHQASRTQTTKKPEKRKVSQGTFTQNKEQDKVIAEQKAAQQKMLREIRRESDV
FT                   AKGKNIIKSTSSHQKKARKLRGRLQEAIITKEILDKPVSLRKNHL"
FT   gene            439167..439850
FT                   /locus_tag="FORC68_0423"
FT   CDS_pept        439167..439850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0423"
FT                   /product="NLP/P60 family protein"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FZL5"
FT                   /protein_id="QBZ17651.1"
FT                   /translation="MNIIATRRKIFFAFIALMISFSVLFLPTTNASAATTYKMTTTADV
FT                   NVRAADNTKGKVIGFYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKCVTTYKAPVATT
FT                   QSFTALNNEARKHIGKRYKIGATGPSCFDCSGYTQYVYSKGVKKSIPRTAKQQYASAKK
FT                   IKAKELKKGDLIFFNYGKGVAHVGIYVGNGKMLNAQNNGVKYDTITSGYWKKYIAGYGR
FT                   VANLK"
FT   gene            439906..440331
FT                   /locus_tag="FORC68_0424"
FT   CDS_pept        439906..440331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0424"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A4P7MPK8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPK8"
FT                   /protein_id="QBZ17652.1"
FT                   /translation="MQYKIKEMPLEELEPKVVEGLLEHKERLGYNIPKKDTEYIGFAAL
FT                   SEVGEMVGGVTAKISYGELHVSLLSVDPSTQGSGVGTELMAQIERYGRANSCHHISLTT
FT                   FSYQAPEFYRKCGFTELGRVKDFPIKGEEKYFFIKYL"
FT   gene            complement(440334..441134)
FT                   /locus_tag="FORC68_0425"
FT   CDS_pept        complement(440334..441134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0425"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /db_xref="GOA:A0A3H0R315"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R315"
FT                   /protein_id="QBZ17653.1"
FT                   /translation="MNRIGFIGAGNMGTAMIRGLAQANLVKREEIIVGGRNLEKLKPLE
FT                   AEFTGLQITTDTEKLVEQADIIILAVKPYTIPEILTSVKEKLTPDKIIISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSVSPNTNVTSEELKEVTAIFTSFGEAEVVSEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAAKKNSSM"
FT   gene            441262..441744
FT                   /locus_tag="FORC68_0426"
FT   CDS_pept        441262..441744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393H7L0"
FT                   /protein_id="QBZ17654.1"
FT                   /translation="MNEAIERRDDDMTIVSFEVEISAPIQEVFALLTTNTGLAKWFNEL
FT                   EVGELGADGYLLFVMTPEEKITMPIRAFEPNQKLAFEWDQDEVAFELNKITANKTRLTF
FT                   TEQLTTITEHSPRDISGWHICLKKLQASAEGKIYDFNKTEFKTLFAKYQKELNIEK"
FT   gene            441914..442372
FT                   /locus_tag="FORC68_0427"
FT   CDS_pept        441914..442372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0427"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /db_xref="GOA:A0A4P7MEQ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEQ8"
FT                   /protein_id="QBZ17655.1"
FT                   /translation="MIVSEEQLFLNQHLSTKEEVLAFIADKAAEIGITTNSAQVERDLW
FT                   AREKEYATAVQQLIAIPHAKTEAISEAKLLFIRLVEPIDWESKEGFKAQAIFAILVPAS
FT                   EASQQHLKILSSVAVNLLEEAFQEQILTIKTEHELMDYLKDNLEGELI"
FT   gene            442369..442701
FT                   /locus_tag="FORC68_0428"
FT   CDS_pept        442369..442701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0428"
FT                   /product="PTS system, fructose-specific IIB component"
FT                   /db_xref="GOA:A0A1C7PXM7"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXM7"
FT                   /protein_id="QBZ17656.1"
FT                   /translation="MKVVGVTSCIAGLAHTPMAAKALEKAGVKLGHDVKIEQQGAMGTI
FT                   DEITPAEVSAADVVIIAADKVIDGEDRFKGKPVVRVKIGQCVANGEAVLSKVVAAIEAR
FT                   KQKEAN"
FT   gene            442705..443817
FT                   /locus_tag="FORC68_0429"
FT   CDS_pept        442705..443817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0429"
FT                   /product="PTS system, fructose-specific IIBC component"
FT                   /db_xref="GOA:A0A0B8RGC4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8RGC4"
FT                   /protein_id="QBZ17657.1"
FT                   /translation="MKGKLNEAKDHLMSGISYALPVIIAGSLVVAVAKLIGIIGGVTNL
FT                   DAYADASGFYHYVYLFQNVGWAAIGLLNLVLAGYIAYSIAGKPALAAGFVGGVLATSTN
FT                   AGFLGAVVAGFFAGWLTNWVKKHVRITGPAASSLPLIILPLITVGATGILMSLILGGPL
FT                   GWLNQTLLDWVTEMCKNDTNVIILALILGAMIGFDLGGPVNKAAWMAGNALFMSGIYLP
FT                   SIMINVAICIPPLGYGIATLLRKKNYSTTFKEAGNGALIMGLIGVTEGAIPFTLRSPGK
FT                   LIPLNVIACAIGSAVTMGLGAYVKMPPIGGMYGFFTIGNGWAYLVGGLVGAFIIGICAN
FT                   LFVNFTEEETAAADDAVDDIDISFDEIEIK"
FT   gene            443833..446466
FT                   /locus_tag="FORC68_0430"
FT   CDS_pept        443833..446466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0430"
FT                   /product="Alpha-mannosidase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ76"
FT                   /protein_id="QBZ17658.1"
FT                   /translation="MKMAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAK
FT                   DDYHFYLMDAQSSLIEDYLRYCPEDKSRLEKLIAEKRLITGPWYTQTDQLVISQESIVR
FT                   NLLYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEF
FT                   IWQGDDGTEMLAEQIPFGYYYGANIPENEAELKTYLDEQIGALEEKASTPNVYFPNGLD
FT                   QAPVRKNLPELVAKFNELDSTREYQIASPETFFADLEKDVTNLPVIAGELTEGKHSRLH
FT                   KSIFSTRADLKQANNQIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDS
FT                   IGGCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSG
FT                   VIKMTAYIPEDNFTVEDTQGNTLEYTILEKTDLTEYVLNQHIDLNPSRPVYLPEKVFLA
FT                   TMLVNVNNLPALGYDTIYFNLEKETAEQEPTQSAATKIENEFYEIQLAANNSLTIHDKK
FT                   AGRTYTDQMIFVENGDDGDSYNYSPPRKDLVISSKEAVVESIESSISSVNQAFTISFKL
FT                   NVPYNLEERANGEKNNEMIIKTVISLRKNEELIRFDVQIANQVLSHRLCVTFATEIASK
FT                   FSTADQLFAPIKRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDESHGVAVMTEGVR
FT                   EYEIIGENYDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALT
FT                   LFESSFDEATIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKTLDATYSLALPTIDG
FT                   AIISAVKKAEDSDAFITRFFNPYLQKEITIPEIFQGKERHLDESKSNEKQTTLKHAKVQ
FT                   SYLFEK"
FT   gene            446500..448434
FT                   /locus_tag="FORC68_0431"
FT   CDS_pept        446500..448434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2CTT5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CTT5"
FT                   /protein_id="QBZ17659.1"
FT                   /translation="MGYFAYKRLETLYGMLLDAGSHLSAQKLSQDLHISERTIRTDIAK
FT                   LTEFLESHGATITLTRGAGYKIEILDPTVFQAFQAEKNKPKNADYFDLDNPEERVKYEI
FT                   FLLLSSADYIKLEDLADTLFASRATISNDMKQVRKVIASYDLTLVSKPGSGVKIVGDEE
FT                   KMRYALTALIASKNAPESYLESFFEWHKQKDKLQKLMTAVTDYFFATNIRFTDEALQNL
FT                   LLHMMILVERIEFGHTLEQFELTDVSEEEILIAAKLATILESLFEIEIADADKNYLLLQ
FT                   IASKRILNVEDKEISEFDDYAYIEGLLNRIESHYFYHLQDDMQLKKDLVAHIHSMLYRV
FT                   KYHMTVKNPMTEHIKRYYPLAYEITLDAVESLKKDYPYDINQNELAYLALHIGASLERN
FT                   YQISYYRHKSALIVCGSGFGTARIVEAKVKSAVSNLDITKVVSIQEYNRFIHIEEDIIL
FT                   STVRIPEKNKPVIKISNIPTNEELKMLGAIIQEQTDPNRGFLSNFFTADFFERSSMTNK
FT                   TAILEEMVDSLRQQNIVGEGFLQSVLEREKLGSTVLGTGIAIPHPLGLMAKETKIVIRI
FT                   LDKPIKWDQKQSVRAVFLLCISKNDYEEAINIYELLVELVREEYGEKLSRLSDFNAFTA
FT                   LANDILKKK"
FT   gene            448560..448976
FT                   /locus_tag="FORC68_0432"
FT   CDS_pept        448560..448976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3H0R447"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R447"
FT                   /protein_id="QBZ17660.1"
FT                   /translation="MNRQTEFTLLIVGASLSILTFLGAMLYTIIFGLNTLMVADTFGYY
FT                   SSSEETILLGIITFFSVVAAFFALGSAVFGFIGAFKVKSDGPKVKTLGVCFIVLGGLQV
FT                   FTIHGILFLIAGILTITKKEYKTNSKEDEGTKWE"
FT   gene            448967..449365
FT                   /locus_tag="FORC68_0433"
FT   CDS_pept        448967..449365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IPE3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IPE3"
FT                   /protein_id="QBZ17661.1"
FT                   /translation="MGMIAFLPIFFIFAMFLGLAAKALLAIWIYKDAEQRGMNAVLWCL
FT                   LMVFINVIIILVIYLIVRNKGEVMKQNLGLLISGIGIAVLNTLMAIIAFIFIISFAVSD
FT                   GGMHNMMDGYNYDYDDGYEYDMDNFEDF"
FT   gene            449474..450481
FT                   /locus_tag="FORC68_0434"
FT   CDS_pept        449474..450481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0434"
FT                   /product="low-affinity inorganic phosphate transporter"
FT                   /db_xref="GOA:A0A3R0GVX7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0GVX7"
FT                   /protein_id="QBZ17662.1"
FT                   /translation="MDTVILITVIIVIVGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGIAAVMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHALIGAIAGASIASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLF
FT                   HDKKLGKMNRRFRFIQIGTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWV
FT                   QVSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
FT   gene            450497..450877
FT                   /locus_tag="FORC68_0435"
FT   CDS_pept        450497..450877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0435"
FT                   /product="glyoxylase family protein, Lactoylglutathione
FT                   lyase"
FT                   /db_xref="GOA:A0A2Z5C0T9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C0T9"
FT                   /protein_id="QBZ17663.1"
FT                   /translation="MKIEHVALWTTNLEQMKQFYVTYFGATANDLYENKTKGFTSYFLS
FT                   FEDGARLEIMSRTDVTGKTTGENLGWAHIAISTGTKEAVDELTEKLRQDGFAIAGEPRM
FT                   TGDGYYESVVLDPEGNRIEITW"
FT   gene            450946..451338
FT                   /locus_tag="FORC68_0436"
FT   CDS_pept        450946..451338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009530"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IP81"
FT                   /protein_id="QBZ17664.1"
FT                   /translation="MDIVTNKIVVEKYNFETIVEENEQFENKIELEVHEVEPVNGNVEL
FT                   MSKGKIFKITIPFLLVLENFRIDGRISRIIQLKDFFGDFSDLEAVDVEGLSNPLIDYIK
FT                   RLTYDVTEIAFDEPGVSLDFNANHNS"
FT   gene            451351..451773
FT                   /locus_tag="FORC68_0437"
FT   CDS_pept        451351..451773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C0X7"
FT                   /protein_id="QBZ17665.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAV
FT                   ISQDGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
FT   gene            451999..454464
FT                   /locus_tag="FORC68_0438"
FT   CDS_pept        451999..454464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0438"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T1NWI3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWI3"
FT                   /protein_id="QBZ17666.1"
FT                   /translation="MKSKNNYFKQIITIMTVVSLLIMVLGIQGNNDVKAATQVAPPASI
FT                   NQIFPDADLAEGIRAELQKSSVTDVVTKEELESITQLSVYAKKIASIEGLEYLTNLKFL
FT                   NLNGNQITDLSPLSNLTKLTEIHIGDNKISDISPLQNLVNVTNLYLKDNDISDLSPLAN
FT                   LTQMYSLRLGGNSNISDLNPVRNMTRLDNLEVTESILKDLTPLADVTSLTRLSLSYNQI
FT                   EDLSPLAGLTKLNDIAAYSNKITDITPVTNLTRLQYLSLGDNEITDVSPVANLQKLTSL
FT                   QLANNQITNISMLEDLTNLTSLDLQHNKISDISVLGNLTHVTYLQLGYNQIVDVKIIGG
FT                   LTNLTSLQLTQNHITDISPLANLTKIQYSDFSNQMITNPERNFSKTLSVPNNITGIDGT
FT                   LVAPETISNNGTYDAPNLKWSLPNYLPEVKYTFSQKIPIGTGTSNYSGFITQPLKELLD
FT                   YKVTFNVEGNTSEVETVTEENLIPEPTSPTKQGYTFDGWYDAETGGTKWDFTTGQMPAN
FT                   DLTLYAHFSVNSYQANFDIDGVVTNEAVVYDTLLNEPTTPTKQGYTFDGWYDAETGGNK
FT                   WDFKTMKMPANDVAFYAHFTINNYQANFDIDGEVKNETIAYDTLLNEPTTPTKQGYTFD
FT                   GWYDAETGGTKWDFKTKEMPANDVTLYAHFTINNYQANFDIDGAVTEEVVNYDALIPEP
FT                   TSPSKTGFTFEGWYDAEVGGTKWDFKTMKMPANDITLYAHFIKETPIIPSPDEGLDSDS
FT                   TNGPITINEPSATSTPSQNNDITVTAGENTTELATAKLPKTGDNAPWKTLFAGILLSSS
FT                   AFYIWRKKA"
FT   gene            complement(454512..457115)
FT                   /locus_tag="FORC68_0439"
FT   CDS_pept        complement(454512..457115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0439"
FT                   /product="Pyruvate-utilizing enzyme"
FT                   /db_xref="GOA:A0A3T1NWD6"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWD6"
FT                   /protein_id="QBZ17667.1"
FT                   /translation="MKPYVLKFQEIQPHSEALVGGKGMNLGACSNIEGVHVPAGFCLTT
FT                   EAYKRTLAENNEFTQLLQRLSSLKTSDMDAIREISETIRTLIQHTQIPSEITSDMDAAL
FT                   LDVGGYEMPFAVRSSATAEDLPHTSFAGQHDTYLNIIGRDALLQHISMCWASLFTERAI
FT                   IYRIQNQFDHHKVQLAVVIQQMISSEASGILFTADPITSNRKSLSIDASFGLGEALVSG
FT                   LVSADSYTVQENTITNKIIATKKLAIYSLKEGGTETRILEKSQQTKQTLTDQQILQLAK
FT                   LGRKIEAYFGKPQDIEWCLAEGIFYIVQSRPITTLYPIPEVSEPGNRVYISVAHQQMMT
FT                   DAMKPLGLSFYLMTTPATMYTAGGRLFVDITQSLSAKVSRDMMVNSLGQSDPLIKDALL
FT                   TVINKKGFLPPLPTEENPSQAPVSGKPPVRSIPDSSSVFELVRNSENSIKHLKQSIETK
FT                   SGSDLFDFIVEDLEELKRVLFNPTSIDAIMAGMDASAWLNEHIYQWLGEKNVADKLSES
FT                   APNNITSQMGLELLDVADVIRPYPAVRAYLEQTKNPDFLNELATLDGGAETRKALEEYL
FT                   QKYGMRCAGEIDLTKTRWIENPLTLIPLILSNIKNFEPGASMHKFAQGEKEAFDKEHEI
FT                   LRRLQELPDGEQKAMETKEKIDILRHFIGYREYPKYGMINRYFIYKLAFLRASEQLVNN
FT                   GVLQNKEDIYFLYFEELREVVRTGHVDYELINARKRDFATFEKLTPPRILTSDGEMING
FT                   KYKRENLHKDAILGLPVSSGTVEGRARIILNMEKVDLEDGDILVTAYTDPSWTPAFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENATTIIKDGQQIRINGTEGYIEILD"
FT   gene            complement(457315..458193)
FT                   /locus_tag="FORC68_0440"
FT   CDS_pept        complement(457315..458193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MQ80"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ80"
FT                   /protein_id="QBZ17668.1"
FT                   /translation="MYMTGLGTLLFLVGIGVLIFGLVSFRRKNWPRKKTQIIIISSILA
FT                   IIIGVGIIPTTDEEASTEEPTKQQEKTEKVDNTPVLKAETTFITDDEGTLVVEGKTNPG
FT                   AEVTLDFVAIPDAVTTADENGAFSLSVNELDKAQDAVLSMVIDGQTKEQTLKLALTPAY
FT                   ETKIAEKAEAERVAAEKAEAERVERERVAAEEKRAADAKIAAEKKAEEARVAAEKKAAE
FT                   EKRVAAERSKAAAAQPDTSNEQGQMVYITATGKRYHYDQNCRGLNNSNGETAVTVAQAE
FT                   AQGLTLCKFEQ"
FT   gene            458531..458722
FT                   /locus_tag="FORC68_0441"
FT   CDS_pept        458531..458722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X269"
FT                   /protein_id="QBZ17669.1"
FT                   /translation="MAKPIEEIGEEIGAKVEKVARKTGNVAGTAAKLSVYSSIWAVKTG
FT                   VNKTRAFAQGFKQGWSGK"
FT   gene            458749..459558
FT                   /locus_tag="FORC68_0442"
FT   CDS_pept        458749..459558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0442"
FT                   /product="Metal transporter, ZIP family"
FT                   /db_xref="GOA:A0A1C7PXP4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXP4"
FT                   /protein_id="QBZ17670.1"
FT                   /translation="MLNYLSSLNPVLLALLAGIFTWACTAAGASLVFFFKNLNKKWGNI
FT                   MLGFAAGVMLAASFWSLLAPAIEMSKDLGKFSFVPALVGFLLGGIFLRVIDRIIPHLHF
FT                   GFPEQAKEGPKTSLRKSILLVLSITIHNIPEGAAVGVAFGAVITGDTETLITAIVLALG
FT                   IGIQNFPEGAAVSIPLRGEGLSRGKSFWYGQLSAVVEPIFAVIGAVLVVFVTPILPFAL
FT                   AFAAGAMIFVIVEELIPESQVEGSADLATAATMAGFAVMMVLDVALG"
FT   gene            459852..461252
FT                   /locus_tag="FORC68_0443"
FT   CDS_pept        459852..461252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0443"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /db_xref="GOA:A0A1D2IYL0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYL0"
FT                   /protein_id="QBZ17671.1"
FT                   /translation="MKIRWIRLSLVAILIIAVVFIGVIGFQKYQFSKSRNKVIMQMDRL
FT                   MKDQDGGNFRRLDKKENGVEIISYIPKTTEKKDNEIIQKEIGKATDAEVKKLNRDKETQ
FT                   GIIFYTYQKHRMAEQAISYKAVQSEYVKEGRTKFVLKDKKDICKNIVTDAETGALLTLG
FT                   EVLIKSNQTKLNLKTAVEEELIKTGDFSLKDVGNLGKIKSLVKWNQTDFEITNSEIILP
FT                   VKIPGAPEPKKVKVKLADIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSSSVT
FT                   PGVLDTLKRHNVKATFFVLGSSVIQNPGLVKRELEEGHQVGSHSWDHPQLTKQSTQEVY
FT                   NQILKTQKAVFDQTGYFPTTMRPPYGAVNKQVAEEIGLPIIQWSVDTEDWKYRNAGIVT
FT                   KKVLAGATDGAIVLMHDIHKTTAASLDTTLTKLKSQGYEFVTIDELYGEKLQIGKQYFD
FT                   KTDSRMVK"
FT   gene            461379..461582
FT                   /locus_tag="FORC68_0444"
FT   CDS_pept        461379..461582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0444"
FT                   /product="HigA protein"
FT                   /db_xref="GOA:A0A0D8X050"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X050"
FT                   /protein_id="QBZ17672.1"
FT                   /translation="MKVRNKVKQLREERGIGQNELALALEVSRQTIHAIEKGKYNPSLE
FT                   LSLKMARYFRLTIEEIFQLEEN"
FT   gene            461584..461994
FT                   /locus_tag="FORC68_0445"
FT   CDS_pept        461584..461994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PXI2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXI2"
FT                   /protein_id="QBZ17673.1"
FT                   /translation="MKRYIINRGIMVAVVIIYMYPLLGIIKGEKIFGDIGTPIIMVIAA
FT                   LIGTLSSVFLSEEKTKREYEKEKLEKDERYINNRKTFSYYLLIVLALTIPIVLIVLNLY
FT                   GIEQISISSLTIIFLIFCFAYMIVLEIIRKKV"
FT   gene            complement(462047..462346)
FT                   /locus_tag="FORC68_0446"
FT   CDS_pept        complement(462047..462346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:L8DSB5"
FT                   /protein_id="QBZ17674.1"
FT                   /translation="MRSLDAVEILRRGETIERYKEGGNSMLPLIKSMQPVRLEPIGMRE
FT                   LKVNDIVFCKVRGSFFTHKISKIRGKQYQISNNHKHVNGWITRNSIYGIVTKIW"
FT   gene            complement(462426..462980)
FT                   /locus_tag="FORC68_0447"
FT   CDS_pept        complement(462426..462980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0447"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A1C7PXS6"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXS6"
FT                   /protein_id="QBZ17675.1"
FT                   /translation="MSKGRLEAFSDGVFAIIITIIVLGMTLPDVFTAASTQAFLWEIFI
FT                   FIEGGLIIGQFWYSHSRLFDQVTFISTSAVLFNILFLLVLSLIPLFTRAIMQHPDMTAP
FT                   IIGFVITILITSVIFQLLHHAVNGKDSGIDNWKFRISSFIFVIALGIISFFAPQISTIL
FT                   FIIFPIAGWIIQLTNRRQPPK"
FT   gene            463128..463940
FT                   /locus_tag="FORC68_0448"
FT   CDS_pept        463128..463940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0448"
FT                   /product="Cof-like hydrolase"
FT                   /db_xref="GOA:A0A3R0H3G8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H3G8"
FT                   /protein_id="QBZ17676.1"
FT                   /translation="MIRAISVDMDGTFLDGNGEYDRARFEKIYAELMKRGIKFIVASGN
FT                   QYYQLKSFFPGKDEELFYVAENGAVIFHQGELRSVNRFDERLVQKILRTLIQDYHDLQV
FT                   ILCGVKSAYLLKAADPDFKAFAKKYYFELQEVESFDVLPDDTFIKFALDVEVAKTGQIV
FT                   EDLNQTFVGEIRAVSSGHGSIDIIIPGVTKGNAIQQLLNEWQVAPEDLLAFGDANNDIE
FT                   MLQLTSNSYAMLESSPEVLAAAKHVAPSNKEAGVLQVIEEYMKKSQRF"
FT   gene            complement(463992..465242)
FT                   /locus_tag="FORC68_0449"
FT   CDS_pept        complement(463992..465242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0449"
FT                   /product="Cell division protein FtsW"
FT                   /db_xref="GOA:A0A4P7MEE6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEE6"
FT                   /protein_id="QBZ17677.1"
FT                   /translation="MSSSTFEEYLGKVIANVKSKQAHSMIKKELSNHLEELSHSFQKRG
FT                   LSIEDANKKAMQEMGDPSTVGRNMNQLHKPRMDWLLIALFILLAGISFLPIIGDVVASN
FT                   SSFMKKQIVWLAIAVLALIGFLFFDYRKLKDLWMYFYAAALILFFTTFLVGIPLTGGGR
FT                   WMSLWGIAIDSPAISLFLFFIAWAGIFTNANAFKGWKKQVVLLILFWVPVISYIIINRF
FT                   VFSIMYFLCVLVMYIFYYRHNRFAIKVALGNLLVGVIFISTMILKYPSSYLPDTSIPLK
FT                   DILSKAGWFGKGLHNNLILPEAHTDFVFPFLVYSLGWVFGIFLCLLLVVFILRISRNAF
FT                   KTKDLFGRLLTIGGAILFTVPACWNILMGLGIVPIMVVPLPFISYGGSMLLVYAALLGL
FT                   ILNVYRRKDIVESTLVN"
FT   gene            complement(465239..465670)
FT                   /locus_tag="FORC68_0450"
FT   CDS_pept        complement(465239..465670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0450"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW97"
FT                   /protein_id="QBZ17678.1"
FT                   /translation="MDDPFYNLKDSIKKDFEGFSFSEERKNAVKKTIRKKQSHLELHSW
FT                   KIETLQNILDALQDEAKHGYEISTQLFQKNELSFKNNEGQLYILLHLLENKKILSSKWI
FT                   EGKKYYSLTAKGKKFVATFELRDSKQHGSLKNLIEEASL"
FT   gene            complement(465673..466221)
FT                   /locus_tag="FORC68_0451"
FT   CDS_pept        complement(465673..466221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0451"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="GOA:A0A3T2HDV8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDV8"
FT                   /protein_id="QBZ17679.1"
FT                   /translation="MTELEEIGIHINSIENTEQIISQLMDNYSDDVLHLVFSYVKNRTT
FT                   AEDLTQEIFIKCYEKLGQFNNKSSIKTWLYRIAINHCKDYLGSWHYRKLNFSEKIWDYL
FT                   PSKSKHVEEEVIAKNVANSLMSAVMDLPVKYREVVFLHYYEELSLANISKITGVNSNTL
FT                   KTRLKQARELLKNKMKKEV"
FT   gene            complement(466401..467258)
FT                   /locus_tag="FORC68_0452"
FT   CDS_pept        complement(466401..467258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0452"
FT                   /product="sugar transporter"
FT                   /db_xref="GOA:A0A3A2JQ26"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2JQ26"
FT                   /protein_id="QBZ17680.1"
FT                   /translation="MSIYLIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFALI
FT                   LFWILSPEITVLSFIVSFISGIFWSFGQLLQFKGIAASSVAKAMPISNGTQLVGATLFA
FT                   VLVFREWQTVTAVVIGVVAVILILIGVVMTGFQKRGNHITESVSFHVYGIVILSSFFLT
FT                   LYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKKTAISRKNVTFNLMTGLSWSIANL
FT                   GMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLEWTFILSGILLIMVGVVFL
FT                   SLLK"
FT   gene            467419..469380
FT                   /locus_tag="FORC68_0453"
FT   CDS_pept        467419..469380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0453"
FT                   /product="Transcription antiterminator, BglG family"
FT                   /db_xref="GOA:A0A3T1NW75"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW75"
FT                   /protein_id="QBZ17681.1"
FT                   /translation="MKAVTKMIANREKNIIQFLMKTGQTRVGTIANHLGLSEKTVSNSL
FT                   KEIDVFLKDFDMTVVRKPKIGVYIEGDNKAFAEVSRFLDNQVSQIPSTKEERVIYIFSK
FT                   LLKADDYITIHQLADELYISRSTIEKNMVEVTKMLEKEGITLYKKPSKGMKLLISEREK
FT                   RALTSKFITNFWGNNWYLKQEGEKVLQAFDTIQADVTGIFPEEGLKEIIAIVQEFSERH
FT                   DFTFTDYAFQSIVIHLAIAVERIREGEYVENVESDPMKDVFESQRNNTEILVGMLEERL
FT                   DIKIPAFEVGYIQLHLTAAYNQQHDELLVNTPPQEDDVADFVSRCLAEGNYDKGLLEDL
FT                   TTHMKSAINRLKLGMHFKNQYLSKIKQNFPQAFEEALYFKAKFEQKYDVQVNEDETAYI
FT                   ALHFEAYKERSRSFPDQIRVVLVCSTGLGSSRLLAARIKKYFPMITIEKILSVQALMET
FT                   EVDVDLVISTIYLELEDIPSIVVSPMMSKADLQQVESQIERTRRKKKKRSQPFVDLIKP
FT                   KTIFAKLDVATMGEAIAEIGDKLVEQGIAKPGIVESALKREALSFTSFEEMATPHAEPA
FT                   LINESRIAIATLKHPVKWGLIDVDKIFFIALTEQNGINLDAMYEQFYKYIDNKKWLEKL
FT                   TQLKSAAEIYEHLLKDGM"
FT   gene            469380..469844
FT                   /locus_tag="FORC68_0454"
FT   CDS_pept        469380..469844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0454"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /db_xref="GOA:A0A3T1I0P5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1I0P5"
FT                   /protein_id="QBZ17682.1"
FT                   /translation="MEVKDILTKELVVFDLEAATKEAAIEEMAELLDERGILADKATYV
FT                   RAVLDREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVESLKNTRDKEEVIRILNGGVVEI"
FT   gene            469841..470161
FT                   /locus_tag="FORC68_0455"
FT   CDS_pept        469841..470161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0455"
FT                   /product="PTS system, fructose-specific IIB component"
FT                   /db_xref="GOA:A0A0D8X5L9"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X5L9"
FT                   /protein_id="QBZ17683.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
FT   gene            470174..471280
FT                   /locus_tag="FORC68_0456"
FT   CDS_pept        470174..471280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0456"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="GOA:A0A3T2PF77"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2PF77"
FT                   /protein_id="QBZ17684.1"
FT                   /translation="MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITD
FT                   IWDAKYADSANSLISLLHSLDGFGGLALGMMFPVIAAFIGYSISDKLALAPGLVGGLLA
FT                   RDIGAGFLGALAAGLIAGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVV
FT                   GIPFADLNTALENWLNGMSGSNQIMMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIY
FT                   APNTAAQVAIIIPPLGLGLATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESP
FT                   LKVIPATVLGSAVGGALAVGLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMS
FT                   VALRKASAGEEMAGSSYDDEIDEAEWEA"
FT   gene            471296..473878
FT                   /locus_tag="FORC68_0457"
FT   CDS_pept        471296..473878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0457"
FT                   /product="Alpha-mannosidase"
FT                   /db_xref="GOA:A0A3T2HDZ9"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDZ9"
FT                   /protein_id="QBZ17685.1"
FT                   /translation="MVKAHIVNHTHWDREWYFTSADALVLSEQLFTEVIDELKKHPEAN
FT                   FVLDGQLSILDDYVALYPEKLADIKQLIADEQLFIGPWFTQTDAFFAHGESILRNAMIG
FT                   IFDSKKYGDYMKIGYLPDTFGFNAQMPTLLEHAGFDNVIFWRGIHLGEHVASPYFKWQG
FT                   LGEEASIYAINMPQGYGTGMLLEPTSAYVDGRLDPAIDFIEKYSKTTEVLIPSGNDQLN
FT                   IISNFAEKLAEINKMGRHDYQLSTYQDFIQYVRELPNLEKYRGEFRSPVLARVHKTIGS
FT                   SRMNIKLKSASLEQKLLTRIEPLLVIAKASGISISERLLMHTWKKLLEGQAHDSLAGCV
FT                   SDPVAEDILHRMKEADELCDSIENTIVKKIADDLSLAANEIIVFNTDSHDFDGYKEIQV
FT                   VTEHKNIHFPAFPDATIVQEEFIPSRENVLEETPAGNRFIEEPGYYVLQVRVKVELPGL
FT                   GYRVITFEENDRELDSMLASNNATIQNESYKITFQDGEILLQKPNGERLTSFITLEDDV
FT                   NAGDTYDYSPLAGDVAELFTFSATNTEKSSEVERLILTGKSDFPLDRLTKEGHGDLQIK
FT                   LILEVKKGSELLDVKVEVDNQIKNHRLRLKVNTGVKTDHNIASLPFGYIERKPVVPANW
FT                   QETYSEMPIDIEPLEQSVTLTNETASCTIFTRGVKEYQQLDQDLALTLLATTGQLGKPD
FT                   LAYRPGRASGDTTKKGHVLIETEGAQLLGKHQFRLAIYLGDQAFDEHKTAERTKTFNQA
FT                   NVSYQRQPFNHFLHRLDNKIQKTERKLGAKQTLAMLNLPKEYLVSACHPSYYTADKYII
FT                   RLENPTNTPQKLAFPDMSFEYVNAIEEVVGNDNNTIPAYGAVTLRLDI"
FT   gene            complement(473901..474776)
FT                   /locus_tag="FORC68_0458"
FT   CDS_pept        complement(473901..474776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0458"
FT                   /product="Chromosome initiation inhibitor"
FT                   /db_xref="GOA:A0A393RJW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393RJW3"
FT                   /protein_id="QBZ17686.1"
FT                   /translation="MELRVLNYFLTVAREKTISRAADVLHLSQPTLSKQLKELEEELGV
FT                   TLFIRGNRSITLTEDGLYLANRGKEILSLVELTTSNLLQNETISGKIMIGAAETRGFEF
FT                   IGSLLHELREKHPDITFQLHSGNADDVLEKIEHGLLDFGLVINPVEKLQYDYLPLTIED
FT                   TWGILVNTKHPLAKKTVVTPSDIETNPIVVSNQSFIDNQLASWLGGHFEQLNVIGRYNL
FT                   LYNASLLAKENIASILCIDGIINTENTNLKFIPFSPPLTAGLSIVWKKNQTFSSASKEF
FT                   LRLIQKTCSK"
FT   gene            474894..475463
FT                   /locus_tag="FORC68_0459"
FT   CDS_pept        474894..475463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0459"
FT                   /product="Maltose O-acetyltransferase"
FT                   /db_xref="GOA:A0A1D2IZ73"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IZ73"
FT                   /protein_id="QBZ17687.1"
FT                   /translation="MIEQDLQNRLVDQEILHGSDLLDEIHEVKQNNEQLIIELNTKYHT
FT                   KKEVTKYLSDITGKPVDPSVDVSLPFYSDFGKHITFGKNIFINLNVTFVDLGGITIEDN
FT                   VLIGPGARLVTVNHLVSPKKRRGLRVAPICVKKNAWIGANTTILSGVTIGENAIVAADA
FT                   TVTKDVPPNVIVAGSPAKQIRKIIEE"
FT   gene            475477..476223
FT                   /locus_tag="FORC68_0460"
FT   CDS_pept        475477..476223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0460"
FT                   /product="Sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="GOA:A0A471ADE3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A471ADE3"
FT                   /protein_id="QBZ17688.1"
FT                   /translation="MTIKNKVIIITGASSGIGKATALLLAEKGAKLVLAARRVEKLEKI
FT                   VQTIKANSGEAIFAKTDVTKREDNKKLVELAIERYGKVDAIFLNAGIMPNSPLSALKED
FT                   EWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVAGLKAYPGGAVYGATKWAVRD
FT                   LMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKETEQGMTSLYKQYGITPDRIAS
FT                   IVAYAIDQPEDVNVNEFTVGPTSQPW"
FT   gene            476904..479306
FT                   /locus_tag="FORC68_0461"
FT   CDS_pept        476904..479306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0461"
FT                   /product="Internalin A"
FT                   /db_xref="GOA:A6P4V7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A6P4V7"
FT                   /protein_id="QBZ17689.1"
FT                   /translation="MRRKRYVWLKSILVAILVLGSGVWINTSNGTNAQAATITQDTPIN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLSNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQAWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGSYAEPDI
FT                   TWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKAIFNVKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGHTFVGWFDAQTGGTKWDFSTDKMPTNDIDLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDIDGKTTTQTVDYQGLLKEPKAPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTKPPSANIPGSDTSNTSTGNSASTTST
FT                   MNAYDPYNSKDASLPTTGDSDNALYLLLGLLAVGTAMALTKKARASK"
FT   gene            479391..481283
FT                   /locus_tag="FORC68_0462"
FT   CDS_pept        479391..481283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0462"
FT                   /product="Internalin B"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR038200"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW87"
FT                   /protein_id="QBZ17690.1"
FT                   /translation="MKEKHSPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIK
FT                   QIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLF
FT                   LNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHL
FT                   PQLESLYLGNNKLTDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISD
FT                   LRALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKP
FT                   NVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEA
FT                   GTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKVETTEKAVNL
FT                   TRYVKYIRGNAGIYKLPREDNSLKQGTLASHRCKALTVDKEARNGGKLWYRLKNIGWTK
FT                   AENLSLDRYDKMEYDKGVTAYARVRNASGNSVWTKPYNTAGAKHVNKLSVYQGKNMRIL
FT                   REAKTPITTWYQFSIGGKVIGWVDTRALNTFYKQSMEKPTRLTRYVSANKAGESYYKVP
FT                   VADNPVKRGTLAKYKNQKLIVDCQATIEGQLWYRIRTSSTFIGWTKAANLRAQK"
FT   gene            complement(481369..481854)
FT                   /locus_tag="FORC68_0463"
FT   CDS_pept        complement(481369..481854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0463"
FT                   /product="Rrf2 family transcriptional regulator, group III"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S0D7"
FT                   /protein_id="QBZ17691.1"
FT                   /translation="MKGLKKMKYSIQFSDAIHILAYIEIFKNTNLLSSEIIAGSVKTNP
FT                   ANIRKIMSNLKKADLITTQTGKANPILARPPEEISLLDVYKSIEGNTNLIHVDPKTNPD
FT                   CVVGANIQQVLTSKYDLLQQKIEFEMEKIKLDSIVRDISVLESKDRPQNMEIIEKFL"
FT   gene            481952..482797
FT                   /locus_tag="FORC68_0464"
FT   CDS_pept        481952..482797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0464"
FT                   /product="NADPH, quinone oxidoreductase 2"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HQX6"
FT                   /protein_id="QBZ17692.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSKEKGADLKAA
FT                   GFNIRVGDYSDAESMKQAFAGIDRVLFVSGAPGNRQVEHENVINAAKKAGVSYIAYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEN
FT                   GKVGWALKREYAEVAAKAVAGADFPAILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSVGLPQAVAEMFLSFQHDIKNNQLDVVSDDFEKALGKSLTNRVDALRELLK
FT                   "
FT   gene            482935..483570
FT                   /locus_tag="FORC68_0465"
FT   CDS_pept        482935..483570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4V1C354"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C354"
FT                   /protein_id="QBZ17693.1"
FT                   /translation="MKEGKRVKKLVAWFNGLSKIWKVVVIIGTVFVVIIALTTGEDESE
FT                   QTKTKTSSNKIVKTASKPKFSTKDLALIKADLAEFEARELSSEKILKDTIKEESWSDLD
FT                   FANDNINQMIGTMKRYQQEILNIDAIKRSSEASADTEAFKKIFKEWSEFKIERIQVTID
FT                   LLNGKKDSEAVFKKTYPNQIIFKKVRTNKLQTALNNLKVGYELLDSQK"
FT   gene            complement(483603..484871)
FT                   /locus_tag="FORC68_0466"
FT   CDS_pept        complement(483603..484871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0466"
FT                   /product="Siderophore/Surfactin synthetase"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDV4"
FT                   /protein_id="QBZ17694.1"
FT                   /translation="MVKITTYPAEPSDVKHYISGEKMKNDHHLHTVLTFDNHLNIDVLK
FT                   KAVMQSTKKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVKTQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRTDTSDQLVVIMNHMLADGAGFKEYLYLLSELYSNLLENPDYAANLSL
FT                   GSRSLKQVFDQLSRKEIKSIFTEKTKQKAVHNPTFPLKGDPKNPKVIWTKLPKEHFSEI
FT                   IHFAKEHEATVNDVLFAAMARTVQQTTGQQEMSIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISADDDLTSFESTLQAVKNSLNPQKNSFAPLRIYYLLELIFKKKNYSVAKKASEKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSTLTDCFICGSLKYAPFFQVAATTFRGSLTLSTNLH
FT                   GTAQDHAWQKEFLEQMISEFPSK"
FT   gene            485009..485512
FT                   /locus_tag="FORC68_0467"
FT   CDS_pept        485009..485512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDZ0"
FT                   /protein_id="QBZ17695.1"
FT                   /translation="MTNRTLTTKLLGTLSYTQENGTMMDAVIPLDGKEVKVDYSIFEKL
FT                   TSEDYFKDIVTLTDQIPELHLKAKKTILEQFDENDTLTIYFEFHTDELPEEVLEVTECD
FT                   ALENVTKEILIDKLVLSGVWFSENANNELDLTFDFKLLPEVSDELLVVRFDNKGEITEL
FT                   THES"
FT   gene            complement(485556..487592)
FT                   /locus_tag="FORC68_0468"
FT   CDS_pept        complement(485556..487592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0468"
FT                   /product="Penicillin-binding protein 3"
FT                   /db_xref="GOA:A0A3T1NWF0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWF0"
FT                   /protein_id="QBZ17696.1"
FT                   /translation="MASYGGKKRNNKKTIIIGSIAAVVVLAGIAIYFFIQNQHKDEKNA
FT                   LAAAETFTSNIAKEKYDKLGSSVSNESLKKVEFTKKEMEDKYQAVYDGIGAKNIKVKNL
FT                   KSVYDDKENKFNLTYELEMRTSLGKLATQKYKTTISKQDDDWKIDWKPALIFPGMVKTD
FT                   KVRITEDDAERGQIVDRNGNPLATTGQFAEAGVVPSKLGEGDEKVKNIADISKKLEVST
FT                   DYINKQLDQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGE
FT                   VSAEDIEKNPKLSVGDVIGKSGLERYYDKQLRGKNGGAIKIINDQTKQEDTLQKIDKKD
FT                   GEEIKLTIDAAVQKKAFDSLGSETGAVTMINPTNGELLALVSTPSYDANQMVLGITSED
FT                   YAKYNDDKRLPFLARYANRYAPGSTFKTITATIGLDTGVTKPDKVREISGLQWQKDASW
FT                   GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFDKEYNLPFTM
FT                   KPAQISNDGLNSEILLADTSYGQGELLMSPIQQAIAYSAIANDGKMPYPKLDTKEKAGK
FT                   ETQATEAKSANQVKAALVKTVSDPAGTAHALEIQGHSIAAKTGTAELKEKQGEDGLENG
FT                   FVYAFDADNPNYLMVGMIENVKGRGGSGLVIDKLKPVIESMYK"
FT   gene            487764..488078
FT                   /locus_tag="FORC68_0469"
FT   CDS_pept        487764..488078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NWA9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NWA9"
FT                   /protein_id="QBZ17697.1"
FT                   /translation="MEEMEQPEKKVIIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNIPENNTNGTMQGPGGSEMPSGTPPSGEPGQAPNSSDDSSDSGTSDSTTSSDGPL
FT                   "
FT   gene            488215..489144
FT                   /locus_tag="FORC68_0470"
FT   CDS_pept        488215..489144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0470"
FT                   /product="Cell envelope-associated transcriptional
FT                   attenuator LytR-CpsA-Psr, subfamily F1"
FT                   /db_xref="GOA:A0A4P7MQ92"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ92"
FT                   /protein_id="QBZ17698.1"
FT                   /translation="MARHAQKRKARKGRIFVTILVALLILVGVVAVIGYFQYQSSLKEA
FT                   QNESKLKDYKFNGAKAVGDEINVLLIGSDSRGEDQGRSDSLMIAHYNTKTNTPKLVSIM
FT                   RDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVQYYVVANFEGFPKIVDTLAP
FT                   EGIKINAEKDMSKNIDANIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEALK
FT                   EQAIDVGDVGKIPDVIGKLQGYSSTNIPTGTLMSIGADFLLGKTETMEKFAIPVEGKWH
FT                   NERIDGAGAVLRLDDVAANAKALQDFLK"
FT   gene            complement(489192..489740)
FT                   /locus_tag="FORC68_0471"
FT   CDS_pept        complement(489192..489740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW61"
FT                   /protein_id="QBZ17699.1"
FT                   /translation="MKKVSSLLTQDQFWGIIDNSDKGSKLEELLEKLSEDELFGYDYWW
FT                   NYFHKKSYNQSLWAVAYVVLGGCSDDGFDYFRYWLLTRGKAVFTSAMENADTLCDEFDL
FT                   LTEDEYPENEEVAYLVMDVFENKLGKDFDDAENEAASRIEFEEVSMPPIDFEWDEDDED
FT                   SIKKVCPNTFAKWWNNDKF"
FT   gene            489975..490700
FT                   /locus_tag="FORC68_0472"
FT   CDS_pept        489975..490700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0472"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A0D8X293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X293"
FT                   /protein_id="QBZ17700.1"
FT                   /translation="MKDKTKKRKWNWAQILAIFVLVTLVVSMVYATVNLITAPSGNVPE
FT                   GQQTKGDYSLMLMQCVLGVVVLFLPSIISKKMKFVIPNAMYIVFIVFLYCAIYLGEVRS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNDERITLSMSPVFVALFACSFAVFLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISIIGYFSIR
FT                   KNKKWMKNFEFKKVDEEVK"
FT   gene            complement(490743..491408)
FT                   /locus_tag="FORC68_0473"
FT   CDS_pept        complement(490743..491408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2F560"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2F560"
FT                   /protein_id="QBZ17701.1"
FT                   /translation="MARSRQISESIGLGLLLALAGGFMDAYSYIERGQVFANAQTGNIL
FT                   LFGINISEGNWAIAIQYFWPVVSFTVGIALSEVIHRRDIRRLHWRQLSVLIEAVILIGV
FT                   AFIPLDHNLIANSLISFVCGIQVESFRKMHGRGVATTMCIGNLRSATQNLCDYFEYKEK
FT                   QYLHNSFLYFSVILSFIIGAVVGNFFIQLFAQYAILVCAFLQLIAFMMMFIDRESKII"
FT   gene            complement(491429..492184)
FT                   /locus_tag="FORC68_0474"
FT   CDS_pept        complement(491429..492184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR032357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW56"
FT                   /protein_id="QBZ17702.1"
FT                   /translation="MTTIFPKEQNVTPLFEQILANPIACRRFKDVFLDNLESYQETRGF
FT                   EKDDTLFAKIILSAYRQSDVSALLLGVCGRTLFELLRQAFLIPKKLTVDNPFFLTDKEG
FT                   NFIAKKDDISNREQEKFQEIYQSDLHHSETTIFLVDDDDIVHSYEPDFSISTKRINKKR
FT                   GILVLYSLPNTLKLEMTESEVYAFIWKTFLHIQEIIPSSRIFYGQETSENADELGVFLP
FT                   IHHFEKKMLQNIEQVNELVDALREQMVNK"
FT   gene            complement(492302..494461)
FT                   /locus_tag="FORC68_0475"
FT   CDS_pept        complement(492302..494461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0475"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   protease"
FT                   /db_xref="GOA:A0A3T1NW63"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW63"
FT                   /protein_id="QBZ17703.1"
FT                   /translation="MKRYLTLVMLFILSVLLISEWIYPFAELTELSTANWIILFITLSL
FT                   GSFFLRLKYYWTIPLHVVMIIIISGIYYAKGGILAGNWLGSFFQITFNGFRDMVQFRSS
FT                   DISMDFILIVFLIALWLLSYITTYSILRKQRVMSVLVLTVAYLAVINTFTDYNSNWAIV
FT                   RTVLEGFLLLHLALASRIAAPNRISADSLKRNGLFYHIFVILLLAAFVFSSLMLPKKAP
FT                   IFPDPIPTIKNALGINTTRTVGYSEDDTTLGGALKKDNATVFTARAEKGHYWRVESKTV
FT                   YTGTGWANANSGDVISFSSGDNFPIQLTEQTTGATNTAEISFASSSDYMPYPYGTQAVN
FT                   GAVDSFSANLTIERVGPVDTIKNYTVQLKTPVYNIEKMQNADFSTLSNAFVSQYTQTPK
FT                   DLPDRVTKLANKVTKDADSIYDKTKAIESYLSTSGTFTYSTDDAKETPMGADYVDQFLF
FT                   ETQIGYCDNFSTSMVVMLRSLGIPARWAKGYTPGEGEKKENDAKTTYTITNNNAHSWPE
FT                   VFFPGTGWVPFEPTATFSNPENFQEPTTETANKPETPNDSTSTPETPNTPDKTPEQDNG
FT                   SSSTGETPKKEEPKTETATSNVEIPSWVWWIPAGLVVALLALAIVFRRRIRGYLLLRSL
FT                   RNSPEFGKTYHRLMKLLASYGYVRESSETLRHFSARVDADLTTSEFSRLTKMYETQLYS
FT                   KNLTEKVIAAEETQLVQQIIARLTK"
FT   gene            complement(494458..495606)
FT                   /locus_tag="FORC68_0476"
FT   CDS_pept        complement(494458..495606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A401AA95"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A401AA95"
FT                   /protein_id="QBZ17704.1"
FT                   /translation="MLKKRLLLAFRWIIMLIIYAGLWTYTLFQGDTASWFLTYFFSFIL
FT                   LLLFLSSIYPLKAWKVNRSFVKNTYHDGDLIDMQVSFTRKSRYPVGYLLFQQKIPATFG
FT                   KVRARQQVVYPLFKKQFTVTLAGFVGVRGIHSFPPVDVETSDAFGLLERSRQLSSEKSL
FT                   TIYPTYFPNVLEKISEASPENERNAAYWTLKKNSNLHSLREFSSGDRISLIDWKSSAKS
FT                   DQLMTREFENSATSRLSVIFYGASHPNFELSLRAAYSFIRKISEENGEIRVTLLGDQTS
FT                   KFAPAKGTSRLQDISTAFAEIAPVDSLTLQESLDSNLHSGEKILLFTPCMDTMLMQKVT
FT                   RLTDNKQLQIITFQSEHSKAMDAPAIFLEQASLLSRWERETK"
FT   gene            complement(495611..496558)
FT                   /locus_tag="FORC68_0477"
FT   CDS_pept        complement(495611..496558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0477"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="GOA:A0A3T1N924"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1N924"
FT                   /protein_id="QBZ17705.1"
FT                   /translation="MSIEPSIKIEEIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLSKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPVMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSVTVDGITRKLANPFFVMATQNPIEYEGTYALPEAQ
FT                   LDRFLLKINIGYPTVKEEMQLLTLKQYQDPLDQTQQVVTLSELLDLKNKAKQVFIDDVL
FT                   KNYIIRLVDATRKHPSVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETAESIIASILKNTSVPVEKR"
FT   gene            496714..498309
FT                   /locus_tag="FORC68_0478"
FT   CDS_pept        496714..498309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0478"
FT                   /product="Regulator of polyketide synthase expression"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDS1"
FT                   /protein_id="QBZ17706.1"
FT                   /translation="MSVKLADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLE
FT                   DDLFDNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKMDQK
FT                   LIDFANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPP
FT                   QRNIDTTLKILSDRTHSSLVLTDNSFQVINSITWPRTRHWDFERVIETSKQIDEHELVQ
FT                   LHLDERDFYTARKPIFQDGMQAMHLFMMKEKGALTADVVMQITEVVQVFMNLWGRNYVE
FT                   ISTAELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRNNEQVLAELKSFVAS
FT                   HFQVSLIDLFEDNIVVLLDNSVAQRDRTHTANEFAMMMKEHGIDLKITVCQGMEQTSDV
FT                   QSAYSLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKSLEDN
FT                   DELIETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLA
FT                   VAIRRLLGGNNNNK"
FT   gene            498443..499726
FT                   /locus_tag="FORC68_0479"
FT   CDS_pept        498443..499726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0479"
FT                   /product="Cytosine/purine/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /db_xref="GOA:A0A1C7PXK7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXK7"
FT                   /protein_id="QBZ17707.1"
FT                   /translation="MTEKKTVEQAQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVVFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPILLFV
FT                   CIYGLVVSLNNGGLAVVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMIAVGAILALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAIAGGLGTVLAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVPGVNWLGVTSWLVGAVIAGIPVILTFFPALPQLPNQPLIG
FT                   IILSLAVYLVGAKVLSGKTNNVENLEGK"
FT   gene            499727..500827
FT                   /locus_tag="FORC68_0480"
FT   CDS_pept        499727..500827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WIJ2"
FT                   /protein_id="QBZ17708.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTNSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
FT   gene            500820..502370
FT                   /locus_tag="FORC68_0481"
FT   CDS_pept        500820..502370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0481"
FT                   /product="N-methylhydantoinase"
FT                   /db_xref="GOA:A0A3T1NW50"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW50"
FT                   /protein_id="QBZ17709.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQQLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGFLSGKYKLTGGGYEYDGQVLSEINEAEIRETLASWKGEVESVAVVGVFSSLKNDQEL
FT                   AVQKIIEEELGANIPVSISSSVGSVGLIERENATILNAALFKVIAATSDGFEKALEQEG
FT                   IEHAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIISIGLGGGSIVRENDGDITIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGVAEIGNPELVAHIPTDFAEKAYKKIADMTEDAIDKM
FT                   KTSSGSVSLVLVGGGSVIIPDEISGVAQIFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREEALQGAEQKAREQATLAGAVTDSIEVVEVEEIPLAYHPGNATRLRVKVVGNLV"
FT   gene            502680..502808
FT                   /locus_tag="FORC68_0482"
FT   CDS_pept        502680..502808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MHZ6"
FT                   /protein_id="QBZ17710.1"
FT                   /translation="MNKETEQKLAASFTSKSIKILPFIPYFSQGFFGLGSSTKDII"
FT   gene            502870..503001
FT                   /locus_tag="FORC68_0483"
FT   CDS_pept        502870..503001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MED6"
FT                   /protein_id="QBZ17711.1"
FT                   /translation="MLGKLQGTVKEDGYVIIDKAYVPELVRNNEMKYQNHEYLTRNE"
FT   gene            503191..504729
FT                   /locus_tag="FORC68_0484"
FT   CDS_pept        503191..504729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0484"
FT                   /product="Glutamate synthase, NADPH, large chain"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7B502"
FT                   /protein_id="QBZ17712.1"
FT                   /translation="MREYLDSKSQKKVALLEKIFYAENHTSTQEELLNDLNITYPTLIS
FT                   TIKTINFDIERFGYKAFSIVHSAPNLSYTLKISDNCSIQLIINAYIRESPKFQILETLL
FT                   LASFPNLQALAKKVHVSYSGIKKEIKELNEELRERNLSISTGNQVEITGDEFSLRIFYA
FT                   FLFLVTYSGDRWPFSFVQYDEITDLLESCPKEIYRANSIDKGMMIHYYVAMHLLRDRMN
FT                   CQIDTTRQFKVALYKACTEESKKSESAFIKKVAKQLPNRNYKEITYTTQIILSTIVAFG
FT                   SYSSIEKMPSFFYMDEQLEEMGFMKLVDFASERVNDNLSIPFSEKEMELLRYSFASINY
FT                   RYFLLDNLINRFNNIVPGYTDLDRNIRKIHKVNHLEPLISQLVNLKEMRLLKPFEERLA
FT                   SDYLIILDKRIDFSIHTLPIKVTILSTISNETAVFDFMRYFSSYYNLEIINQVDPVVDL
FT                   YISDFSVSPEVLTSLRINQPIVYVNTRWLESDYVKINDNLAKIARKKFIANKKD"
FT   gene            504979..507048
FT                   /locus_tag="FORC68_0485"
FT   CDS_pept        504979..507048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0485"
FT                   /product="Glutamate synthase, NADPH, large chain"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW41"
FT                   /protein_id="QBZ17713.1"
FT                   /translation="MKKLSMRVILIVTVIFIACGSANVSIAQEMDIANKLPEEELGSLD
FT                   TSNVNTEGVPQDKSAEVENLEEIPITDDLEQNPDVLEQPVADSDDSDLTVVDSGAYWTI
FT                   YHNTANGEYSLHMFGNVPSSKPTAWNSYLNSIKHIEIEEATLTGDFSSYFRSFFFTALE
FT                   SVRIERSNLSGVKSFALAFYSSGIEKVIIRDNDYSTAPSLLTTEGMFKNCSNLTELDLS
FT                   GLDTSAVTTMRDMFYSCSALEELDVSHFDTSSVTNMSYLFYDNEKLEKLDVSNFDTSLV
FT                   TNMYAMFEDCTSLEELDVSNFDTSSATDIYRMFESCVKLKKLDVSNFDTSSVTDMAYMF
FT                   RNCSTLEKLDVSNFNTSSVTSMRAMFAGCTSLEALDISNFDTSSVTDMASMFLTCTSLE
FT                   ELDLSTFDTSLVDFMGYMFKDCTNLKTLYLNNFTDAASTIDMFTGTTSLTYLFVSHNFK
FT                   VFNGLEDTNWYDEKNWVQFETVWQLQTYHWRQSEPIGYRKGAFLSLTMDAMGGQFEDME
FT                   EQKVQNKVFGDYWEEMLPVKDGHYFDGWYLDQDFTSKFDFSLPADASITIYAKWIENYT
FT                   VVIPASIFLNETSELKVEGINRGDKTLSVGLNRTATSISESNELTLANTADTTVQCLAP
FT                   LSWDGSENNPKNAILTLAPGSEITEGDAVMEIESPENIQAGKYTGNLVFSINYE"
FT   gene            507184..509253
FT                   /locus_tag="FORC68_0486"
FT   CDS_pept        507184..509253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0486"
FT                   /product="Glutamate synthase, NADPH, large chain"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NW40"
FT                   /protein_id="QBZ17714.1"
FT                   /translation="MKKLSMRVILIVTIIFIACGSANVSIAQERDTINILPEVELGSLY
FT                   TSDLITEEVAQDKPVEVENLEEAPITEDLVQNPDVLEQPIADSDDSDLTVVNSGDFWTI
FT                   YRNTVNGEYSLHMFGNVPSSKPTAWNSYLNRIKHIEIEEATLTGNFSSYFRNNVFTVLE
FT                   SVRIERSNLSRVTSFALAFYSSGIEKVIIRDNNYPTAPSLLTTEGMFKNCSNLMEVDLS
FT                   GLDTSAVTTMWDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTSSV
FT                   TNMYAMFEDCTSLEELDVSHFDTSSVTDMYRVFNGCEKLKKLDVSNFDTSSATAMVQMF
FT                   RNCSALEKLDVSNFNTSLVTDMRAMFAGCTSLEVLDVSNFDTSSVTNMAAMFSDNEKVE
FT                   KLDLSTFDTSSVTNMGTMFKNCTALKSLYLDNFTHAASSTDMFTGTTSLSYLFVSHNVS
FT                   NFNGLENTNRYDEKNWVQFETLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGQFEDAE
FT                   EQKVQNKFSGEYWEEVIPVKEGHYFDGWYLNQDCANKFDFSLPADTSITIYAKWIENYT
FT                   VIIPASISLNETSELKVEGINRGDKNLSVGLNRTATSISESNKLTLTNTADTTVQCLAP
FT                   LSWDGSETNPEKAILTLTPGSEITEGDAVMNISIPENIQAGKYTGNLVFSIKYE"
FT   gene            509319..509792
FT                   /locus_tag="FORC68_0487"
FT   CDS_pept        509319..509792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A393UCP0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393UCP0"
FT                   /protein_id="QBZ17715.1"
FT                   /translation="MKKKRVVIISLLLLLVSVIGISSYFLFKDKINLLDVDHSAVDWNG
FT                   KKQKDTSGEENTIAIPGFEKVTLYANETKQAVNFHNPEINDCYFKISLIHPDGSVLWIS
FT                   DLIEPGKGMYSIELEKTLAVGEYENAVLKYECFSLNDQSPLNGSEINLKLVVV"
FT   gene            509812..510297
FT                   /locus_tag="FORC68_0488"
FT   CDS_pept        509812..510297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H1ZEH5"
FT                   /protein_id="QBZ17716.1"
FT                   /translation="MNKLVLSTLSVAAMGMVFFSGGTAYAADKEGNTVVEYSVEGDYTL
FT                   VVPEKVNLSNDNATEMSVKTINRNLEPGKEVEVTLSSGLSADGEIELQRVGATSDVITS
FT                   SFKSNNSVVPMANPVIGSFSGYAMEETEVSKIQIGNPQGDKKAGAYQTTLTFTAAFK"
FT   gene            510325..510630
FT                   /locus_tag="FORC68_0489"
FT   CDS_pept        510325..510630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0489"
FT                   /product="cell wall surface anchor protein"
FT                   /db_xref="GOA:A0A3T2HDX0"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2HDX0"
FT                   /protein_id="QBZ17717.1"
FT                   /translation="MKRKLVLAMVLISFCGMFLLSPERVQASQTVVEVLISEDDLDVSE
FT                   ENIQEIPKKELAASSDKDNKQHMLPKAGDTVTNYTLLGLVLVLIWLIMQRKRKKKE"
FT   gene            510706..510972
FT                   /locus_tag="FORC68_0490"
FT   CDS_pept        510706..510972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0490"
FT                   /product="transposase"
FT                   /db_xref="GOA:A0A3T2I542"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I542"
FT                   /protein_id="QBZ17718.1"
FT                   /translation="MARIEYGEEIQKSLLVLYSRGSTIDSICKEYGIPRYEFHKWMKLH
FT                   DADKLETKEVKTLLQIRELKQQKNKLEEEILFLNEAINLLESP"
FT   gene            511507..511797
FT                   /locus_tag="FORC68_0491"
FT   CDS_pept        511507..511797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ17"
FT                   /protein_id="QBZ17719.1"
FT                   /translation="MQMREIKVDERTFQQHATKLASESTGSYLPLKNGNMAYSRANSID
FT                   QLRSALIELVDVVEDFQHVTKKDASRLKKMGIAYAKQDQLMGQKINQLEVR"
FT   gene            511798..512166
FT                   /locus_tag="FORC68_0492"
FT   CDS_pept        511798..512166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MIF1"
FT                   /protein_id="QBZ17720.1"
FT                   /translation="MDSAHSQLEQQLQQIKKAKITAETDVDQTRRKQNEQDWLEEDSNQ
FT                   LTQEKLVLLDFLRSGWQGEEASGFHRYLEEQQHEESQAWRRDLQDKRTDLDKELQENKD
FT                   KLHTLETKQATLQKEWSK"
FT   gene            512163..513539
FT                   /locus_tag="FORC68_0493"
FT   CDS_pept        512163..513539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A401AAF0"
FT                   /protein_id="QBZ17721.1"
FT                   /translation="MSRIDIAELNDFLHGLRSSNAEAKEMIRKIKEAAMDYAQDDRLKG
FT                   EAVTTSKRYFKSTYTSICQSIIEALDESEERLAQYIREFGSQVDSSPSARIDAEILQEA
FT                   MAKVSQLQRKEEDLHRQLTAPNTKPDMQQVYVVKSRSIHTQLLKAIEQENILEKYLAFE
FT                   QSHGQFFNALAELIQATGRAVQELLHHVTFNDKTGTYAVPKSAANSLLLMKRALDNART
FT                   ENDKDPFPKAFEDYTVLAYTYVNDQGETVTMWLLEKDGKRVENKELQDFLEKHGQELDT
FT                   LLYTSLSGEELERKVNDSWKEGINYLNGQKVSGLSGATLRSSAYVASMKDWTDDAGLTD
FT                   MALSLGFGIAAARNKVIIPKKTSTAKSSGKDIFNYTDKVNEHMANLDRAVPVQTLKEAI
FT                   KGGIPMPDPRGSRATMYYSEIYINGKKYNFEVLYDNTTNTIYHFKYDRRPLGPLSAISK
FT                   "
FT   gene            513561..513833
FT                   /locus_tag="FORC68_0494"
FT   CDS_pept        513561..513833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1E7E7G4"
FT                   /db_xref="InterPro:IPR015287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E7E7G4"
FT                   /protein_id="QBZ17722.1"
FT                   /translation="MTKKEQLYFLLNGLDNGEIEINNFTNQFMKIFDLEIDYDELSKEE
FT                   YTILGNVSDMAARFSDSEEDLKLPNVYYSEKQIREEVTRSLEALA"
FT   gene            513861..514208
FT                   /locus_tag="FORC68_0495"
FT   CDS_pept        513861..514208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A476BYY5"
FT                   /protein_id="QBZ17723.1"
FT                   /translation="MQKDTYNGIRLSVIQLIDSKKENLKENNIKLTIIKNEKDGYVVEL
FT                   DNDKCMAEIVVEEPTYAPYRYISFEVVSLMDGKVKIIYSWYDDETSQWSDIEKELNKGI
FT                   QFLNNFKTMEQ"
FT   gene            514612..514854
FT                   /locus_tag="FORC68_0496"
FT   CDS_pept        514612..514854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MLZ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MLZ7"
FT                   /protein_id="QBZ17724.1"
FT                   /translation="MKRIILTSTLIVWTIVCIYMSISMVSNNTGIAFPIWLHIILLICF
FT                   LATSIVNVKKKEYLWSTMLFEGELVVLLSLIIVLV"
FT   gene            complement(514937..515917)
FT                   /locus_tag="FORC68_0497"
FT   CDS_pept        complement(514937..515917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0497"
FT                   /product="Putative dNTP triphosphohydrolase, Archaeal
FT                   subgroup"
FT                   /db_xref="GOA:A0A4P7MEX1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEX1"
FT                   /protein_id="QBZ17725.1"
FT                   /translation="MMKMTDPLYGTFEIEPVLAELIQSPLVSRLAHVHQGGSSYLVNPL
FT                   WDLSRLDHSIGVMLFIRKFGGSLEEQIAGLLHDVSHTAFSHVVDYALDFEEEDYHEQIF
FT                   EDFVKTSTIPAILEKYGYSFEGIFEDISKWEILEQEAPELCADRIDYTLQDLYRHGKIS
FT                   LAEVEGFLQALVMVNGRLYLANISSAEWFVKQYYSEVIDYFYDPLNVYSYEILAEAMRI
FT                   AFQQESITTADLRLTDAELLAKLNANSDIREKIQLLASPHLEENEVDFTYHHKKKMRLI
FT                   NPSVLVDGRLIPADELSEKVREMNDWASERSKHGIYIKATKKSKQ"
FT   gene            516044..516181
FT                   /locus_tag="FORC68_0498"
FT   CDS_pept        516044..516181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MFF3"
FT                   /protein_id="QBZ17726.1"
FT                   /translation="MKTSSGGVRLVLVGGGSVIILDEIPLVYHLANAPRLHMKVVGNLV
FT                   "
FT   gene            516265..516414
FT                   /locus_tag="FORC68_0499"
FT   CDS_pept        516265..516414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MEJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEJ4"
FT                   /protein_id="QBZ17727.1"
FT                   /translation="MVLYEIGYLLEGLNGLFYFSMYKIMYIDTICVILNINLSKSILNV
FT                   LIFA"
FT   gene            516631..517008
FT                   /locus_tag="FORC68_0500"
FT   CDS_pept        516631..517008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0500"
FT                   /product="putative secreted protein"
FT                   /db_xref="GOA:A0A3T1NP26"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NP26"
FT                   /protein_id="QBZ17728.1"
FT                   /translation="MKKYKKWWITIGIIFLLSVIGYVYWFAIPKNTANKAVGNYLAEQK
FT                   IKSSQIDTRVIKKNWKMGGYLTKIVFKDDPNLKYEYSYDERIDLPYHVFVDAYKDGSGQ
FT                   TEGEMKHPPLEEQLEEMNKSK"
FT   gene            517308..517667
FT                   /locus_tag="FORC68_0501"
FT   CDS_pept        517308..517667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0501"
FT                   /product="putative secreted protein"
FT                   /db_xref="GOA:A0A3T2H636"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H636"
FT                   /protein_id="QBZ17729.1"
FT                   /translation="MKKYKKWWITIGIVLILCVIGYIYWFTIPKHTANKAVDNYLAEQK
FT                   IKSSQIETRVIKKDWKMGGYLTKIVFKDDPNLKYEYSYDERYEFPHHIYVLVFKDGSSQ
FT                   EDDQVKHPPLQEQND"
FT   gene            complement(517887..517994)
FT                   /locus_tag="FORC68_0502"
FT   CDS_pept        complement(517887..517994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI12"
FT                   /protein_id="QBZ17730.1"
FT                   /translation="MASAPFRLFGLIVSQVGLELLGKAWERLVLYYLLE"
FT   gene            517993..518553
FT                   /locus_tag="FORC68_0503"
FT   CDS_pept        517993..518553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0503"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="GOA:A0A0B8R881"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8R881"
FT                   /protein_id="QBZ17731.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNGAVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
FT   gene            518663..520363
FT                   /locus_tag="FORC68_0504"
FT   CDS_pept        518663..520363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0504"
FT                   /product="antigen, putative"
FT                   /db_xref="GOA:A0A3A7FG32"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7FG32"
FT                   /protein_id="QBZ17732.1"
FT                   /translation="MKNKKRTLVALTGAAIGTGIAAKKISEQKAAEKERAVDEAIKARY
FT                   YGDKQVYFVGGGIASLAGAVYLIRDANFDGKNIHIIEGMHILGGSNDGAGSVEHGFVCR
FT                   GGRMLNEETYENFWDLFSSIPSLDMPNFSVTEEILNFDHLHPTHAQARLVDKDRNILDA
FT                   HSMGFNNNDRMLMTKLLATPEEKLDNLTIRDWFDEHFFETNFWYMWQTTFAFQKWSSLF
FT                   EFRRYMNRMMLEFSRIDTLEGVTRTPLNQYESLILPLKTFLDKHHVDFTINQTVEDIDF
FT                   KDAPGITATALHLSDGSTIELGPDDDVIMTNACMTDSATLGDMNTPAPKPEEKPISGEL
FT                   WYKVAQKKPNLGNPEPFFAHEEETNWQSFTVTCHGDKLLKRIERFTGNIPGSGALMTFK
FT                   DSNWLMSTVVAAQPHFKAQDANTTIFWGYGLYPDRVGDFVKKPMKECTGEEILYELMCH
FT                   LNWQDDFEEIKADIINVIPCYMPYIDAQFEPRAMSDRPAVVPEGSTNFAMISQFVEIPK
FT                   DMVFTEEYSVRAARIAVYTLLDIDKKICPVTPHNRDPKVLAKATQTMFR"
FT   gene            520514..521617
FT                   /locus_tag="FORC68_0505"
FT   CDS_pept        520514..521617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0505"
FT                   /product="Ribosomal RNA large component methyltransferase
FT                   N"
FT                   /db_xref="GOA:S5M3P6"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:S5M3P6"
FT                   /protein_id="QBZ17733.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEAHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMNTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVNKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGVRERMKQKQAAAEE"
FT   gene            521706..522185
FT                   /locus_tag="FORC68_0506"
FT   CDS_pept        521706..522185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0506"
FT                   /product="Transcriptional regulator, AraC family"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NP62"
FT                   /protein_id="QBZ17734.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANANGDAE
FT                   RINELAEFATIDGILGVCQMNGDQMDYYIAIESELTPPADMEKLTIPASKWAIFKSVGP
FT                   LPNAIQKVWEYIYGEWFQTGNYTHGNAPELEVYTEGDTTAVDYYSEVWIPVVEKD"
FT   gene            522343..522708
FT                   /locus_tag="FORC68_0507"
FT   CDS_pept        522343..522708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0507"
FT                   /product="Heme-degrading monooxygenase IsdG"
FT                   /db_xref="GOA:A0A0D8X5S2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR023953"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X5S2"
FT                   /protein_id="QBZ17735.1"
FT                   /translation="MIIVTNTIKVEKGAAEHVIRQFTGANGDGHPTKDIAEVEGFLGFE
FT                   LWHSKPEDKDYEEVVVTSKWESEEAQRNWVKSDSFKKAHGRTKDTREQREDRKGIVGNA
FT                   IARFEVVHVQNPVIVEK"
FT   gene            complement(522675..522827)
FT                   /locus_tag="FORC68_0508"
FT   CDS_pept        complement(522675..522827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MFG2"
FT                   /protein_id="QBZ17736.1"
FT                   /translation="MIGLWVASKGAFGEKTTVFIFSSANKKQAIYLEMACSFTSYFSTI
FT                   TGFCT"
FT   gene            522877..523452
FT                   /locus_tag="FORC68_0509"
FT   CDS_pept        522877..523452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0509"
FT                   /product="Putative nitroreductase family protein"
FT                   /db_xref="GOA:A0A3T1NP25"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NP25"
FT                   /protein_id="QBZ17737.1"
FT                   /translation="MIEKTIMERRSIKKANDEPISRETVNTILEQAAYAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHRKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFADDLGIPAEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKNLADL"
FT   gene            523517..523687
FT                   /locus_tag="FORC68_0510"
FT   CDS_pept        523517..523687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0510"
FT                   /product="LSU ribosomal protein L32p"
FT                   /db_xref="GOA:A0A0D8X026"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X026"
FT                   /protein_id="QBZ17738.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPD
FT                   GTYKGRTIIEK"
FT   gene            523779..524507
FT                   /locus_tag="FORC68_0511"
FT   CDS_pept        523779..524507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0511"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="GOA:A0A3T2H649"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H649"
FT                   /protein_id="QBZ17739.1"
FT                   /translation="MTEEFVNKEDALKNYNAKEFRTPDGYTSDMILTTVKELNGKPTLH
FT                   ILLIKRSLTNAEGKPNMEGGKWAVPGGFVDENESADQAAERELEEETSLTDIPLIPFGV
FT                   FDKPGRDPRGWIISRAFYAIVPPEALEKRAAGDDAVDIGLFPMTEALELPLAFDHLDML
FT                   KKAYSAITEEFLLTTAIRDFLPETFSAELLYQILDGCTKPGILPDEVEFMENIEYLPYL
FT                   EKVGELYRFNADAEAGSIYF"
FT   gene            complement(524543..525436)
FT                   /locus_tag="FORC68_0512"
FT   CDS_pept        complement(524543..525436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0512"
FT                   /product="Chromosome initiation inhibitor"
FT                   /db_xref="GOA:A0A3T2H642"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H642"
FT                   /protein_id="QBZ17740.1"
FT                   /translation="MNLRQLYYFKKLAEREHYTIAAAELSITQPSLSHSIAELERELGV
FT                   YLFEKQGRNIRLTKYGRFYLTYVEKSLAELEKGEKLLHELTSPSHGNIDLGFIYTMGAH
FT                   TVPELVQNFTKVESHKDITFSFFQGATKSIIPDLKNEKFDLAICSYVENEPDIEFLPLT
FT                   KQELVVVVAENHPLAKYDSIDLKDTADYSYIFFSDTSGLRPLIDSLFAEINIQPKIGCY
FT                   VEEDTAMVGLVSVDYGISIMPKISSLAHYNVKVLSINEPKHDRFIYLASLKNHYISPAS
FT                   KAFKDFALRYGEKHFL"
FT   gene            525634..527628
FT                   /locus_tag="FORC68_0513"
FT   CDS_pept        525634..527628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0513"
FT                   /product="2,4-dienoyl-CoA reductase"
FT                   /db_xref="GOA:A0A3T2H646"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H646"
FT                   /protein_id="QBZ17741.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGTPENRARIVKLILEKVREEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVASGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEASEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLLDVIDKEGSNVHSIFGLISSIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNNVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
FT   gene            527728..528603
FT                   /locus_tag="FORC68_0514"
FT   CDS_pept        527728..528603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0514"
FT                   /product="Shikimate/quinate 5-dehydrogenase I beta"
FT                   /db_xref="GOA:A0A3T1NPT7"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPT7"
FT                   /protein_id="QBZ17742.1"
FT                   /translation="MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVY
FT                   LAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDD
FT                   GVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRK
FT                   DDFYANAEKTVEKINSKTDCKAQLFDIEDHKQLRKEIAESVIFTNATGVGMKPFEGETL
FT                   LPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEM
FT                   PVDYIKEILF"
FT   gene            528669..529427
FT                   /locus_tag="FORC68_0515"
FT   CDS_pept        528669..529427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0515"
FT                   /product="3-dehydroquinate dehydratase I"
FT                   /db_xref="GOA:A0A3T2H635"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H635"
FT                   /protein_id="QBZ17743.1"
FT                   /translation="MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLKTIDLDVV
FT                   EWRVDFYEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETL
FT                   AGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEA
FT                   LGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAM
FT                   TFGAAKKASAPGQIDVNELRHVLDLLHKQF"
FT   gene            529524..530117
FT                   /locus_tag="FORC68_0516"
FT   CDS_pept        529524..530117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0516"
FT                   /product="lipase/acylhydrolase family protein"
FT                   /db_xref="GOA:A0A1D2IP68"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IP68"
FT                   /protein_id="QBZ17744.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKMIAEQLEKEDVTVIN
FT                   RGVSANRVADLHRRIEADAISFQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   SRIKEETNAELVLMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
FT   gene            530303..531262
FT                   /locus_tag="FORC68_0517"
FT   CDS_pept        530303..531262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0517"
FT                   /product="Permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="GOA:A0A3T2H637"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H637"
FT                   /protein_id="QBZ17745.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLILLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVIFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSVMLFGLSRFMEPDGMSELVTVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FGFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
FT   gene            531337..531561
FT                   /locus_tag="FORC68_0518"
FT   CDS_pept        531337..531561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IY63"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IY63"
FT                   /protein_id="QBZ17746.1"
FT                   /translation="MKLLLKNINELAAKQKSEGLTAFEKERQAALRQEYLKKIRGTVQD
FT                   NLHHVTIIDPLGDDVTPKKLKEIQAELRG"
FT   gene            complement(531612..533120)
FT                   /locus_tag="FORC68_0519"
FT   CDS_pept        complement(531612..533120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0519"
FT                   /product="glycosyl transferase"
FT                   /db_xref="GOA:A0A3A7NG31"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR041038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7NG31"
FT                   /protein_id="QBZ17747.1"
FT                   /translation="MIKISVIIPIYNAENYIEKAFSSLKNQTLAQNEFEILCIDDKSTD
FT                   NSLGKLKQLSKIHKNMRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALE
FT                   RLFIQAEKNQSEVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAPHKMFQTA
FT                   FLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYYVVSRGDENLSIKESKMD
FT                   PREICKVVPAVIKEIEASPLHPTYKKTLIRAYIQRYFNDYITGNYNLDYKNMSERQKTF
FT                   VQVMKDTIVCHLDEKMKNELPTKIRFMIDIIAENNPEKLIDVRMQMENFSKNQVVKVEN
FT                   GYIKGRFRKMRPQLAYDDVYDINHLNSSKVQLHSVTLQNNNYLLDISLEQSLLTRFQTA
FT                   LRLCLKERDGNLEIWISPLKMLSTERGIYAVDSTLFNHTCIWDLFIESEINGFKNRKRV
FT                   GKDRDFEEIVSSNNTPLLIQNNSYQIKAYFTTPFSNLSFQIISE"
FT   gene            533316..533765
FT                   /locus_tag="FORC68_0520"
FT   CDS_pept        533316..533765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0520"
FT                   /product="Ribose 5-phosphate isomerase B"
FT                   /db_xref="GOA:A0A3T2H638"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H638"
FT                   /protein_id="QBZ17748.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAKLEEREEDK"
FT   gene            533762..534430
FT                   /locus_tag="FORC68_0521"
FT   CDS_pept        533762..534430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0521"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /db_xref="GOA:A0A470RIP5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A470RIP5"
FT                   /protein_id="QBZ17749.1"
FT                   /translation="MKMIAASIMCADSLHLADELRALEQANVKMLHCDVMDGVFVENAA
FT                   MGAYVLQDIKNNTKMLLDIHLATVNPDKFVDLYAAIKPAYMSFHVEASRDVNATINHIR
FT                   ELGIRPSIAISPDTEIEQIYPFLDKVDMVLMMTVNPGFAGQKFQHHVLEKIKKLQKELE
FT                   SHTNKPLIEVDGNIFEETVRLLEPIGADVYVVGTAALFNEKAGSYTEKLAPLREIIQER
FT                   "
FT   gene            534437..535087
FT                   /locus_tag="FORC68_0522"
FT   CDS_pept        534437..535087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0522"
FT                   /product="Transaldolase"
FT                   /db_xref="GOA:A0A3T2H644"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H644"
FT                   /protein_id="QBZ17750.1"
FT                   /translation="MHLDSANLDDVKKIQASSIFKGITTNPTILVKEKCNRQTAINRIL
FT                   ELTDKQVFVQTVGFTYEEILADARMLLTMFGKDKIAIKIPAHEAGTNVIDTLKKEDKTI
FT                   QILGTAIYSADQAITAALVGADFVAPYVNRMSAANIDPFKEISQMRHFFDKKALKTQIM
FT                   AASFKHSGQVMQAYESGADTVTIPYEIYSQMTNKVLAVEAIRVFNEDAVLYEK"
FT   gene            535196..537256
FT                   /locus_tag="FORC68_0523"
FT   CDS_pept        535196..537256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0523"
FT                   /product="Putative galactitol operon regulator, BglG
FT                   family"
FT                   /db_xref="GOA:A0A3T2GPA8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2GPA8"
FT                   /protein_id="QBZ17751.1"
FT                   /translation="MYLDNRSKTLFQEVIKNPNITNKQLEVKYKLSRYQISYSFQKVNE
FT                   WLKWKNYPEVKRSKNGRFILEPELTALFSEKETRDPSVEYLPSENERANLILLMLLTSK
FT                   EELSLAHFTTKIQVSKNTILRDLKVAQKLLPKETTVTYSRASGYQLAGSEWELRKVLTQ
FT                   VVSSVKEMFRGEHYFLSYSGIEKVQLMEIRRTLEEAEAMMQIKFTYEQIELLPYLLSVM
FT                   FLRIRDRRLIDTAFHIDEKSLSDTREYHITDILLEKTGPVPEQERLFITLQLLTTNIFS
FT                   GEILTEKLTEDLEKVVLTCLDLFEKKALVSLKNKHILIEKLLLHLKPAYYRIKYQMNLE
FT                   DTLYEKFNQEFEALNFIVKEAFDPLAKFIGREIPAGEIFFISLFIGSDMIPQNDIYHKQ
FT                   KRAIVLCPSGVTFSKIMENILVKLFPEIHFYPTISVREYAFFKAEVDIVFSSIPLKDGE
FT                   NVFVVQPFMNDIEKTQLRQHVLQNLFGMGNQLTSIDKIMEVVERNADIKDPNAIRDGII
FT                   DILSANTATDENKRVKKVYLHDLITEDNIMICEDVKNYQEAIRLASQPLLLQQAITANY
FT                   VKTMIDNHKFHDPYIIIGEDIAIPHAMPNAGVNRLAMSLLVVKNGVYFSETEQVHFVIV
FT                   IAPVDKEQHIEALYQIVHLAENHQILDDLLENVTKEKIMQTINQLVIREDE"
FT   gene            537260..537862
FT                   /locus_tag="FORC68_0524"
FT   CDS_pept        537260..537862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0524"
FT                   /product="Polysialic acid capsule expression protein KpsF"
FT                   /db_xref="GOA:A0A3R0H2H7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H2H7"
FT                   /protein_id="QBZ17752.1"
FT                   /translation="MDKQAILNNIHQTWQEEANAISRLPEVTSEEALVKTVEKIAECTG
FT                   KIVVAGCGTSGVAAKKLVHSFNCIERPAVFLTPSDAVHGTLGVLQKEDILILISKGGNT
FT                   GELLNLIPACKTKGSTLIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVI
FT                   ASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLLNK"
FT   gene            537890..538357
FT                   /locus_tag="FORC68_0525"
FT   CDS_pept        537890..538357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0525"
FT                   /product="PTS system, galactitol-specific IIA component"
FT                   /db_xref="GOA:A0A2Z5C167"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C167"
FT                   /protein_id="QBZ17753.1"
FT                   /translation="MDVLEYFKEEMVRFSNEQDKEKLLTEMAEQLCEVGAVKPSYKDAV
FT                   IKREKVFPTGLLTAHAGVAIPHTDSEHVIRPVVAVRILKKPVSFIEMASDNEAIDVRIV
FT                   FMMALRSADEQLDMLQTLIQLIQDEEVMTTLLKAQETGDVLSAIEHFSKNN"
FT   gene            538374..538772
FT                   /locus_tag="FORC68_0526"
FT   CDS_pept        538374..538772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IP61"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IP61"
FT                   /protein_id="QBZ17754.1"
FT                   /translation="MGSFFASFVDWLIGSPGRFVVNLIEDNMLIFMVVVMIYATTILYA
FT                   KWTLAYYLPKKMSQLAEMKTWELDELYAAWQTEKKALPWYILVPSRNEFWVKSARNAPE
FT                   STKLLHFSQQKLKLSDKEKLQKIIEIQS"
FT   gene            538783..539433
FT                   /locus_tag="FORC68_0527"
FT   CDS_pept        538783..539433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0527"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /db_xref="GOA:A0A463HGV6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A463HGV6"
FT                   /protein_id="QBZ17755.1"
FT                   /translation="MAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIA
FT                   FGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIK
FT                   SYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIG
FT                   NRPIQIEVDGGVNDELAKECTLAGADLIVVGSYLFEGDIEANLEKLAKGVLTE"
FT   gene            539430..540476
FT                   /locus_tag="FORC68_0528"
FT   CDS_pept        539430..540476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0528"
FT                   /product="Galactitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="GOA:A0A462VAC9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A462VAC9"
FT                   /protein_id="QBZ17756.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEEPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGARRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKVLFFPE"
FT   gene            540492..540785
FT                   /locus_tag="FORC68_0529"
FT   CDS_pept        540492..540785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0529"
FT                   /product="PTS system, galactitol-specific IIB component"
FT                   /db_xref="GOA:A0A1D2INX4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INX4"
FT                   /protein_id="QBZ17757.1"
FT                   /translation="MKKKRIYVCCGTGIATSTVISKKVRAVLDEKRIPYEISQCTVQEV
FT                   ASKVSTSKPDIIVSSTTVTGDVGDVPVVIGRSFLTGLKKQETIDEILAILQD"
FT   gene            540800..542071
FT                   /locus_tag="FORC68_0530"
FT   CDS_pept        540800..542071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0530"
FT                   /product="PTS system, galactitol-specific IIC component"
FT                   /db_xref="GOA:A0A4P7MQE5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQE5"
FT                   /protein_id="QBZ17758.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWIKTMDVDIWNYWQPLFIASALYLTTGSMIIAVLSSIINMAIIFKIA
FT                   DWTQKDVEDVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
FT   gene            542211..543146
FT                   /locus_tag="FORC68_0531"
FT   CDS_pept        542211..543146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0531"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="GOA:A0A3T1N8Z5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1N8Z5"
FT                   /protein_id="QBZ17759.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGANRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEK
FT                   DVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSSIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
FT   gene            544061..544639
FT                   /locus_tag="FORC68_0532"
FT   CDS_pept        544061..544639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI31"
FT                   /protein_id="QBZ17760.1"
FT                   /translation="MKKILVPILLLATILASCSSPNEKITKDTKISKTITIRADYKVPK
FT                   DIKELEDDSANIVKVKFLQNKTIGKDGSTISEIEILTSYKGNLEKGSKVDISEPWYLSD
FT                   GKYVAVENYIALDKEQEYTIFLGEKDKDTYPLSSLGYGKFGGSLKEDQAVLADFNILGE
FT                   VQKFDFISENTEEVKNYQLIKEQVAGKYK"
FT   gene            544746..545426
FT                   /locus_tag="FORC68_0533"
FT   CDS_pept        544746..545426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0533"
FT                   /product="glutamine amidotransferase, class I"
FT                   /db_xref="GOA:A0A4P7MEH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEH1"
FT                   /protein_id="QBZ17761.1"
FT                   /translation="MIIDVLQHVPHEGPGLIANWARENQHQLKIHSLFEENAHVPNDSD
FT                   FLIVLGGPMGINDTAEFPWLKDERKLIKRLSEQHKPVFGVCLGAQQIAATFGSEITVNK
FT                   EKEVGWFPVKRTSDKLSFFPESLNVFHWHQDTFALPAGATRLFASEGCLNQAFLYGENI
FT                   IGLQFHFEMEKAGIETILQIDEAFITPGKYVQSVEVMQEKDVPEDNKQMLEAILDYLIN
FT                   PKTI"
FT   gene            complement(545451..545813)
FT                   /locus_tag="FORC68_0534"
FT   CDS_pept        complement(545451..545813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPV0"
FT                   /protein_id="QBZ17762.1"
FT                   /translation="MMEQILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQGLL
FT                   PDGDLQNMVVNIKLALPCDADQLDEDTIRAIIPYGTVTIEKMAGGMMTTSGIFLEDKED
FT                   KNDLMYIVNASVETGY"
FT   gene            complement(545817..546275)
FT                   /locus_tag="FORC68_0535"
FT   CDS_pept        complement(545817..546275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0535"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="GOA:A0A3A2PHX8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2PHX8"
FT                   /protein_id="QBZ17763.1"
FT                   /translation="MNNEQNMNQQIALFYFGYKAFTETADLIIAKHSLKRLHHRILFFT
FT                   ARMPGLTINELLTFLEISKQALHQPLAELKERELLTIEQGRRDKRQRCIFLTAAGKELE
FT                   NELGAAQRKQMSEIFTNSADTDGMHFTEVMEGYAKNRPGAAFIKDFKE"
FT   gene            546657..548492
FT                   /locus_tag="FORC68_0536"
FT   CDS_pept        546657..548492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0536"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T1N921"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1N921"
FT                   /protein_id="QBZ17764.1"
FT                   /translation="MKKALKLFLAMICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNG
FT                   LLKQASDAPITKTQMNTIQTVTLSGSTYTDLTGLEEAGNLVTLSINNTNIQTLEPIKNQ
FT                   TSLTYLTVGGDNVKDSLFVDLNGLVNLQSLSINGSEVTHNVFKTFNKLPKLTYLYAQNS
FT                   MKITDISALASLPALTTLFLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPRI
FT                   TLKSGKLDYNETNQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSAR
FT                   LSITEDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMTSYTISSGTYDQYFDI
FT                   SHTLDLTADESFDYNQYDTTSEEQFLKDVHAETDDGTAVKSDFDQVVKLDVPGEYTVTL
FT                   NAENAAGLKATPVTVKVTVHEKPVITSDSQISYKKETTKSVDEFLKEIHGSVTGNAVLT
FT                   SDFDKVVDLNTPGEYTVTLNAINDRGQKADPVTVVVTVTTSDSGHVNPVPPTPEVKPTP
FT                   QEETDQTIIPEPQSETTEDSVKEDQAKDGQAKSEEKADKTSLTTKENKVEKSEKTNQPK
FT                   TKALPQTGDTNKTALPIAGVMLSLAALLIFRKSKS"
FT   gene            548590..549024
FT                   /locus_tag="FORC68_0537"
FT   CDS_pept        548590..549024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0537"
FT                   /product="universal stress protein family"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF02"
FT                   /protein_id="QBZ17765.1"
FT                   /translation="MMEKYHRILVAVDGSEPAKLAFEKGLELALKLDGVLGIASIVDLR
FT                   AFSPNVSYDGSLEEKAELELKTSVNEYAEKARTAGVKQVETFVAKGNPKILLSTDIPAE
FT                   FQADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
FT   gene            complement(549071..550501)
FT                   /locus_tag="FORC68_0538"
FT   CDS_pept        complement(549071..550501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0538"
FT                   /product="Capsule biosynthesis protein capA"
FT                   /db_xref="GOA:A0A3T2H667"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H667"
FT                   /protein_id="QBZ17766.1"
FT                   /translation="MKRRTYVIITGLVLVFIAGAFWITNSTNQSDQKATQTEPIKKISP
FT                   ANVKTISSEAKKTLNSLASSGADKASISDLKQLIKELKSYPTEKNDSGVYLQNLTACLE
FT                   AVKSYTTGKADEKALGKVYPDFLASEQKLSAIEKTNQYDWFYAAAATNQQGLKEKGVVT
FT                   LTMVGDNSFGTYPETPEHLKFDNVFQKNNGNNTYVYNNCLPWFKSDDYTVINAESAFTN
FT                   ATKAENKMWRIKSDPAHVAFLPASGVDAANLANNHTMDYFQVGYDDTLKAFKENNIPVF
FT                   NTDAPLETTIKGMKTVLLGYDCRMSQQSPAYLERIVKDVKKYKKEDTLVIVNMHWGVEY
FT                   RETPTDYQTQFGHAILDAGADIIMGSHPHRLESVEKYKDKYIVYSMGDFAFGADPTLLS
FT                   RMTSMFQLRFTKEDNKIVLKDISIVPTYENSDGSTTENNYQPLPVFGDDAKKIVDELNR
FT                   ISKPIEGGVTEYTYFDPF"
FT   gene            complement(550622..551437)
FT                   /locus_tag="FORC68_0539"
FT   CDS_pept        complement(550622..551437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0539"
FT                   /product="Phosphoglycerate mutase family"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QY98"
FT                   /protein_id="QBZ17767.1"
FT                   /translation="MKKNIFKLLMALCAVLLIAGCGNSTSADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDPRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGLSPKD
FT                   FANSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
FT   gene            complement(551718..552086)
FT                   /locus_tag="FORC68_0540"
FT   CDS_pept        complement(551718..552086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A466RJ69"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A466RJ69"
FT                   /protein_id="QBZ17768.1"
FT                   /translation="MAILAFILTFIVMIEHIYIMILEMFFANTKLAAKTFGVEKELLAN
FT                   KKVQTLFANQGLYNGFLAAGLVWGLFFAGAGMAETVQIFFLSCVVVAALFGGATSSKGI
FT                   LVKQGLPAVLALVVVLLV"
FT   gene            552234..553649
FT                   /locus_tag="FORC68_0541"
FT   CDS_pept        552234..553649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0541"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /db_xref="GOA:A0A4P7MIW5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MIW5"
FT                   /protein_id="QBZ17769.1"
FT                   /translation="MQQEATGGQKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGESGWGSATVLVSIIVGGLALGLFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   IVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPVQTNGLNQLPPKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMSAGQKAYMETAQGMGPEQMVASLTAGIQNAFVFGLIMAC
FT                   IGLLCSLFIRKAK"
FT   gene            553778..554785
FT                   /locus_tag="FORC68_0542"
FT   CDS_pept        553778..554785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0542"
FT                   /product="Putative N-acetylglucosamine kinase, bacterial
FT                   type / Transcriptional regulator"
FT                   /db_xref="GOA:A0A4P7MI38"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI38"
FT                   /protein_id="QBZ17770.1"
FT                   /translation="MMAIPRDLKELNKKNIKSILRQQGAMTKAEIAEVTGLSVVTVNKL
FT                   IRDLVENEEILEQDNSVATGGRRAVSYEINPNFQQVLVISLQEKWKKITYSFSVYNLLG
FT                   EPEFVEDMSGEDLDITALKRNTKDIICAFPKISCVVIGVPGIEIGGKLRAMDFPLLLNV
FT                   QLRETLEAEVNLPVLVETDTNAAILGYKNRPVKEENIVGLYYPERFPPGAGLLMNGEIL
FT                   KGQNGLAGEIKHMPLQVDWDNFDFSVDEIKAHIRKMVLLTMSFYDPETIVLYTNFYFGQ
FT                   KDFMEELKEELKQVYPYAVLPEIVLSRKFTTDYRIGLLAFGIDYLENNMTDWRI"
FT   gene            complement(554817..556133)
FT                   /locus_tag="FORC68_0543"
FT   CDS_pept        complement(554817..556133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0543"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="GOA:A0A3A7RBY1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7RBY1"
FT                   /protein_id="QBZ17771.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVKKAGVNMEIHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIAETLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
FT   gene            556335..557087
FT                   /locus_tag="FORC68_0544"
FT   CDS_pept        556335..557087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0544"
FT                   /product="Phosphosugar-binding transcriptional regulator"
FT                   /db_xref="GOA:A0A3A2JSH2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2JSH2"
FT                   /protein_id="QBZ17772.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVEILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQLDKEKM"
FT   gene            557193..557636
FT                   /locus_tag="FORC68_0545"
FT   CDS_pept        557193..557636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1JTH4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1JTH4"
FT                   /protein_id="QBZ17773.1"
FT                   /translation="MYSNMKEKVVFTLIMCSLMILCMSSYNIFLENGIGTDSLMIILKA
FT                   FVPFLFIGFLLDFFVVGKIANRLHALLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGILILRNYFVALFLQIFIVSPFVRLISPRIFALL"
FT   gene            complement(557682..559343)
FT                   /locus_tag="FORC68_0546"
FT   CDS_pept        complement(557682..559343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0546"
FT                   /product="Sulfate permease"
FT                   /db_xref="GOA:A0A1D2IYB6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYB6"
FT                   /protein_id="QBZ17774.1"
FT                   /translation="MFKHILLSLNGYKISYLRNDVISGVGVAALTIPVAMGYAQVAGLP
FT                   PIYGLYASFLPVIAYVIFASSPQLIFGIDATASAITGSIILGTAGLAAGSKEAIALAPI
FT                   LAFFCAIFLVLFSVLKLGRFAKYISAPVLSGFISGLSVSIIMGQIPKIMGLKESGDSFF
FT                   SSLGIIFGQFFQSNWISFAMGVVTVIIVITCKKVIPKIPMSLVVLVLGTMAAYFFKLDQ
FT                   YNVDIVGKIPVGFPSLALPDFGASSWALAIGGGLVCAIATFAGSLLPSESFAMRNKYTI
FT                   DDNRELFAYGVSNFVAAFSGCSPASASVSRTAANEQFRGKTQMVSIVAATIIALIVAFL
FT                   SGLLYYMPQPVLSGIVFAALVGIIDVDVLKGLFKVSRREATVWIVAALGTLLVGVIFGV
FT                   LLGIFLSFINVVSRSMKTPIAILGVIEGRHGYFDLKRKSEAKPIPNVVIYRYSASLFFG
FT                   NFNKFADGLKEAVQDDTKLVIFEASAIINIDTTATESMKDLLKWLDDKGIEYYFADLID
FT                   HLKTSFRKHDLGYLIDNGYTKKTVEDALDAYYAEHK"
FT   gene            559599..560930
FT                   /locus_tag="FORC68_0547"
FT   CDS_pept        559599..560930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0547"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H669"
FT                   /protein_id="QBZ17775.1"
FT                   /translation="MATQKNLVDLATKAYIYGFPFIFNTQQIERYVTVGIGGTKQVPFN
FT                   NFTHASRLAEPSDKFVSVNNDTIYSNAPIDVSAGPVVLSVPDTSGRYYVLQFVDAWSNN
FT                   FAYVGKRATGTSAGKFLLTPPNWNGDVPADMIEIKFPTNIGIIIGRLACDGEADLPTVR
FT                   ELQEQLKITPLNEGKEVDGFPEYDRSLGKELAFFEQLRVYMAQFPPAERDLVKQESFAP
FT                   IGLMEKGVSPYSNPSEELKNALIEGAKAGLANIKKATTNFKSENGWGLTQHLFDYNADF
FT                   FEIGTKKSLDWVIEDREEAYIIRAVSAITALWGNHGYEAVYLMTWTDTDGNALNGKNKY
FT                   TLELNPIPPVDSFWSITMYDLPEYFLCENPINRYSIGDRTPGIQYNDDGGITIVVSKDE
FT                   PTDPKERANWLPAPDAEFRPMFRLYNPQQPLVDGSYHFPGFEKK"
FT   gene            complement(560976..561716)
FT                   /locus_tag="FORC68_0548"
FT   CDS_pept        complement(560976..561716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0548"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="GOA:A0A1C7Q105"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7Q105"
FT                   /protein_id="QBZ17776.1"
FT                   /translation="MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSEKDVD
FT                   KLQQILFFKELDFPLKKIQQILDDPLFDKNVALDMQRHLLIEKKQRIETMLATLDLTIK
FT                   NEKGEITMTNKEKFTGFDFSSNPYEEEARKLWGDKVVEKANEKVNNMSEKEQLTLKESF
FT                   DAEFRHLASVRKLTPESEEAQLEIDHFFHYLNDTHGNIYSLEAFASLGEMYVNDERFTK
FT                   NIDQFGDGLSQFLQEAMTIYAKNK"
FT   gene            561946..563421
FT                   /locus_tag="FORC68_0549"
FT   CDS_pept        561946..563421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0549"
FT                   /product="membrane protein"
FT                   /db_xref="GOA:A0A1C7PX69"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX69"
FT                   /protein_id="QBZ17777.1"
FT                   /translation="MIRKVKSISMWLWHHLTPQIFAVICVFIITIIALFMPPYIGMADN
FT                   GDFFRIFSSNGLFVNNTNYDALQFGHFVKEFGIYQYFNENQVAIYSSQSIFIQMALLLN
FT                   KLFWSTTVFDVRFLGGLQLALLLPAIYLLVAGLTAKMKGWPGYVVAALTVFIFADTAYT
FT                   AYFNSFFSEGLILIMMLYISAGFLLLYQHKYNDYAMLGLIFVASLILITAKQQNAPIAV
FT                   VIAVCGILVFFIRKNRAFRISAAATFLVIFLSGVVMYAFIPGEFVTINQYQTMTRGVLL
FT                   DSENPEKSLEEMGMNSEFALLKGTNFYQKYKMIDLDSKLMEKEFYPNYNFVTVLSYYLE
FT                   NPKQFGKMLDLSAQNSFSIRPFEMGNFEKATGYKFKEKTHFFSAYSDVKEKFAPAKFTF
FT                   LILWALVFLICYGVSAFKHFREKNIRGTLLFDLIVLLIGSGFAVILVTIVGDGEADLTK
FT                   HNFLFNVCFDLTMLIGAASLLEVYLKKRGERNA"
FT   gene            563414..564910
FT                   /locus_tag="FORC68_0550"
FT   CDS_pept        563414..564910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H678"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H678"
FT                   /protein_id="QBZ17778.1"
FT                   /translation="MRKKMIISILLAFVIFIVGGHSAIAKTDDGVVVFYDSLATGTENE
FT                   GNMDALLRMLNSLGKRVTIYSWEENPDLSQTSEIIVLQNKNDGLANDWTEKLAKSKAKI
FT                   AYIGGNPPTFLTDKLQLKTKAITDASITIQTEAGLSGKPQLVNETNLITSYKGTSFGEM
FT                   DAAENGQAAYGVQAGNYAYAPLFQTDNTSEFTLMDVLKALFDIKTTTNQYAFITGVNPF
FT                   VDFDLLKKTADTFYEKGIPFIVSAGPVFYNQDFQAAKNYAEILRYVQAKNGTIMLNVPA
FT                   VTYGDSPSGELESIMQKSVNFFAENDIAPIGVTAELYWNFDKVYGVEGFAPFNTGILLP
FT                   NQKIIHTTKVNNGSAFEKSPYSVANDFYATTTEGRNFPVDIAITYSFFDNEKELKAAAE
FT                   ELANDNISDFRFQNHGVKTNKDTIESSAGSLYINNQPVALDGDLNYIKTKNKAVKQAGS
FT                   LEGFFGYQNTFFTIVIVLSLGIIGVLFVFGYRLYMKKYMK"
FT   gene            564921..566171
FT                   /locus_tag="FORC68_0551"
FT   CDS_pept        564921..566171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0551"
FT                   /product="Dolichol-phosphate mannosyltransferase"
FT                   /db_xref="GOA:A0A3R0GWF2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0GWF2"
FT                   /protein_id="QBZ17779.1"
FT                   /translation="MVVADYLALFAVICIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   VEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSAELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTVLKRETKWYKTERF"
FT   gene            566187..568238
FT                   /locus_tag="FORC68_0552"
FT   CDS_pept        566187..568238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1HR86"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HR86"
FT                   /protein_id="QBZ17780.1"
FT                   /translation="MKKFTVMWLLIFAVLFLYRPEVFAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIEIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQFDKTSAINVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAANTLEDKNIAFGQ
FT                   YEETKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALFQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDERIDTPATSVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDELTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEESNVIAVGTMNNNPVIKNANDDLYFQYNKTGDYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGAKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKE
FT                   ADTQEESFGAKISNNKEVTVFGAFALLTVVILVVAVLLILRKYRRSRK"
FT   gene            568251..569105
FT                   /locus_tag="FORC68_0553"
FT   CDS_pept        568251..569105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PXA1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXA1"
FT                   /protein_id="QBZ17781.1"
FT                   /translation="MKKITNNLFADIGFLFFILLCFITIGFMINTPDEYLRNIILLNIT
FT                   FLLVIITYFTNLTLGLILNVLYIFIYATYIIYEIVANQIAYGFGSYFWLIITPLFTVAS
FT                   AMFTRNTSRLQEENTKIKQQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEDEMRLALQDISAILETCIRTSDVLYLLDKDDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIDLATKELE
FT                   YDV"
FT   gene            569165..569995
FT                   /locus_tag="FORC68_0554"
FT   CDS_pept        569165..569995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H668"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H668"
FT                   /protein_id="QBZ17782.1"
FT                   /translation="MNLEEIVDCMLLNENDKEIQRTQTEHRIKLVDFWRVKKGDRVLEV
FT                   GCGQGDTTAVLANAVGASGFVQGIDIAPRTYGAPFTIGDATDHLQKSKLGAQIDFKLGT
FT                   DILKGDITFPDNAFDVAVLSHASWYFSSKSELTLMLELLSKWAKRVCYAEWDTRITDVK
FT                   QTSHMLAVLTQSSYEAFKQETQSNIRTFITPIDMQEIIQEHNWKIGAETSIFSEKMQDS
FT                   RWEIGYVKDFITKELEADLGLPEKFKAFLLSQSKLITLENSLPMASYCTSWQAK"
FT   gene            570073..570342
FT                   /locus_tag="FORC68_0555"
FT   CDS_pept        570073..570342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0555"
FT                   /product="ACT domain protein"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X2R2"
FT                   /protein_id="QBZ17783.1"
FT                   /translation="MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQITKEFDEVKAELAGKGEDLQVKIHIQREEIFNAMHKL"
FT   gene            570361..571716
FT                   /locus_tag="FORC68_0556"
FT   CDS_pept        570361..571716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:L8DR03"
FT                   /protein_id="QBZ17784.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARNLVAVGEAIESEFGIPIINKRISVTPIAIIAGSSADTDYVEFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPQALAQTERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSVDFIARGGRIPAPIHSFKN"
FT   gene            complement(571756..572724)
FT                   /locus_tag="FORC68_0557"
FT   CDS_pept        complement(571756..572724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0557"
FT                   /product="Ribose operon repressor"
FT                   /db_xref="GOA:A0A393BU31"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393BU31"
FT                   /protein_id="QBZ17785.1"
FT                   /translation="MANIQEIAKLAGVSSATVSRVINKRDYVSDETRKRVQTIIDKLDY
FT                   VPNINAVSLKKGATKLIGMVIPSFTDSLNVFLKSFTMIAQEHGYNVTLFMTRIDPDKEL
FT                   EALEMLRQKQIDALVLVIRSNDWKTIEHYTKYGPIVTWQRVESEKIPSVFMNQYDGYTL
FT                   GLEHLYAKGYRKFVNVYGNTTGLNTQSRMLAFKDFCARYELDPHEFRQFYGQGSRQDGE
FT                   KIAHWFAETEHKPDAFLTPNDYFAAGLLTEARRLGYSVPEDFAICGFDNMEIAHLLDIT
FT                   TIHYPVNLQAENAFTLIMNQLFGSNLPLLDLDFHLVERKTT"
FT   gene            572896..574218
FT                   /locus_tag="FORC68_0558"
FT   CDS_pept        572896..574218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0558"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="GOA:A0A0D8X2G4"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X2G4"
FT                   /protein_id="QBZ17786.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVGNMAKRMVKAANIDCEVHLTLDRREALKDADFVTTQFRVGLLDARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   NWDKVIGLCNVPIGAVKSASDVLEKPEEDLFFKFAGINHLHWHRVFDKDGTELTEKVID
FT                   GLYAPDANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDYKPEELSKRGGAHYSDAACEIINSIYNNKGTVMVVST
FT                   RNNGAIDDVPYDSAVEITSVIRAHGAEPINFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEFLPQFAK"
FT   gene            574322..575593
FT                   /locus_tag="FORC68_0559"
FT   CDS_pept        574322..575593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0559"
FT                   /product="N-carbamoyl-L-amino acid hydrolase"
FT                   /db_xref="GOA:A0A418S0L9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S0L9"
FT                   /protein_id="QBZ17787.1"
FT                   /translation="MQTNLERIKKHIEKLDTFTATPGQGTTRLTYSKEDLDARNYLKQE
FT                   MAKVGLTVSEDAIGNIYGRLEGESPDLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAS
FT                   VFHEQQIKPHFPLEIIAMVEEEGSRFGAGLLASRAITGKVTTEMLHEMKDIDGITATDA
FT                   MAKLGFNANRVHRAIRTKESVKAFIELHIEQGPILENASEDVALVDTVVGLTQIKVTVK
FT                   GQAGHAGTTPMLDRKDALVSAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VIFTVDIRAKDEIHVQNTLAKTKEIIQATEKNGITCEIKDMIYQQPTHLSKEIHQALTE
FT                   SADQLGFKYRTMVSGAGHDAMIFASLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLKTVKKWTEESANESENKTNSFK"
FT   gene            575559..576734
FT                   /locus_tag="FORC68_0560"
FT   CDS_pept        575559..576734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0560"
FT                   /product="Catalyzes the cleavage of
FT                   p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate,
FT                   component A"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQG5"
FT                   /protein_id="QBZ17788.1"
FT                   /translation="MNQKIKQIVLNNESEMIAFRRDLHMHPELQWQEFRTTDQVAKELD
FT                   KLDIPYRRTEPTGLIAELKGGKSGKTVALRADMDALPVQELNQDLPYKSTEDGKMHACG
FT                   HDAHTAMLITAAKALVEIKDELPGTVRFIFQPSEEIAEGAKEMIAQGAMEDVDHVFGIH
FT                   IWSQTPSGKISCVVGSTFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFIMNLQAIV
FT                   ARETDPLDPVVVTIGKMDVGTRYNVIAENARLEGTLRCFNNTTRAKVAKSIEHYAKQTA
FT                   AIYGGTAEMIYKQGTQPVINDEKSALLVQETITESFGEEMLYFERPTTGGEDFSYFQDE
FT                   APGSFALVGCGNPEKDTEWAHHHGRFNIDECVMKNGAELYAQFAYNYLNQN"
FT   gene            complement(576782..577798)
FT                   /locus_tag="FORC68_0561"
FT   CDS_pept        complement(576782..577798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0561"
FT                   /product="Tagatose 1,6-diphosphate aldolase"
FT                   /db_xref="GOA:A0A1D2INX1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INX1"
FT                   /protein_id="QBZ17789.1"
FT                   /translation="MVQITKGKFDGLQRLSNDKGVIAALAIDQRGSLKKMIQQAKGTEN
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDATVTDSGSLEYAKLKPAKVKASIKEFSKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   VAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
FT   gene            578036..579229
FT                   /locus_tag="FORC68_0562"
FT   CDS_pept        578036..579229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0562"
FT                   /product="penicillin-binding protein, putative"
FT                   /db_xref="GOA:A0A3T2H673"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H673"
FT                   /protein_id="QBZ17790.1"
FT                   /translation="MNRRERRKHKRRKNMIIVLSTVFLMFIATSWMIYEFKSKQEQTVS
FT                   APTKKKAATATNPSENAATNEPEETKEPEPVEEKPKETIVKNQEIDNYLQKIGFSGSAL
FT                   VVRDGETIIQKGYMYANRDDKVLNTPDTLFYIGSSQKAIIATALLQLEEKGKINTNDPI
FT                   LKYIPDFPNGNKILVKNFMNHTSGIVGRPNLTSNMTPDQIVKAIEKRGIKSQPGKWDYM
FT                   DANYTVVGYLVEKISGQPLATYLQENIFNPAGMKHTGYYQKDVDGGKNVSTGYKIDENG
FT                   VFQSPKLADLTKLYGAGDISMSTTDMYLFDKALMDKKLISEASLKKMFTKGSKSTYGMG
FT                   FYVDPGSYNSHGVVTGWDVSNSFSHTGRTYVILFSNVQNYIASFGKVNNDIYGFLNK"
FT   gene            complement(579269..580189)
FT                   /locus_tag="FORC68_0563"
FT   CDS_pept        complement(579269..580189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0563"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPH6"
FT                   /protein_id="QBZ17791.1"
FT                   /translation="MYQKHKWSAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   TDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPDATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKNAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSAAAQLYQMEDAVKQITGK"
FT   gene            complement(580300..580650)
FT                   /locus_tag="FORC68_0564"
FT   CDS_pept        complement(580300..580650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0564"
FT                   /product="PTS system, glucitol/sorbitol-specific IIA
FT                   component"
FT                   /db_xref="GOA:A0A1C7PX12"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX12"
FT                   /protein_id="QBZ17792.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFQDA
FT                   PNNALTKGNTLLIGEQVYTIEEVGTDANKNLEELGHISVYFRSGQNEVLPGAIVVSPEV
FT                   FPTITVGDSIQF"
FT   gene            complement(580669..581655)
FT                   /locus_tag="FORC68_0565"
FT   CDS_pept        complement(580669..581655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0565"
FT                   /product="PTS system, glucitol/sorbitol-specific IIB
FT                   component and second of two IIC components"
FT                   /db_xref="GOA:A0A1C7PXA6"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXA6"
FT                   /protein_id="QBZ17793.1"
FT                   /translation="MYQSIHVNKGQGGWGVGLDITPSEPRTKVVSITGGGIHPVALRIA
FT                   ELSGAEAVDGFKNSIPEEEMMCVVIDCGGTARIGVYPMKRIPTVDVLPSSPSGPLAKHI
FT                   TEDIFVSGVKPEDIEVRDISAEPGKPFDREKFKEDYAKIKEDQKEASELKEGFLVKFSR
FT                   GIGKAMGVFYQAGRDSVDMLIKNIIPFMAFISMIIGIINYTGIGKLIANTLSPLAGSLW
FT                   GMLLIAFICSLPFLSPILGPGAVIAQVIGVLIGSQIAIGAIPVTYALPALFAINAQAGC
FT                   DFIPVGLSLAEAKPKTVQFGVPAILYSRMITGVLAVVIAWVFSIGMY"
FT   gene            complement(581676..582197)
FT                   /locus_tag="FORC68_0566"
FT   CDS_pept        complement(581676..582197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0566"
FT                   /product="PTS system, glucitol/sorbitol-specific IIC
FT                   component"
FT                   /db_xref="GOA:A0A1D2IY98"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IY98"
FT                   /protein_id="QBZ17794.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGIVVILMRGVITETI
FT                   TKFLMRKEKV"
FT   gene            complement(582222..582602)
FT                   /locus_tag="FORC68_0567"
FT   CDS_pept        complement(582222..582602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0567"
FT                   /product="Glucitol operon activator protein"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IY22"
FT                   /protein_id="QBZ17795.1"
FT                   /translation="MNIVLIASLIFIAQTCLGFFQVKYYQHHMNKVANKYAGKIGYHLY
FT                   SEMERLKFRTSAVAILVVNENHIVHECQILTGKTVFAQFKTFTNYHHKELSEILTELSS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
FT   gene            complement(582657..583907)
FT                   /locus_tag="FORC68_0568"
FT   CDS_pept        complement(582657..583907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0568"
FT                   /product="Sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1HYT8"
FT                   /protein_id="QBZ17796.1"
FT                   /translation="MTLYRQLLARENENNPIRVGVIGAGQMGFGMISQIAAIPGMSVVG
FT                   ISDIHVEAAQKAADAYNATATKKEKILLSNDFKEIIHSDLVEVIVDATGVPEVGAKISL
FT                   ETLLAKKQLVLLNVEIDITIGPLMKKLYDSAGLVYTGSDGDEPAAITELYEFSKSMGME
FT                   VLVAGKGKNNKLKISANPDSCQVEADGKNMASHMLAAFQDGTKTMAEMNLLSNAIGYVP
FT                   DVVGMHGISGDVDSVIKDLDLKDQGGILNKFGVVEYVDGLAPGVFVIVKGQNEGVSHEL
FT                   SYLMKKGDRDHHILYRPYHLASLETPLTIAKAVLNHDHAIVPMGAPVSETVAVAKKDIA
FT                   AGEKLDGIGGFCVRGVLETHVDMATNGHIPIGLISGEVVARRNIKAGTFITDEDVSLDE
FT                   STTVWKLRKLQDETFSK"
FT   gene            complement(584165..585112)
FT                   /locus_tag="FORC68_0569"
FT   CDS_pept        complement(584165..585112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0569"
FT                   /product="Sorbitol operon transcription regulator"
FT                   /db_xref="GOA:A0A0D8X088"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X088"
FT                   /protein_id="QBZ17797.1"
FT                   /translation="MKWEEKRDMVKIATWYYHYGWTQAQIAKKIGISRSIISKTLQRAK
FT                   DLGIVEIFIKDETYYTVDLEQKLEEKFGLEEAIVVATHDMSEEEALNFLAKEAAYTLSK
FT                   RIAKVKTLGISWGKTIRKFANEFPFIPHKDLTIIPLIGGMGSSDIDLHSNQICYDLKKK
FT                   MKCHSKYLYAPALVEDTEMKTDLSKNKYISEVLEEGKTVDMAIVGVSSPYNHSTMEEIG
FT                   YINSEDIEELRYKDVVGDINSRFFTADGKEAKTEINTHVIGLSLEELKNIPTVVALANG
FT                   LQKKEALVAALNAGLIDVIVITDRMAEYILQKND"
FT   gene            585479..586144
FT                   /locus_tag="FORC68_0570"
FT   CDS_pept        585479..586144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1P269"
FT                   /protein_id="QBZ17798.1"
FT                   /translation="MEKLFTYKEFVDMMQKYGIRHTKRKLRRGENLMENASKFSNVVLL
FT                   INGYISSYTYESPEKLLSIFEPGIFLRYSILEDQPEFVTNIALSDNCEVYEYKKEDIEY
FT                   ALTLFPENFGFQYFFLKRIGRHLYYRALLNGKEHKEKLYYAMKYLGELIGKTDENGNVS
FT                   LPPEVTLKVLIEYSTLSKAAFYRQRIRLLEQEILKPHENTFIVQKKVASHYEDQLTSI"
FT   gene            586162..588183
FT                   /locus_tag="FORC68_0571"
FT   CDS_pept        586162..588183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0571"
FT                   /product="Internalin-like protein"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPE6"
FT                   /protein_id="QBZ17799.1"
FT                   /translation="MKFNWKVVLLFVLILALIVPVYSKAVETGKELPKSPELQDDKSST
FT                   LKNVNTPKNLKASPLTIPANSTIADLFPDEGMAKTVANQLGRTENNNFQTPTKTDWKVD
FT                   DVVTEVELNRMWYLTSVATIGSIEGIQYLPNLYDVRLQFDNQCKDLSPFLKAPNGYSQL
FT                   YRLAINNGNISDISPLTELSAPTLNYIDLGGNNISDLSLFPKLPNKLPNLEEISLERNN
FT                   ISDVSPLADFASTKIKVFNLDENHITDLSSLTNNKMPNLQRLYVRYQTLDMEPVVTSSK
FT                   YEFSIQPSIFGTTKPVKITATKPKATIDPITSKITYSAEEMAKKPFYYSPLFPGVTYSW
FT                   DENFPLNGSNSLVDFRGTITQPLTYIEPPQVVSYNSGLTYEIGTSLTEQQFLNDVNLIT
FT                   DQPTTITSDFDVKLKNLNTVGIYWVAVKASNIEGNAEANIMVTIKYKPPVITADAEYTY
FT                   LVGDKVNATQFRADVNATLTGEGTLRDDFIYKVRLNTAGDYVVTLTSPKSGYYEQDAIP
FT                   VTVIVHVKELLELQIPDEFRMDIDANADSVPISDKKQTLKCYGSSGKAELEVIDRRTVR
FT                   QGWTITGAMTPFTNSGGDILQTSLKYQSKSPSSSPIYLNTTNQPIEKKQSAVTDPKYDS
FT                   TVFNLEDSLSMEIEPNDALVNDSYESKITWILEDAPRP"
FT   gene            588216..588512
FT                   /locus_tag="FORC68_0572"
FT   CDS_pept        588216..588512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0572"
FT                   /product="putative peptidoglycan bound protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A394VHV4"
FT                   /protein_id="QBZ17800.1"
FT                   /translation="MKKMGFILICCLFVCASPFYVKANTDKATSKAGVIFTHDPRKPKT
FT                   GTDDRSGTFPTKVPPKRLPKTGDTTDFYLVLLGFGFILIAKKGYFKEVREEIR"
FT   gene            588556..589398
FT                   /locus_tag="FORC68_0573"
FT   CDS_pept        588556..589398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0573"
FT                   /product="extracellular protein"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:L8DR28"
FT                   /protein_id="QBZ17801.1"
FT                   /translation="MTSRTVKVTTASLLALGLIVAPVLSGDFASAATSVTKDSKGIVKF
FT                   DKSTTPDPDPVNPDPVDPDPVIPDPTDPPVGTDGLWILAVSDWDFGTHNVSSLSSGALN
FT                   VHAADDTISTYVDANGNGQQDLPGEVSVTKKVTPYAQISDVRGTNTGWTLSVTGSAFKD
FT                   SSTPAKTIPGAELTIPKSTVSSATSTAQAPTGYDSVTISMTGGAAVPVMAAKDMQTATP
FT                   TNFNDDQGMGTWTDSFGSQAVSATDTSKPKLSIPKNVVVADGTYQSTLTWTLSDTPAV"
FT   gene            589474..590505
FT                   /locus_tag="FORC68_0574"
FT   CDS_pept        589474..590505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0574"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="GOA:A0A4P7MPX9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MPX9"
FT                   /protein_id="QBZ17802.1"
FT                   /translation="MKKICAIIFACILAILCFPGQQAYATENSSFSVKAILPDNQASSV
FT                   TYFDLQMNPKQKQTLKVEITNHSKEEITVNCVANTAVTNEMGYVDYSIPNTKPDKTLKY
FT                   PFADIVKESVSEVTLKPNETKIWTAAIQMPAENYDGIILGGLHFQEKKEEDKEKESSEN
FT                   DVQIKNEYAYVIGVKLTEKTTVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKVHLVAKNKEDKW
FT                   EWTKEFTISSDQAKKANKAALGLEKDYTWMYIVGGVLLFILLIITTYFVGKRAAKKKQE
FT                   NEK"
FT   gene            complement(590562..591197)
FT                   /locus_tag="FORC68_0575"
FT   CDS_pept        complement(590562..591197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0575"
FT                   /product="CBS domain protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR017036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYV1"
FT                   /protein_id="QBZ17803.1"
FT                   /translation="MLIKNLCIPKINLTTVPGDATLQEAIHLLEESGYRCVPVLDEKGE
FT                   KFLGNIYKMHIYKHAANGGSLSDPVMSLIKNATKHICVNASFFEVFFTIKELPYIAVLN
FT                   EQGNFYGILTHGKLLGLLQDGWNVKTTSYVLTIATGEVQGALTKITKIIDRYSSISSLI
FT                   TLDNQTEDFIRRVLVSLPVGVTEEKKNEIVSHLERKGLRVVETEKIEK"
FT   gene            591407..592588
FT                   /locus_tag="FORC68_0576"
FT   CDS_pept        591407..592588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0576"
FT                   /product="NADH-dependent butanol dehydrogenase A"
FT                   /db_xref="GOA:A0A3H0R7R3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0R7R3"
FT                   /protein_id="QBZ17804.1"
FT                   /translation="MQKEMLNFDYYNPTHIIFGKNRFNELNEVIPQDKKVLILYGGGSV
FT                   ERFGTLDKVKAALKSREVGEFGGIEANPTYETLIKAIQLVKEENYDFLLAVGGGSVIDG
FT                   TKFVAAGALFDGEPMDIFGSGIGEKRPITKALPFGTVLTLPATGSEMNSGGVITFVEKK
FT                   AKLGFGSAYTYPVFSLLDPELTYTLPKRQLANGIMDAYVHVMEQYMTYPVGALLQDRYA
FT                   ESLLQTLIEIGPDVIKEDNHDYNTRATFMWSATNALNGTLSRGVPQDWASHSLGHEITA
FT                   LYGIDHARTLAIVLPSLLNVRRSEKHDKLVQYAERVWGITSGSDEEKIDAAILKTREFF
FT                   ESLGAGTRFSDYGLGEEVVDLLVDQLDRHGLTNISERGDQTLEVSRQIYTNAL"
FT   gene            592678..594156
FT                   /locus_tag="FORC68_0577"
FT   CDS_pept        592678..594156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0577"
FT                   /product="Di/tripeptide permease DtpT"
FT                   /db_xref="GOA:A0A4P7MF36"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF36"
FT                   /protein_id="QBZ17805.1"
FT                   /translation="MSTNKEKTFFGHPRGLATLFNTEFWERFSYYGMRALLLYYMYTAV
FT                   ADGGLGFSQSTATAIMSIYGSLVFMSGVIGGWFADRVLGARKTIFYGGVLIMVGHIVLA
FT                   LPNGGAAALFGSMAFIILGTGLLKPNVSNVVGDLYPAGDNRRDAGFSIFYMGINLGAFI
FT                   APPIVSAVSDNAGSYHAGFGVAAVGMAIALVVYVLTGKRYLKDAGKKAPNPLQRSEAKS
FT                   LTFKIIGIVLGIGLLIAVLSLITGSLTIDTIILAVTVMGVGVPLAYFIMMMTSKKTEAD
FT                   EKSRLTAYIPLFLIAVLFWMIEEQGSSTLALFAAERTDLSIWGMNLNPANFQSLNPVFV
FT                   ITLSPIFAWIWTKLGDRQPSTPRKFALGLFFAGLSFVVMMLPGILHGNTTTLVSPLWLV
FT                   LSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQSFNAQLTQLFNADT
FT                   EIAYFGITGFVAIAFAIALFIFAPFLKKYMKGVH"
FT   gene            594285..594992
FT                   /locus_tag="FORC68_0578"
FT   CDS_pept        594285..594992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0578"
FT                   /product="Phosphoglycerate mutase family"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1JLL0"
FT                   /protein_id="QBZ17806.1"
FT                   /translation="MESSSRVVIYLTRHGKTILNTLDRVQGWADSPLTEEGALVAHDLG
FT                   RGLKGTNFVAAYASDRGRAIETARIVMKESDNHHLKLEKLAEMREFGFGKFEGEYNQAV
FT                   LKMVAKAHGFESIESYYDKTSENNSNIVIDTVHKMDETGMTENSAIFEERLTAGLDTIL
FT                   ADANKRGGGDVLVVAHGMVIHRIIEMIDPSKNLRIIENASVTKVIFEDGAYSIEEPGNM
FT                   LYVEAGKKAQGGV"
FT   gene            594993..595688
FT                   /locus_tag="FORC68_0579"
FT   CDS_pept        594993..595688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0579"
FT                   /product="Phosphoglycerate mutase family 1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7I2G9"
FT                   /protein_id="QBZ17807.1"
FT                   /translation="MATGKLNVYLVRHGKTMFNTSRRVQGWSDTPLTNEGIEVAEFLGR
FT                   GLREIPFDAVYTSDRGRTIETAGIVLRESNQAHLEINELRDFREFGFGKFEGEYEDIMF
FT                   GRVMEHLGFRSMEEAFEKFGDDGYQIISETVEKIDETGMSENWDEMVARLKNALGTVSA
FT                   ENEVENANVLVVSHGMAINTIISFFDKSLINPDLANASVTRLGFENGEWTIETVNDLSY
FT                   IEAGKLVLV"
FT   gene            complement(595730..596770)
FT                   /locus_tag="FORC68_0580"
FT   CDS_pept        complement(595730..596770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0580"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A6XTU4"
FT                   /protein_id="QBZ17808.1"
FT                   /translation="MSKNQATAYIGTYTKAESQGIYRLVIDKTTGEIKENKLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFSVEEDGSLTFIGQDVQTGNPPCYVDASHDGSI
FT                   VVSANYHLGTIVSYPTENGALKPSVSTIQHTGKSVHERQEKPHAHFAGFTPEQKYVITC
FT                   DLGTDKVTTYSANAGKLEKVTELDVKPGSGPRNLVFHPNAKYVYIMTELTSEVIFAEYD
FT                   EATGALKVIQTIASLPEGFDKENKGSAIHISPDGRFLYVSNRGQDAIVSYAVAENGTLT
FT                   LAATTPVEGVGPRDFDLNYTGEILVATNENSNNVTVFGVNKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
FT   gene            597170..598075
FT                   /locus_tag="FORC68_0581"
FT   CDS_pept        597170..598075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0581"
FT                   /product="Magnesium and cobalt transport protein CorA"
FT                   /db_xref="GOA:A0A1D2INV0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INV0"
FT                   /protein_id="QBZ17809.1"
FT                   /translation="MSIQTIFGNGQYNWINIDTDNTDKLADFYEEYHIDDEVIAYSIDR
FT                   NERAHFEYDQKTNTFVIVFNVPDQRKIDNHYETIPMVFIIKDKQLITITNNDNQYITRK
FT                   MKRYLKESDEVTIFQFLFSSLYFIMDAFFPYVEEMDTDRRTINDKLKIKTTKKNLLSLS
FT                   DLETGIVYFVSASKQNAALLEQMKAHMIYRELNEVEKEQFEDALIEARQLVEMTGLSSQ
FT                   ILQQLSGTYNNILNNNLNDTMKILTALSILLTVPTIITGFFGMNMPLPLEHNTFGWIVT
FT                   IFISVILWFGLSFILRKLMR"
FT   gene            complement(598118..599494)
FT                   /locus_tag="FORC68_0582"
FT   CDS_pept        complement(598118..599494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0582"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /db_xref="GOA:A0A1C7PXE4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXE4"
FT                   /protein_id="QBZ17810.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKQRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
FT   gene            complement(599987..600298)
FT                   /locus_tag="FORC68_0583"
FT   CDS_pept        complement(599987..600298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0583"
FT                   /product="Phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="GOA:A0A1C7PX64"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX64"
FT                   /protein_id="QBZ17811.1"
FT                   /translation="MLNDLYEEIKLRKTQPREGSYTNYLFDKGLDKILKKVGEEATEVV
FT                   IAAKNDNQELIAEVSDLAYHLLVLLAEKNIPLVAIQTELQKREGKLSTTRDRKEINDL"
FT   gene            complement(600299..600616)
FT                   /locus_tag="FORC68_0584"
FT   CDS_pept        complement(600299..600616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0584"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="GOA:A0A1U7AN65"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AN65"
FT                   /protein_id="QBZ17812.1"
FT                   /translation="MISVDFSKGLVPTIILDDQNGDVLMLAYMNEESYQKTLETGYTWF
FT                   FSRSRNELWNKGATSGHTQKVKQIWTDCDNDTLLIRVTQIGPACHTGKKSCFFNLIKED
FT                   F"
FT   gene            complement(600613..601368)
FT                   /locus_tag="FORC68_0585"
FT   CDS_pept        complement(600613..601368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0585"
FT                   /product="Imidazole glycerol phosphate synthase cyclase
FT                   component"
FT                   /db_xref="GOA:A0A459EAJ3"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A459EAJ3"
FT                   /protein_id="QBZ17813.1"
FT                   /translation="MLTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGAD
FT                   ELVFLDITATVELRQTMIDVVERTAEQVFIPLTVGGGISSVSDMKELLQAGADKISLNS
FT                   AAIKRPELIQEGAAKFGNQCIVVAIDAKWNGTNWSVFTRGGRNDTGLDAIEWAKKAVQL
FT                   GAGEILLTSMDGDGTKNGYDIPLTKAISEAVSVPVIASGGCGNAAHMAEVFEKTNATAA
FT                   LAASIFHYGELSIKNVKTTLLEKGVNIRP"
FT   gene            complement(601358..602080)
FT                   /locus_tag="FORC68_0586"
FT   CDS_pept        complement(601358..602080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0586"
FT                   /product="Phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="GOA:A0A3T2H697"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H697"
FT                   /protein_id="QBZ17814.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGAT
FT                   YLHIVDLDGALEGRPINLEIIRKMKKAAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTDPDFLRAAVQKYGTKIAAGIDAKNGFVATRGWLDVSQVSYLDLAKQMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVSLIASGGVSSRADLEALAQLGLYGAIAGKAL
FT                   YNHHISMSDIVEVEQIAY"
FT   gene            complement(602059..602685)
FT                   /locus_tag="FORC68_0587"
FT   CDS_pept        complement(602059..602685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0587"
FT                   /product="Imidazole glycerol phosphate synthase
FT                   amidotransferase component"
FT                   /db_xref="GOA:A0A465TX22"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A465TX22"
FT                   /protein_id="QBZ17815.1"
FT                   /translation="MIVIIDYDTGNTKSISKALDFIGLQNKISSDTTEIAQADGVILPG
FT                   VGAYPEAMKELTRRGLNKTLKEIAAGGKPILGVCLGMQLLLESSNEHSFTNGLGLIPGH
FT                   VEKLPEDPEFAVPHMGWNQLQIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYS
FT                   IEVPGMINKGNIYGAQFHPEKSGQIGLEILKGFKEVTYSCKSSQQ"
FT   gene            complement(602686..603270)
FT                   /locus_tag="FORC68_0588"
FT   CDS_pept        complement(602686..603270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0588"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="GOA:A0A1D2INV2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INV2"
FT                   /protein_id="QBZ17816.1"
FT                   /translation="MRTATKTRVTAETSIELSINLDSQVESTISTGVGFLDHMLTLFAK
FT                   HSRVTLNVKADGDTYVDAHHTVEDIGITLGLCLKEALADKASINRYGSAYVPMDESLGF
FT                   CALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNTEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITINPEIKGVNSTKGVL"
FT   gene            complement(603271..604554)
FT                   /locus_tag="FORC68_0589"
FT   CDS_pept        complement(603271..604554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0589"
FT                   /product="Histidinol dehydrogenase"
FT                   /db_xref="GOA:A0A463NRF0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A463NRF0"
FT                   /protein_id="QBZ17817.1"
FT                   /translation="MKILTGTINELLNEVKAENNTNNSLQVESEVKSIIEKVKKDGDQA
FT                   LFDFTSQFDGVRLTELRVQTADIQSASSKVNPAFLVALQQAKANIESFHSKQKQHAFLD
FT                   SEKDGVIRGQLIRPLETVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGI
FT                   NPHVLAAAQLAGVDEIYQVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGL
FT                   VDIDMIAGPSEIVVLADENANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEIN
FT                   KQLENLPRKAIAQKSIETQGKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKN
FT                   AGSIFLGSYASEPLGDYFAGPNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKE
FT                   KDAIVLLAKKEGLDAHAKAIQIRFEEEN"
FT   gene            complement(604551..605192)
FT                   /locus_tag="FORC68_0590"
FT   CDS_pept        complement(604551..605192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0590"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="GOA:A0A1C7PX50"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX50"
FT                   /protein_id="QBZ17818.1"
FT                   /translation="MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQ
FT                   PISFILVKAVDVMTYVKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDF
FT                   DPSSYRRKIIATKYPTVASKFFREKGEDVEIIKIEGSVEIAPVLDLADAIIDIVETGST
FT                   LKENGLIIYEKMYPISARLIVNKASLKQNKTQIFHLIDQLEQAIKEELAE"
FT   gene            complement(605189..606370)
FT                   /locus_tag="FORC68_0591"
FT   CDS_pept        complement(605189..606370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0591"
FT                   /product="ATP phosphoribosyltransferase regulatory
FT                   component"
FT                   /db_xref="GOA:A0A3D7WGN3"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WGN3"
FT                   /protein_id="QBZ17819.1"
FT                   /translation="MNLNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILIGIGVLNALEIPNFQIELGHAAIY
FT                   RRVTNLLNLSETAEIDFRLLIQNKSLTGIKRFVADNPSTLDDFILALPRLFGPATAILK
FT                   QAKNLTTDKGILTALREMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSASSPAVGLALNLDSLTTLQNRAGVIKKQVSTSLLIHYDLDAIQ
FT                   QAEKLMQETPNSELSFFETPTNAISFAKKWHIPAVIHVSRQGIQTIFQREADL"
FT   gene            606438..607349
FT                   /locus_tag="FORC68_0592"
FT   CDS_pept        606438..607349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0592"
FT                   /product="Histidinol-phosphatase"
FT                   /db_xref="GOA:A0A4P7MI76"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI76"
FT                   /protein_id="QBZ17820.1"
FT                   /translation="MNRKIVAYGIISVPFKALGKKNFERGLNMKRDGHTHTEFCPHGTH
FT                   DDVEEMILKAIELDFDEYSIVEHAPLSREFMNNTAGDKEAVTTASMAMSDLPYYFKKMN
FT                   HIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLDEYGPQTDDGVLSLHFLEGQGGFRSID
FT                   FSAEDYNEGIVQFYGGFEQAQLTYLEGVKQSIEADLGLFKPRRIGHISLCQKFQQFFGA
FT                   DTSNFSGEVMEEFQAILALVKKRDYELDFNTAGLFKSLCGETYPPKEIVTLARELKIPL
FT                   VYGSDSHGVQDIGRGYNTYCQK"
FT   gene            complement(607334..607630)
FT                   /locus_tag="FORC68_0593"
FT   CDS_pept        complement(607334..607630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0593"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="GOA:A0A3T1JM18"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1JM18"
FT                   /protein_id="QBZ17821.1"
FT                   /translation="MVPADFEERVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATL
FT                   KHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSEGVTFKENGHVKMKDHFWQ"
FT   gene            607707..608738
FT                   /locus_tag="FORC68_0594"
FT   CDS_pept        607707..608738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NQ10"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NQ10"
FT                   /protein_id="QBZ17822.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFKKDEYYQFTHETDLDFNEVRTFAANMFVAEEEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLIFNVDHDTGNKVVILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATTEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
FT   gene            complement(608779..610074)
FT                   /locus_tag="FORC68_0595"
FT   CDS_pept        complement(608779..610074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0595"
FT                   /product="Hypoxanthine/guanine permease PbuG"
FT                   /db_xref="GOA:S5K6L0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:S5K6L0"
FT                   /protein_id="QBZ17823.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
FT   gene            610390..611784
FT                   /locus_tag="FORC68_0596"
FT   CDS_pept        610390..611784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0596"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="GOA:A0A3D7WGK8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3D7WGK8"
FT                   /protein_id="QBZ17824.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAADVDGRKPSIWDHWYKIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMLANDVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHYPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIIL
FT                   NLTPSYPRSQNPADLKAAHIADLIFNRSFLDPVTKGEFPTDLVEIIREHDALPEYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGANCHGYHLWTFMDCWSWANAYKNRYGLVEVDLDNDFKRTVKASGHWYKELAE
FT                   NNGFED"
FT   gene            611828..612556
FT                   /locus_tag="FORC68_0597"
FT   CDS_pept        611828..612556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0597"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A1U7AN60"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AN60"
FT                   /protein_id="QBZ17825.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPTEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDDLNLKIASSYKQIRADKATLLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SRSRHRYDKFVFTTVNIARR"
FT   gene            612981..614444
FT                   /locus_tag="FORC68_0598"
FT   CDS_pept        612981..614444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0598"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="GOA:A0A3T1NPB8"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPB8"
FT                   /protein_id="QBZ17826.1"
FT                   /translation="MKKKYFLCVFAVILFFTGFLFGNSPVNAAETDTSNVTYNYIDIST
FT                   LTETQKNSIIKGNPNETLTNDYENYSFVYQKNTSEPTTNTDNTSDNNKNQNGTLLKAGD
FT                   VGPNSYLIILGFILFGSGIGLLTLKKRHARQLLVFLVVLGGSSLLVGSIVQATENSNLK
FT                   TQESQTVAKGAKETKQPESMEGYTYVGYIHTSKNNTSPVVEKGTVTVNYQDEQGNSLAT
FT                   SETLEGNIGQPYQTATKDIEGYQLKEVNGNTTGTFTEKAQVVTYVYQKVPVATVTVKYL
FT                   DQDGNKIHDPQTISGNIGEPYDASTDKYKLQIDGYTLDTTKLPNNANGIFTNQAIEVTY
FT                   IYTKEAQDVKITIKFVDSNGDPFVLTDLTTYKNGDLVPIYPNLDQYHMRLNYNQQIYNQ
FT                   GEAVPDIVIPAREGETYSLPERMTFNILDNQGKQIPYVISQNADFSSTGIERWENYQSI
FT                   PANREGTLTSEDVVVTYQILVYGVLIPEP"
FT   gene            complement(614498..614956)
FT                   /locus_tag="FORC68_0599"
FT   CDS_pept        complement(614498..614956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0599"
FT                   /product="membrane protein"
FT                   /db_xref="GOA:A0A392ZM52"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A392ZM52"
FT                   /protein_id="QBZ17827.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAVLSHFFAKHKKMPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRAFRGRKERI"
FT   gene            complement(614970..615722)
FT                   /locus_tag="FORC68_0600"
FT   CDS_pept        complement(614970..615722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2I0P7"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I0P7"
FT                   /protein_id="QBZ17828.1"
FT                   /translation="MSNETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATIASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISVGWGINLDTMIIGGVMPLVPGVPITNAVRDLLAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
FT   gene            615886..616095
FT                   /locus_tag="FORC68_0601"
FT   CDS_pept        615886..616095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0601"
FT                   /product="bacterial seryl-tRNA synthetase"
FT                   /db_xref="GOA:A0A1E8EPY4"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1E8EPY4"
FT                   /protein_id="QBZ17829.1"
FT                   /translation="MANIEYEIIEEIGVLSENARGWRKELNKVSWNGRPPKYDIRDWSE
FT                   DHEKMGKGITLTDEEAEALKKLLD"
FT   gene            616117..616773
FT                   /locus_tag="FORC68_0602"
FT   CDS_pept        616117..616773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0602"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /db_xref="GOA:A0A1C7PXA0"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PXA0"
FT                   /protein_id="QBZ17830.1"
FT                   /translation="MFAYDIYEPIGRKDEDTFPVIFALHGFGGDELEMAGRLELLMDRF
FT                   VVVSMRGDVEYGPAYGFYHMVTEGDPNPREVDYISLRVAQFIDKICTDYISIDKEQVFL
FT                   AGFDQGAVLAISIMQSYGGQYKAAALLSGRLPYYMEERPANLMLKDKRIFIGHGIEDAV
FT                   IQISEADDIARLFEKMGCQVEKHRYFIGHNVNEAEEDDLYRWFESFLPNQPVKNK"
FT   gene            complement(616804..617988)
FT                   /locus_tag="FORC68_0603"
FT   CDS_pept        complement(616804..617988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0603"
FT                   /product="LSU m5C1962 methyltransferase RlmI"
FT                   /db_xref="GOA:A0A3A7NNU4"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7NNU4"
FT                   /protein_id="QBZ17831.1"
FT                   /translation="MKNLVKVKVFPKFTKGYKEGYPLILKERMEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLTNLITTAIEKRQFLFADDSTTAF
FT                   RIFNGEGDGLGGFTVDYYDGYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYSVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPNEQAIIVEDVFHYF
FT                   KYAARKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIIASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRTYKIVETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
FT   gene            complement(618076..619518)
FT                   /locus_tag="FORC68_0604"
FT   CDS_pept        complement(618076..619518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0604"
FT                   /product="P60 extracellular protein, invasion associated
FT                   protein Iap"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NQ18"
FT                   /protein_id="QBZ17832.1"
FT                   /translation="MKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGT
FT                   TVDAIKKANNLTTDKIVPGQKLQVNNEVAAAEKTEKSVSATWLNVRSGAGVDNSIITSI
FT                   KGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVAPTQEVKKETTTQQAA
FT                   PAAETKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQD
FT                   IMSWNNLSSSSIYVGQKLAIKQTANTATPKAEVKTEAPAAEKQAAPVVKENTNTNTAPT
FT                   EKKETATQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNTNNTNTNTNTPSKNTNTNS
FT                   NTNTNTNSNTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYV
FT                   FAKAGISLPRTSGAQYASTTRISESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDN
FT                   GVKYDNIHGSGWGKYLVGFGRV"
FT   gene            619943..622273
FT                   /locus_tag="FORC68_0605"
FT   CDS_pept        619943..622273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0605"
FT                   /product="Protein export cytoplasm protein SecA ATPase RNA
FT                   helicase"
FT                   /db_xref="GOA:A0A3T1NPD2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPD2"
FT                   /protein_id="QBZ17833.1"
FT                   /translation="MRQNYDDRKIVKQYREIARQIVKKEGLYKNMDQAELCEQTNFWRE
FT                   KFKTKPMTDRDKINIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDIAQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYHTANKLVKKMMKDDYEMEEHKRFVWLNDAGIEKAQKFWGVGSLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLDDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEGVEVK
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRVNREDMQD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDPDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSAKLKRKAPRDGKPVNSRKIHAVVV
FT                   DAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDLLLERNKLGVSSEKILREVAEYS
FT                   FIHPSDIPEEELEIYYSRQKELLGGTKFPISFDQVTLMEPREVVEEIVSWHKKERNKFP
FT                   AETIAAIEREVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGAQLFEKF
FT                   QADYHFYFAHALLELDPDGLIQG"
FT   gene            622389..623561
FT                   /locus_tag="FORC68_0606"
FT   CDS_pept        622389..623561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1D2IP26"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IP26"
FT                   /protein_id="QBZ17834.1"
FT                   /translation="MKGSFTKFKQFFIENKFVLGLLIFLLVALDIYVLTKIAFIFDPLM
FT                   VILKTVAAPIILAGISYYLFNPIIDWLEKHKWKRGWAIALLYLVIIGLLILLFSFVIPA
FT                   VKDQIVSLFKSFPGYWDQITQKFDEFSRSSLFDQLKDKLNTNMSDIMKTLSTKGTSVIN
FT                   SAISSIGSIVGTVTEVVLAIVTTPLVLFYLLKDGKKLPDFLLKMLPVNGRAHTRQVLGE
FT                   ANHQISSYIRGQIIVSLCIGILLFIGYLIIGLPYALTLAIIAACTSIVPYLGPAIAITP
FT                   AIIIAIVTSPWLLIKLIIVWCVVQLLEGKFISPQVMGKTLKVHPITILFVILVAGNLFG
FT                   VLGVIFAVPGYAVLKVIVTHVFIWFKRISGLYGEQPESEYVETPTEEKEL"
FT   gene            complement(623598..623771)
FT                   /locus_tag="FORC68_0607"
FT   CDS_pept        complement(623598..623771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF57"
FT                   /protein_id="QBZ17835.1"
FT                   /translation="MRQFNVQFIKKENKIILFIRFRNIYYIKIALLLLSPCKEKNYVFF
FT                   VNINFNTTKKHY"
FT   gene            623820..624533
FT                   /locus_tag="FORC68_0608"
FT   CDS_pept        623820..624533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0608"
FT                   /product="extracellular protein"
FT                   /db_xref="InterPro:IPR027994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QY01"
FT                   /protein_id="QBZ17836.1"
FT                   /translation="MIFKKTLIVGLIGISSVTLFAPSAFAVTSEGDSKATVKFKAGTGV
FT                   VDPVDPENPTKPIDPLDPSNPTDPGTGNTGSLTLDYVSSVNFGEHEVSSTEQSYSSTSR
FT                   KPFIQISDRRGTGAGWKVTATATAFQNEDGAASLSGATLSFKNGETASASTTATTPTAA
FT                   QTVELPTDGTSIVSVVSAKESEGMGTWINRWFGATPNDTASLNDNVKLTIPAGSATLGD
FT                   HEATITWTLSDAPGV"
FT   gene            624602..625627
FT                   /locus_tag="FORC68_0609"
FT   CDS_pept        624602..625627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0609"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="GOA:A0A3T2H6E0"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="InterPro:IPR021759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6E0"
FT                   /protein_id="QBZ17837.1"
FT                   /translation="MKKSFLSLLFIIPLLVTCGNFTEAQAAEGDVGYSVQAHIPANQID
FT                   KRQTYFDLKMQPNQKQTVEIDVMNSSNEEIQVEAAINYASTNRTGVIDYTKNDLTKKDK
FT                   SLKYPLPELAEIPDDQKRLTIPVNGKKTVQVMIEMPAEKVDGVVLGAVEFKKKNTNETK
FT                   KTKGVSLKNEYSYIVGMQLSETDKQVKPHMNLLSIKPALINYHTAIVAKLQNDQPVILE
FT                   NLSIDAKVYQQNSDKLLYQTKKTDMKMAPNSNFDFGIDWENQPLKEGKYRLKMTATNGV
FT                   ETWTWDEAFTIGKEGQNLNKEAVNLEKTNTWLYVAIAAGVVLIALIIILVIRKRRNKQE
FT                   K"
FT   gene            625645..628110
FT                   /locus_tag="FORC68_0610"
FT   CDS_pept        625645..628110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0610"
FT                   /product="cell surface protein precursor"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NP89"
FT                   /protein_id="QBZ17838.1"
FT                   /translation="MAFKKLILVLTMAALFLGLKIVVAAENEPTDLASNEAIVTNFADL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPATGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLKDINVVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSASGKLTINHASSNANSAFWFGGGTAE
FT                   VNTFTVEENADVTIISNGTGMFYRSGTKPVDIDVKKNAKLDITSNNNIFRDTPGGAVKI
FT                   AEGADVTMTKTAGGNPLLWVADDITVSPDARFILNKTGGTGYIIQFYNATAKLDVNDPL
FT                   SFLITTNSNTPMFYWPYANTFNLNAQMVNYWDTVGTIDRTDLAAQSFSLPNGENVTGSL
FT                   TYTGTTTKILSTNAGMTPTNFNQNTARMIAMGRLEGTINPVTDADNEITGTATPNAFIN
FT                   ISYTENGGNKVLEGQANDDGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDVTVEDVT
FT                   PPSGDAVTQIIQLGDPFPDVAELVTNIYDHSDNTSGAGVTTTLQSAPDTNVFGPAEAIV
FT                   RLEDKAHNHVDIRVPVFIKDDATEIQDGKALRAADFSVNVKDINELNDAELEQFILTKS
FT                   GAKAFQIETGEDLTTDVKVASTNLKKETGTYTATIQIGGLTKEIAIQVTGELKFNHVPE
FT                   TISFETMGLNQQKNIAKRNADFDLSVLDSRGAGDNFSVTAAIKAPLTSTANSAHTLPNG
FT                   LIFIDNAGEKKILSDEPITIFQSQSASDMIVPIEWAEDRGILVEVDAAEAYVDESYETT
FT                   IEWTLTDAP"
FT   gene            628227..629630
FT                   /locus_tag="FORC68_0611"
FT   CDS_pept        628227..629630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0611"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /db_xref="GOA:A0A3T1NPD8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPD8"
FT                   /protein_id="QBZ17839.1"
FT                   /translation="MTSVMWFRRDLRVSDNKALYHACKEDDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEVDKTALLQIMFGEPVECLKQLKETLPSWDKVYFNRDETGYGAERD
FT                   EAAKTFFDEQEIEVQAFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKVTL
FT                   KADNIRKENLFPKYEEQFAEMTCDLPILDSGEKTANTRLANFIKHDVADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISVRTIWQALQENEATEGRAIFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREFFKAWQEGKTGFPLVDAAMRQLKETGWMHNRLRMVTASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTIQSQKFDPTGK
FT                   FIRKYVKELANLPDKYIHQPEKMSETEQKEYGLLLGKDYPFPIVDHKERRKLAIARYEF
FT                   SKEHYRGNI"
FT   gene            629768..630181
FT                   /locus_tag="FORC68_0612"
FT   CDS_pept        629768..630181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MI91"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MI91"
FT                   /protein_id="QBZ17840.1"
FT                   /translation="MAQFLKLFLTSAVVFLVFDLFWLLVASKKMYQQFIGDLMGDVRLA
FT                   PAVIFYFIYVVGVTFFVLLPGTEKGSLGYTILAGALFGLVCYATYDLTNLATLKDWPIT
FT                   MTIIDLIWGTAVTTVTSVIVYFINLHFFSGAGS"
FT   gene            630181..631950
FT                   /locus_tag="FORC68_0613"
FT   CDS_pept        630181..631950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0613"
FT                   /product="DAK2 domain protein"
FT                   /db_xref="GOA:A0A4P7MEN5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEN5"
FT                   /protein_id="QBZ17841.1"
FT                   /translation="MMESESKRLLKSMLNGAAEVISKKDELNRINVFPVADGDTGSNLA
FT                   SLMQAIIDHVSPREYSTKELLEEVASAALIGARGNSGMIFAQYLNAVAESYHHIESTFD
FT                   GLVIAFQKAVHKAYEALLDPKEGTILSVMKAWSEELAGTYEQERSFQQSLLNAQIVAEK
FT                   ALINTEFQMPILRKNRLVDSGAKGFYYFIAGLTNAYCGKAISAPVRFMEVEQTAEHMHV
FT                   ETSEPKYRYCSEFIIKQATISHQRLQEVLASKGDSLVIAGNEKQIKIHIHTNEPQKVLG
FT                   TLAGYGMMTYQKVDDMRLQYEVTKKPRAKIAIVTDSIADLPEAFLLEHQVHVLPMNILA
FT                   GDENFLDKLTVGPDMMQEKLRKQTKMSTAQPTIRTVDALLSFLENKYEHVLVISVAAKL
FT                   SGTYQLIKQRIKVRELSSDWIRVIDSKLNSVAQGILVKQAVELVESGKSWESIYPEVEQ
FT                   MIERTFIYVAVADLSPMVQSGRIPRVLGKLAQKLSLYPIVSLDESGDGKLIGVSFSQKQ
FT                   SMKKIIKKIAKLQLKELAITHVSSRDNAAIWQKQLEKETGKISYLVDSSAAIAISAGLG
FT                   SVAVAGIKKEETI"
FT   gene            631947..632720
FT                   /locus_tag="FORC68_0614"
FT   CDS_pept        631947..632720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0614"
FT                   /product="steroid 5-alpha reductase"
FT                   /db_xref="GOA:A0A4P7MQ19"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQ19"
FT                   /protein_id="QBZ17842.1"
FT                   /translation="MMYWTVALALLVYFILWFIISKIKGKYSLVDIAWGGGFVVVAWTG
FT                   FLTTFSVTTQSITILILVTLWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTTLVNLKAF
FT                   LNVFVLQGVLLFIIALPITHSFANETATFAWWQILGIVIWIIGFIFEVGGDLQLENFKK
FT                   NPANKGKLLTSGFWSVTRHPNYFGEALSWWGVFLVALTQLTDLWLITSPIVITLLLLFV
FT                   SGVPLLEKKYQDRADFQAYANKTSKFFPFIGKKGL"
FT   gene            632848..633390
FT                   /locus_tag="FORC68_0615"
FT   CDS_pept        632848..633390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1KJQ3"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1KJQ3"
FT                   /protein_id="QBZ17843.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLVAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMVGAIVGSMRDAGEVKD
FT                   ALTVFERTLKTIPEGSTGVILIATEQELANVNDVAMDELHGRVQRMDEAIVAQEIKSAQ
FT                   ETEGKAKDSAKKHWFSK"
FT   gene            633617..634417
FT                   /locus_tag="FORC68_0616"
FT   CDS_pept        633617..634417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0616"
FT                   /product="formate/nitrite transporter family protein"
FT                   /db_xref="GOA:L8DXC6"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:L8DXC6"
FT                   /protein_id="QBZ17844.1"
FT                   /translation="MDVESSPLMQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGT
FT                   AVAVMIGDKVDHFAPGLGKITYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIVKP
FT                   GKALQILLLCIVCNLLGGILAGYLVSLTSVFHNLPADHFLFTAVSGKLEKAPLQIFVEG
FT                   IFANIVVNTAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGT
FT                   LAAMTAGNVTVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
FT   gene            complement(634454..635560)
FT                   /locus_tag="FORC68_0617"
FT   CDS_pept        complement(634454..635560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0617"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /db_xref="GOA:A0A3T1NPI3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPI3"
FT                   /protein_id="QBZ17845.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSESRDNCILL
FT                   EHALTGTAHAAKHFESDAPGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSINP
FT                   KTGEPFRLQFPGFSIKDIIKVQRELLEQLGVTRIVSVIGGSMGGMQATEWAIDYADITD
FT                   SIINIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYVGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFSKIKIPYLLISITTDQLFRIHDLRRGYELLKEWDVPVTYHEVASEYGH
FT                   DAFLVEKEVPKFEPLIRSFLSNLPVKSI"
FT   gene            complement(635577..636854)
FT                   /locus_tag="FORC68_0618"
FT   CDS_pept        complement(635577..636854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0618"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="GOA:A0A1C7PX68"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX68"
FT                   /protein_id="QBZ17846.1"
FT                   /translation="MSNEYKFETIQVHGGHTPDGDTHSRAVPIYQTTSYTFDSPEHAAA
FT                   LFGLQETGNIYTRIMNPTTAVLEERLTLLEGGIGAVATASGMAAITYSILNIAGSGDHI
FT                   VAAATLYGGTHTLFSHTFKTFGIDVTFVDPNEPENFEKAIKDNTKAVFIETIGNPDINI
FT                   VDIEKVAKIAHASDIPLIVDNTFATAYLNRPFDFGADIVVYSATKFIGGHGVAIGGAVI
FT                   DSGKFNWANGKFPKLVVPDDSYNGLSYTNDVGAAAYITKLRVSLLRDTGAALSPFNAFL
FT                   LILGLETLSLRLEQHVKNAKQVANFLNDHPKVAWVNYPGLKDNKYHELAQKYLPKGPGS
FT                   IFTFGVKGGYEAGKKVIESVELFSHLANVGDAKSLIIHPASTTHQQLSEEQQLTAGVKP
FT                   ESIRLSIGIENADDIIQDLTKALEQI"
FT   gene            637302..637829
FT                   /locus_tag="FORC68_0619"
FT   CDS_pept        637302..637829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:L8DQI4"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:L8DQI4"
FT                   /protein_id="QBZ17847.1"
FT                   /translation="MKTFTRILVLLAGIAMIILGVWFLFHPGISLLTSTLMFGFLLLIS
FT                   GIFHTISYFSDRKSQNVSGWVLADGILSILLGFLLLFNEFDGTLTLVLLFGMWVLFAGI
FT                   MRTIGAFTAKQNNVQGWGWILTIGIIGIIVGFIALFNPVVSAIGIVLVVAIFFIVQGIG
FT                   AIATFFFIGKNS"
FT   gene            complement(637931..638632)
FT                   /locus_tag="FORC68_0620"
FT   CDS_pept        complement(637931..638632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0620"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="GOA:A0A3T1NPA0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPA0"
FT                   /protein_id="QBZ17848.1"
FT                   /translation="MSLLNEENSFYNVDLLNLLKDSSEAVLPYKRIRFRRNQQILAEGA
FT                   ETDYFYIIEDGVVSMSKNTCKEDSIINFLGKQECIGPLTLLGGAKSPVNYTTISEVSVY
FT                   QFERKYVLNKFLSSPDVFWQMNALMQSMVTPMLEREGYVNLPSSEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEDGIIALSPKPWRVKNFEIHK
FT                   QKLKENYKPYI"
FT   gene            complement(638708..639256)
FT                   /locus_tag="FORC68_0621"
FT   CDS_pept        complement(638708..639256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0621"
FT                   /product="Substrate-specific component BioY of biotin ECF
FT                   transporter"
FT                   /db_xref="GOA:A0A1C7PWZ8"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWZ8"
FT                   /protein_id="QBZ17849.1"
FT                   /translation="MRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGIIFGPTGGFIIGFIFNAFLTGWLLE
FT                   KTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWPTAFLTGMVPFIIPGIIKAVFAA
FT                   LLGIIIRDRLIKAKLLRAS"
FT   gene            639450..639782
FT                   /locus_tag="FORC68_0622"
FT   CDS_pept        639450..639782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0622"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INR9"
FT                   /protein_id="QBZ17850.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLNELISEWNNFTDSVAKLLTE
FT                   GEAVNE"
FT   gene            639775..640365
FT                   /locus_tag="FORC68_0623"
FT   CDS_pept        639775..640365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A393JNW9"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393JNW9"
FT                   /protein_id="QBZ17851.1"
FT                   /translation="MNKQDFLNELNQRLELLDPKERRELLSDYQEHFRNGIEAGKSEEQ
FT                   IVFDLGKPEEIAADIISERGIREEPTEMDYYYVPRKNQNENRSVSKQILIGVGLFFLDV
FT                   CLIIPIMVSLWSLVISLWVTVGAFLLSPVILGVGILFGADFEFYQMFVSIGLVGLGLML
FT                   LFVANALTQLTSKVTMAIIQWHKYAVKGGGKNA"
FT   gene            640358..641458
FT                   /locus_tag="FORC68_0624"
FT   CDS_pept        640358..641458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6G3"
FT                   /protein_id="QBZ17852.1"
FT                   /translation="MRKHHLSKKLFFAGLVLFIIGAIGVAFTMNTGKMIEKGEPLTKQW
FT                   DLSTENIKKIAFSSERDASIEWKESTTGKNYIELKGNYSANDKKAIQQLEPVSEDGTSF
FT                   DITVPEEDDWYNGFGKIYAYGKQKVTIYLTKDTKLADLEVKSHSGDIDVADFKVKKFVS
FT                   STNSGELKVTNLEANTAQMATSSGDLTLSNIKANSSIETDSGKTELTNLTGDLEVNGGS
FT                   GDVNVAGVKAKKLKIAIDSGDIELTSGTVTDLAVLTTSSGDIDANTKGKIQAESDSGSI
FT                   ELAGATNNVTAKTSSGDIDVAFTKQVKNIEINSDAGEVELELPGDFKAIYEASSNSGSV
FT                   KAPTSDSNTDNRVTVKTSSGDIKIEK"
FT   gene            641564..642064
FT                   /locus_tag="FORC68_0625"
FT   CDS_pept        641564..642064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0625"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A1D2IXV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXV7"
FT                   /protein_id="QBZ17853.1"
FT                   /translation="MDFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERFY
FT                   NVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLE
FT                   VGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHAF
FT                   EEE"
FT   gene            complement(642112..642498)
FT                   /locus_tag="FORC68_0626"
FT   CDS_pept        complement(642112..642498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NPE8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPE8"
FT                   /protein_id="QBZ17854.1"
FT                   /translation="MRFIIAYLSIFVLGIFSALLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVAAVIILSIIQVSGMLISVGVSILVGVI
FT                   MALLAIIFFFLRGGKSTSGKAATK"
FT   gene            complement(642551..642895)
FT                   /locus_tag="FORC68_0627"
FT   CDS_pept        complement(642551..642895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A2Z5C5F0"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C5F0"
FT                   /protein_id="QBZ17855.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVRWALLT
FT                   QTTFVAGVVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRGITRIV
FT                   KHSDDNWARC"
FT   gene            complement(643044..644384)
FT                   /locus_tag="FORC68_0628"
FT   CDS_pept        complement(643044..644384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0628"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="GOA:A0A3T1NPL9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPL9"
FT                   /protein_id="QBZ17856.1"
FT                   /translation="MSSVHKVASISLFTLAWPIFLEQFLRLMISYIDVFMLGHYSDDAV
FT                   AATGVANQILVISIIIYGFISVGVQIIVAQMIGAKKHKEIENVITNGLVVAFLIGIVMS
FT                   IIFIFMSKNFLTWMGINPHLVQVGAPFLEIIGGSSVVIAIHASILPILRAHGYVRQSIL
FT                   VPVTISIINVVGNYLFLYGPLAYLDYGVAGVGISTAVANFVGMGLAIWMLRKYIGYTFH
FT                   FKKLEQVSKKLLYSILRLGLPSAGENLSYAGSQLVVTAIIAILGTEALTTKVYASTVSQ
FT                   FVALFAIALGQASQIIIGRAVGAKEIDKAYKQGLRSWKIGLVVAIVVSVSIYLFAEPIM
FT                   SLFTTNTEIIAMTKELFLLSIFLELGRATNIIIISSLNSTGDVRFPFICGLIVMWIVSL
FT                   PFSYVLGISAGLGLVGVWLAYIIDEGVRAVLMYRRWRSKVWSLKSVI"
FT   gene            644550..645011
FT                   /locus_tag="FORC68_0629"
FT   CDS_pept        644550..645011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0629"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="GOA:A0A1D2INV1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INV1"
FT                   /protein_id="QBZ17857.1"
FT                   /translation="MSSKNQDLGHSVIKAFMNFKHAEIKSFQIPGYSKSETRFIFILSR
FT                   GLKSRGPKIRVSDLGHMLRISKPSVTQMIQSLEGKGLIKRVQNPEDKRSMYVELTEVGA
FT                   GVSEKMLDEFQASFEDMQEFLGEDDMKKLITLLEKLTDYLNTKSENKEA"
FT   gene            645019..646743
FT                   /locus_tag="FORC68_0630"
FT   CDS_pept        645019..646743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0630"
FT                   /product="Lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="GOA:A0A3T2I0M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I0M2"
FT                   /protein_id="QBZ17858.1"
FT                   /translation="MMKLMKRLKPYWLSITAVLVLTFGQVIGQLYLPTLMSNIIDKGVV
FT                   TGDTDYIWSTGMKMLLISFASVILSVIVVYLASRISMGFGKELRDKIFTKVEDFSLQEF
FT                   DKVGTSSLITRTTNDVVQIQNVLYMMMRLMVMAPIMLLGGIIMAVGRDAKLSLIFVVVL
FT                   PLLLLLVVILGGKAMPMFKSLQKKMDKLNRVIREGLTGIRVVRSFNRNEDELEKFEEAN
FT                   ADYATTAIKVNRLLSLMSPLMMLLMNLTSIAIVWIGSIFIGNGDMQVGDLMAFIQYAMQ
FT                   IMMSFMMLSAVFIMIPRAGASAERINEVLDMNAEILNPENPKTSTPPAKLSFEHVTFRY
FT                   EGAEKPVIEDITFEANAGETIAIIGSTGAGKSTLINMIPRFYDVESGVVKINGIDVREM
FT                   DQSSLRQKIGLVPQKAVLFTGTIASNMRYGKEDATDEEIWEALRTAQAENFVSKLANGL
FT                   GSRVEQGGNNFSGGQKQRLSIARSLIRKPEIYIFDDSFSALDFKTDAKLREALKAETTE
FT                   AVTLIVAQRITSVVNSDQIIVMNEGKIAGMGTHEELKESNQIYQEIMRSQLSEEEIA"
FT   gene            646740..648557
FT                   /locus_tag="FORC68_0631"
FT   CDS_pept        646740..648557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0631"
FT                   /product="Lipid A export ATP-binding/permease protein MsbA"
FT                   /db_xref="GOA:A0A1D2INN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INN5"
FT                   /protein_id="QBZ17859.1"
FT                   /translation="MSGPGPGGGMRMQTAAKPKNFKQTLFRLLGYMKPRSVAIIVVFIF
FT                   AILSTIFNIFSPKELGKATTEIFKGVMSQDGINNDKIFNILMIVLVLYLGSSLFSFIQQ
FT                   YVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQ
FT                   AITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILN
FT                   DTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGY
FT                   VGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMM
FT                   DEEEEKDEIPANVNQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTG
FT                   AGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIA
FT                   YGREGATKDEVIGAAKAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSD
FT                   PSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVI
FT                   EQGTHQELLDAKGFYADLYNSQFTGAQAV"
FT   gene            648672..648971
FT                   /locus_tag="FORC68_0632"
FT   CDS_pept        648672..648971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0632"
FT                   /product="Rhodanese-like domain protein"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX10"
FT                   /protein_id="QBZ17860.1"
FT                   /translation="MYQSITANDLEQDLKKVPHNILDVRDADAFVEGHIPDAINIPINE
FT                   LPEKLATLDKEKAYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAFHGTVTN"
FT   gene            complement(649016..650785)
FT                   /locus_tag="FORC68_0633"
FT   CDS_pept        complement(649016..650785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0633"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A3T1NP82"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NP82"
FT                   /protein_id="QBZ17861.1"
FT                   /translation="MKKMGVKIGLCILLIMPFTISFSANVSAEENISIKAAQDVVNIPD
FT                   PVLKSYLNGLLGQPSTSDITEAQMDTITDVTISNASLTDLTGLDYAHNLTILHLTNTGV
FT                   TDYSLVANIPSLTNLNISGSNLTTNSIPDLNGLTNVTNLNLSSGKLDNSALTKFNKLPN
FT                   LTFLNLDNNPSITDFMPLKSLPNLASLFIQFCGVNDFRGIDSFPKLTNLAAFGQNVGSA
FT                   ILINSTIKSSALNYNEANQTIFVPFTLMTERSMNFDGYLFPFTTNTASSSTYFTLNGVQ
FT                   ISGSRLSIDDTGVTVSGITKDFFDSITKMEYNAFYDNPAGSYNSPPNFNSYSVSSGTYD
FT                   HYFDIDHSLTITNDSAISYGEQTTVTEEQFLKDVHAETDDGTPVTSDFNTIVDFSKPGV
FT                   YTVTLNAENAAGLKATPTQVTVTILAKPVITADKSISYTKDTTKTEQQFLQDIAAKTSD
FT                   GSKVTSDFDSVVDLAKVGTYKVTLNAVSADGLNADPVIILVNVVAGNEPPTPPGPGPDP
FT                   TPDPTPNPNNPNINPNPDNGQSANSEIASNPSNSEVNIALPNTGDASQATTVLIGIILA
FT                   GGAILFFRKRKHS"
FT   gene            complement(650946..651572)
FT                   /locus_tag="FORC68_0634"
FT   CDS_pept        complement(650946..651572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0634"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /db_xref="GOA:A0A418S0U5"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S0U5"
FT                   /protein_id="QBZ17862.1"
FT                   /translation="MTNVLFIKANGLPAERSVSVALYEIFLTEYKKSHPDDNVTELDLF
FT                   EADLPYYDVTMMSGLHKEAAGETLSPEEKRLADIANSYLDQFLAADKIVMAFPLWNFSI
FT                   PAQFLTYLFYLNQAGKTFKYTANGPVGLVADKKIALLNARGGIYSDGPMQSFEMSLNYV
FT                   KNVLAHFGISEPEMVIVEGHNAKPDQAKDIISAGAKEAVELAKIF"
FT   gene            651753..652196
FT                   /locus_tag="FORC68_0635"
FT   CDS_pept        651753..652196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0635"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="GOA:A0A4V1C371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C371"
FT                   /protein_id="QBZ17863.1"
FT                   /translation="MLKPCTERSELLYRMHLLSKEISHVFEQQTNMSFTKVEILFHIQQ
FT                   TPGQSQNRLREKLYIDSASITRHLKRMEEQGLIVRKKQDENKRYTYLFLTSAGEAELAT
FT                   LLLEKEKFQNGALEAFSEEEVSALLKSVTKMMNNVEKMEEKLK"
FT   gene            652193..653134
FT                   /locus_tag="FORC68_0636"
FT   CDS_pept        652193..653134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0636"
FT                   /product="Bifunctional protein, zinc-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MMB7"
FT                   /protein_id="QBZ17864.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEDRAKEKNVTATGIWLQPNGEQLKELGKLLANKTIKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
FT   gene            653230..653763
FT                   /locus_tag="FORC68_0637"
FT   CDS_pept        653230..653763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0637"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A3T1NPK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPK5"
FT                   /protein_id="QBZ17865.1"
FT                   /translation="METRELKNGQIMMIREATKEDSSNIITYLNEVAGETNYLSFGQGE
FT                   FAFSIAEEAEYIEESDKNPGSVMLLCFIDDELASISQLIGHIKKRELHTSELAISIRKK
FT                   YWGLGIGTICMEELIKYAKSSEYLKLIYLEVVTENKRAINLYKKFGFIEAGEIPALMQV
FT                   DRRYLDVTMMYLVI"
FT   gene            complement(653760..654002)
FT                   /locus_tag="FORC68_0638"
FT   CDS_pept        complement(653760..654002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INW3"
FT                   /protein_id="QBZ17866.1"
FT                   /translation="MHPIEQLLANNNTTATDIESNTRLKEGSLQKIIDKDIRTSDISLR
FT                   VLSQIAIFLNTGADIIAKQLSDIEVANDLAFLIED"
FT   gene            654109..655860
FT                   /locus_tag="FORC68_0639"
FT   CDS_pept        654109..655860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0639"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="GOA:A0A3T2PFS4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2PFS4"
FT                   /protein_id="QBZ17867.1"
FT                   /translation="MNDLKDSFKVLYQFKTDYLKVTLLLTILQAFVIGPFIYYFFFFIL
FT                   RVIGVPGITDANLGEVFSSPVAIIMLLILALLILLFVYYELGFFIMMAIYQLRGESYTF
FT                   FKIIQRLNVKAKYFLSYQAIYFLLYFFLLLPIAGLSLPITITENLYLPHFITDELMKTT
FT                   TGTWLYVIAIAIIFYISARLVFALPYFIEDKSLKISGAIRKSWKYPQKHLFFMLLKWVL
FT                   IIVAIGFLVSIIATIIMLPLLLVEKITPGIAVVIAGITLTILQVIGFFAAGIFQGIIAQ
FT                   LLVKNAFAIKEQPALVTRSQFPHKKRFIIVAIIIFIIFSSFNIYTVNATLYEPNTKIIA
FT                   HRGDTMNAVENTVEAIESAAEAGADYSEIDIQETKDHQFVVFHDMTLRRLAGSSKRVAD
FT                   MTLKELQQTKVRSGDYSSHIASFDEIIKIAKKNKIDLLVEVKLHGGESSDMVERLVTLL
FT                   KKEKVTDKYLVQSLDQPVIEKIEQADPTLETGIILALNIGNLPKTSADFIVLEDFSINK
FT                   RLLTQAKQNNKMVFVWTVNKEKLMQMYLRKNIDGIITNYPKKAIELRESFNENDSLRSR
FT                   IENRLGF"
FT   gene            complement(655901..656395)
FT                   /locus_tag="FORC68_0640"
FT   CDS_pept        complement(655901..656395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR031989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I0L4"
FT                   /protein_id="QBZ17868.1"
FT                   /translation="MKKLKSILLLMGIITFALALTACGGTEDKASTEKTETAKAETKKK
FT                   SNPNELGDYKVEILSSEVVKDFEGNNAIAIKTKFTNNSKENISFMVAIDQQAFQNGTQL
FT                   ETTVSADASMGGSEKDVQPGGTLEVTELYKLQDTQNTVDIEATELISFSKNSVKKSFEL
FT                   K"
FT   gene            complement(656475..657617)
FT                   /locus_tag="FORC68_0641"
FT   CDS_pept        complement(656475..657617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0641"
FT                   /product="serine/threonine-protein kinase pknB"
FT                   /db_xref="GOA:A0A3T2CMY5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2CMY5"
FT                   /protein_id="QBZ17869.1"
FT                   /translation="MGEMTLAFIEEQYKELDNLNNKENPAVLTRNTSTGELFVRKIIPS
FT                   SFAPVIEQLKNLSSKYLPKIEVMIPKGNQLIVYEEYINGKNLADLMKTNAPFDTDEVTR
FT                   LMLMLSDALTELHANAIIHRDIKPSNIMISSDGVLKLIDFDASRMFEVGKNQDTVNLGT
FT                   IGYAAPEQYGYSQTDARSDIYSIGVLMLELLLGKNTLPDKEHATSLEKIAMQAAAFDPE
FT                   QRYQSIQDFRTAVKNDSLGPSYVSELSDFTELDDFPTESAWKTPADEYENDFIPWYKHI
FT                   PGFRTGTPWKMIVAVFGYMFLIFGLFSPPTEGVKMSHTVNFFSNFFLIVPAFVIFTNLC
FT                   GIWSKLPLLKSPSPGTRKAGIVIYVIVCVSIYGIYNEIFS"
FT   gene            657724..658179
FT                   /locus_tag="FORC68_0642"
FT   CDS_pept        657724..658179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A6A606"
FT                   /protein_id="QBZ17870.1"
FT                   /translation="MDGEKETSKLLHELKKATNLRQVLDENEAEFKSSEMVTYLKELLA
FT                   EKKLTKASVIRAARLHETYGYQIFSGVRRPSRDRTIALSFGFKLSGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYTLDQTNDSLYDLEEALIETYKEEKPLI"
FT   gene            658235..658627
FT                   /locus_tag="FORC68_0643"
FT   CDS_pept        658235..658627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A458QSY4"
FT                   /protein_id="QBZ17871.1"
FT                   /translation="MLNEQTILQAATSEKNAGDFPKVVQGFKDLGVTKYQFLVQKGVYV
FT                   FWDETDTRVESKLNGVSMPVAEEISSEKMKDAIKQAQAGKIDFEMFIKLAGLAGVGLWE
FT                   ADLTAMKVTYIDNAGNDLVVEPIPSV"
FT   gene            658724..659464
FT                   /locus_tag="FORC68_0644"
FT   CDS_pept        658724..659464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0644"
FT                   /product="anion permease"
FT                   /db_xref="GOA:A0A1D2IY53"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IY53"
FT                   /protein_id="QBZ17872.1"
FT                   /translation="MDIITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFIGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRNNEKPHFLSKYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
FT   gene            659550..659828
FT                   /locus_tag="FORC68_0645"
FT   CDS_pept        659550..659828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A473MQ48"
FT                   /db_xref="UniProtKB/TrEMBL:A0A473MQ48"
FT                   /protein_id="QBZ17873.1"
FT                   /translation="MKRSWPDFAAFLLTILTVTWIILTWGLHISDIVPGGEKGIWYKLI
FT                   PLFLGLISTISVFFVKEKLVKWILLGFNILLLILIYFVYHIGEIGMF"
FT   gene            659844..660110
FT                   /locus_tag="FORC68_0646"
FT   CDS_pept        659844..660110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR021464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWT7"
FT                   /protein_id="QBZ17874.1"
FT                   /translation="MDEPTKAVIYQILSKTEEQNATMDHLVFEMMQFPGAAAFTKNELL
FT                   FGIYWLETYHYIFRMSENQTTRYYRTEKGHEKLAELELLKNKS"
FT   gene            complement(660148..660591)
FT                   /locus_tag="FORC68_0647"
FT   CDS_pept        complement(660148..660591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0647"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A1D2IYM3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYM3"
FT                   /protein_id="QBZ17875.1"
FT                   /translation="MTAFDLEDFLTTAITDYAKEKVEAGTWDEEESLAKSQDSFNKLLY
FT                   DGITTPNEYLYSIISGEKIGYIWFHVDETRSGKHAFIYDFVIFEAFRGKGFGTKTLAAL
FT                   DVLAKEMQITKIGLHVFAHNQTAIGLYNKVGFQNTDITMAKYL"
FT   gene            complement(660622..661323)
FT                   /locus_tag="FORC68_0648"
FT   CDS_pept        complement(660622..661323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PX43"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX43"
FT                   /protein_id="QBZ17876.1"
FT                   /translation="MKKTIQSVGVWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGL
FT                   TFQNHSTMGRTITKGHEILTKDLAKDATNDIAIIEFGGNDCDFNWAEVAENPAAEHIPR
FT                   TPINIFETQLLEMIARLKKLDIKPILMTLPPLHAKRYFDFITRDGLNKDNILQFLGGDV
FT                   EMIYRWQERYSNTISRIAAETSSQIIDVRDSFLAEFHYENLLCADGIHPNEAGHIAMSR
FT                   RFIQYASFHKA"
FT   gene            complement(661409..663088)
FT                   /locus_tag="FORC68_0649"
FT   CDS_pept        complement(661409..663088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A477ACN3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A477ACN3"
FT                   /protein_id="QBZ17877.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRV
FT                   FAFLGLFLWARDYLIKDKKYLVPIYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVVILTLLPFYSSLILGFCFFLVMVGCIWLYDVFKKKQVNIRFLLSMLYMGLI
FT                   YVIVNYRFIYAMFLHPEPDSRSEFSLPNLSFLSSIRLSFKNFIFGHTHDQALAGYVILP
FT                   ILLLVLVLIIIKREWVKEKLFLWLFGFNLFLSFWYGFWWYRGWNVIKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLAYVAIVLQLIVVFANNSEIYYRTGNGSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYIFSAELGKNYDFGKDSKKHIKQLDFNTEAFKK
FT                   VGGEYVLSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATN"
FT   gene            663394..668166
FT                   /locus_tag="FORC68_0650"
FT   CDS_pept        663394..668166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0650"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A4P7MQP0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQP0"
FT                   /protein_id="QBZ17878.1"
FT                   /translation="MLKHNWQKVFVVMVAVALIFQLVPWSNIFAGAEENQTKTTQQIAQ
FT                   PDDQKVADENKTTVTPDNKETTKNLVNGKQLLKDSVDWNFTNKVTDANGNTKETYAPGD
FT                   SLKFSVSLAIPSYSEAVLDETYTFWIQKDFFQGDKVTFVNPAIDGLTPRQNVFTDDSMK
FT                   NSIGTKTINGVEYIGYTLKFNQSPEALAKYEDKPLTNAKFDMFATISTTITTKEDYKAI
FT                   VIEDDKDVDISNIEVPVTPPTPDTDNGVLTASKVIDSAWRLDKDTGKYVKVATSSTNYT
FT                   PEKDDLVFYYVYATNNSAENAVLEKMIDELPAGFSIITEGSPEWQALSTASGSSLQRGW
FT                   VASADQTNLAPGATRYELPFSPAQTISKNGGGIYRTIAAKVTDPTKDLTNVTKSPTKGG
FT                   EGKSGSITPSGKDVYDMAITTKISSTYDKNNKYIGAVSSTTTPVSISEGSTVGVTYTAI
FT                   NQGNYTKDVVVYAYVPAGYELNNDTSDFKTANDKWKYETTVPSGGGVWSDIKVYSITLS
FT                   GGMASGATKTATMYMKAMGIPEDGTYSAVDFYMAGEIGSFSNFNGESTLDGAITDVDST
FT                   PDMNPGNDLISNVDGSTIKPIDGFQKEKPHVVKENAKSTATLQDEDDFDFDYVTFIKTP
FT                   EVIPSEGKVFEKTRLSAADAEKTARNMIGNDIMGSALKDYTPLADDGRITSPKTYMVYE
FT                   MNINPSGVEDTLNSSFTDTLPKGLKMLEYDIAGLNSSNKHIYGFTTNKFEGTPKFTNAD
FT                   GQDVIVYQKGLYSEKQVCIANPTLNDVGVRYFGNNADKMGVTGSVTKDARTLTLNFGQP
FT                   AADPMYSETKAAYKVYMIVVIDPDEIDYSSIMQNKATYTYNDKVITSYENSEMYWDAGG
FT                   GTAYAKKYVLDNKTNAYLSGSQYNVATPDADGNLSVGYKIRVRSAYEFDKSSINIGDVI
FT                   AADNFKSISNVEVNGYEASPNTGFQIDGELENPVPLTADKYAVEAKATANTLDITNPVD
FT                   IPQMQLYNVLFKVNYQKVKYGAKLVNQAAGSEVATVVPLNLNLLKQDDISKTALTGYEF
FT                   KAYYADENGKADLTKPVKDTNSNEIVMTDSSGAANFIPNGYKTTSKNQEWKVVLVETKT
FT                   PTGYESNENKEYPVTVKSDANGNLSIPTSTETGLEITNDDHGAATATIDNHADVKMIDV
FT                   NGAKTWTGDTAADRPDSIEVQLLQDGVAYGSPITVTKADDWKYEFKNVPETNADGNKYT
FT                   YTVLENTVTNYTSAVTGLDINNTLIKPDIKMINLDGQKTWKNDTENDRPASIEIQLQQN
FT                   GQDYGFPVTVTKANNWKYEFKNLPETTNDGAAYNYTIVEKAVPGYETKVDGMDVINTKI
FT                   DAPKTAVSGEKTWKNDTAKDRPDFIEVQLLQNGQTYGDPVKVTKENDWKYSFKDLPKAD
FT                   ANNQDYRYSVAEIAVPGYKTTTDGMNLTNTKVTDEKNVTSASGTKTWVGDNEKTRPDSI
FT                   EVQLLQNGKAYGTPIKVTAKSNWKYSFTNLPEKDKTGEKYSYTVSEKQVSGYSVKVKGM
FT                   DLTNTKVTKTTPKDTPKDTPKDTPKDTHSTNKPSKTKKLPGTGDTNGMLLFAGGLALLF
FT                   LGLHLRRKSAK"
FT   gene            668259..668537
FT                   /locus_tag="FORC68_0651"
FT   CDS_pept        668259..668537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MJ70"
FT                   /protein_id="QBZ17879.1"
FT                   /translation="MMKEELLQAIEVGEPVLLVTAIGYIVGIVEAKGELIRLNDVYINC
FT                   VSASRVNRFSRGLAVNINQVIGMQLLSKSEKDEMIGGWKAYVAPTAG"
FT   gene            668599..669126
FT                   /locus_tag="FORC68_0652"
FT   CDS_pept        668599..669126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0652"
FT                   /product="Isochorismatase"
FT                   /db_xref="GOA:A0A462MFX4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A462MFX4"
FT                   /protein_id="QBZ17880.1"
FT                   /translation="MILLVIDTQKLIMTNNLYNFDSLVPNIEQLIATARKNKIEIVYIR
FT                   HDDGPNTELTEGKEGFDIYQKFQPTTHERIFDKTVNSAFKGTGLLEYLKEKGMKKIVVA
FT                   GLQTDFCIDATVKCGFEHGFHMIVPAHANSTEDNHFMSGENSYKYYNEWMWPGRYATCI
FT                   SMEETIKEMEHN"
FT   gene            669485..671515
FT                   /locus_tag="FORC68_0653"
FT   CDS_pept        669485..671515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0653"
FT                   /product="PTS system IIA 2 domain protein"
FT                   /db_xref="GOA:A0A3A2W3N1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2W3N1"
FT                   /protein_id="QBZ17881.1"
FT                   /translation="MLSGRMVLIIKYLEGKSESSIRGISKKLEISERKVRYDIDNINDA
FT                   LTLNQLKPILKEGKGRLVIPADLAKLALEEKETYIFAPQERINILQYLLFFNVKKVNLE
FT                   HLSKWMNVSRTTIKKDLLLIEEQLQKLNLQLVYKQGYRLIGNENALLNERVRILRDYID
FT                   FIPSEDIETNFYRKCMLGEMKVSLKNIDINGVNKWSKQLLKQMGWILNDESYYWYLANI
FT                   LVFCWYIKNDVTNPLKDAKLVLPIFNSQLIQGMEVILDYELSQEQLNILVGFVFFTNKY
FT                   ASLNEEMDLITTETIVNSLITSMSEELNLPFLEDAILYKGLLNHVAPLIERVRGNVQIY
FT                   EDTFDVIPTEFLYILQATSKVVKTIPLLESVENESEISLLAIHFLASIQRNQREEKLHV
FT                   LLVCGLGYGAIAMMKDTLNSEYQIAFVATIPEYMLKDFTAWEDVDLVITTAKVTTPLPK
FT                   STVKVSPVLKECDLVELEKQGLKKKNILTSYFAINKRLSFLDSTVKQQVISVIKEELGY
FT                   GHVSIPNRKLGLSDLIGIDAIQITSESLTWQTAIQRATKLLSDNHFVLPAYAENIKQIQ
FT                   EELGFYSVKDEEFALFHGNDSQLVQMNSMALLINEQPVMFGEKQAKVIFILASKDKKEQ
FT                   IPAIITLTKMTYQTDFISKLEQAKNPIDADRIIKKYEEEVR"
FT   gene            671517..671969
FT                   /locus_tag="FORC68_0654"
FT   CDS_pept        671517..671969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0654"
FT                   /product="PTS system, fructose-specific IIA component"
FT                   /db_xref="GOA:A0A3H0QZB8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QZB8"
FT                   /protein_id="QBZ17882.1"
FT                   /translation="MGVKIDFLSISNINVNTKEDAILQLVNVLEKADYLADKSLFEQDI
FT                   LERERTLSTYIGHEIGLPHAQSSGVKEPCVVVGKLSKPVKWTEEEEFVQIVFLIAVPRD
FT                   NQNNLHLKVLSNLARLLMHEDFRTKLSKLDDIATVALLNKSVKEDN"
FT   gene            671970..673031
FT                   /locus_tag="FORC68_0655"
FT   CDS_pept        671970..673031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0655"
FT                   /product="PTS system, fructose-specific IIC component"
FT                   /db_xref="GOA:L8DR22"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:L8DR22"
FT                   /protein_id="QBZ17883.1"
FT                   /translation="MRTLKFLQKHLMTATSYMIPFVVAGGILFALSVMLSGQAAVPDAG
FT                   WLAKLNQIGAAGLALFIPILGGYIAFSMADKPGLAPGMIGAYLANEIGAGFIGGIIAGF
FT                   LAGFVVIQLKKIKLAPSMRTLGSIFIYPLLGTLITGGIIVFLIGEPISGFMDWMTNALN
FT                   SLSGAAKVPLGALLGAMISFDMGGPVNKVAATFAQTQVDTLPYLMGGVGVAICVPPIGL
FT                   GVATLLFPKKFTRVEKDSGIAALLMGSVGITEGAIPFATADPLRVIPSIMVGSIVGNVS
FT                   AFLFGCLNHAPWGGLIVLPVVDNRIGYIASIALGAVVTAIMLRILKKDATELDEALEEG
FT                   QDIDDLDINFEDI"
FT   gene            673046..673354
FT                   /locus_tag="FORC68_0656"
FT   CDS_pept        673046..673354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0656"
FT                   /product="PTS system, fructose-specific IIB component"
FT                   /db_xref="GOA:A0A0E0ZZ95"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E0ZZ95"
FT                   /protein_id="QBZ17884.1"
FT                   /translation="MKIVAVTSCPSGVAHTYMSAESLELSAKKMGVTIKVETQGSSGIE
FT                   NKLTAKEIEEADCVIITNDVEIRESQRFKGKKVVKMSVSEIIKKSDALIKKLQTMFE"
FT   gene            673381..674649
FT                   /locus_tag="FORC68_0657"
FT   CDS_pept        673381..674649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3A7Z3R3"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7Z3R3"
FT                   /protein_id="QBZ17885.1"
FT                   /translation="MKLPIKKAVEALLKLQTTGDSATLIGVGPMSRNLLQASFELAKED
FT                   DYPLMFIASRNQVDADELGGGYVNGWNQFSFIDAIKEVAKEVDFDGLYYVCRDHGGPWQ
FT                   RDQERNDHLPTEKAMELGKKSYIADIEAGFDLLMIDPTKDPFEVGKVIPLETVLERTVD
FT                   LIAFCEEERKKRGLPEVGYEVGTEETNGGLTSTETYEKFITQLKVELEKRDLPLPTFIV
FT                   GQTGTLTRKTEQVGHFNFKNAYDLAQMAKKYGVGLKEHNGDYLDDVTLLEHIPSEITAT
FT                   NVAPQYGTEETRAYLKLVELEQKLVENGLIKTPSNAREVLLIQSIKSERWRKWMLDGQK
FT                   DITINEIMQDDDLSLEILDIAGHYTFNDAMVKKEINTLYANLAANNIDGKRFVIDHIKR
FT                   PIRNYSECYNLKGATTRIKQLAK"
FT   gene            674739..675443
FT                   /locus_tag="FORC68_0658"
FT   CDS_pept        674739..675443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0658"
FT                   /product="Putative FMN hydrolase,
FT                   5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase"
FT                   /db_xref="GOA:A0A3T2H6H0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6H0"
FT                   /protein_id="QBZ17886.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKIVFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVRGEMPKAEMHVYRITQALSDFDYQITKKEAETFQHAYEQNQRKIELSPGI
FT                   KEILAWAKKNEITMGIITNGPKEHQQHKINDLQINDWIPAEHTFISGKVGIEKPDKKIF
FT                   KLVEEQIGINSAETYYIGDSFENDVIGSKSAGWKSIWLNRRGHLRPTEAAFQPDYCVEN
FT                   EQQLFAILQEIF"
FT   gene            675548..675964
FT                   /locus_tag="FORC68_0659"
FT   CDS_pept        675548..675964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0659"
FT                   /product="Rrf2 family transcriptional regulator"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:S5JU92"
FT                   /protein_id="QBZ17887.1"
FT                   /translation="MKFSKATNYALHTMVYLANLSPEKSVGVKELATKQNVSPTYLSKV
FT                   LTMLVKAGFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
FT   gene            675977..676570
FT                   /locus_tag="FORC68_0660"
FT   CDS_pept        675977..676570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0660"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /db_xref="GOA:A0A3T1NPE1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPE1"
FT                   /protein_id="QBZ17888.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERSEVLSPEDFLQAMPIGKTAS
FT                   ILDLGAGTGFLTIPAAKLVENTVFALDLDAKMLELIELKAKEACLPNVETLEASMDDIP
FT                   LEASSVDVVLASLVLHEADSLADVLREVSRVVKTGGYFASLEFDTKGTDLKGPPMEIQI
FT                   SAEKLKEELAGFGFEVVKNWQLDEGMYVSIAVKK"
FT   gene            complement(676638..676729)
FT                   /locus_tag="FORC68_t011"
FT   tRNA            complement(676638..676729)
FT                   /locus_tag="FORC68_t011"
FT                   /product="tRNA-Ser"
FT   gene            677813..678718
FT                   /locus_tag="FORC68_0661"
FT   CDS_pept        677813..678718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0661"
FT                   /product="Glutamyl endopeptidase precursor, blaSE"
FT                   /db_xref="GOA:A0A4P7MJ77"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MJ77"
FT                   /protein_id="QBZ17889.1"
FT                   /translation="MKKIAAIFIFSLAVLLMPLSGKATVEKSLDLSGTTCVTNEEQLEI
FT                   QDFVDSSKEAREKFVEEYNEAHPEDQVENTEPIINPIEKQASRLLKKVVGADNRVKANV
FT                   NNSPYKQIGYMEMSFKKGNKMVWYVGTGTIIGSNKVLTAGHNLYDKSTRSWANGVIFQP
FT                   KMNNWVSPTYVTSSKLHVPVNWSSKGDSNYDIGVVTLSKSVSSYGSLKYRVPTANTTLF
FT                   STISGYPGQSPKAGSQWYGNGNALITNQKISYSIDTTGGQSGSPIINNGSIIGVHTLGS
FT                   SANSGVRITPALKSFIDGAK"
FT   gene            678718..679077
FT                   /locus_tag="FORC68_0662"
FT   CDS_pept        678718..679077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A392ZVV7"
FT                   /protein_id="QBZ17890.1"
FT                   /translation="MKKIISLILLLLILTACSNDPQKESSVEANGIVESVDGYSIVVNS
FT                   FKENSKKVTADKGEKIYFDIEDKYYNEEGKKIKLSEIKRNDKVLIELSDDYKIQETYPG
FT                   KIDSMDVIKIIKLNS"
FT   gene            679175..679297
FT                   /locus_tag="FORC68_0663"
FT   CDS_pept        679175..679297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MES3"
FT                   /protein_id="QBZ17891.1"
FT                   /translation="MIQGIFVRFLVIGEKIYDLLDAFKSNWAIEILCLKNDYHM"
FT   gene            679609..680142
FT                   /locus_tag="FORC68_0664"
FT   CDS_pept        679609..680142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0664"
FT                   /product="transcriptional regulator"
FT                   /db_xref="GOA:A0A3T2I0H7"
FT                   /db_xref="InterPro:IPR021683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I0H7"
FT                   /protein_id="QBZ17892.1"
FT                   /translation="MERKLIQEINLLENKKLVMNLNIVAIAIVLILTVLGIVFSGGFAI
FT                   TNGFMGIIWMFGGYAVAIVIHEAVHGIFFKAFRPEAKVKFGFKNGMAYAGSPGAFYTRA
FT                   QFFIISIAPFIVLTGLFIFLRFLGVNEAVLYLIFALHTSGCVGDFYYCILLINQPAGIV
FT                   VEDTDKGISFYSEG"
FT   gene            680206..681123
FT                   /locus_tag="FORC68_0665"
FT   CDS_pept        680206..681123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0665"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="GOA:A0A3A6XVX4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A6XVX4"
FT                   /protein_id="QBZ17893.1"
FT                   /translation="MKRITIGNSALTASEISLGCMRMADLSKEDANKVINTALENGIDF
FT                   FDHADIYGGGKSEEVFADAIDMNATIREKMILQSKCGIRQGFFDFSKEHIIASVEGSLK
FT                   RLKTDYLDTLLLHRPDTLFEPEEVAAAFTELEKSGKVRHFGVSNQNPGQIELLKKYVDQ
FT                   ELIANQLQFSIMHTGMIDTGFNVNMTIDPSLDRDGGILEYSRLNNMTIQAWSPFQYGFF
FT                   EGVFLDNDKFPELNKTIDKIAADKGVTNSAIAVAWIQRHPASFQTVVGTMNPGRIADIA
FT                   KASDVTLSREEWYEIYRAAGNQLP"
FT   gene            681389..683269
FT                   /locus_tag="FORC68_0666"
FT   CDS_pept        681389..683269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0666"
FT                   /product="Lead, cadmium, zinc and mercury transporting
FT                   ATPase"
FT                   /db_xref="GOA:A0A3T1NPS7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPS7"
FT                   /protein_id="QBZ17894.1"
FT                   /translation="MKDWMKQNWQFITTGISGILIVIGCLIGSDVGDFWTAIIFLSAFV
FT                   IGGFEQAKEGIQATIKTKKLNVELLMILAATGASIIGYWFEGAILIFIFSVSGALETYT
FT                   TNKSKREITKLMAFQPERAFRLLSNGDLEEVAAKELQLDDMVFVRPGESVPIDGVIVRG
FT                   STTLNEAAINGESVPATKTVGADVFGGTVNVSSAITVKVTQTFENTIFSKIIRLVETAQ
FT                   SEPSKTARFIERFEDVYVKAVLLFVLVMMFLPHFALGWSWNETFYRAMVLLTVASPCAL
FT                   VASVTPATLAAISNGARHGILFKGGVHLENLRGVKAIAFDKTGTLTNGTPALTDRLFAE
FT                   NVDKQLVINVVGAMERQSLHPLAAAITQDLEPEITEKLTEIEVTDVPGWGVQAIYREGN
FT                   WQVGKAGFVGKEAAAAFSNGAFERLASEGKTIVYVAKDGVIQAMFALKDTCRPEAIRTI
FT                   KALQAKGIKTIMVTGDNEQTGAAIQAELGMDYVVSGCLPEKKVDVLRELSVTYGSVAMV
FT                   GDGINDAPALAHAAVGIAMGEGTDIAMETADVVLMKNDLEKIPYAYTLSERLHWITWQN
FT                   ICFAIAVILVLITANVFQLINLPFGVVGHEGSTILVILNGLRLLRSNRKK"
FT   gene            683365..684093
FT                   /locus_tag="FORC68_0667"
FT   CDS_pept        683365..684093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0667"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A469IIJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A469IIJ4"
FT                   /protein_id="QBZ17895.1"
FT                   /translation="MKKINWTQWIALFVFASMGISVVFTIYEIFTAPVKQPATGPHVTL
FT                   RGDYIFLLFEIILGIFILLLPSIIARRFKFEIPGLVYILFIVFLYGSIYLGTVQKFYST
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNANNKVVMKLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALEDTMTDIIVDIIGALFIVIVGYFALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
FT   gene            684066..684203
FT                   /locus_tag="FORC68_0668"
FT   CDS_pept        684066..684203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MFV3"
FT                   /protein_id="QBZ17896.1"
FT                   /translation="MEKRTKEKIRAKSISARGGAFLVAQIRQQIWVSETIDWLVELFYT
FT                   "
FT   gene            684235..684885
FT                   /locus_tag="FORC68_0669"
FT   CDS_pept        684235..684885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0669"
FT                   /product="Transaldolase"
FT                   /db_xref="GOA:A0A3T1NPN7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPN7"
FT                   /protein_id="QBZ17897.1"
FT                   /translation="MFLDTGNLEEIKKALQFPFFEGVTTNPTILLKENRPRKTHIGSIQ
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSLEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHHAALPK"
FT   gene            complement(684925..686745)
FT                   /locus_tag="FORC68_0670"
FT   CDS_pept        complement(684925..686745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0670"
FT                   /product="Lipoteichoic acid primase LtaP"
FT                   /db_xref="GOA:A0A3T2GPW9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2GPW9"
FT                   /protein_id="QBZ17898.1"
FT                   /translation="MILFYFLLIIGKFTFAYFQIFKDPNFLALGMDLLFIVLLLGLIHL
FT                   FAPVRSHIYWYAGMSLFIGILMLVCVLYARFYNEVPTYHSFSLIGEVGVVKNSATSLLS
FT                   GTDWLYILDIILLPFILYFNIKKGHEFPSFRLTSRVYGVSFISTLLILSGFTYFMMQQN
FT                   IISDSKRAKRMGIFTFNISTALTGADHVKAADITAKNVNDIKGVSVKSNPDYFGAAKGK
FT                   NLIIVQLESFQRNLTNVKINGQSITPTLDGLQNETMYSNQFFQTVSKSNTADAEWSVYT
FT                   STFPSGYYTNTQTYGDRVIPSMPRLLGKNDYKTATFHTNDASFYNRDEFYPAVGFDKFY
FT                   DRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKNNQKFYAQLISVSSHMPFDIPKDKQE
FT                   IDLPSDLKDTELGNYFEAVHYADKQLGEFIQKLKDSGIWDDSVVVFYGDHHIIKTDQLP
FT                   EEQKKYVNRSTQLKAEPADDYRIPFFLHYPGMENPGEIKNVGGEIDIMPTVMNLLGIKT
FT                   GDQIMFGTDILNSSNNYVPERYTMPEGSYFTNSYMYQPDESFETGAATNYDGTNKELSS
FT                   DVKKRFDASRKLLQYSDSYVNNLPLRNEDK"
FT   gene            686980..688371
FT                   /locus_tag="FORC68_0671"
FT   CDS_pept        686980..688371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0671"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="GOA:A0A1C7PWX4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWX4"
FT                   /protein_id="QBZ17899.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVVIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPLYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
FT   gene            688461..689300
FT                   /locus_tag="FORC68_0672"
FT   CDS_pept        688461..689300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0672"
FT                   /product="Glyoxalase family protein"
FT                   /db_xref="GOA:A0A456CKG5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A456CKG5"
FT                   /protein_id="QBZ17900.1"
FT                   /translation="MAEISEELRLGEVVLNVGHLKEMAGFYQEVIGLKLLEENEGMVRL
FT                   GVSGSDEALLVLKKIDNAVVPEVPRIGLFHTAFLLPTRESLADVLLHLAKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRPKAEWMRDGDGNLPMVTEQVDVDSLLQIATDEPFT
FT                   GMPNGTIIGHVHLQVADADKAEQFYKEALGMKLTTAIPSARFFAAGDYHHHIGSNVWAG
FT                   RNLELLQENETGLAWFTIITPDKDAIITTLEEQGYDVKRFESTISVTDSNGIKIHFK"
FT   gene            complement(689383..689667)
FT                   /locus_tag="FORC68_0673"
FT   CDS_pept        complement(689383..689667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0D8X322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X322"
FT                   /protein_id="QBZ17901.1"
FT                   /translation="MEFMSMIVTGIVLAAIISGLSFVVGKLSGLSWFWIAFCANSGFFI
FT                   IFITVQNSFPDNAAVALSYLNLGIGVVLIALTLFQSSNWLFKKTMQRKH"
FT   gene            689765..690715
FT                   /locus_tag="FORC68_0674"
FT   CDS_pept        689765..690715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0674"
FT                   /product="Magnesium and cobalt transport protein CorA"
FT                   /db_xref="GOA:A0A1D2IXV9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXV9"
FT                   /protein_id="QBZ17902.1"
FT                   /translation="MIEFFKTTNEKMEQLSALEDGCWVKVTAPTDDEIEMLSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEQDVRHSLVIVDYPYESEDELGYAMYETLPIGIVLTRKH
FT                   LVTITLRDLPILKDVQSMKLEEYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEDNHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASIYGMNI
FT                   KLPFMHNEHAFALILLFTLLITTGVTVIFWRRKYF"
FT   gene            690739..691380
FT                   /locus_tag="FORC68_0675"
FT   CDS_pept        690739..691380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0675"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A1D2IXR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXR2"
FT                   /protein_id="QBZ17903.1"
FT                   /translation="MEKQTYEKLAYYTIKEKILSGKLHVGQHISEAGIAKELSISRTPV
FT                   RKAIAVLVSEELIEYELNRGAIVIESSMSAGRFIELLEMAEILVVQTIEKCKNKNLTYK
FT                   PEQGNALLEEMREIQKEEDVEAYLSLLSKWLLQFVAQLANSYAEDIVRKMKRDFFNKAQ
FT                   KDIKIIPVLLEEETMETLEQLTYYMVEKKHDLAKEVIQKLVNLYIIRTFR"
FT   gene            691423..694113
FT                   /locus_tag="FORC68_0676"
FT   CDS_pept        691423..694113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0676"
FT                   /product="phage infection protein"
FT                   /db_xref="GOA:A0A1D2INR8"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INR8"
FT                   /protein_id="QBZ17904.1"
FT                   /translation="MRKVYEIFILDWRRLFKAPLALLLVIALIILPSLYAWFNIEALWD
FT                   PYSNTSGIKVAVSIDDEGAEIDVPGKKPQQVNVGNQLKKTLEKNKKLGWTFVSEDEAKK
FT                   GVKSGKYYASIHIPKDFSEDMVSVVNDNVTKPTIDYSVNEKINAIAPKMTESGATTIVN
FT                   QISSEFVGTVSKAVLEEFNKAGIDLENELPTIRRLKTKVFQVQDALPELKKMGAEAVKI
FT                   EAKLPELKAKANQVVELNEKIPELNKATENVLLVEQQLPKIDQLGQDILVLQKKIPEIK
FT                   QIAESVKEVDENFGTIKKTVNDAVNESGKALDVIDTAMAAIPTVEKIAQNGSGYVDKVS
FT                   DFADEINKSFDTLAPAIKQNLTLMKQMADNIYQVTEAIKNGSITPEQAITELKKMEQDI
FT                   DSLQQMITKQTATLESLNETLPNKPFTDLIANLKTINSQLGAQKETITKVRTELENGAQ
FT                   PSEELLNQLNEQAKNVSEKLDQILANYDSEIVPAIKVGLNQIQGDLKDSQKLLETLQAK
FT                   IPEITQVLKDSRETLQTGQTYLEEFQERLPEIQKTLDEATKVINTKLDTIIAGINEAAN
FT                   FYQNDYPNVKANIKKAANFIRDDLPGLEKEINQASGLIQEKMPEFEKAIKIAADLSREE
FT                   LPEFEKAINNAANKITDFDKNYDLQSIIKMLRNDADKDSSFIASPVKLKETSYYPIPNY
FT                   GSASSPFYTALCLWVGALLLISLLRVDVEVPAGIFSHYHRYFGRLLTFLSIGLMQALIV
FT                   TLGNIFLLGVSIAEPLLHVLFSMFISVVFMTIVYTLVSLFNNVGKGIAIILLVLQISGA
FT                   GGNFPIQVSPPFFQAIYPFLPFTYAVSLIRESVGGLYMPTVWIDMSVLAGFAILFITLG
FT                   ILLKKPLDKVVPKLSEKAKRSKLIH"
FT   gene            694159..694806
FT                   /locus_tag="FORC68_0677"
FT   CDS_pept        694159..694806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0677"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A1C7PWW9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWW9"
FT                   /protein_id="QBZ17905.1"
FT                   /translation="MANKFKTLDKMVYNLLLEKIKNGELVPNEHLAEEKLAREFGVSRS
FT                   PLRKAIATLTAQGIVSYHENSGAVLNDCIVDADRYVQLMETIEIFVDAAIAKAAHFGYE
FT                   MDLEKLYARMQEMERFSYLTDLENYFDAHHRFILCLISFAENPYQVRIVKQIFFQMVHF
FT                   SDGINMFKSVEIREWTNKKSNQIYELLAEGKIELARKTIKSMFAELTIQAYR"
FT   gene            complement(694815..695351)
FT                   /locus_tag="FORC68_0678"
FT   CDS_pept        complement(694815..695351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0678"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="GOA:A0A1D2INJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INJ0"
FT                   /protein_id="QBZ17906.1"
FT                   /translation="MNQNKITAGGLEFLVRFALPTDRLKINGLMMDTARWLKESGSTQW
FT                   SDILHGFDVHNIEQRIELGEVALFETEAGKLAGTMIIRKTPSDWDTDLWDNLAIDKAYY
FT                   LHRIMVSREFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNKTLNQMYLRYGFQFLG
FT                   TKNGFHLYQKKLPQK"
FT   gene            complement(695338..696261)
FT                   /locus_tag="FORC68_0679"
FT   CDS_pept        complement(695338..696261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4P7MEY7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEY7"
FT                   /protein_id="QBZ17907.1"
FT                   /translation="MMTISQVKQTAKESLRGNWGIAIGIFVLAWLIETVGGGVLGWIPV
FT                   VGWIALFLLTGPLYTGVAWVYLAISRREQPDVAYMFSGFKQFGRTFLAYLLISIFTFLW
FT                   SLLLIVPGIIKTYSYSQTFFILRDNPNISALDAITESRHMMNGHKGRLFGLSLTFLLWY
FT                   LIPLAVAIAGTVIVAGGMATTSYTADPAEVISALAAGATFGGLVLILASWLITLGISLY
FT                   VYPYLITSIAVFYDDLYAATEGTFTEETVIVEEEVNPFGATEADPFAEDTHPEGFGPDA
FT                   AKEPETPVVPEAPETPEAPKDNNEPK"
FT   gene            696449..696658
FT                   /locus_tag="FORC68_0680"
FT   CDS_pept        696449..696658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X678"
FT                   /protein_id="QBZ17908.1"
FT                   /translation="MAHENLRELEDQLIELRQTYQEVISETREFEDPQLQNGPINAAEV
FT                   RLSALRHEIAEVEKKIKKAESKTE"
FT   gene            696726..697433
FT                   /locus_tag="FORC68_0681"
FT   CDS_pept        696726..697433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0681"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MJ95"
FT                   /protein_id="QBZ17909.1"
FT                   /translation="MKPIFAVGDVHGEITLLDELLENWDKERERLLFVGDLIDRGENPA
FT                   AVLRRVKALADQTGAIVLKGNHEQMLLDFLENPSGKMHYYLSQGGMETIQSLIADSLDK
FT                   KMTPEGLAKRVKEEAAELIDFIRNLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWI
FT                   REPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVV
FT                   EEKVITKSFSVKK"
FT   gene            complement(697477..698040)
FT                   /locus_tag="FORC68_0682"
FT   CDS_pept        complement(697477..698040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7Q0N4"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7Q0N4"
FT                   /protein_id="QBZ17910.1"
FT                   /translation="MEQNKEKLTKPTSEKNYFWPIMIISFVAVVVILLLFFSPIGYQGA
FT                   VHFDITIFPRMNAIFNSFTFVFLVIALWAIIKKKNIKMHRGFILAAFTSTLFFLVSYLT
FT                   FHYLSAETSTFGGTGIIRPIYFFILITHSFLAAIVVPLALFALVWGWTMQIEKHKKIVR
FT                   WTMPIWLYVSLTGVLVYLFMAPYY"
FT   gene            698160..698576
FT                   /locus_tag="FORC68_0683"
FT   CDS_pept        698160..698576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A7M3K1"
FT                   /protein_id="QBZ17911.1"
FT                   /translation="MSIIARELTKAEEAEIIRLKEEGEVMLQTDGTPEERIEKITEYLK
FT                   NTSPDPDLAEELGYILGSLYGEAVREKYGWRWLFVSENDLEGYAITSKEHGYTFMVHDY
FT                   FMQVIVQNKPDNSKMLFELMVDMTGNRNDFRMIG"
FT   gene            698628..699263
FT                   /locus_tag="FORC68_0684"
FT   CDS_pept        698628..699263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0684"
FT                   /product="Endonuclease III"
FT                   /db_xref="GOA:A0A3T2H6P5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6P5"
FT                   /protein_id="QBZ17912.1"
FT                   /translation="MNVDEQKVRVLNNLVEHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLGPHLDLESLIGMDMATLEECIYPAGFYKQKSIYIKALIKWFHGHGASLDK
FT                   FQTYSTEDLRKELLGIKGVGEETADAMLLYIFERNVFIADLYARRLFSRLGFGEYKTYE
FT                   QMREEFMPITENIPHKLCKEWHSVIDVHGKHFGKDKAMDESWLLEFSN"
FT   gene            complement(699253..700149)
FT                   /locus_tag="FORC68_0685"
FT   CDS_pept        complement(699253..700149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0685"
FT                   /product="Transcriptional regulator, MutR family"
FT                   /db_xref="GOA:A0A3A6X7M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A6X7M0"
FT                   /protein_id="QBZ17913.1"
FT                   /translation="MIGYGKTVRDIRTSKGIHQKDLYDNIISKSFAIEFEKGKHDITLS
FT                   LFEKILKRMNMDLDEFFYIHRELSKSAEKNYLCMNQERGNIYDLESLELLYSELSKHDG
FT                   ELVEVWKAFVRSRIKMVEHLLKYHEFTVDVITAKDKCTIQKYLFSIDTWTLEELKICAN
FT                   SIYFFEEDLQIQFLNQVIKAIQPYKNYDRARRVLCTLLINTIEVFISRGQLSSASKLLI
FT                   LLDSLCIYNESAFYRNISNFLKGLLKMQSNQIKEGYAQAKKAIQLMNDLHFEEIAYLYE
FT                   ILLDQFIQLEGIDILNY"
FT   gene            700380..700664
FT                   /locus_tag="FORC68_0686"
FT   CDS_pept        700380..700664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0686"
FT                   /product="Mobile element protein"
FT                   /db_xref="GOA:A0A1D2INQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INQ9"
FT                   /protein_id="QBZ17914.1"
FT                   /translation="MAKAKYEENFKKSLVALYRRGKTKHSICQEFNVPHSTFGKWIKKF
FT                   NNEENIESNEILNILQAQELKKQRVLLEEELSILTEAIAVFENPLPKNK"
FT   gene            complement(700719..701027)
FT                   /locus_tag="FORC68_0687"
FT   CDS_pept        complement(700719..701027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0687"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="GOA:A0A402X0X7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A402X0X7"
FT                   /protein_id="QBZ17915.1"
FT                   /translation="MKVSKSFEVFAKEAPEVQSAWMETVHKLDAASKLDKKTEELAYIA
FT                   VMAATRLESGLPFHVKMAKSNGATRDEIISAILVGLPAVGNTVISALPIALDAFDEE"
FT   gene            complement(701091..701906)
FT                   /locus_tag="FORC68_0688"
FT   CDS_pept        complement(701091..701906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0688"
FT                   /product="Hydroxymethylpyrimidine phosphate kinase ThiD"
FT                   /db_xref="GOA:A0A3T2H6P3"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6P3"
FT                   /protein_id="QBZ17916.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAQLVREQLKTILSGGPVDAMKTGMLGSIEIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKAA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGKEITIYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDFVTAAIKGGFALNEFIGPVWHGAYNKAENR"
FT   gene            complement(701932..702798)
FT                   /locus_tag="FORC68_0689"
FT   CDS_pept        complement(701932..702798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0689"
FT                   /product="Cof-like hydrolase"
FT                   /db_xref="GOA:A0A0B8R2E9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8R2E9"
FT                   /protein_id="QBZ17917.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVPAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
FT   gene            702972..703535
FT                   /locus_tag="FORC68_0690"
FT   CDS_pept        702972..703535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0690"
FT                   /product="Maltose O-acetyltransferase"
FT                   /db_xref="GOA:A0A1D2IXX8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXX8"
FT                   /protein_id="QBZ17918.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDAMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   SFPDNVVVAGNPARVIKTIEVEEK"
FT   gene            703532..703795
FT                   /locus_tag="FORC68_0691"
FT   CDS_pept        703532..703795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR035218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INN8"
FT                   /protein_id="QBZ17919.1"
FT                   /translation="MIISDSKIFEQMENELAKAKAATTKASQDKHLHGLMLLVQLAKTG
FT                   DETTAAVEPIAIQPTEPAQIASMDGKKIELEDGANGDSLLDF"
FT   gene            703805..704182
FT                   /locus_tag="FORC68_0692"
FT   CDS_pept        703805..704182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0692"
FT                   /product="hypothetical protein"
FT                   /note="COG2363"
FT                   /db_xref="GOA:A0A1D2INK6"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INK6"
FT                   /protein_id="QBZ17920.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVIGLLMEKQASRLYTWAAILFATGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
FT   gene            704296..705231
FT                   /locus_tag="FORC68_0693"
FT   CDS_pept        704296..705231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0693"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:A0A3H0QY31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QY31"
FT                   /protein_id="QBZ17921.1"
FT                   /translation="MTYALEIKGLRKIYSTGVEALRGVDLTVEEGDFYALLGPNGAGKS
FT                   TTIGIITSLVNKTSGQVSVFGYDLDTDIVRAKQQIGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVSRKEAIKRSEKYLKQSNLWEKRSERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRREMWTFLRELNESGTTIILTTHYLEEAEMLCRNIGIIQSGELIENTSMKS
FT                   LLSKLQFETFIFDLEPYEEAFEITGYNHVFEDKQTLSVEVERNQGVNHIFEQLSEHGIK
FT                   VLSMRNKSNRLEELFLKITEEKHQVGEKHV"
FT   gene            705224..705994
FT                   /locus_tag="FORC68_0694"
FT   CDS_pept        705224..705994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0694"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="GOA:A0A1D2INK4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INK4"
FT                   /protein_id="QBZ17922.1"
FT                   /translation="MFNLYYTALKSLAAKETNRYMRIWVQTLVPPVITTSLYFIIFGKM
FT                   IGSRIGDMNGFSYMEYIVPGLIMMSVITSSYANVSSSFFSQKFQKNIEEILVAPVPTHI
FT                   IIWGFLIGGIGRSVLVGALVTLISMVFVPIHIHSWTIGIITFLMTAILFSLAGLINGIF
FT                   ARSFDDVSIVPTFVLQPLTYLGGVFYAISMLPPIWQAISKVNPIVYMISGFRYGFLGVT
FT                   DVPVVISLSILVVFSVVLYSICWYLISKGRGLRS"
FT   gene            706127..706243
FT                   /locus_tag="FORC68_0695"
FT   CDS_pept        706127..706243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4V1C377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C377"
FT                   /protein_id="QBZ17923.1"
FT                   /translation="MGNKKVKRKLGANIWWILILAILIIFVAYLVMGYVAKI"
FT   gene            706255..707136
FT                   /locus_tag="FORC68_0696"
FT   CDS_pept        706255..707136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0696"
FT                   /product="Sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MMH2"
FT                   /protein_id="QBZ17924.1"
FT                   /translation="MNKENPLNKYHTGKFEKQRQDYPGLQSKMTPVPDAGESSYQGANK
FT                   LTGKKAFVTGGDSGIGRAAVIAYAREGADVAINYHPDEEVDVQEVKAIVEEAGQKCVLL
FT                   PGDLRKEGLAKDLVKKAYNELGGLDILVLNAGLQQYQLDIQKLPAEQLRDTFEVNVFSV
FT                   VFAIQEALNYLKAGASIILTSSIQGVKPSAHLVDYAMTKSSLISLTKSLTAQLGEKGIR
FT                   INAVAPGPIWTALQISGGQPQDSIPEFGQDQPLGRAGQPAELASAYVLLASDEASYTTG
FT                   QVYGITGGAPIN"
FT   gene            707154..707330
FT                   /locus_tag="FORC68_0697"
FT   CDS_pept        707154..707330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1U7AMX8"
FT                   /protein_id="QBZ17925.1"
FT                   /translation="MPWTKNDYPDSWKNLKKTEREKAIEIGNALLKDGYSESRAIPIAT
FT                   SKAEEWYKNHKES"
FT   gene            707456..708064
FT                   /locus_tag="FORC68_0698"
FT   CDS_pept        707456..708064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H6S0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6S0"
FT                   /protein_id="QBZ17926.1"
FT                   /translation="MNKRRWIFSTVVTAFLLIIGGFLVYQQMILKPFTEVVAEAKIDGY
FT                   ESGDELENASTVIVTGQLEKRGDSIIERASDDAVVGVYRMSTFKIAQVLKNETDDNLAK
FT                   EMTIPIYENEGYDAKTNTTYHIAGYTKMEKEEKYLLLLQKDSEDDYYIPTAVIFGKINL
FT                   DPNKRNELFPKNSDTEVAINKVQAEVLKNLEKEIDREDK"
FT   gene            708273..708413
FT                   /locus_tag="FORC68_0699"
FT   CDS_pept        708273..708413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF04"
FT                   /protein_id="QBZ17927.1"
FT                   /translation="MEKMLNIRKLLKQGKVRGVRHLPIFINATGGFLSEQRYECLGKHP
FT                   L"
FT   gene            708608..708688
FT                   /locus_tag="FORC68_0700"
FT   CDS_pept        708608..708688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQT6"
FT                   /protein_id="QBZ17928.1"
FT                   /translation="MGSLMLIAVLVLAVYVITKVINKLKK"
FT   gene            708979..709407
FT                   /locus_tag="FORC68_0701"
FT   CDS_pept        708979..709407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0701"
FT                   /product="Arginine/ornithine antiporter ArcD"
FT                   /db_xref="GOA:A0A0D8X0K2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X0K2"
FT                   /protein_id="QBZ17929.1"
FT                   /translation="MGFLEAYKSFWRNYVNFSGRAPRSAYWYVVLWNVIIFVILYALAF
FT                   IFGISAIMEAAMGGTGMAGGGGAIVLVIILWLYLLAALLPTISLMVRRLHDSGKSGFFV
FT                   LLSLIPFAGGIIMLIFMCLESDGPNQYGDGDIDSKFDF"
FT   gene            complement(709446..709655)
FT                   /locus_tag="FORC68_0702"
FT   CDS_pept        complement(709446..709655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X344"
FT                   /protein_id="QBZ17930.1"
FT                   /translation="MYIEIYTVNGESIRLDDDAKINNISIHELSKADLKNLFNEKCIEL
FT                   TKYDLTYFINTNQVNWFLVSEGIH"
FT   gene            complement(709674..710594)
FT                   /locus_tag="FORC68_0703"
FT   CDS_pept        complement(709674..710594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0703"
FT                   /product="Motility repressor MogR"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MEU9"
FT                   /protein_id="QBZ17931.1"
FT                   /translation="MPKSEIRKLFQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEI
FT                   YHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLN
FT                   DLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRKTQKNTKKEKTNIFGKVVPAE
FT                   FKAPASIKEQISYDKSREKNLVDLLSGVKSNVQLLSENQGEENNVYDLLKSIYSLSSLA
FT                   VQKEELDKKYQDLQTKCQELEQENSYLKQQNETMTDSFHTLVLQVADFAYASDLDQIQA
FT                   LPLFSQQLVVTLNQLGVFKENYKQM"
FT   gene            710966..711280
FT                   /locus_tag="FORC68_0704"
FT   CDS_pept        710966..711280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0704"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="GOA:A0A418S1B4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A418S1B4"
FT                   /protein_id="QBZ17932.1"
FT                   /translation="MEYFLSLLKIIVLLAVLAGISYFLVKKNKQANRTRKSENDLIKLK
FT                   DTLLISHQLRAVLLEADGEKVLAIISNNDIRTVSLKGKNDQNEALFRELLLKEETKENA
FT                   "
FT   gene            711273..712040
FT                   /locus_tag="FORC68_0705"
FT   CDS_pept        711273..712040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0705"
FT                   /product="Flagellar biosynthesis protein FliP"
FT                   /db_xref="GOA:A0A3A2UZB2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2UZB2"
FT                   /protein_id="QBZ17933.1"
FT                   /translation="MRKIASRRVFQVSFIVIFAISLVVFWPGVNVHAESWLDSLGVNGT
FT                   DGVNSSVALFVLVTVLSLSASIVLMFTHFTYCIIVLGLTRQGLGATNLPPNQVLVGLAL
FT                   FLSLFMMQPLITAWYDDVYKPSQKEEWSASKVWDETQPLLTKYVAENTYKHDINMMLKA
FT                   EGEDPVTKKEDAPLMALMPAFILTQITQGFLTGMFIYLAFIFIDLIVSTLLMYLGMMMV
FT                   PPMTISLPFKILVFIFIGGYGLITNMIFQTIHF"
FT   gene            712053..712325
FT                   /locus_tag="FORC68_0706"
FT   CDS_pept        712053..712325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0706"
FT                   /product="Flagellar biosynthesis protein FliQ"
FT                   /db_xref="GOA:A0A0D8X0K7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X0K7"
FT                   /protein_id="QBZ17934.1"
FT                   /translation="MNLTPITQIFQDFFYSGLALILPVSLICIVVVIVVAILMAMMQIQ
FT                   DQSLTFLPKIVAFVVALFILGPWMFEHMTDLFVGIFSKLPLMIRV"
FT   gene            712328..713089
FT                   /locus_tag="FORC68_0707"
FT   CDS_pept        712328..713089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0707"
FT                   /product="Flagellar biosynthesis protein FliR"
FT                   /db_xref="GOA:A0A1C7PWS7"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWS7"
FT                   /protein_id="QBZ17935.1"
FT                   /translation="MEFEFFLAVVIVFSRVASFLFFFPLLKGRNIPNSVKVVFGMAISI
FT                   PVATWVDVSGITTLPDLLLRVTSEVVFGLALAKLVEIIAVIPKMAGFMIDYDLGFSQVN
FT                   LIDPSYGTQNSITAAILDTFFVVIFLSLQGMDYLIYYLMKSFEFTASVSILFEKGFIDL
FT                   LLGTLGFALASAVSIALPIMGSIFIVNIILAFISKSAPQINIFMNAFIIKITFGIFILA
FT                   CAVPILSTVFKNLTDEMIQQYVSFFDYLLKK"
FT   gene            713105..714151
FT                   /locus_tag="FORC68_0708"
FT   CDS_pept        713105..714151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0708"
FT                   /product="Flagellar biosynthesis protein FlhB"
FT                   /db_xref="GOA:S5L6Z5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:S5L6Z5"
FT                   /protein_id="QBZ17936.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGEMFIKNTIQAFVALLKQPPKLANMESYSLFYLMEFGKVLMPIMVMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDT
FT                   LISYTGQNWLYSLGQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPK
FT                   LLVKGEDELALFIRQVADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIKF"
FT   gene            714198..716273
FT                   /locus_tag="FORC68_0709"
FT   CDS_pept        714198..716273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0709"
FT                   /product="Flagellar biosynthesis protein FlhA"
FT                   /db_xref="GOA:A0A1D2INI3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INI3"
FT                   /protein_id="QBZ17937.1"
FT                   /translation="MGNLGAIKKYFAILIAVSFVIALIVPLPPFVLDLVLVTILAFSVL
FT                   VYMRATSIKDWNELKSFPSLLLLMGIFRVSINISTTRAILTTGDPGQVIKQFGNFVIGS
FT                   NFVVGIVIFIILIVFQFIVANGSSRTAEVAARFTLDALPGKQMAIDADLNQRLITEPEA
FT                   KEKRAYLNMETEFYGAMDGAGKFVKGDVLFTVLLAVVNIVFGLIVGMVQGGLSFGEAAV
FT                   KYTELTIGDGIVSQIGSLLMAMSAGVIVTRVFDGSDDNVAVGIFKELMQNSVVVYTLAA
FT                   MFILMGVFSPLPTIPFVGIGVVLGIIGYRTQFNLKKKEQLELEKEMELIQSETNSAEAE
FT                   HNQAFGAAREKFPVVVELGLNIAALVKQKMNGETAKDKVVLMRKSILQDLGIGVPGINF
FT                   KDNTSFQPRGKYEIKVKGVAVASGVLKAGHLLALKTPGVMMDLDAEPTKDPIFGEDGYW
FT                   ILPGELEDAQMKNYQVLEPLSILITHLDVVLRKNLHELLMRQQIKDLIDGLADENQILI
FT                   DEIKKKEIDYSLIQGVLRQLLKEGISVRDLPTIVEGIIDGQTIYPNDLDGITAFVRERI
FT                   SKVICEQAKNQDGKIYALLLQDSIEMDTEIVNTPYYGYALNWALDKELPIIQKVRDTVN
FT                   KAQLTGREPVILTRRKDFRFGFVRVLERYQLDVPVLSISELSPETEVEQIALIEPT"
FT   gene            716295..717518
FT                   /locus_tag="FORC68_0710"
FT   CDS_pept        716295..717518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0710"
FT                   /product="Flagellar biosynthesis protein FlhF"
FT                   /db_xref="GOA:A0A1C7PX42"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX42"
FT                   /protein_id="QBZ17938.1"
FT                   /translation="MGKHLVEKMEIFKGNSKREIHKKIQLVTNEPYKITDERVTKLGIF
FT                   KKQYEVTAVIMSEVAIADGRMDFQETFQKSVVKTRPKTDDLLKKEKLLEMLAAGAELAQ
FT                   STPLLEERKTQEEELSSMRLELAALNRELAVKMREEREQNSDFVKFLKGRGISDTYVAD
FT                   FMQAGRKQFKQVETAHLDDITDWFVPYLSGKLAVEDSFDLSGHRIISLIGQTGVGKTTT
FT                   LVKLGWQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIVATSPAELEEAVQYMT
FT                   YVNCVDHILIDTVGRNYLAEESVSEISAYTDVVHPDLTCFTFSSGMKSADVMTILPKLA
FT                   EIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTDGQNITENIFRPKSRWLAERFVG
FT                   TDRRQVVE"
FT   gene            717515..718294
FT                   /locus_tag="FORC68_0711"
FT   CDS_pept        717515..718294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0711"
FT                   /product="Flagellar basal-body rod protein FlgG"
FT                   /db_xref="GOA:A0A393PJ21"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393PJ21"
FT                   /protein_id="QBZ17939.1"
FT                   /translation="MKGLYIGAAGMMNYMQHIQVHSNNVANAQTPGFKFDQLTSEVISR
FT                   NKVNYQNGPVTRQVGTIDYGVRPAATHINLTAGSSYITNRDRDFFMQDTDPTQGSNFFI
FT                   TAKNGEISLSRGGQFHSDQFGFLRTADGANLLSATGEAIQVGQKTSIRAEANGDLYNAE
FT                   TSQYLGRLGTKFVSANQADSLVKDGEGRLHINGVNTMNLPAGQGIIQNGVIETSNVDLG
FT                   VEMVQLMDNQRMVQASKNVVNMFDKVYDKEATGLIRQ"
FT   gene            718323..719111
FT                   /locus_tag="FORC68_0712"
FT   CDS_pept        718323..719111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0712"
FT                   /product="Chemotaxis protein methyltransferase CheR"
FT                   /db_xref="GOA:A0A3R0H228"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H228"
FT                   /protein_id="QBZ17940.1"
FT                   /translation="MIPDLEKDYLYFTRVVKRDLGLDLALYKETQMKRRILSFIVKKKY
FT                   ITFGEFFKHLKKDAVLLDEFISLITINVSSFFRNRNRWDALEKQVLPRLLEDSRGKLRV
FT                   WSAACSSGEEPYSLAMMMERSVGTRHYDILATDLEPAILKRAVIGEYQSRQMEELSEQE
FT                   RHTAFVEKGDTYQILPKYRKSIRFRRHDLLTDYYEKGFDLIVCRNVLIYFTAEGKHQAY
FT                   QKFAESLRRGGVLFIGGSEQILNPADYGLATLNNFFYIKT"
FT   gene            719136..719471
FT                   /locus_tag="FORC68_0713"
FT   CDS_pept        719136..719471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IYE8"
FT                   /protein_id="QBZ17941.1"
FT                   /translation="MGRIENIKNLAFFEDKPGLAEQILMLEKKTQLFLPNEFEIRQTVG
FT                   YEIGDKEVILGRLESFYFLALKGVGENNYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
FT   gene            719498..720349
FT                   /locus_tag="FORC68_0714"
FT   CDS_pept        719498..720349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0714"
FT                   /product="flagellar motor protein MotA"
FT                   /db_xref="GOA:Q9XDE7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q9XDE7"
FT                   /protein_id="QBZ17942.1"
FT                   /translation="MEITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKEKMPDKVDVLVQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEIERGQASQETAGG
FT                   TR"
FT   gene            720309..721136
FT                   /locus_tag="FORC68_0715"
FT   CDS_pept        720309..721136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0715"
FT                   /product="Flagellar motor rotation protein MotB"
FT                   /db_xref="GOA:Q9XDE6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9XDE6"
FT                   /protein_id="QBZ17943.1"
FT                   /translation="MAKRRKKPQEEHVDETWLIPYSDLLTLLLALFIVLFASSSVDAKK
FT                   FEQMGNAFKKIVEEGAAGNQAYVSKEKGPDDPNVNAVLKAMEEQDKKKEANEQEKAKKA
FT                   AAALLKKQNEEKIEAFKKQIDSYIAAENLGTKMTTKYSDEGLLITIRDDILFQSGSAEL
FT                   SAGKREIAKEIGELFAQGKGTMEGIVSGHTDNVPISTSIYSSNWELSVARAVNFMEAII
FT                   QENSEVNPGEFSARGYGEFRPVAKNDIAANREKNRRVEIMVRPINRDTLDEDE"
FT   gene            721146..721646
FT                   /locus_tag="FORC68_0716"
FT   CDS_pept        721146..721646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXM6"
FT                   /protein_id="QBZ17944.1"
FT                   /translation="MQLFLSGSHTLTDYDKQEIQAYLEKFAPVNHIHLLCYKSIENEVL
FT                   QFFLKKEHLAPRLSIYTFAPKECLPEPFLSAIDYLERLGSSYQSFGYFDTVIAKPTYEK
FT                   FLAQIVSKMDLVCCFYNGDKPTDVIPVDVAKAFDVQSMIYDLPKAKKHLLHRASSDKIK
FT                   LVN"
FT   gene            721669..723582
FT                   /locus_tag="FORC68_0717"
FT   CDS_pept        721669..723582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0717"
FT                   /product="Dolichol-phosphate mannosyltransferase"
FT                   /db_xref="GOA:A0A459MN89"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A459MN89"
FT                   /protein_id="QBZ17945.1"
FT                   /translation="MRPLISICMIVKNEAHILRQSLASFRKFTEEIIIVDTGSTDETKE
FT                   IAQEFTDFVYDFEWTGNFSDARNFAAKHATGKWILAIDADECLEEESYRKLEKQLKSPT
FT                   EPIQMAQIISFTGEKGRVTTTNQMARVYKNDGTICFRGVIHEQLEAIDKRPIAAGVAEV
FT                   KIYHYGYMSEIVEKQDKSDRNLRLLEKEVKNNKNSGFVHFNIGQEMNRLGNKKEALKEF
FT                   SEAFRLRDHNHYIWAKLSAYHIAELLEQEKRYDESLAIIEEARVIWPNVPEFPLKKANI
FT                   LYVNHQLEDAKEIYQSLLENTAIDYQPIVLYEATNFMPHKMLGTIYLEEKDYTRAMTHF
FT                   SKAYAENSSDYGVMFQMIMLLSKFHQPKEIFAFMERHHFISSTETGLRLLSMTTQQGYA
FT                   ELSELIVQSLTDVYPPVAEATEVKIATIRNVFPVISESAILFGIKEELIDAADLCLWHY
FT                   ENPQLPIENVMKNSDVGDIYDFIFENGPRISKKRYLFVLERAIALGKGEFADYLLALRN
FT                   VYHDSINSHIADLFFQYDFADIALDFYNIVDADEVTKQGYINLINYLVDADVLDEALAI
FT                   AERGIDNFSTDFRFYLWAIKIDTENRANRISEAMDEFPNNRYLAKLLDEVTMLQDTVTN
FT                   NR"
FT   gene            723595..724503
FT                   /locus_tag="FORC68_0718"
FT   CDS_pept        723595..724503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0718"
FT                   /product="Chemotaxis protein CheV"
FT                   /db_xref="GOA:A0A1D2IXS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXS1"
FT                   /protein_id="QBZ17946.1"
FT                   /translation="MTEEKGILLQSGTNELEIVTFTVGENLFCINVLKVKEIIHPLEVT
FT                   PVPDSNPAIEGVSQVRGEIMPVVNLARVMKLPEIEPENTKFIITELNQMKIVFRVDEVH
FT                   RIQRISWEQIEEPEKLSIGLEELAVGIVKLDGNLVLLLDYEKIIYEISGNADFAVTGED
FT                   RIARKVNREEKTIFIAEDSQMLRQLLEDTLHEAGYTNLQFFANGREAQEHIFKLLKEQK
FT                   EQTFENVNLLITDIEMPQMDGHHLTKVIKEDEIGRELPVVIFSSLITEDLEHKGAGVGA
FT                   DAQVSKPNIHQLINILDELVL"
FT   gene            724741..725604
FT                   /locus_tag="FORC68_0719"
FT   CDS_pept        724741..725604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0719"
FT                   /product="Flagellin protein FlaA"
FT                   /db_xref="GOA:B1NWM5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:B1NWM5"
FT                   /protein_id="QBZ17947.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQQATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
FT   gene            725879..726238
FT                   /locus_tag="FORC68_0720"
FT   CDS_pept        725879..726238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0720"
FT                   /product="Chemotaxis regulator, transmits chemoreceptor
FT                   signals to flagelllar motor components CheY"
FT                   /db_xref="GOA:A0A0D8X2W7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X2W7"
FT                   /protein_id="QBZ17948.1"
FT                   /translation="MLKLLIVDDAMFMRTMIKNIVKDSDFEVVAEAENGLEAVKKYDEV
FT                   KPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKP
FT                   FQADRVLEALEKAAK"
FT   gene            726258..728114
FT                   /locus_tag="FORC68_0721"
FT   CDS_pept        726258..728114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0721"
FT                   /product="Signal transduction histidine kinase CheA"
FT                   /db_xref="GOA:A0A3T2H6S4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6S4"
FT                   /protein_id="QBZ17949.1"
FT                   /translation="MTTNMLDLFIEEASEHLQALNDNLLQLEKDPTNGQLVSEIFRSAH
FT                   TFKGMSATMGFQQVADLTHAMENVLDEVRNNRLAVTEHLVDIIFTCTSHLETMVSDIQH
FT                   GGQGAADISKTVADLEALLHPEQETDLTIEKSYRIAIQIEEAAILKAVRAVMCLERLAE
FT                   MGIISETTPDREAIELEEFEQSFEVVLESAQTKDEIKAVILDISEIEKVTVTEEVEEVQ
FT                   VIEPIKKAAKQTTKRLENKTIRVQLEKIEKLMNVFEESVIERARIDEIAEKTNNKELME
FT                   HLGRFSSISKEIQNGLLNMRMVPVDSVFNRFPKMVRTLAKELGKKIDLVIEGADTEVDK
FT                   IVIDEIGDPLVHLIRNSVDHGAETVEVRRKNGKNETATINLKAFHSGNNVVIEIADDGA
FT                   GINKRKVLEKAIAKNVVTRAESTKMTDAEIFDLLFDSGFSTADQVSDLSGRGVGLDVVR
FT                   NTILKIGGKISVESSENAGSTFRIEIPLTLSIIQSMLVATSERRYAVPLANVAEAITIN
FT                   PADIQHVHGKDLINYRETIIEVLDLGECFHETPLNDTDELLLLVVKNAKRTFGLIIKDI
FT                   IGQREIVLKTLGGFFSESQIAFSGATILGDGRVVLILNLETF"
FT   gene            728124..728426
FT                   /locus_tag="FORC68_0722"
FT   CDS_pept        728124..728426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0722"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MIH8"
FT                   /protein_id="QBZ17950.1"
FT                   /translation="MMEQVFQVELPEWEPKETPQEGREKGSIRQVDNIGVNLIVRLGKK
FT                   EMPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
FT   gene            728445..728855
FT                   /locus_tag="FORC68_0723"
FT   CDS_pept        728445..728855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6T5"
FT                   /protein_id="QBZ17951.1"
FT                   /translation="MKQEAYNAVKMKVDQEKTAILKELQLLLSKRGKVTEKLAHEKEVY
FT                   YSRTKKERLQVAVLAGSMQLDAFSPSRIQQMEREITQISQYIKSNEQILEQLEEKGKQA
FT                   KKMYDDTRKKWQQLENKKEEQTLRDLKMVLLK"
FT   gene            728871..729917
FT                   /locus_tag="FORC68_0724"
FT   CDS_pept        728871..729917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0724"
FT                   /product="Flagellar hook-length control protein FliK"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPK7"
FT                   /protein_id="QBZ17952.1"
FT                   /translation="MLIPDNLLQPLIGKKQIEPKEKLAEELVELPFISLLMENSPAPLL
FT                   KGEAGDAEQATTPLKEIAQPLVSAKLLDSEPETKLPSAPLELKEVKETLAAIAKQAIDQ
FT                   PKIDNAPQVVQTPETNTPKEPTKNATREQQPPPELIMPTKDSPKLAENVAKNQPALAKL
FT                   PQEKEAVQLFKASIKEPLTAKEEVAVKKPAESSNIWHDTTKQLTPATKVEVPVTLKQLD
FT                   KTITDQIEQLQKFQVKQNKAFFAIQPESLGKVEVLLKKMPDKIFVHIEYQEQTAKQKLE
FT                   QMAQDLHNRFRDRGVEVAVTMTEKQAPKENGQGSEGRHHGESKKEKERENPHQEKAKQQ
FT                   VFDLEEET"
FT   gene            729919..730341
FT                   /locus_tag="FORC68_0725"
FT   CDS_pept        729919..730341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0725"
FT                   /product="Flagellar basal-body rod modification protein
FT                   FlgD"
FT                   /db_xref="GOA:A0A1D2IXL3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXL3"
FT                   /protein_id="QBZ17953.1"
FT                   /translation="MDGISSLSGASQDTNNAVTSSVSKTLGKDDFMKLFLTSLQYQDPS
FT                   SPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNSALQSAVNFIGKDIKGVSLNGE
FT                   VISGKVESVQQTTNGVMLKLKDNDSLVPMTYVTEIN"
FT   gene            730362..731597
FT                   /locus_tag="FORC68_0726"
FT   CDS_pept        730362..731597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0726"
FT                   /product="Flagellar hook protein FlgE"
FT                   /db_xref="GOA:A0A0B8QTK7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8QTK7"
FT                   /protein_id="QBZ17954.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMGLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
FT   gene            731611..731847
FT                   /locus_tag="FORC68_0727"
FT   CDS_pept        731611..731847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0727"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="GOA:A0A0D8X367"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0D8X367"
FT                   /protein_id="QBZ17955.1"
FT                   /translation="MKINHTIPLRIDFELGRTKQPVGSLLDVKKGTVFRLEDSTANVVK
FT                   ITISGKCIGYGEILTKDGKMFVKITKLGEGSSS"
FT   gene            731868..732860
FT                   /locus_tag="FORC68_0728"
FT   CDS_pept        731868..732860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0728"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="GOA:A0A1D2IXR1"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXR1"
FT                   /protein_id="QBZ17956.1"
FT                   /translation="MSDKLSQEQIDALLSQMSEGKVVDESTEIGDFGRFHPYDFHKPEK
FT                   FGAEHLESLKTIASAFTKKSMEFVSQRIRIPIHTEATLADQVSFASGYIETMPNDSYIF
FT                   CIIDLGNPELGQIIIELDLAYIIYIHECLSGGNPKRKLSERRLLSVFEELTLKSILEKF
FT                   CEALKDSFKSVHPISPEIVNIETNPALLRVTSPNDMMALVSVDIKSEFWISTMRIGVPF
FT                   FSVEEIMNKLENVVEYTFDKRRNFDAEVEQELHQVEKEARIRVGEIKTTWKELNKLEVG
FT                   DVLLTETHIRDTLKGYVTEKWKFECYMGKSGNQKAVKFMRHTGRTEQER"
FT   gene            732863..734410
FT                   /locus_tag="FORC68_0729"
FT   CDS_pept        732863..734410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0729"
FT                   /product="Flagellar motor switch protein FliN"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MF30"
FT                   /protein_id="QBZ17957.1"
FT                   /translation="MEQLLEKNITQMELDVIGEIANISFGSASTVLSDLLHQQVTISTP
FT                   KVEIVDLYNTKDIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNE
FT                   ELSELHLSAVQEAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIK
FT                   VGFDLIIGDLITSNLMQLIPVDKGRELAKRLLGDAIPEADPVKEEISLTAEELDVFLEV
FT                   CNIGIGSASTVLSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTF
FT                   IISKNAALIMADLMMMGDGMVQDDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKID
FT                   ISPPTMEFCNFGDTMIQKNIEEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLML
FT                   GIQAKEVAEKEATTPAEIIEPEKPAEPIKHTVIEEKETLSEMEQILEDIPVTLEVVFGT
FT                   AKVKLEKFISWCEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
FT   gene            734416..735819
FT                   /locus_tag="FORC68_0730"
FT   CDS_pept        734416..735819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H6T3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6T3"
FT                   /protein_id="QBZ17958.1"
FT                   /translation="MRKLGLMTILFWMFLSVQAFAADLEPPMISLEKEQRVFTSGEVIS
FT                   FHVKNPEELKLVLVNEHGQRKLLDGETYTVTDWDLDGNYQAEFYQADISKPVVTVEDLF
FT                   EVKQLEEVAKDETAPSLKMIEITHDEDVLPTSVLYASAELDDAESGVKQAILLVHSKSN
FT                   ESEMELIRNNYTGEFDAEIPLEKFQLGEELTFQLQLVDFAENEITLDLENTIQLYEPKA
FT                   PVLSYDGSDITNVQKKIGQVGNRIELTLDKYTTEFPELETENGKTIPLLWQKTATEWKG
FT                   SLALTTELSGEIIHIQEMNQYMLVRATSEPFGDIQLINNSILTGTIHPDFTFISNLYVE
FT                   VNGQNFPIKRTDNSFTSAEITTTGKITLHWTDWDGQVFSKQMNQEIKPVIEMPDKETIA
FT                   PPSVIPKEKESLLTSPDPKPSVESHENTPKKQEKKETSTKNKSSSIPFWIPALMIIGVI
FT                   IFSGNRAMK"
FT   gene            735842..737008
FT                   /locus_tag="FORC68_0731"
FT   CDS_pept        735842..737008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A1C7PX22"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PX22"
FT                   /protein_id="QBZ17959.1"
FT                   /translation="MKIDGIQESAENRNQLERELIKQNPVVKEGTIKAQMNTEVAVPKT
FT                   PPVSFSFKELSSLQLNGTSAASLELYMKLMMNNAKKANDLIFYVMRAGIKNPTDSTKWQ
FT                   TVRSEISSQLSTILMKQHNFEAYFSENPANQKLFLANQKIMNEISFLLKMLPTLTFETT
FT                   GKYDFLRMMQIASGNMETGIQMMREFQGHIEHATRLDSIVDARQETNWMIKVLREFGNM
FT                   FQSRHLLPYELQAENINIWKLGSEYLKLMNQLLPQIGAFPNGNIKIFHQQATKPLTELF
FT                   QELQRLADGQMTQGGIAVILDRMQGQLTRLAQLFQKMEIEAGFTDTERILGSVDAEFAS
FT                   DMTKMMLLAQQEMSFFDLLVKDFRSVSKQPIFFMIVAIFIILLLIILF"
FT   gene            737115..737579
FT                   /locus_tag="FORC68_0732"
FT   CDS_pept        737115..737579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0732"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWR2"
FT                   /protein_id="QBZ17960.1"
FT                   /translation="MNNVSIGQISQSKQTNVVRGIQELNQTQQLYFEQMKANGKKQTPS
FT                   LTEINELITNVTDKKSLVEMDMTVDNVLSYKKAVQTFLNFYVNNVMDYDNIESRHPKYG
FT                   FSQKMTILKQVEKQTNELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
FT   gene            737589..738017
FT                   /locus_tag="FORC68_0733"
FT   CDS_pept        737589..738017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0733"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393K066"
FT                   /protein_id="QBZ17961.1"
FT                   /translation="MQNELINQLEILIEKNVKATDEAILLGKLVQEENWIEAEERQLGL
FT                   QRELAALQNEYQALKTIIGEDNTLRTLQNTWTPEENAIIDERKKMLLEKENLLRVSVTE
FT                   NQIRTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
FT   gene            738037..739557
FT                   /locus_tag="FORC68_0734"
FT   CDS_pept        738037..739557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0734"
FT                   /product="Flagellar hook-associated protein FlgK"
FT                   /db_xref="GOA:A0A394YL29"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A394YL29"
FT                   /protein_id="QBZ17962.1"
FT                   /translation="MRLSDFNTSLSGMSAAQIANMVAQQNISNMNTPGYIRQAVDQTAV
FT                   YGDGGLLGGKQTGYGVKVTDIKRLTNTALTTQYNNQIAKQSASLYQSGALNQALNLFGT
FT                   PGKNTPSDNLDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIA
FT                   ADTDAAIQDLNSLIKKLGSINKAIGNAGSNPPNDLLNQRDQLLSTMAGYAGISVSAHPN
FT                   NPDVYDVTIGGRLVVQGDETTEITSTRTATGFEFSVDGQKLNMPEGSIIASVRVNQNEI
FT                   KSYQEKIETFSNGLAKALDDIQVKNVNKTMDDLQKINDALQANPNDEKLLSNRDELLRQ
FT                   LEKFPGVTRSGDTLTIGGVDHPVDTLGTSTYVTDVNDFSIPIFTQSSGKWILNPAITSN
FT                   ADNKPFLGVIAADIASLKTDKNIQGTTFPSFMDGIITEVATDASKSSATATADTQALSS
FT                   LTESKSSLEGVNIDEEMTNIMQYQSYYVANTKAMNTVNDMMKALLAML"
FT   gene            739569..740444
FT                   /locus_tag="FORC68_0735"
FT   CDS_pept        739569..740444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0735"
FT                   /product="Flagellar hook-associated protein FlgL"
FT                   /db_xref="GOA:A0A1D2INM3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INM3"
FT                   /protein_id="QBZ17963.1"
FT                   /translation="MRISTNQQASSIINQLNNVSGNLAKYQLQVSSGKKYESMSENPGA
FT                   TAQILSYNHVLSQLNREKTDVTEAKSLLNTAETSLSSMSTSMNRVNALVLQAINGTSDK
FT                   DNMSQSAEEIKGLLDVLISVANSEDDGRYVFSGSSTSVKPFTTDKTTGEIIYNGTTENK
FT                   KFRVTDTLEVEVFHDGSAMTDVFNNIQKIVDAMKTGDKDALSALQETNSKNIEIITNSM
FT                   TNIGGQKNGVTAYDNVLSSKIVDFSERKSNVEEVNMPEAVSNLNKTSIAYQAALQSSVM
FT                   VQKLSILNYM"
FT   gene            740456..741745
FT                   /locus_tag="FORC68_0736"
FT   CDS_pept        740456..741745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0736"
FT                   /product="Flagellar hook-associated protein FliD"
FT                   /db_xref="GOA:A0A0B8QTJ9"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8QTJ9"
FT                   /protein_id="QBZ17964.1"
FT                   /translation="MGSSIASSLMDPTQYYSQFISLQKASLEKAKTPYQNQISSYQSRI
FT                   DLYASLKNALSESLKTMSSFTTYESKTKLATSSNETSFTVSSTSSSVNGSYSIEVQNLA
FT                   TADTYNKAVPDIEAKIGVSGTIKINGKEIKVDADSSMKNVMNSINSAGAKVNIYTLGEN
FT                   MVVTSSTTGVENSIKFEGDSAVLDALGLVQNSPDHLAAEDAKLRINGATVTSATNKVTN
FT                   YIPGVTINLKKETTGAEKLTIQDQSDEKAASMITSFVNTYNALTSTMKTYTGKGTILQA
FT                   SAADLEANRALNNVFQHKKDGNTLFDFGISVDKEGVLKVDETAMKKMVAEDPTAVERFF
FT                   FGIGGIGDELYQSLNKTFGSTGFISDETTSMTNEINKLNLKLTDITSRNDTLLTNITDQ
FT                   YNKWLEMMQAMQSDAMTLDALIDGMNSSNK"
FT   gene            741763..742149
FT                   /locus_tag="FORC68_0737"
FT   CDS_pept        741763..742149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0737"
FT                   /product="Flagellar biosynthesis protein FliS"
FT                   /db_xref="GOA:A0A3A2NT26"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2NT26"
FT                   /protein_id="QBZ17965.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLDKALAELHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
FT   gene            742121..742402
FT                   /locus_tag="FORC68_0738"
FT   CDS_pept        742121..742402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0738"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6W1"
FT                   /protein_id="QBZ17966.1"
FT                   /translation="MNQAKTHLAELKALFHSTGQLNVTLEEYQAKLNELLKSTEHLPKE
FT                   TKEAVLKETRDVINKGILFTQKQLESTENAFSENKSRNAANLNYAKFF"
FT   gene            742423..742824
FT                   /locus_tag="FORC68_0739"
FT   CDS_pept        742423..742824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0739"
FT                   /product="Flagellar basal-body rod protein FlgB"
FT                   /db_xref="GOA:A0A3H0QXP4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QXP4"
FT                   /protein_id="QBZ17967.1"
FT                   /translation="MENYTTHIGNYLNYLQTANQVVSNNIANANTPNFKASEASFEESL
FT                   GSSLRASGQNSAESAGNLTKTNTKHLAGTDIDETNAKVTTKSGSINEDGNNVNVTSEMI
FT                   SLTKNNQMYALAISALNYNSSINTAARGK"
FT   gene            742836..743246
FT                   /locus_tag="FORC68_0740"
FT   CDS_pept        742836..743246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0740"
FT                   /product="Flagellar basal-body rod protein FlgC"
FT                   /db_xref="GOA:L8DRB9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:L8DRB9"
FT                   /protein_id="QBZ17968.1"
FT                   /translation="MFEGINTSGSALNAAKQWMEVSSNNIANADSSAAPGETPFLRKRV
FT                   VLSEITPFETALTGTKGVKVSEISSDTGSVKRVYDPTHPNANEAGYVNYANVDMTAEMT
FT                   NLMVGQKMYAANTSALQANEKMMEKDLEIGKV"
FT   gene            743263..743559
FT                   /locus_tag="FORC68_0741"
FT   CDS_pept        743263..743559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0741"
FT                   /product="Flagellar hook-basal body complex protein FliE"
FT                   /db_xref="GOA:A0A1D2INL4"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INL4"
FT                   /protein_id="QBZ17969.1"
FT                   /translation="MAIESINAASVLPKVTLGETAKTDNAAGAGNTFTQMLDSMSDTQS
FT                   NAQTSVSNLLTTGEGNASDVLIQMKKAESEMKTAAVIRDNVIESYKQLLNMQV"
FT   gene            743627..745279
FT                   /locus_tag="FORC68_0742"
FT   CDS_pept        743627..745279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0742"
FT                   /product="Flagellar M-ring protein FliF"
FT                   /db_xref="GOA:A0A3H0QY22"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3H0QY22"
FT                   /protein_id="QBZ17970.1"
FT                   /translation="MAKIKTMYSKLKNWHKGAILVGLFVVVTVLLLYMNTPKTEVTLYK
FT                   NLSETSQQQVTDQLAKMGVDYTVDKSGNILVDEKVETLVRDKFADLGIPYTGQDGNDIL
FT                   LNSSLGASEEDKKMQEKVGTKVNLEKEIVQSYGTTIDSASVQLTLPESSSIFEEASQKG
FT                   TAAVTLKTKNNQTLTSEQVLGIQRTVSAAVPNVASDDVAIIDTKNGVISEADTSKEEGS
FT                   SAYKNEVDIQNAIGKNVKTDIEGTLSSIFALDNFRVNTNVAVNFDEIKQNTEHYPNDGK
FT                   VRSNQKDTSTDTSKGSANTTESGTASNADVPNYTEQNGDDTNTYTSEKSSETTNYELDS
FT                   TIQEIKKHPALAKTNVVVWVDQNALNKNGVDMAEFTKAIGVSAGLTPNMTTEEAGADGE
FT                   AAAAPTFEGTFQNGDVTIMPIQFLDNATPAEKDTTEKAEPASKAWIWWLAGGLLFAVIA
FT                   AGIITYIILLKRKEQLEEALEPEEKDYIPAEEAIINPEEHPDFNFQTDAFDLSEPELKA
FT                   RKESLKNKLGEMAKEDPGRAAAVIQKWLNERQE"
FT   gene            745282..746388
FT                   /locus_tag="FORC68_0743"
FT   CDS_pept        745282..746388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0743"
FT                   /product="Flagellar motor switch protein FliG"
FT                   /db_xref="GOA:A0A3R0H7V8"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0H7V8"
FT                   /protein_id="QBZ17971.1"
FT                   /translation="MAETLKETLEETNAELETVEVVETEEKTTTSADSGISRREKAALI
FT                   IWSLDEQIATEVVDLLPDASKQRLAREMAKMKEMDGGAVEEATREFLGELELLSGGIAK
FT                   LDREHLQRLFPDMTTEELNQLIYGVEAESRIGETALDILREIDDVDSLFTIISDESPQT
FT                   IAMIASYMKPEEASKLLALLPEEKMINTVIGIASLEQFDSEVMQNVSNLLRIKLDTMSN
FT                   SSLNKTDGIKNVANILNNVTRGLERTIFEHLDAEQAELSERIKEKMFMFEDIILLDNMT
FT                   LQQVLAEIQDNNKIARALKNEKEELKEKILSCVSKNRRDMITEELEVLGPIRLSDVEQA
FT                   QQDIANVVKNLEKDGKIVIQRGEQDVLI"
FT   gene            746375..747067
FT                   /locus_tag="FORC68_0744"
FT   CDS_pept        746375..747067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0744"
FT                   /product="Flagellar assembly protein FliH"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q7B415"
FT                   /protein_id="QBZ17972.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEETEEIESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELRRDAEAEIEANKQAFEKEKTQ
FT                   IYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
FT   gene            747064..748365
FT                   /locus_tag="FORC68_0745"
FT   CDS_pept        747064..748365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0745"
FT                   /product="Flagellum-specific ATP synthase FliI"
FT                   /db_xref="GOA:A0A469DPV4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A469DPV4"
FT                   /protein_id="QBZ17973.1"
FT                   /translation="MSWSPKTEAWQELKNTVPYIQKGKIHTVQEQVYISKGPQVKIGDT
FT                   VMVGENKVLCEVISIEKENNMLLPFNQSDKVAYGDWVYVTDTKITIPADEFLLGKVLNA
FT                   SGDILNEEAGMAKFKQKMPLEAPPIHAFSRAEITDTLETGIKAIDGMLTIGIGQKIGIF
FT                   AGSGVGKSTLLGMIARNAKADINVIGLVGERGREVKDFLRKDLGEDGLRKSVIVAATSD
FT                   ESHLMQLRAAKLATSIAEHFRDQGKTVLLMMDSVTRFADARRSVDIAVKDLPIGGKTLL
FT                   MESYMKKLLERSGKTQNGSITGIYTVLVDGDDMNGPVPDLARGILDGHIVLTRELATKN
FT                   HYPAIDVLGSVSRVMEEIVPESQWKTASKIREWMSIYQENELYFKLGTIEQTSDNAAIF
FT                   TSKEKSYFIHQFLKQLRDESVTLEETSKLMETLV"
FT   gene            748382..749050
FT                   /locus_tag="FORC68_0746"
FT   CDS_pept        748382..749050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0746"
FT                   /product="Soluble lytic murein transglycosylase precursor"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GMY2"
FT                   /protein_id="QBZ17974.1"
FT                   /translation="MNPVEQVISARQAEFQSVFEAAKQSATAFETKLNERLNETTNAKT
FT                   TSVQTVTDAELARAREAYEALINQSETNSAAPTSSTTTETPTASTGELTNWNNYQIKPI
FT                   SAENEGKYSDLIKTAATKYGVPEALIKRVIQVESNFNPNVVSSAGATGLMQLMYGSNRT
FT                   DPATNIDAGTKQLASYIKKYDGDLKLALAAYNAGPGNVHKYGGVPPFKETQNYLTKIIG
FT                   "
FT   gene            749064..749708
FT                   /locus_tag="FORC68_0747"
FT   CDS_pept        749064..749708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0747"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6U7"
FT                   /protein_id="QBZ17975.1"
FT                   /translation="MGNWQQKWESWRDMTAAMQQEIKIEAAEKVTSYIKNDQFEEAINV
FT                   IRQTENLLNELDFETKMNRVEEQLQAFTSDQEAAKSFEASQLQNIEKPSTKVSFDLSHV
FT                   KSEAINQFTKRDFNLVDSNDTHMQFLKGNRNFYMDIFNPEESEEYHYANLDEKCQYKNI
FT                   GFICQNDAAAEIATNLTNEWLETLEAPKKKFLTVNIANLNAMKQNPEVLFQ"
FT   gene            749830..750156
FT                   /locus_tag="FORC68_0748"
FT   CDS_pept        749830..750156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0748"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:6ABQ"
FT                   /db_xref="PDB:6ABT"
FT                   /db_xref="UniProtKB/TrEMBL:L8DXR9"
FT                   /protein_id="QBZ17976.1"
FT                   /translation="MKGLTELLKGSLEGMILERISRGETYGYEITKYLNDLGFDEIVEG
FT                   TVYTILVRLEKKGLVEIEKKKSELGPPRKFYTLSPAGEEELAIFWKRWDFIQGKIMQVK
FT                   GGQA"
FT   gene            750156..750479
FT                   /locus_tag="FORC68_0749"
FT   CDS_pept        750156..750479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:L8DT81"
FT                   /protein_id="QBZ17977.1"
FT                   /translation="MFNWYKKYREEKRDYKQYKKRIAALPEDYKTAMKAIETYLWNFAK
FT                   GAGMFEILKNVLEMFENAAADNLELKAVVGDDLAEFADNLLSEFPEETWMDKQRQKLRD
FT                   SIK"
FT   gene            complement(750525..751172)
FT                   /locus_tag="FORC68_0750"
FT   CDS_pept        complement(750525..751172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0750"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="GOA:A0A393IWU6"
FT                   /db_xref="InterPro:IPR010841"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="InterPro:IPR038344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A393IWU6"
FT                   /protein_id="QBZ17978.1"
FT                   /translation="MKEFIEPYQYNFIKNQLANVSRAYRSANDTSTLKALKSLTEEKIN
FT                   ELFPDSVLEEHKELFSKLHVITSTKEAEPFLEGLKAYVIPFAPPSDVKLKKLFAKTKKL
FT                   KIPAWSKLDLRDYTFYGWNDIAQQRKYIVTYEDGNLVGVQGTISTEIQKGVCSICHSHS
FT                   KVSLFMAKTKSSSDGVYTTNGNYICYDSDVCNEQIKAHETLDEFIEVVKKRK"
FT   gene            751443..753173
FT                   /locus_tag="FORC68_0751"
FT   CDS_pept        751443..753173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0751"
FT                   /product="Pyruvate oxidase"
FT                   /db_xref="GOA:A0A3T1NPR5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NPR5"
FT                   /protein_id="QBZ17979.1"
FT                   /translation="MKKVKASETLVQTLKNWGIDHVYGLPGDSIDTVVDALRKEQEAIE
FT                   FIHVRHEEVATLAAAAYTKLTGKIGVALSIGGPGAIHLLNGMYDAKMDHVPILVLAGQV
FT                   TTDVLNTGFFQEVNLPAIFEDVAVYNKQIDNAETLADVVDEAIRTAYKEKGVAVLTIPN
FT                   DIPSQVIKASLEAKPVKFEQENPKLDEAAIQEAVTLIEKAEKPVILAGLGTKHAGPELI
FT                   AFSEKLKIPIIHSLPAKTIVPDDHPNALGNLGKIGTKPAYEAMQETDLLLMFGNDYPYS
FT                   DYLPKKADCIQIDIDPAKISKRFPATVGLVGDAAEIISDLTAKIAPVEERKFLQACQEN
FT                   MQEWWKWLEEDIAQTSDPIAPEVVMANIQKIADKDAVFSIDVGTATVWSTRYLHLTPEN
FT                   DFIVSAWLGTMGCGLPGAIAAKKAFPDRQAIAIVGDGGFSMVMQDFVTAVGLNMPMIVV
FT                   VLNNQQLSFIKYEQQSAGELNYAIDLPDINYAKFAESCGGIGFRVEKMADLEAAFENAK
FT                   LATKPVIIDVSVDSAAAPLPGKIVMDEALGYTKFEIQSVLEDHRFAKMPPLKTILRRFL
FT                   "
FT   gene            753335..755140
FT                   /locus_tag="FORC68_0752"
FT   CDS_pept        753335..755140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0752"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="GOA:A0A394UGB4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A394UGB4"
FT                   /protein_id="QBZ17980.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSTLIKDIDNLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKASASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNDMNYKEVENSSQAISDFGVKISLIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLNRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEATEEPESETKDPGEPVLAENV"
FT   gene            755153..755881
FT                   /locus_tag="FORC68_0753"
FT   CDS_pept        755153..755881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0753"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWH3"
FT                   /protein_id="QBZ17981.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLNN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFNGKRVTKNELANNLSTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIAKLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVIITGFDKNNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSRP"
FT   gene            complement(755930..756142)
FT                   /locus_tag="FORC68_0754"
FT   CDS_pept        complement(755930..756142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0754"
FT                   /product="putative peptidoglycan bound protein, LPXTG
FT                   motif"
FT                   /db_xref="GOA:A0A1C7PWS5"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWS5"
FT                   /protein_id="QBZ17982.1"
FT                   /translation="MVFPKKLVASIAVFISLGFIYFRVSTAVAFENTSSASLLPSTGDA
FT                   FSVWPIVIGVVLVALAVVLFIKKKI"
FT   gene            756589..758394
FT                   /locus_tag="FORC68_0755"
FT   CDS_pept        756589..758394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0755"
FT                   /product="Glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="GOA:A0A473XMI4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A473XMI4"
FT                   /protein_id="QBZ17983.1"
FT                   /translation="MCGIVGYIGTNNAKGILLEGLEKLEYRGYDSAGIALQNKELVTVV
FT                   KEKGRIADLASLVPSDAFGTTGIGHTRWATHGKPNHENAHPHQSKSGRFTIVHNGVIEN
FT                   YTLLKEEYLKNHSFVSDTDTEVIVQLIELFAAELSTKEAFKKALSLLHGSYAICLIDQT
FT                   NTETLYAAKNKSPLLIGKGENFNVIASDAMAVLKETDEFVEIMDKEIVIVTKDGFTLET
FT                   LEGEEITRASYKAELDASDIEKGTYPHYMLKEIDEQPAVTRKIIQAYQDETGEINVDKT
FT                   IIDEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVSSEFAYNLPLMSKKPLF
FT                   IFITQSGETADSRQCLVKVKELGYRTLTLTNVPGSTLDREADHSMYLYAGPEIAVASTK
FT                   AYTAQISVLAVLAVSLGREIGDEEALNINLAAELGIVATAMEAMVSSKEVIEHIAGEYL
FT                   ATSRNAFFLGRNIDYFVAMEAALKLKEISYIQAEGFASGELKHGTIALIEDGTPVLALI
FT                   TQESINWNIRGNVNEVLARGAKTCIFAMENVAQPGDRFVIPQVHPLLTPLASVIPCQLL
FT                   AYYAALHRDCDVDKPRNLAKSVTVE"
FT   gene            758506..759246
FT                   /locus_tag="FORC68_0756"
FT   CDS_pept        758506..759246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0756"
FT                   /product="Riboflavin kinase / FMN adenylyltransferase"
FT                   /db_xref="GOA:A0A1D2IXI1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXI1"
FT                   /protein_id="QBZ17984.1"
FT                   /translation="MEVSHVTLAPNKDSRAAVLTIGKFDGVHIGHQTILNTALSIKKEN
FT                   EILTAISFSPHPLWALKQIEIYREMLTPRMEKERWLAYYGVNHLIETEFTSRYAETTPE
FT                   EFVTDHLTNLNLSHIVVGSEFNFGKGRDSDVDLLRDLCKPYDIGVTSVPVIETNQTKIS
FT                   STNIRAFIRRGHFQEAEELLGHPWYITGIVENGEMTGLDDYVLPATGTYQTDSGIVNVT
FT                   NNRTIEVGLSDGLQQLHMKNELSE"
FT   gene            759329..759808
FT                   /locus_tag="FORC68_0757"
FT   CDS_pept        759329..759808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXI3"
FT                   /protein_id="QBZ17985.1"
FT                   /translation="MKIPTTLKHKPVIVVENYEEVDGKNAYHSDAKGLSLGLAQWNDRG
FT                   KVDISAKVWRHTGDKWSRQSEELPLHRVLDLAILIARTKVHFKDAYRLPHFYDKENPTL
FT                   DRIGLQGDALTIAVCEDNEYIDEDMQLFEQALKNDDELLSERLKTLSKLLQEAGY"
FT   gene            759822..760160
FT                   /locus_tag="FORC68_0758"
FT   CDS_pept        759822..760160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXQ0"
FT                   /protein_id="QBZ17986.1"
FT                   /translation="MNKDNRKELIRAYKEKSPDAGVYRFISTKSGKSLIDNTMDLKGIA
FT                   NKLAFGVKIGAGNMLPPEMAKEAKEHGIDTIQFEILEKVDIKPEMTKEDIKEENDVLLS
FT                   LWLEREDI"
FT   gene            760305..760709
FT                   /locus_tag="FORC68_0759"
FT   CDS_pept        760305..760709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0759"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A255BW01"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A255BW01"
FT                   /protein_id="QBZ17987.1"
FT                   /translation="MNPRKSEFVLTLIAGITGIIAGITGIAGGGLLAALSGSEELSNAT
FT                   AMTAADSEALAAAGGLTVIFSIIALVLGIALIVFAVLIKRNAKVFGILTLVAGVVGFFL
FT                   VGLLWIVPGVLAVIAGIMCLARKVPTDTFS"
FT   gene            761403..763319
FT                   /locus_tag="FORC68_0760"
FT   CDS_pept        761403..763319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0760"
FT                   /product="Internalin-like protein"
FT                   /db_xref="GOA:A0A4P7MQY6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4P7MQY6"
FT                   /protein_id="QBZ17988.1"
FT                   /translation="MKKAFLCLSAIVLSLNFVWINPITGSASKIETTKETNQQVNLKNN
FT                   VTDIVTSEDLGGQTWLINEVNRQLAPKTVDVNLTFEDLAKITTISLNNRSLTGEVPPEI
FT                   KNLVSLQRLYLFSNKLSGEIPAELGELTKLTELRLDYNELSGKIPDGLGNISEIALQNN
FT                   RLVGQIPLSLYENRTGKNEVNVSGNQVTINSQQSEPSVYSAYTFVYPSSTPEYSGHIKA
FT                   NNSFISNLTNDMNLTPFLKNSPTFINLQVVYMFNSELFDGHDVTITDTNDGRVLYDGTL
FT                   TSDISIPLTNFKSGVHVINVMLDNAPNNPQNQTTFLIDILPVPAHDLTVNYVDEAGAEI
FT                   HEPQTVSGNVGDDYDVTTPEFELAIDKYELDTEQMPTNGLGTLSSEAQTVTYVYKKVNG
FT                   APVTVKYEDQNGVEITTSDVLTGKLDATYQSKAKEIAGFTLDNSKLPANASGIFETNPQ
FT                   TVTYVYQAVPATIKAHDSTIYVEDKWSAEDNFDSAVNSVGAAVSFDDLEVEGTVDTTKA
FT                   GVYPVTYSFAGESVTINVTVKAKDLPAPPVTPTKPVVPIQPTNPDQPDIQAAPGEHQAS
FT                   TDKSEALKVTVAQKEQPTVAGNLKLPTTGDNLWDSVLYSVFGLIAVCVAFSLFFWRKKQ
FT                   KHS"
FT   gene            763649..764158
FT                   /locus_tag="FORC68_0761"
FT   CDS_pept        763649..764158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0761"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="GOA:A0A1D2IXT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXT2"
FT                   /protein_id="QBZ17989.1"
FT                   /translation="MLNENIKAIRKSKGLSQEEIAIKLNVVRQTISKWEQGLSVPDSDM
FT                   LISISEVLETPVSTLLGETVMVSKVDDVKAISEKLEIINLQFAQRKTARRKMLYWLFVS
FT                   LCAVIAIISAVFIILNSPYLGWDYSDPETSVIGVAFHTFEWLFVRLAPIILIGGVVGIF
FT                   LTRKNV"
FT   gene            complement(764316..765320)
FT                   /locus_tag="FORC68_0762"
FT   CDS_pept        complement(764316..765320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0762"
FT                   /product="Transcriptional regulator of D-allose
FT                   utilization, LacI family"
FT                   /db_xref="GOA:G9G5L3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:G9G5L3"
FT                   /protein_id="QBZ17990.1"
FT                   /translation="MKKTSIKDIAKLSGVSVATVSRVINDNGRFSEETREKVLAVIKET
FT                   NYQMNFSAKSLRMNKSFSVGILVPDISNYFFSSVVQQIEAILFDQGYSTIICNTGRNLD
FT                   KEMAYLNMLESKMVDGLIVISGADEFGFKYTNAENGIPYVCIDRQPKDKKDTIFISSNH
FT                   YQGAFEATEALIHAGVKSPVIFMHSRQSSSAKERLKGFQDALKKNNIRYDPDVSKFTVD
FT                   LQIHDYQKSIITFVNEVTTMDGIFAINDNIALELLNLLPTIGKKIPNDIKVIGFDDTPQ
FT                   CNYTVPKLSSVKQNIPKIAQITVDNLITIIKNPKQKKRITEIVPVELSLKDSI"
FT   gene            765534..766205
FT                   /locus_tag="FORC68_0763"
FT   CDS_pept        765534..766205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0763"
FT                   /product="D-allulose-6-phosphate 3-epimerase"
FT                   /db_xref="GOA:A0A1D2INB4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2INB4"
FT                   /protein_id="QBZ17991.1"
FT                   /translation="MSKKLICPSMMCADFSGLEREVEELDKAGSDVFHVDIMDGAFVPS
FT                   FGMGLQDFEEIRQKTQKLVDVHLMIMNPGDYVEMFADKGADIIYIHPEADLHPARTLDK
FT                   IRNKGKKVGIAINPGTAIATIKELLPLVDNVMVMTVNPGFAGQKYLDYVDVKIAELVEL
FT                   KKDYTFEIMVDGAISPEKISKLSQLGVKGFVLGTSALFGKKESYAEIIKKLKQEKMEEL
FT                   R"
FT   gene            766202..766648
FT                   /locus_tag="FORC68_0764"
FT   CDS_pept        766202..766648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0764"
FT                   /product="D-allose-6-phosphate isomerase"
FT                   /db_xref="GOA:G9G5K4"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:G9G5K4"
FT                   /protein_id="QBZ17992.1"
FT                   /translation="MKIAIGNDHVGIELKPVIVAYLQDLGHEVDDFGAFSNERTDYPEY
FT                   GKKVAESVAAGKSDLGILICGSGVGISIAANKVNGIRAVVCSEPYSAKLSREHNNTNIL
FT                   AFGSRVVGAELAKMIVQNWLDAEFEGGRHAKRVEMIARIEDEND"
FT   gene            766661..767593
FT                   /locus_tag="FORC68_0765"
FT   CDS_pept        766661..767593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0765"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6X9"
FT                   /protein_id="QBZ17993.1"
FT                   /translation="MEQEVTRLISASKQDFEKMNGRDLKRSIFQSEGRVIMAQHLLFAS
FT                   QGLVRGVTNTELLAAFGSDMIMLNTFNLEDGKSNLGLQGLTLEDLKKRVNIPLGIYLGC
FT                   PGENKTSENIIYDAAGMLATDEHLLRAKEIGADFIVLGGNPGSGTSIQDIIETTKRARK
FT                   LLGNDVLIFAGKWEDGIDEKVLGDPLAKQDAKEVIKQLIDAGADVIDLPAPGSRHGISV
FT                   RMIQELVQFIHLYKPGTLAMTFLNSSVEGADQDTIRLIALMMKETGADIHAIGDGGFSG
FT                   CTTPENVMQLSISLKGKPYTYFRMASRNR"
FT   gene            767617..769470
FT                   /locus_tag="FORC68_0766"
FT   CDS_pept        767617..769470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0766"
FT                   /product="PTS system, D-allose-specific IIB component,IIC
FT                   component, IIA component"
FT                   /db_xref="GOA:A0A1C7PWP0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7PWP0"
FT                   /protein_id="QBZ17994.1"
FT                   /translation="MDYQKLAKEILANVGGEENVRSVVHCATRLRFKLVNKEKADKKQI
FT                   ESISGVISVVENAGQLQVIIGNTVGDVYKALGSFTKLTDDGDSEIAKGTKDSDGNFLSK
FT                   AIDVISGIFTPILGALAGGGMLKGLLMILTTFGWLTESSGTYQILYAAADSVFYFLPLI
FT                   LAYTAARKFGANPPVAIAAAGALVYPTMINLFNEGAHITFLQIPVVLMSYSFSVIPIIL
FT                   AVWFLSILERFLNSKIHEAAKTFLTPMICLMLIVPLTFLAFGPLGTFISQGLASGYTFI
FT                   YNLSPIVAGAFMGAFWQVLVIFGIHWGFVPIMINNLSRYGRDTMIAMVGPSNFAQAGAS
FT                   LGVFLKTKKPEVKAIAGSAALTGFFGITEPSIYGVTLKYKKPFVIASIAGAIGGAIVGA
FT                   AGSSGAANAIPGILTLPIFIGKGFVGFILGIAVAYILSAIGTYFFGYKDEMADGIAPTT
FT                   KEAKETGVEAEVIVSPIRGNIVPLNEVKDEAFSAGLLGKGVAIVPQEGKLISPVNGTIE
FT                   TAFPTGHAIGIRSDKGVEILLHVGFDTVQLNGKYFKLLVAQGDRVLVGQALLEFDLEAI
FT                   KADGYDITTPIVVTNTDAYLDVLISDQKTVNYEDTLLTPVL"
FT   gene            769490..770863
FT                   /locus_tag="FORC68_0767"
FT   CDS_pept        769490..770863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0767"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="GOA:A0A477W5I7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A477W5I7"
FT                   /protein_id="QBZ17995.1"
FT                   /translation="MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDM
FT                   PDESDFESFKTASDHYHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEF
FT                   YSNMLAELEKYNIEPVVTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRV
FT                   KYWVPFNEQNFISIDSEYMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGG
FT                   NIGNICPYPMTCKPEDVEASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFDQIILD
FT                   DDLTIIKSSEPDFMSLTYYMSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGF
FT                   KHYLQEFYHRYQLPILILENGMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCE
FT                   IIGYLTWSATDLYSTREGFEKRYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY"
FT   gene            complement(770877..771536)
FT                   /locus_tag="FORC68_0768"
FT   CDS_pept        complement(770877..771536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0768"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6Y6"
FT                   /protein_id="QBZ17996.1"
FT                   /translation="MPEKLDTVLGYLKEFPDYYKYVTKKTYTLNEKIIFEDEKAKSIFF
FT                   IVEGYAAVELEDNLRKTNYISIFVLPYNVLGIDAFSSYPKKKHSITVMSESLMLYKIDA
FT                   DFLLNILSIKPDVNDFLLTSIADVFARHYALLGMIAKTPKERIYMALENLAVEMGTEDE
FT                   EKNEIVLPNFINQSVLARYCRTTQPNISNLLTELVKEEFLINKKSPYRIDKDSLDI"
FT   gene            771800..772177
FT                   /locus_tag="FORC68_0769"
FT   CDS_pept        771800..772177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0769"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="GOA:A0A1D2IND9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IND9"
FT                   /protein_id="QBZ17997.1"
FT                   /translation="MKFDDSKPIYKQIVHYIHTEIVTGTYEAGDKLLSVRELATKLEVN
FT                   PTTIQRAYAELEETEIIYTVRGTGKYLTEDKRRIEQLENDIAKQLTENFISEMSKLGIN
FT                   KEKIIAWVKKVEEVEVNVSGK"
FT   gene            772161..772850
FT                   /locus_tag="FORC68_0770"
FT   CDS_pept        772161..772850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0770"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:A0A1D2IXH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXH0"
FT                   /protein_id="QBZ17998.1"
FT                   /translation="MLVGNNIAKSYPNKLVLQNVDFEAKSGDMIVLTGENGSGKTTLLD
FT                   MLASLKKPDSGTLELDNELFTTNDIRQQIAYLNNELYAKKSTTIEDFMKQHGLLFENIE
FT                   LDKWDRLLAGWRINKRLKLGELSTGMLMKVKIGSVLARKAKLYLYDEPFASIDIMARSE
FT                   VMKAIISETNPDAITIISSHHLEGTEKLYSKLWLIKDNTLQTIETETYREETGNALIDF
FT                   YKEEMNK"
FT   gene            772847..773551
FT                   /locus_tag="FORC68_0771"
FT   CDS_pept        772847..773551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0771"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="GOA:A0A1D2IXS2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXS2"
FT                   /protein_id="QBZ17999.1"
FT                   /translation="MTKMITFYLKQISPILLIGLAIILGLNFLGFTMNLLEGTDLLFRA
FT                   IRGTTVISLILVLITTWKITKLDTSKENVTLASLSRFSETKKFFGKLFAAYLSAITVIL
FT                   LQSAFIWYYGFETGRIEAGDALSFVSGTLMMFLFIAMFVCYFVIPVGWLKDHVKASSLQ
FT                   KAAVILLLFAILIVNLLAEYYLHIYNSAGIISILPNGHFDISLLSIIWNVGLCSVIAGS
FT                   YIYMKSKKMDTI"
FT   gene            773566..775566
FT                   /locus_tag="FORC68_0772"
FT   CDS_pept        773566..775566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0772"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="GOA:A0A470MW12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A470MW12"
FT                   /protein_id="QBZ18000.1"
FT                   /translation="MLEVKHLKKSYKLGKKNETPVLKDINVTIQDGEFAAIIGKSGSGK
FT                   STLLNIISGLDTDYEGKVLYNGEDLQDIDLDAYHFNHIGFIFQSFHLVNHMSVVENVKV
FT                   PLYLNPELSESDRNARALDLLKQVGLEDFASKKPTQLSGGQKQRVAIARSLANNPDMII
FT                   ADEPTGALDSVTSDEIIKLLKDLAAKGTTVIVVTHDLNIADQTDAVLRLADGEVISFER
FT                   KKEVVQKVTHKNEKKLRLNWWATAKISFKSFFNRKFRNLLVALGTSIGIIAILLAFGLG
FT                   NGVNQSLSKIFGTTFSPNQITTYYKEDGGSKSPEPTTPLTSSEIKKIKQLYEDENITEI
FT                   YERTTVQGIKFEYDGEYLKGISGEMQEANFKPSRYEDLTVKDEYLLSGKMVTSDETGAV
FT                   IPSNVAKAILGKKDSDELTKSDGDKLISKKITLVYAGRNSDTKNTVKIETTISGITNPS
FT                   KEGFARGFDVSTKTMNDFIKTTGIEKPILSVDAFTKTTAEAEEIVEKYEDNKDWANYSI
FT                   TNANAFVDTFSQFTDIIVYLIAFIAGLSLAVAGVMIAIVLYIGVVERTREIGVFRAIGY
FT                   RKRHIRGLFMMEASYIIILANVLSSLVAVTIAKIASPILETKIGFEDMIHISFWNFLVT
FT                   LAITITIGFIFSIYPSNKAAKLDAAEALRSE"
FT   gene            775595..776098
FT                   /locus_tag="FORC68_0773"
FT   CDS_pept        775595..776098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3A2WFV7"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A2WFV7"
FT                   /protein_id="QBZ18001.1"
FT                   /translation="MKKPLKISLIVVGIAVVIFAGVMLSYRFIKSMDVTENAEINKSAT
FT                   GDHVLLATQGSKFKDSVMDQVKKDMEGKNVHVSIIDTTKLDKVKADDYDKVVLFTTVQS
FT                   DDIPENVSTFMNDNKDKSIHIAVTADSGRWDDKPKDIDAISEASKAENKQDFVDDLTKA
FT                   IVAE"
FT   gene            complement(776249..776548)
FT                   /locus_tag="FORC68_0774"
FT   CDS_pept        complement(776249..776548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H6Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6Y4"
FT                   /protein_id="QBZ18002.1"
FT                   /translation="MKYCCISIIIIICYYFTNEKMKLDLGISTTIIVEEVKKNREDYST
FT                   LLNKLAEKELKGITTLRNFRLLVSSIFLIIVILLIAITYLAKKRQRITEDFIAN"
FT   gene            776612..776953
FT                   /locus_tag="FORC68_0775"
FT   CDS_pept        776612..776953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0775"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V1C385"
FT                   /protein_id="QBZ18003.1"
FT                   /translation="MYQSLSNIIINLQANKDLLLQQDNEVDRIKSILPLVVARNSIIET
FT                   LGRNPVWGISLTDDVNNLKIDNQLVTEVIPFDWNNETLYLCYFSDLESSNSPSEMGISF
FT                   QLVNIFSLS"
FT   gene            777060..777347
FT                   /locus_tag="FORC68_0776"
FT   CDS_pept        777060..777347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0776"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T1NQL9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T1NQL9"
FT                   /protein_id="QBZ18004.1"
FT                   /translation="MEMNASFIGLYAIIVYYLYGYLEKRERLEWLLLLPVLMALTITIT
FT                   NTIAYYENIVTNPVEQNIVSFIASFIILAVCLTIPVSIVLFFRKRKGEVQ"
FT   gene            777344..777550
FT                   /locus_tag="FORC68_0777"
FT   CDS_pept        777344..777550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0777"
FT                   /product="Transcriptional regulator, Cro/CI family"
FT                   /db_xref="GOA:A0A3A6YRS1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3A6YRS1"
FT                   /protein_id="QBZ18005.1"
FT                   /translation="MKNIKMKVARVEKDISQEELAKLIHVSRQTISSVEAGNYNPTLNL
FT                   CIAICKALGKTLDDLFWEEDDNV"
FT   gene            777543..778058
FT                   /locus_tag="FORC68_0778"
FT   CDS_pept        777543..778058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A3T2H6Z7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2H6Z7"
FT                   /protein_id="QBZ18006.1"
FT                   /translation="MFKNLFKKPKMKDEMLEMKQNQYGARAFNMMIIIIAIVILIKAVV
FT                   LEASISELWVELLLLIVGGGYYFYSVLKNNVPFMPTISLKQTIRLVFLISAIFGISVGI
FT                   RNVFFLYADNMSGTELSYQMMMFFFISLFTAIGSGVIFGALAYCLYQLSKWQEKNIMKK
FT                   IEVENAED"
FT   gene            778113..778409
FT                   /locus_tag="FORC68_0779"
FT   CDS_pept        778113..778409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0779"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A460M0J3"
FT                   /protein_id="QBZ18007.1"
FT                   /translation="MDIAKWFDNAELYSISQVLKENAARFEDDCIGIIFPCYNFAASRM
FT                   VCEFIERIQLFSQYIFVIVTYSNTALMCASTELYEHFLMSTYHLVGVFWKINP"
FT   gene            778505..779341
FT                   /locus_tag="FORC68_0780"
FT   CDS_pept        778505..779341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0780"
FT                   /product="Putative hydrolase/acyltransferase"
FT                   /db_xref="GOA:A0A2Z5C384"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2Z5C384"
FT                   /protein_id="QBZ18008.1"
FT                   /translation="MSVLNIEGAKLSYQKVGQGPILIFIPGANGTGDIFLPLAEQLKTS
FT                   FSVVMVDRRGYGDSELTAAIPERASHAYDDYRVTRDAADIAALAKALSDEPVYILGSSS
FT                   GSIVAMHVLKNHPEVVKKIAFHEPPINTFLPDSEMWQEANEKIVQTALTKNMAEAMQLF
FT                   GETLHIAPIDAESMSKPAVTIDEVTKDSTTQQMKYWFTYEIRQYTSSNISLDDFKPYVH
FT                   QITLLNGTDSKGSFPQDVNAFIAKQLGLTIVDIPGGHLGYIQKPAGFAKVLLSIWG"
FT   gene            779467..780147
FT                   /locus_tag="FORC68_0781"
FT   CDS_pept        779467..780147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0781"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="GOA:A0A3R0GYV5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3R0GYV5"
FT                   /protein_id="QBZ18009.1"
FT                   /translation="MNIRTELQNSQLCEGITEAQLTELMNKITVKEKHYKNNEILFYTD
FT                   EVTKVYILVKGNAAIAKNTSSGKRILGKNVTEPGELAGEIYYFSHRNPFWDYAIVLEPT
FT                   TVLEISGIDQGTLQTLDLALQNQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYL
FT                   FGIQDDDGSIELTETREEIADYLDITRPSLSRELGRMQKENIIRIEGSSVIILDAIIFD
FT                   TFIE"
FT   gene            780228..780839
FT                   /locus_tag="FORC68_0782"
FT   CDS_pept        780228..780839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0782"
FT                   /product="Bile acid 7-alpha dehydratase BaiE"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1D2IXG0"
FT                   /protein_id="QBZ18010.1"
FT                   /translation="MLLTRNEPFTAEKIQAKADILELVQFERFCRDNALWDAMETCFTK
FT                   DSNVKISWFQGTGHGFIEASKKMTNPAPHKIYNTQVWIKNDRAVAIMQATIQTRTIING
FT                   VEMELNSDAKLVTRVERIDGKWYINAFEGVYEKDSLMPVVPSKNADVPAELLANFRKSY
FT                   ACLALSLTLNGYEIDNNLPGIDRPEQVTQFFKEADEWLLQ"
FT   gene            780954..781775
FT                   /locus_tag="FORC68_0783"
FT   CDS_pept        780954..781775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0783"
FT                   /product="Lipase/Acylhydrolase"
FT                   /db_xref="GOA:A0A3T2I073"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A3T2I073"
FT                   /protein_id="QBZ18011.1"
FT                   /translation="MKKSKTVQILLVFSVVALILSMVGVVSIWYGQKNHQTNNAKTTAK
FT                   KETTVTKKQDTFKITALGDSLTYGVGDTEGGGYVRVVENFYKQKEKNVENVNLAISGAK
FT                   SDQLLKQLDQKEVQNQIKSADVILMTIGGNDLFRGGEALDDFKSDAIKQAEASYTSNLK
FT                   QIYQTIRNLNPSAPVFHIGLYNPFMSLENASEMSAVANEWNMQSQNLSQNEKNIIYVPT
FT                   FDLFQQNGDAYLATDKFHPNHAGYQFIGNRVTEVIETGGVEGNDGASTSSN"
FT   gene            781747..782652
FT                   /locus_tag="FORC68_0784"
FT   CDS_pept        781747..782652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0784"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:A0A458GM46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A458GM46"
FT                   /protein_id="QBZ18012.1"
FT                   /translation="MTERALQVTNLHKKIRKREIIKGISFEVMPGEVFGFLGPNGAGKT
FT                   TTIRMIVGLIKPTSGTILIGGKDIRKNFTEAMRGLGSIVENPEFYSFLTGQENLAYFAR
FT                   MDSSIKKERIQEVTELVGLEKRINDRVSTYSLGMRQRLGIAQALLSNPKLLILDEPTNG
FT                   LDPSGIHEMRDFIRALARNEGISVLVSSHLLSEIELLCDRVAIMTDGTIIKTDQVSHLL
FT                   SSRAQLRWLATPMEQAKAFLESVTEVEVDGEYLVTAVNEHSAEWNEQLVAKGIQVHEID
FT                   KKKPSLEDLFLELTGGHTID"
FT   gene            782645..783625
FT                   /locus_tag="FORC68_0785"
FT   CDS_pept        782645..783625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0785"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="GOA:A0A0B8RCV7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B8RCV7"
FT                   /protein_id="QBZ18013.1"
FT                   /translation="MINLVYNEQLKLWRKKRLIVILALVAIIVAIFTYAQFRQHQEDEK
FT                   QAGTSDWHVQTQQQIVDLENRLGTGRLPEEYQKYFKVLVGQLQYYLDNDINPNAPGAPT
FT                   FLKTFVENGISLLFPLFIMVIAADLISAETSAGTMKFLLTRPVKRWRILTSKYISMLLS
FT                   ISAIMVLSAVIAYLISGIVFGYGGWDAPVLTGFGMKDGAVTTTDVYQLPVWQLLLMEFG
FT                   LAWFVSVVVGVLTMFVSVLVRSTAAVMGIMLASLITGTILTNLVSSWPSAKYLFMVNLQ
FT                   LTNYLNGSSPPVEGMTLSFSMLVLTAWMLVAFILSYFIFTKRDVY"
FT   gene            783752..784639
FT                   /locus_tag="FORC68_0786"
FT   CDS_pept        783752..784639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FORC68_0786"
FT                   /product="Glycine