(data stored in ACNUC7421 zone)

EMBL: CR377818

ID   CR377818; SV 1; circular; genomic DNA; STD; PRO; 80033 BP.
XX
AC   CR377818;
XX
PR   Project:PRJNA13128;
XX
DT   30-APR-2004 (Rel. 79, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Photobacterium profundum SS9 plasmid 1
XX
KW   .
XX
OS   Photobacterium profundum
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Photobacterium.
OG   Plasmid pPBPR1
XX
RN   [1]
RA   Vezzi A., Campanaro S., D'Angelo M., Simonato F., Vitulo N., Lauro F.,
RA   Cestaro A., Malacrida G., Simionati B., Cannata N., Bartlett D., Valle G.;
RT   "Genome Analysis of Photobacterium profundum reveals the complexity of high
RT   pressure adaptations";
RL   Unpublished.
XX
RN   [2]
RA   Cestaro A.;
RT   ;
RL   Submitted (22-MAR-2004) to the INSDC.
RL   Cestaro A., CRIBI, Biotechnology Centre, University of Padova via U. Bassi
RL   58/B, 35131 Padova, Italy
XX
DR   MD5; 4779fe09ea57366202bab3e8d0a15b39.
DR   BioSample; SAMEA3138336.
DR   EuropePMC; PMC3033894; 21326607.
DR   EuropePMC; PMC6481104; 31093490.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   StrainInfo; 379911; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..80033
FT                   /organism="Photobacterium profundum"
FT                   /plasmid="pPBPR1"
FT                   /strain="ss9"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:74109"
FT   CDS_pept        317..709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0001"
FT                   /product="putative sex pilus assembly and synthesis protein
FT                   (TraY) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17939"
FT                   /db_xref="GOA:Q6LW96"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17939.1"
FT                   /translation="MLNRTYMQKSKSDTYPTSHVTCFLSSFANKLLEESIGRSKRSKKK
FT                   EAEIRLADHLDRYTLIPKSKCQYDSENIEYPSSHVTCFLAPTENELLDKTIVGLNPSKK
FT                   QEAAKRLTEHLIEFISISELGNATKR"
FT   CDS_pept        complement(917..1201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0002"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17940"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17940.1"
FT                   /translation="MGCIHSVGAIPIAVFTPSWTDDVWHSPYRREYCDLSDERLHRVLW
FT                   VILLHMTSSFYIYQNNLFGMYKSRAFFPTDTKHGYDMSPHLNFFFSLIL"
FT   CDS_pept        1503..1775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0003"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17941"
FT                   /db_xref="GOA:Q6LW94"
FT                   /db_xref="InterPro:IPR008873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17941.1"
FT                   /translation="MSTKLGVLIIATGVALAISQPALAADIFAGSKTVIKENADGDSGL
FT                   YMGMTVAGLGSAALGGFLTKNWGGAIGGFVTGMIFANTAMAIVGL"
FT   CDS_pept        2007..2654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0004"
FT                   /product="hypothetical sex pilus assembly and synthesis
FT                   protein (TraE)"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17942"
FT                   /db_xref="GOA:Q6LW93"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17942.1"
FT                   /translation="MHPIASARPSLPSRPARKNATGSTKAFTMLNNNKITILALSKALN
FT                   GLLLLFTIGLLFTVVILGGALATQINSKSRTLVPPIISRAFTISDGAVDSSYLQQMGEY
FT                   VTYLKLNMTPKNVERQYGQLLDYVDSEAWPNIQPTLMADAQQIIKENVSSRFDIDTVNV
FT                   SVPTLKVKLTGTLQKHVGSRALEPELASYIVDFAYEHGVISLLSIRKIKEST"
FT   CDS_pept        2651..3385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0005"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17943"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17943.1"
FT                   /translation="MNRWRWFAIIIAGCVSATAHAKNTPGTTYTFNDNDTVPVILSSVD
FT                   INRLVVKNDKITGIDCPAGFCVVSGTKTDTSGSARLKLNISVAFVAYVSTQKGRQFGMF
FT                   ITPQAIPGITSEFIGVQNTQHTPSVFEKKAPYTTQLAEFTAQMIRWTNTGEMMGGFSLH
FT                   PVDPKTVTNTLTARLAVIPDTIFVGNTFSGIRYKLKNNTTTTQTLTTAQFYSRAARSAA
FT                   LSTDQLAPNDTAWLYIVTGGRW"
FT   CDS_pept        3379..4848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0006"
FT                   /product="putative sex pilus assembly and synthesis protein
FT                   (TraB) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17944"
FT                   /db_xref="GOA:Q6LW91"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17944.1"
FT                   /translation="MVMNVLKWFKTDPEGDFEDGASLNTQNKQRNLIALASFTSVLLLL
FT                   IAAAVAYNKSAFSAATDKDESKPIDFGAVVDVEFTAKDNQSALSAQQVSVTRLEKTLAS
FT                   MEKTLKTQTASYDAFRAKIKSEQESVARGYQEQVAFMQDDFNTRLEALNTPGDSDIPSH
FT                   TTMTTQGRYLGQNTTGARQPPSSDGLAQDGRYDHDSQSLGVQGGIDHTALVWNTGPTDA
FT                   RKRTIENYVPSGTVVTAVITGGADANAGVNGQGDTTPIVFQTLDNGLLPNGKKSRLNNC
FT                   SITAAVYGEVSSSRGIARTDRMSCIFADDEIIDIPIQATVFNFGRNGIRGNTVIQNGKI
FT                   VQMAGISSLLTATGSAAKSLSETTSTSALGSTSSVNSGDILLNMLGEGGEGAGKTLADY
FT                   YIKLAEQYHPIIELNPGNVVNIVILKGFPLDAVGIEEYEAKLAQQQSTAPSPAAQIMET
FT                   ITNPLLSQLPAGTRPTPRQANLNTQPFGQPQ"
FT   CDS_pept        4860..5255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0007"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17945"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17945.1"
FT                   /translation="MRYFMLSLIALLLTGCSAGMKSNFSCEKIGGIEGCASMTDVRSAM
FT                   DRGEFSPQGHVIKGEASHAYLTPTPSFIPLPRRNREGAPLRTQEHVQKITIFPFTTPDG
FT                   YYIDTTDVYIADDSQWTGRPVQAIRKD"
FT   CDS_pept        5259..7847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0008"
FT                   /product="putative sex pilus assembly and synthesis protein
FT                   (TraC) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17946"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17946.1"
FT                   /translation="MRNAFSDLAGFVKSSKDSNYHIHRELPYRFYDDTTGIFENHHSLG
FT                   FGLSLSVLGGANDDLVSSLNAIICTLPEGDKWDYQFVLVGNNQVADLIKQNTQAMAIRG
FT                   GICEQFATNQGIYAQHSAQQGFSTRLNKAYHYDLKDYNACLFVSTTDSKMALQETKDML
FT                   AAELTQCGINHTPVTPVALMTHVREHLNFNRHQDRPLPATYNEFETINTQTLSPDSEYL
FT                   LNRTYVDTRHTPLDSDDAVRTRIVNLGLARLPNDFRLYGFSNCLASLKRTANSLQCPHR
FT                   ISVHFRVEPSGEQITKNDSKIQSLTKIVESKMRLLVPSAEEELKERKELQHGLMHQEYK
FT                   VATMVMTVSLYTTEEKARTHTTVATSTFREAGLNLVRTNMLQGQSTLSTLPFAMSEGYF
FT                   EDCKKAARTRTMKTSNVVNFLPIVAEYKNFSGGVMVPTMRHQISYFDPFNCGSDNYNIA
FT                   ITGGSGAGKSVFTQLIAQAIHARSGKVWILDKGSSYKKLTLMLGGTYMTHESIFLNPFT
FT                   HLDKIEEARDAGTFGDITDDDGNIVDPIALVLDNITGLIGSMASPREELETYQEAMLGD
FT                   AILIAWKKMGTQTRIDDVQDALYALAKEKNDDRRISDIAAQLNKYCSAGVYGDVFNKPS
FT                   QLDPTIHITTLELDGFADAVKRPVIFALMVAINQQMYLSGSRSTPKMCIIEEAWSMMGG
FT                   ANAQAREFINTGYRTVRKFGGSFCTVTQGIEDFFLNEEARAAFNNSDIHITLRQGEGFE
FT                   KFIKENPKHFSPYEQNMIKNFPRAQDAGHSCAMIKAGSYTSFHRIFADPWSRSMLSTEP
FT                   HEFEYCETLINQGTPLLDAIEKTAMHFNGEAMSEFAALLATYSARQESHP"
FT   CDS_pept        complement(7943..8359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0009"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17947.1"
FT                   /translation="MVLTIRRHFPVGEVRHLNWHLVRGSHHQRWSLYSVLPQPLSLVQG
FT                   CDQYSFFSLLVFLIRQHIHGLLRNGTGDIRCATNDGGAHNNHRVIVVAIRAQHGVQCCR
FT                   ETRNVPLLLGRVKITLLDIFLKSGQGGVHVHLHQ"
FT   CDS_pept        8406..9104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0010"
FT                   /product="hypothetical sex pilus assembly and synthesis
FT                   protein (TraW) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17948"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="InterPro:IPR025864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17948.1"
FT                   /translation="MCLMGKATQGQCITLFLLSFFCLPLPTDAKNLGVFGPVFPIGEID
FT                   MLDWIDNRLRTFEKNGEIDAMKQRMQARVKASVMRPSPVQGLSTTTAPKTYFIDPTLTL
FT                   AAPVKDSLGNELYPKGTRINPFDSTTWPAAEKQNLPRFTFSKQLVLFDGDDPQQRQWAQ
FT                   QYLAPLPVKWILTNGEPAALSRLLDSRVYFDQQGKLTREFQIKHVPVVISQSGTRWQVT
FT                   EVDVSPLKEK"
FT   CDS_pept        9108..10112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0011"
FT                   /product="putative sex pilus assembly and synthesis protein
FT                   (TraU) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17949"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17949.1"
FT                   /translation="MRRTLPWAYLLILFFTRPLYAGGSACTGTFVNPVTDICWSCIFPM
FT                   TIGSVPIVASVYPDTENPTMPISFCPKPPPVYMQIGLNIGYWEPYSLVDVTRKPYCMVN
FT                   MGMELNAGEMQQIGGRSTSRDNDSSDGGFYHAHWYKYPIVYWLQIIQSVACMSTDSFDV
FT                   SYMTEIDPMWDDDELAFILNPEAILFGNLIAQLACVPEAIMTSTNVALPIDALFWCLGS
FT                   QGSAYPLTGTTNYRDTPIQAGTLIMERLNFKLHREGIVWETRGADGAICYQWPEPILPK
FT                   SRYRYQMTNVIPDPLWCHPYTTTTALWEMGHDNPVTGDNFGFVNFRKRNCVFL"
FT   CDS_pept        10303..11007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0012"
FT                   /product="hypothetical conjugative transfer protein trbC
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17950"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17950.1"
FT                   /translation="MPLPLLSTTRSHRIAGLILLSALNCNLTAANTLGYSQTELKALQQ
FT                   REIAIQAPEHAPTLDLDALWQNAKQFETDMRTTQHDALSPILKQANIGDNPNSAAKGVI
FT                   IFASLTMPSTALKQLMMQSSDLQVPIIIRGVLPQGFPATVAAIQSLIHSEDDEVINSGM
FT                   AINPLWFKQLGIQRVPAFAVIKPGACLPQQPCQDSDFDVLVGNVSLYDALATLARDGDV
FT                   PNIAQQVLSRRK"
FT   CDS_pept        11009..12811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0013"
FT                   /product="conserved hypothetical protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17951"
FT                   /db_xref="GOA:Q6LW84"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17951.1"
FT                   /translation="MTGRVCTVIALMFIASTAIASQEQRYTDNVNWAKQSATVTQGQSG
FT                   FTAFSVNEYCKDTACQQQLSNPEQTRYRNDATAMDSAKAAAIATDDNAQAVQANFNAGR
FT                   PTIDPNDPAYSQAVGYMNDAYTISHGLVSQYHDCKKGQTCEFSESIKHCAQPTHTPYTC
FT                   DITPYVISKNEHTGSQRFPMSYPRSNAGNARVTSAGLQITLPAKVIVTRIELPPFGVQS
FT                   NTRSVSIDANGRPIKNATASPYWSDPWDMCGPIGSFCWSEVGAQTMNVSIDTSTLNLTI
FT                   RAADGRTGIHLMDKGTITVHWKTRTLNIGWKNSCGPTLPACSKTQEVCVEGGGSRWLHG
FT                   VYQYLPCWKKRQTYHCTYPDTCAALSTCVEQSRQCSKNTQGVCVQEKVTKKCTVQTCVD
FT                   TNLICGEQSFCLDGECYSPTREQNTEFNQAASSLAALADAAKGLGDPPLLFTGKAMTCS
FT                   KKPVGLSDCCKDSGWGSDVGLAQCNDEEKALMQAKEKKLTISLGQYCAEKVLGVCIRKK
FT                   KAYCTYDSKLARIVQEQGKPQLGMNFGSAKHPDCSAITPEQMQQMDFSNMDFSDFYSDL
FT                   HNNMTLPDNNQIQQRIKETLGGKQ"
FT   CDS_pept        12808..13599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0014"
FT                   /product="hypothetical sex pilus assembly and synthesis
FT                   protein (TraF) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17952"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17952.1"
FT                   /translation="MTLTPSLPFGALFFTTPLLVMAILTSPVTRAEQPPGWKWYNDPLL
FT                   IKEKALTPPPPTPSVTVTRTLSPTQQMQWFHRYHDDTKNDALINKDDVKKAEKLMLLNQ
FT                   FAYNMSSDFGMTFQKALLMNPDLSYTKDRPTEQAARSTYLQMEREKKIRAVRQLAGSGW
FT                   GLFFVYEGASPMAEKLAPSVQQFADAHGIEVLGISLDGTQLASIHQNRDNSNHIQVPFS
FT                   PALVLVNPNTQEMKPLAYGFIAQEDLLGRFLNVATDFAPDF"
FT   CDS_pept        13611..14051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0015"
FT                   /product="putative Thiol-disulfide isomerase
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17953"
FT                   /db_xref="GOA:Q6LW82"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17953.1"
FT                   /translation="MYRLLIVTLSLVLCWMQPVTASTDNQPHFKQDDYALVFFFRSDCS
FT                   YCHLFAPTLKQFEQQTGLTTYAFSLDNKGMTGFEVPIPVTKEIAETFFDNPRSITVPAT
FT                   FLINVNSRKFARMAQGQVSLHDLQTTYSQIRRDPAVIEALRP"
FT   CDS_pept        15384..18218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0016"
FT                   /product="putative sex pilus assembly and mating pair
FT                   (TraG) [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17954"
FT                   /db_xref="GOA:Q6LW81"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17954.1"
FT                   /translation="MLTYNLGVNRMTLAVYTYSNGDVAKEVFNAIATFFATNSFASMLQ
FT                   ICTFFAVIATGFHFFMTRDANAIPKWAAVYLMVPLLLINTKVGVQIIDLTDPTGNYAVA
FT                   NVPMIVAGPTYLSSTYMYGVTSSIESIFHSPDDEQYSKTGMVFGAKLYKLSRQSQLEDS
FT                   QLKGHWVHYLQSCIVGDITLNQKYTWQQLANTDDIFDFLTNHSPSPLRRIQMGPNDFPT
FT                   CKDALPRLKAGFTADAQKSLSLMAHKLYANKVATNQARFTAGLQGSYAKYAGISRTASQ
FT                   ITTQNMAINAIRNGLTDSAAVNGNTAAAFNYAYTQNKMQTTSMWTGMALQAREFLPMMQ
FT                   SILFLLFGCVSILVVALAMLPGMTKLVLSNYIKGFVYLGTWPILFAFINFIMTTRLSLS
FT                   SSAVANLYNGITLSNVDALAEMHSRYAAMTGMLMMSVPVIVGFIVKGGASVMSNMSHQL
FT                   AATMGSVNSRTSASAASGDINLGNGQVDNFSFNNMNGNKTDTSALQRTHGMTVQNDTGG
FT                   MTTTFAGGGQVLDGSNTISRGLGVDLNSREGVSRSLRSLASETLSQAEGHRSQYNESTD
FT                   KTFDQIVQLGQNTSKGLSYGDTASNKEGASAMKAASTMQSTVEEYAKVNNISHEQAESQ
FT                   LTSKWVGGSFSVGGSSPKLFGLGVSGSAEGGIRGTWDKRTSDTASNSESERESQALQKQ
FT                   FNESANVLKNYDLTDSSSETRTKTDTALSNIGDSLRDTESLGLTAHTEFSKSQSLNRQA
FT                   DKVEDVSNGVSFNLMPDFQSYMRQENPDHYEGIMYGSTESLREERAGYVRQFMNEPETQ
FT                   AKLERYTDDSLPQTEKELVNDFDQQTGELALTPAQRTAQQQQSEELQTRHDEGAELIIE
FT                   GKGVREYFDENKFNTIDREVHESINTTQETVTDNAVQHPSPEPAPQKDIEAVNDNVEPQ
FT                   SQPITHPAMGRGSR"
FT   CDS_pept        complement(18222..18701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0017"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17955"
FT                   /db_xref="GOA:Q6LW80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17955.1"
FT                   /translation="MLINHQVRVRFLMSDSDNTLLAAVAMRAKKNAIDQGDQEATAVSI
FT                   TAKVKALSEAGFSDGEIDKILAVDATPSATLQTEKTAATEEYNEQVDETINHAKVHTGL
FT                   MLVMGIGFITILFWPSSNVEDVFLPAMGWMLFCFAVMLLRTIPFAFKKAGYFLKR"
FT   CDS_pept        18779..19150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0018"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17956.1"
FT                   /translation="MSCVKRLFFITFLSLATPLHAASIQTHLDSINGPDPTVRAVAETY
FT                   LNGIVDASMYINALLGANNKPRAFCLPSKQPLNRQRLADIIADTYHNAPTDKQDPTLNT
FT                   GMIAIIGLTNTYPCKGDLQ"
FT   CDS_pept        19147..21252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0019"
FT                   /product="putative conjugative transfer protein (TraD)
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17957"
FT                   /db_xref="GOA:Q6LW78"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022585"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17957.1"
FT                   /translation="MSNQRPKNSNYTRGGQITFHNITMFFQINAKLVRWMGYGILLLTA
FT                   LLCFSFIDQDTLKGTYYYWRYSMVGKIKPDTHEVFTLWQGVTYKSTLGQQRLNPVFIDA
FT                   NRQFWLSLQLYLLASLISGLTVFSLAMRYFKKKGDEQTDDHFIRGIQIATPPELARILK
FT                   KANKQSDFALDGHKIFKQHFECQHLLFDGTTGSGKSVALRKFLRWIKNRGDKAIIYDKG
FT                   CTFVSKFYNPETDIILNAFDERCAYWDVWCDAKDATDFENMSAALIPMHGDGDPFWVQS
FT                   ARTIFTSTAYKMVNEPNRTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKTAISI
FT                   KSVLAAYIKSLRFLEGLDRKDDQGNLVRPRFSIREWVKNKDENGFLFLSSNAQQHASLR
FT                   PLLSMWLSIASTSILEQEEDHDRRIWVVMDEAPSLHKLPELAETIAEVRKFGGCYVIGI
FT                   QSFAQLKKIYGTNAALEMFDLLNTRFFFRSPSNEMAKISSQDLGEQEMDISKENYSYGA
FT                   HAMRDGISLGHQTITRPAVTPSEIMQLDDLQCWLRSPGDFPITKLDLKFDKMRSICPPF
FT                   IRREYASSETMQSIEHMLTYCQISALNLLSSDDQNKLMSVHTGQFDDDTERNAEEERMK
FT                   ATIDKAKAAKKKHVDKEKDTKNVKEKEAEKKVKALEQADGQAVTEQLFQEEQNINAMDH
FT                   DMVDFGE"
FT   CDS_pept        21670..22164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0020"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17958"
FT                   /db_xref="GOA:Q6LW97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17958.1"
FT                   /translation="MIQTYLRNGKNKQRHQHKPRRYRHQITDHGAPMSSYAMNEYLTEM
FT                   FFCMSRLALCYFSVLFVIITFISKKRTHIVQAIVLAGIAVYNSFSAIPVFTYLSLFIMT
FT                   LLFLRRSFDIVEAGNFFNLPAFKIILFMSTVIIAIWGIMGLGLLGFFIIYILRIDPMFS
FT                   L"
FT   CDS_pept        complement(22182..23342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0021"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17959"
FT                   /db_xref="GOA:Q6LWB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17959.1"
FT                   /translation="MGGEVWYVMTKIGMNKGLATAIAMALVTCVAVWFVLGGGAEKIAR
FT                   DEILKAEVNYASTLAYRLVRFDVENGIADRKAADRARANIGTYFRQVDGRCGRYRQARD
FT                   FLLCANRVLGEYFEYEGTADATNTYAMGHSDCDLNAFLVMDAAAMHGVETSVMYTPGHA
FT                   LVTWAGEEGKTYYLETTVSDNRGKLADIKDTFYVRTNDDTYYTPYDDEAAFVLYQAVVY
FT                   RQMADKGYIVGLFDALPDNTLVADSYYEYLMTHGRIGPDEIADITERLKTATTSETLSL
FT                   ILADWYLKLGDTDRALSVLGGLPPQFCTYDCIWLGIEAWADHLGYHEQGAQISDFYREY
FT                   LKDWKIFESRQRIRYLLVTGVIGVLVVVIFVSVFLRRRFARKSCQR"
FT   CDS_pept        23492..29434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0022"
FT                   /product="putative DNA helicase (TraI) [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17960"
FT                   /db_xref="GOA:Q6LWB7"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040668"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17960.1"
FT                   /translation="MLSISPLSQSAGDAASYYLTEEKHHDLPDVSLEVDTQSPEKETNY
FT                   YLKEHSDEPNTQWFGKIAEQEGMLGKPVEEKQLEAVLSGTLNGTTVHGKRENHRNGFDF
FT                   TFSAPKSVSTLALVGGDKRLITAHDDAVKFTLSHMEKDAAQAKYTDEQGKTAFANTGNL
FT                   LFAMVRHKTSREDEPQMHTHALTSNMTKDSEDTLRALASCFKQQGGVINGTNERIYNHQ
FT                   LYYGMLYQSYLSKQVESLGYGIHSVGKGQFEIEGVPEGYLQSQSTRSQQIDEHARSVGM
FT                   DSAAARDMAAKGTRKGKSYASDATLMEKWQGDAKASGFDIQAFVASSYARANSEAPSQS
FT                   LKPAAMDAAHRAINHQSQTRNQLGYEKLIESAATQFTQGEKLDVIDIKLAVDTLILQGH
FT                   LIGLNDSQSLFTTQTMIDNEQKLIASTQGQKRHLRTLVNTQSLEQQGLSADNQDKINTL
FT                   FASRKQTNIVNVFGQSQQIASALLHVGTESGQRIHIITPDTLSKQTTGAKVPREAFTAT
FT                   QWVKNLFRPEHTHTVQRLLHDKDTPYSNRDLFVVEAANKLGVNEVQGLIDKAKVSNSKL
FT                   IFLNHTHARQGMKAGRVMDTLKKGNVTEHSWVDTKDNSAQLFVHEKNDGERIDAIARAY
FT                   SDLTDTSQVQVLGTTQKDVQALNTTIRHTLQQRGDINRHGVTVRTLNPVFLSDAQREVV
FT                   SHYKKGMVLSEWQKVHGRNTKQDFTVTAINRKNNLLTLKDSKGKTQDINPNTREAKARQ
FT                   FSISRSDSIEIARGDKLRVNGNHFASKLTQHQTLTVSSSNALFINLKDNDGKYHLLATN
FT                   QLNDAPLSYNFAQPLSKADDTKAHTLIGMKSYAASKELLHDLNHGQASRLDVFTDSGEK
FT                   LDKHLEKSTIQPSAIHRVMQAHGDPEKFINSQTFDVLRQDVNATLHTLKDKALDKGLIE
FT                   SAVQYAIGTVSEKEAGFSQKQLVIEAIKYAFEEKGQAIKETEIVAHLKQAENNQQLLSA
FT                   EYHDGTRWTTHAAIATETRILERLAAGKNTVTPLATPAQANAFLDKHPRFTDGQKSAVH
FT                   LITTTADRFVAVQGLAGVGKSTMLESGIDLVKGIQAMNPEQTTFIGLAPTHAAVNELKA
FT                   KGVQSQTAQSLLTDFLSEKHTPGQFRNTVFLLDESSMTSNQQIDQFTELVNITGARAVK
FT                   LGDIYQLTSQEAGKPFELAITNNIIDSVTMKDMKRQQNDTLLGAVHNIVDRQGESALEK
FT                   LKQQAPLQDYQPLPATKNEQQADDQEQASINQSHNVISTYHNTGNPKKDQETATLALAT
FT                   TVALEYLSRTPQSRENTLIIAYTNQERDDISHIIRQGLQQQKHLSAQQYNVPRLRSVGA
FT                   TNIEMATMMPYKSGLILRTGKDNYAAITDVDRQHGVVTVADMKTGEERPFFPKNHDHTF
FT                   TQLWSQSEQPLAKEDSIMLRQTDKSRQWQGNKVYRVTDINNGKIQLESKDRHTLSLSTT
FT                   QMKDAHWDYAYTRTADMAQGSTYENVITTIKGKGILTNIRRAYIDITRASHHVKLITDN
FT                   TEKTMLSWVNNETNKPSALETRDKYYPEHKALFNDRPIPKDNPVYQDINGRLDIKTMGK
FT                   VINQQLPAYTESLATQLLGQPDTTKSGRDTLTFQQPKGELKITLTGQYRGHFKNWGTGE
FT                   NGTLISLIMNKEGLSYKAALFKADTLLSEPDKHQLTINPQHEQLKATVPLKQSQLEARA
FT                   QQYFNDGMPVTNTLAQTYLDTNPNRPFKDNDSIRYHPRVYSSETRSTHPALIAKLETPD
FT                   NQIKGISVTYLNDATGDISDLKINKRVLGTKSGNHIPINEGIQADYSILAVGIENALLI
FT                   NDNNPTNTDIIAVTNNNDCRTVNTDNLRENIIIVLNQENTEISQRLIDDITSKLERDGK
FT                   HATIIEPNDINNTPGSTLSDHIKTAINDITIKDNYIPDAITTLTNDINNAITPYINTPL
FT                   TETEKSTVRDIAINEHIEKQTNMILLEKETTLDTRTTQLEIDRELTR"
FT   CDS_pept        complement(29463..29849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0023"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17961.1"
FT                   /translation="MTEKVVMTKSKRVQVYIEDSELLKTLDLYMKQNPDKSQSEACGDL
FT                   MAIGARVWKHSQEDDGEQLTVMDMLEKLLRSSYSTQAFLHLSGNKNIKKVDDDNSEAFE
FT                   LKSIIEKANAISKDKVDELLGKEE"
FT   CDS_pept        complement(30909..31367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0024"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17962.1"
FT                   /translation="MISRCEVVMNTVSLINAMHTLRCSHRQVNGLLLAKKKINKQLTMS
FT                   RQYTALCERDKVQLRAMGFSQRVCDRVGDQRFYHYSDLQLLEESLNTATELPWSITLFN
FT                   GGAWINTRFNRLVPALVFHITSSGKYKLSLFSLNINRGDNSVIMDRYY"
FT   CDS_pept        complement(31938..32915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0025"
FT                   /product="putative antirestriction protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17963"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17963.1"
FT                   /translation="MTHSTVINSTITKQHQATSVSPLEQSGSNKNVSSKRKPRRVAKVA
FT                   KDMYQIVTDRIIQSLEKGVKPWVCPWDRTQECTLLPMNFKTKHQYSGVNILLLWSEIVE
FT                   KGYSSPYWLTYKQAAELGGNVIKGQKGTAIIFYKMLEKDNDKGEKDTIPMLKSFTVFNL
FT                   DQIENIDKPSVTVSEARTVQGDFVTLDHVEAAMVETGATISHLGVRAFYSPSHDAITLP
FT                   TKDRFASSNDYYATAMHELTHWSGHKSRLDRDLKNSFGSKDYAFEELVAELGAAFCCAD
FT                   LSVFGEVQHEDYIAGWLKKLNDDKRFIFKAASLASKAHAFLLNK"
FT   CDS_pept        33557..34747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0026"
FT                   /product="putative partitioning protein A [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17964"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17964.1"
FT                   /translation="MDNQETYKAFEALRQGAENYIVRRNNAYKKEVRYFTRIEASNYLS
FT                   VDGKTVDKYVKMAGIDPNRHEDAAWLIDINEMYQVRELLPLDKRIEHKFTRPKNHKLQV
FT                   IVVQNQKGGVGKTISAATIASGLATEFHEEFRVGVIDLDPQNTLSTYYAPIVEGEENQW
FT                   LSVGDLMAGKFEMEEDETFSNVVSESFLQTTIPNLRILPATQDDRSLENWFHRQLHNQS
FT                   LDKPYHLLKNIIDAVENEFDIIIIDTPPSMGFATINGYFAATSVIFPMQVAENDIDATC
FT                   NYFKFIPELWELIDDHGHTGYDFMKILLTNHKTSSSTTTLQNKLSNVFGSFIYSREFNN
FT                   SEAIKECSRLVSTLFDISKSEYPGRTKSVFQKAKDNAYEVTSQVYRNIVDVWDKDN"
FT   CDS_pept        34750..35835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0027"
FT                   /product="putative partitioning protein B"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17965"
FT                   /db_xref="GOA:Q6LWB2"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17965.1"
FT                   /translation="MARKKGSNNEGTFGQPINPQSQTKSALRTALDNVDNFSEEQRQQL
FT                   SSALGLQVESKPEVWELKSGAKATFTSVLLTRKQVEEETFVSFEVNGRDQELLTDESLK
FT                   SLSSMANQQFYPAIGRKINGKLEILDGSRRRATFLRTESIELFKVLLTDDDVSVGDAKA
FT                   LAKDLQTAEAHNLYEIGQRCLILKGQDEKVTQKEMAEQLGISQSSISRAIKAANIDKEL
FT                   IIFFPNANNLTRKDYELLEKVTHQFAGMPSAMSDFIIDVTNEHNQSNFELSVDEQHDEL
FT                   IKLITSKLADQKKAVKKDTGRKVLPIAEFTESGVFARKVKKNRFFGYEFGRIPNDVQDK
FT                   LDSAIQAIICEYQNTDSAKQD"
FT   CDS_pept        complement(36432..36779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0028"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17966"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17966.1"
FT                   /translation="MPFPPPTHGHEESSIGETLMDHLVSKPSATRIVALDRDFDRLHLE
FT                   KGDHLVIEQGRNPHDGCTAMMELDGDIFCAQLYWQKGQWYAATDDRRGIVTEDMLLLGV
FT                   ATRAIKNQIID"
FT   CDS_pept        complement(36895..37743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0029"
FT                   /product="putative Endonuclease I [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17967"
FT                   /db_xref="GOA:Q6LWB0"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17967.1"
FT                   /translation="MSVFYTANVCGFQKKMEMARVQHYRLEGSPSFTSHINKVRKSIVK
FT                   RILFIVGLLLAFNATAANLHIESFSKAKKTLEKNVYFDHRTTLYCGASFDTKKNITPPP
FT                   GFKSDKYVKRSKKVEWEHVVPAENFGRTFIEWRDGDTQCVNNKGKAYKGRRCANKASKE
FT                   YRLMQSDLYNLFPAIGSVNAARSNYNFTMLPAEPADFGSCQVKIDNRKAEPPIAARGRI
FT                   ARTYLYMEQSYSRYRMSKSQRQLMAAWDKQFPVSAWECKRAERIEKLQGNVNNVLKTRC
FT                   H"
FT   CDS_pept        complement(37791..38285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0030"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17968"
FT                   /db_xref="GOA:Q6LWA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17968.1"
FT                   /translation="MERNMTQRALEQDKWLHAGLMGFSAAFFLALFSAQGGVEESIMLH
FT                   LSVLLFSIALPLFTIFTILCMSLMNPNLPKGMFDTLQNSRWLFYARALSYASIYLAVMF
FT                   LIGHFTLLAMFTFFIISAAIWWKLRGLILPDLERLQQEKQDSGIKTSPVAQAVRQAIDE
FT                   R"
FT   CDS_pept        complement(38487..39068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0031"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17969"
FT                   /db_xref="InterPro:IPR021316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17969.1"
FT                   /translation="MSKEKYHQQLSDVIENSLLHLYGQVASNDRFVPLARRNDIVCKFL
FT                   KPKLKQPCYKSIKGDIKRMILVGQRKDGDLEAKLNELHSMSVDFQKKANDAQKLFDLLS
FT                   ILLSKHGFDSKIFDESAQAEPEVIYVLQDHLENCFEDNGTQIAPVSMLIESDRSLELIE
FT                   FINATQLFSAELKESDSNNQQSHILLHPVK"
FT   CDS_pept        complement(39908..40201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0032"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17970"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17970.1"
FT                   /translation="MPDGAFGVVFPVLTGLNRRLNQVGLFHQRVPRTHGAEPDGIYLTD
FT                   SACYVFPVLTGLNRGEISEINGTTCVPRTHGAEPLNQAVALRSLMCSPYSRG"
FT   CDS_pept        complement(43366..43674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0033"
FT                   /product="hypothetical inner membrane protein
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17971"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17971.1"
FT                   /translation="MSMCVVVTEAVPPRLRGRLAVWLLEIRAGVYVGDVSRRIREMIWF
FT                   QVDKLAEQGNVVMAWATNTESGFDFVTYGENARMPVDLEGLRLVKFTSQEIDKKPKN"
FT   CDS_pept        complement(43683..44603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0034"
FT                   /product="conserved hypothetical protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17972"
FT                   /db_xref="GOA:Q6LWA5"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17972.1"
FT                   /translation="MSFVPLKPIPIKDRNSMIFIGKGRIDVKDGAFVVIDEVNGERMHI
FT                   PVGSVVCIMLEPGTRISHAAVKLAATTGTLLIWVGEAGVRLYSVGQPGGARSDKLLYQA
FT                   KLALDETLRLKVVRKMFELRFGEPAPERRSVDQLRGIEGARVRKIYQMLAKQYGIEWHG
FT                   RRYDPKDWEKGDVINQCISAATSCLYGVTEAAILAAGYAPAIGFLHSGKPLSFVYDIAD
FT                   VIKFETVVPVAFLVASKKPNTPDRQVRIACREAFRKDRTLKRLIPLIEDILNAGEISPP
FT                   IPYEDAQPPALPEPESIGDEGHRTG"
FT   CDS_pept        complement(44619..46046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0035"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17973"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17973.1"
FT                   /translation="MSLKTILTSEHDYQLQYYFDETQLAMLQLLASLTTVLLKPTVVEL
FT                   KSYLQHGVTEQQYDEAIEKIATKWFEDDCFMQSTFPVEAKIADGPITKLISGIECGGSA
FT                   NALGLFSEVEQADAVCADCVHVLNYNLHMNIKGECFGPTGATGIRGGGAITTLVAGKNV
FT                   KTTVLANTVAIDFFETFANLDEGAESRYMWDLPPSGDVYFAQKIGLERGLFALAYHINF
FT                   PIEDKKCVCDVCGYSSEYTVTTFQRVKYTGSYGSTKNGRDAHAGWWLHPYTPRTEKEDG
FT                   TYAVCARNQHWQSWQELTAYVVGKEVEKASVKPALIIDQYRKLLIGRLDLLVGGNIADQ
FT                   GSILGRVYDLYSMPSSLSKNVGRISGVVDAGLEQKERLSISFNKLFGIGYDKKFVGGIK
FT                   EQAMQRFTANAQQIIQQILLDVDRKEAQALRQGAVEKLNQDAKKIFTAVQRKYQHDLPL
FT                   FKALVKGEHVLYQPSNK"
FT   CDS_pept        complement(46078..46740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0036"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17974"
FT                   /db_xref="GOA:Q6LWA3"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17974.1"
FT                   /translation="MDENNMHHVMKTLILKTEGLSAYGLQTFDVHRRVNHFPTRSAIVG
FT                   ILCAALGISRDEHAKIHELSTKLTIAVQVHHTGEKMMDYHTVENFRSPLGKIQKGTKPT
FT                   YREYWCDSEHSFAISADEQTIKLLIQAVKSPVFTIFQGRKCCPLTRPLLECVLEESNPS
FT                   DALKHLGEKGQIFSDIQGSNHVATLQVRDLITPVARKYAIRTVYVSGRSEGEACESA"
FT   CDS_pept        complement(46753..47778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0037"
FT                   /product="conserved hypothetical protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17975"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17975.1"
FT                   /translation="MTTFINIHTLISHSSSMMNRDDSGLQKTAVFGGTTRSRISSQCLK
FT                   RAIRQSDIYKESVAELSIRTNKMDELLTLCIEQLPEVETSVIEDVLLNMGSKVKKEKNK
FT                   ETGETSRYFDAVQPYSIGAIREAINMVQSGTELKALKKIVQIPTIDVALSGRMDASCPE
FT                   RNVEAAMSVAHSLTTHSADIEVDWFTACDDLATQGSGHIGTTEFSSGVFYRYASIDVDL
FT                   LAKNIGKSVEEVSDIINTMVRCFAQVTPSAKQKTFAAHNHADFVMVTQSNQPLSLANAF
FT                   RKPILNTGEVMEHSIESLVKHYEKLVEGYELDSKAIVFDMTDVAQSKRINVVNTISDIR
FT                   F"
FT   CDS_pept        complement(47819..48235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0038"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17976"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17976.1"
FT                   /translation="MYQQIYQAYCRLPKGDQADLKRCNLSKLADSSAYFRVLKFSGTND
FT                   NKQTQRILYLMVAIDLTQEEDGSSVAIALLKAGVNENQIQQIIRSGDNGIEYLKRQLVR
FT                   CKNIQLKSLGKLAQYWGENTRRQLLKEYILADQD"
FT   CDS_pept        complement(48251..48799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0039"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17977"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17977.1"
FT                   /translation="MMYISMVALSVIDTYEQHQAIWELFPNSSERKRDHLFRVENINTS
FT                   GQVMVLLQSASEPQSNVKATVLQSKLFDPQISQGEYYKFKLLANPTKCLSQGKKVIEIK
FT                   DENEQIQWLQRKLRGANVTVTALESVLVKSRKSFTSRFVCFEGILQVDKPDQIYSVLVM
FT                   GIGRKKHAGAGLLSLAKAS"
FT   CDS_pept        complement(48841..51318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0040"
FT                   /product="conserved hypothetical protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17978"
FT                   /db_xref="GOA:Q6LW99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17978.1"
FT                   /translation="MSRREVAYGFSKGLFMSSATYFKYWGKVEKDSEQADIGYHLLPYH
FT                   CLDVAAVADKWLTRSNVLLKQISAHIGKTEQEARSIVLFFVLLHDFGKFDARFQNFVES
FT                   IRIKLQGNEYEVESEAYSHGSFGYLHFRKVHGNNEAMKAVAGHHGYCDVSLDPFSPEAE
FT                   PDADDELIELDKHAREEWVKFCLEWTGLSQIPDVGEIPMLAGLCSVSDWIGSSITNFTQ
FT                   EPDLDLYQYYKQILPKADAALIESGMVQVLSGAGFEFLFNGYTPRGIQTLIEQIPQQPG
FT                   LTIVESDTGSGKTEFALAYASRLIENKLADGIVFGLPTQATANGLFDRIGDAAEKLFPD
FT                   STVTLAHGKSRYILKDKYLSPDENGFLHRSNKRAFLGSMSVATVDQILMGVLSIKHQFI
FT                   RSFGTRKSVLILDEIHSFDAYMYGLIEQVLKGQHQAFSSVILLSATLPNTQKNKLLRPY
FT                   GGSTQSDCYPLITHTSVEGETNEFTLTTGTVRKQIKAEKWCSATLLPNQQQQQQLLNWA
FT                   MKGAMVGVICNTVNDAQKLYLSLQEVLPKDQGPELDIDIFHARYTFADRAKIEKSVLNV
FT                   YGKNAPRKGRILIATQVVEQSLDLDFDVMVSQIAPIEFLMQRMGRLWRHDRVDSELAKR
FT                   TISVNEPVFITLIPSTKASDWKTHYQGSGFVYRNIRSLYRTEQYLHEHQVLTFPDCYRE
FT                   AIEYVHAEQMFAEEPEALESLFNEYQDSNSASSYVAKMNANLESKPLSDVDPRCALLTR
FT                   EGEMTVSVVLVDEHGKLLHGGDYQEQQDRELSTVSIAKKHVRGIQDADYYCVKATVGQD
FT                   IDYTELGVILPKN"
FT   CDS_pept        51581..51868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0041"
FT                   /product="unknown protein [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17979.1"
FT                   /translation="MVWGVLSQIAFFSQNPNLKSIENRWLKNEKTSKFAICDRTRHCLT
FT                   EYSISYEGLIKPLLGAALAFAKRSQDERSEMLERTRQVNPVLFDSVDSDD"
FT   CDS_pept        complement(51938..52891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0042"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17980"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17980.1"
FT                   /translation="MRTRIYIDGYNFYYGCLKGTPYKWLDLVKLFEEHIIPRSDVRNAT
FT                   LHDDVGIKYFTAEITNKAAADPNSVNDQRSYHHALYLHSENWLKTFKGSYAVDKVEYPK
FT                   VEHHEAGIEKEPKDCARVKVWKLEEKQSDVNVAIEAVYDAVMDHTLEQIIFVTNDTDIV
FT                   PALKKIREHNQKSLRSPIKIGLVVPSRENNEYRKPNKSLSNLADWTVKYIKNSELSESQ
FT                   LPCRIAGKKSSAIKPTSWFKHHQKVEEILEILTASDVLKTIPRAWRWLSEPKPEVKCLP
FT                   ILTSTPDQLLDCEKGIEDVLEHVKAFARYMREKNKN"
FT   CDS_pept        54028..56025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0043"
FT                   /product="putative exonuclease[Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17981"
FT                   /db_xref="GOA:Q6LWD3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17981.1"
FT                   /translation="MYIMKLSKVRISNFQCFDQSQTEIDFEEQLTALIGLNGSGKTSTL
FT                   QALSRMFGVSESARKIKVDDFHSPSVTVQRADELSIEAWFTFPEVESEADMIAVAGTFN
FT                   QLCFKSSGNEMMLRLKLEAKLTVDDISPDGVVDETVYYVLSDSDTYASDKCRELRRSDR
FT                   NNIQVHYIPASRNPFKEISSSTKMLLGRLLNAIQWDQSADGELQKALELTEQASEEISK
FT                   NSAIKLIEKQLQNSWQEMYSGDYLSKAKVNFLPLQTDELLKTITLSFESDTNNRKATMD
FT                   RLSDGQRSLLHIAIIQAVHELESKTLREQSNRVHFDSKKLNTPIFTLLALEEPENHLAP
FT                   HFLGRIVKSMSSLAKSTNAQVLVTTHSPSLVGRIEPTQIRYFRLDSTSRSTVVSKIQLP
FT                   DQQDELYKFVAGAVKAYPEIYFARLVILGEGQSEQIVIPKLLSKVGIDIDDSFVSVAPL
FT                   GGRHVNHFWKLLNGLGIPYVTLLDMDYGRNGGGWGRIKYVVDQMVMLGKSEIITGIPNW
FT                   DVSDSNPMTDTLSNSKNTAEGLLNQHGVFFSTPLDLDYSMQLSYPKNYNEKLTGENGPQ
FT                   DKDWESLKSAVLKTKYSKGIADYYYDEMQDEDAFLWYNYRFLGSKGKPVSHINALEKID
FT                   FNLAENISRIPTGIQEMIKHIENEISNLSE"
FT   CDS_pept        56032..57750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0044"
FT                   /product="putative helicase[Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17982"
FT                   /db_xref="GOA:Q6LWD2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17982.1"
FT                   /translation="MIDASVWEPKDGLKFDDKSLGIIKCDNNISIMAGPGAGKTEILAQ
FT                   KACFILETELCAWPYNVLSISRKRESASNIKNRVSLRCGNVLSERFHSFTIEAFTKSIV
FT                   DRFMHILPKHEQPNEDYKLVFNSRDSNFRDKLTFDQLTITALKIVNSSSTLMSSIRATY
FT                   KYVFIDEFQDLNGHQYDFVKSIFCGSQSVVTVVGDTKQAVMKFANALPDGFIKFKQDFK
FT                   ADLKIIYTNFRAAPELKQFIDCIGNEWWPINTESVESNIDSVALDKGDYSLLNFNDEEH
FT                   EVKQLSLKIKKWISEDGIKPKEIAILFRINTNNNYSKNLNIALLDLGVLSINESNIQDY
FT                   LSEPLGKVLVSLLCLLTRPRDIKAWECLRDSYLYCSSSNSLHNDFELTRILKLIGDTPF
FT                   YGDGDAKTFDSILDVTIEIMNEFFYENLKKTWTQYRQGTLMDETFHGVLEELKEARNIS
FT                   SSWSGAVDLISGVGAVRMMTIHKSKGLEFEAVVLLGLEDYSYFRYGMTQKKLDEERSTV
FT                   FVALSRAKSKLLISSAMSRKHTGPSKFMHVNSIINDLTKFGMNRSRVDKLDTLKI"
FT   CDS_pept        complement(57943..58239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0045"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17983"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17983.1"
FT                   /translation="MYIFNTAKGAITMASKAKTKLTITTISANLSAKGQNMKAGRLRAI
FT                   LKRLGLKNYKSNWGVLKIVKGAYRDAVKRGDLIAAYNIKHAFVRDNGRYAWKN"
FT   CDS_pept        58879..59142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0046"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17984.1"
FT                   /translation="MKRTPFEQLGGRNLSLLPWIQTVFVKHILIKSFIINFFKFKCPED
FT                   ICLLLLSFSSCPPQFQLKIQHTKYISHQIACFLSMFSVGNQC"
FT   CDS_pept        complement(59286..59594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0047"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17985.1"
FT                   /translation="MKTMLTVGDLNLGSYYLGRGRNGNVALWDGDVFLVACSVPQRRLT
FT                   DDGKIVYGPDRRAEMKREGHFDTEYGCFQPFVEINEGKGIPYQDERRSSLYCESLVV"
FT   CDS_pept        complement(59613..59972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0048"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17986.1"
FT                   /translation="MQNRELTYQPSPAFAQLAQEETAIKIWEFLCEGDNIIRAETATFL
FT                   KKPALEALGPILHSSFDVFNKDLVEKSVFDAHKKLSGNMMRQIMEHLGYVIDKTGVQVV
FT                   NKTIFKTATRYKKAD"
FT   CDS_pept        61198..61812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0049"
FT                   /product="gi|11344926|gb|AAG34553.1| putative cyclopropane
FT                   fatty acid synthase [Photobacterium profundum]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17987"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17987.1"
FT                   /translation="MNFLDRLNIYFYHKDRHKKWPSNPPKILGWRDEESQLSRFRIIAK
FT                   QHDFNHKSVLDLGCGYGDFKPYLDQNYDIAHYTGVDQLKAFVNAAKKRRLTASRFVHAD
FT                   FARQTLPKYDIVIACGSLNYRSSDPNYLTRMISKMHQAANEAVIFNLLNAETFPEDALL
FT                   KSYHSEHVLSYCRNLSADSYIVDQYATDDFTVVLKKSANSA"
FT   CDS_pept        complement(61899..62543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0050"
FT                   /product="putative transposase"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17988"
FT                   /db_xref="GOA:Q6LWC6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17988.1"
FT                   /translation="MSKFAICDRARFRKHERPDDKIAAIAIDSMGLKRFGKDEWHQEKH
FT                   KVNAKRSWRKAHFAVDEAHFIQSAVLTGKNTMDAQVVGTLCQFIITDVEHVSADKMYDT
FT                   NAVYQTLDAHFPDAEIVIPPKDNTFADEAHHPKRMSNLIGCFALGIIGWQSVRQYGKRN
FT                   ISETAMQRYKKIIGNTLHIRKIENQSKEMLLGCSVLNRFTKLGMPNSYRVA"
FT   CDS_pept        complement(63001..63306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0051"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17989"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17989.1"
FT                   /translation="MKNAVKKLNKKRSSSKNHRNTAKVKRNSLKPFLKVFSLERQAQCW
FT                   LLLSCLTGMLNVRIVVIESLKIMVMNFNKQGYVQSWQLCGFCCLLTLYDHARSAQI"
FT   CDS_pept        63869..64501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0052"
FT                   /product="Putative site-specific recombinase, resolvase
FT                   family [Photobacterium profundum]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17990"
FT                   /db_xref="GOA:Q6LWC4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17990.1"
FT                   /translation="MYIFGYLRASTNEQDAQRAKSSLKSFVEEKGRRVASWYWENVSGA
FT                   SLKRPELMRLLDDAAPGDAILIEQVDRLSRLNDEDWITLKALIQEKNLKIISLDLPTSH
FT                   TALSAHINDEFTNAMLRAINNMMLDMLAAIARKDYQDRRRRQKEGIEKAKNEGKFRGRQ
FT                   ADLNKHEQIYKLRVINGLSIADTAKLADVSYRTVIRVAQSYKANEPE"
FT   CDS_pept        64523..64918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0053"
FT                   /product="putative transposase [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17991"
FT                   /db_xref="GOA:Q6LWC3"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17991.1"
FT                   /translation="MEDAENQLPDLSRAIIADCYDHLLTLNQRIEDQENCFNMLVSRSH
FT                   NAKKIMKVAGIGPITATAVIASIGKGEQFDKGRDFAAWLGLVPSQYSTGGKPRLGRITK
FT                   RGDKYLRTLLVHGARAVIANLGAQPLV"
FT   CDS_pept        complement(65355..66380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0054"
FT                   /product="conserved protein of unknown functions
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17992"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17992.1"
FT                   /translation="MNTAQSKVALFIDADNASSSNLEFVLSELKNHGDTCIRKAFGNWK
FT                   RPNLQSWEKILCKNGIESVQQFDLTKNKNATDIAITISVMDFIHRKDLNVDTICLMTSD
FT                   CDFTPLVTRVRQSGFNVICAGENKTPAPLKESCTHFICTEKSETKITKENHNIEQSPPV
FT                   IDCDDIYSVMNYAVDLSKNEDEEYWYRLSDIDKNIKSIISNFSAEYQDIFIKNIYSSII
FT                   TKLQRKTISGVCYIECNNIKPKEAQPKAAQPKAAKPKAAKPKAAQPKAKNCEIKKLKGT
FT                   ISNLISKHKDSSGWVRVDVINNKLSINVKQLGYKSTIQLIKNMDFLQWKKTKNAELIKM
FT                   V"
FT   CDS_pept        66987..67478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0055"
FT                   /product="putative transposase [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17993"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17993.1"
FT                   /translation="MNIPLNYVRSYVAINKQGETLDFYFSHKRNKEAAYQFLKRCLRYY
FT                   DVDNQPKTLNTDKHSSYANAIARLKKEGRLRADVEQRQVKCLNNGIESDHAPIKKLVVA
FT                   TGGFKIRKRAWSTIQGFESLRMLNKGQFDFWLRHDERKTLVRERSAFMNRLFNVEVVYQ
FT                   "
FT   CDS_pept        complement(67811..68134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0056"
FT                   /product="Predicted orf"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LWC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17994.1"
FT                   /translation="MLLVEVNDERKQYCPFPNKGKKYPEQLIKLPSSGVVFDCISRGKT
FT                   LGTTRNEKERAWLYQKTRIVSSLSLSSVKKSSSEHWASTWLKLMGLDTMMVWKIQRLTL
FT                   KMK"
FT   CDS_pept        68271..70019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0057"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17995"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17995.1"
FT                   /translation="MSEKAYNLTELEDKLRPLFEAGIAYNLMLLDECIDLNKVNKLEDL
FT                   LHKLEPSSKPKVTEIINTIFEHKLPLKKNKILSKLEIDSSNEIFEHIEYIYSHFPSWHW
FT                   DLYQKKTRETINPKFLLSLYFKIRKIFDNSKQKKINPHIPHNLNEALNLLYRLNYALTI
FT                   NMVSVINSGYNNQTSLYECHILYNKHNTTRAKALRVSLANIKSNNPLSLVKHQPLKGKK
FT                   LPDWEKVLVTLSCLQSGMSNSEFLKAHLKSIPKMYWNSYIEPSILTHHRKHLAKCKNSL
FT                   KSFYYTQDLNTESSHKTNQDTAEMVVRTTIANLSKAYAIMINYSDFIIELTSFSHRILN
FT                   HLNNKHMIHYFLNKISSTDISTKHGYAELDDLINIDLKEFIRIEYQALSSLLSYNFPST
FT                   CWGYFIIDGFIPPPMKLLAEYVSIKEKCNKKFSSLKHEQIENFKEESIYESSSAMVNIL
FT                   RTVFQPILPSWIMLKTTPSFTVYDKDNLDMEVKLNLALTFEEGRFNINLDNPSFSFVKL
FT                   EELLIGLAYQYQNSIITPKLSMDKFMTTLDSCYKEPINNGKLKRGKKSAEEFLNHFNEG
FT                   DYSKGI"
FT   CDS_pept        complement(70380..71414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0058"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17996.1"
FT                   /translation="MTGDLNREILVGRDWANGTFKDKIFRFSSYTFPACKSCNDEFGIL
FT                   ERETKPVLIDVMSGNNVEERDLNTLLDWFDKIRTGLWLSDYVLNKNHNGINPHYFISDR
FT                   VARSDRALIIYKNDKDPDGVNFIGTDGPIFQTMPSVFGLKINNFYFISISAPLLVHKEL
FT                   GLSYPKLHEIDSETEISWYSFSDGTQKIAIPSFINRFPENGITLLQAIKLKDDKLTEGS
FT                   GLLYDSEHDRRIFNFDNENRRSIFISGKDITKYPKESTRLTIKDVNYPVMFNLQLGLHL
FT                   MECQEDMFKTNIIYDNITGGKSEKVKNHLDYITNAHGVLKGVYKIQLRHLFSGVLKDLT
FT                   MRIK"
FT   CDS_pept        complement(71507..72244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0059"
FT                   /product="putative transposase [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17997"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17997.1"
FT                   /translation="MTNPEFKWKHFAPEIILWCLRWYGSTPMSYANLSDMLAERGISVN
FT                   RSTIYRWYIEYAPTLRKKLRRHQFIRTDSSWQLDETYVKVKGKWHYLYRAINKQGETLD
FT                   FYFSHKRNKEAAYQFLRRCLRYYDLDNQPKTLNTDKHSSYANAIARLKKEGRLRADVEQ
FT                   RQVKYLNNGIESDHAPIKKLVVATGGFKIRKRAWSTIQGFESFRMLNKGQFDFWLRHDE
FT                   RETLVRERSAFMNRLFNVEVVYQ"
FT   CDS_pept        72364..72777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0060"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17998"
FT                   /db_xref="GOA:Q6LW74"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17998.1"
FT                   /translation="MNMEVRVANRIKLGIAFFLISFLPSSIIVYAQYMILGFNCDSKFG
FT                   CSGSFTIMVMAIAYLSLLSALAVFLSDFIRVYKRGCGLSGSGKVIVLIFGFILGLSINL
FT                   VFYFLGDLTLKYLVILYFLVPFTFSYLVSFWKN"
FT   CDS_pept        73628..74278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0061"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAG17999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG17999.1"
FT                   /translation="MNIFEFWREVTEDKSGRYIHHEDESVLSELSHLVGDDLDFSFPPG
FT                   PIFGPLKTAKIVLCYANPGIDDLSLDTIRRPEFQTELFDQLAGINNYPHHLSGWKEWFN
FT                   QRANSLFDGDIELAGKHISVFNLIPYASVNMDKVEKVANCLPSVWVAQNYLRSVLIPKA
FT                   KSGDILLIMCRSGHLWGLKSAHGCDNILINNVRSGFSQDVKNKVKEWCHRQGI"
FT   CDS_pept        74859..75119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0062"
FT                   /product="conserved hypothetical protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18000"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18000.1"
FT                   /translation="MQSLTANTAKTKFGDLLMKVQREPVQICKNGSPVAVVMSCEEYAQ
FT                   LEALKLQFIKMRFAAAEKDIAENNLVDGETFFNQLEQDMLD"
FT   CDS_pept        75119..75421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0063"
FT                   /product="stabilization protein ParE, putative
FT                   [Photobacterium profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18001"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18001.1"
FT                   /translation="MSKYVLSTGAQTDLIDIRQYTLDKWGQVQWKGYFAELKSTMILLA
FT                   ENPAIGAKTLDLGDNYFRFPLKHHVIYYIQQPTQIVIVAVLGKSMSPQKHFEIIN"
FT   CDS_pept        75589..76602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0064"
FT                   /product="hypothetical KrfA protein [Photobacterium
FT                   profundum SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18002"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18002.1"
FT                   /translation="MSILAGRRWMVAAKVTVENVFTTANRIVEQGEKPTVLKVHKALGV
FT                   GSYSTIQKHLKVWEESDAGQVAMKAALPEEIILPNNAQDAMGDAMKIIWSAAQKAANSL
FT                   IEKHQLTIQSDHEEQEAIVREVLSKVDVAEQRLKETEARVRQLESERDASIDERATLRQ
FT                   QLDVSQLELSREQSTNKEKINQHAVEVASLNAQVDELKQALTQSNDNLSSSQHNLIAEL
FT                   AKHDESKQQLASVSAELKASERLLGNFESQISELKVSNREYSDNVSETRHALTDARVSE
FT                   SALGAELKDARNVIDELKVQLSESQQGFNNLKNDNIKLRNVLDGEIGRYLQGLSKK"
FT   CDS_pept        77016..77291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0065"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18003.1"
FT                   /translation="MLFPLRTRIIASGQRDNIRRLNSFSSFGNPLSGRPVLFTINSMFI
FT                   QHLETITVYNYSDYIHSMFKSNCLTSHINRLKIIHLSCYIVTVHLI"
FT   CDS_pept        complement(77981..78874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0066"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18004.1"
FT                   /translation="MLCVIMLRMCVMTFAEPSTSIPPSPPVAPNKGEYDAEYRAKRKLR
FT                   KQTLIELHHDVVERENQKLQAQDKTANFAIGFRARRLLRNGEVETLPQEFARILKGCEE
FT                   FIENPNRFPSLRAWCDATNNVQSRRLIAKVLACILPNTDLIGGRVGVPTEAGIRTISYD
FT                   QLQEDYALRFGEFISPNSFKKAIQHLGHAGYFHSERINVCVDKKGGTVRSAAAFKQFTE
FT                   RFFSDLKVVRYSNICQMIIATRERQKKKGLRFFWVARRLLMEGVQQIFNASILDDYADT
FT                   TSTVFSAYQHPQQVPL"
FT   CDS_pept        79373..79657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PBPRC0067"
FT                   /product="hypothetical protein [Photobacterium profundum
FT                   SS9]"
FT                   /note="predicted by orpheus program"
FT                   /note="predicted by glimmer program"
FT                   /db_xref="EnsemblGenomes-Gn:PBPRC0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAG18005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LW67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAG18005.1"
FT                   /translation="MKKAVDELEHELNESRLFAKQMDNSQVLVIDYIYFWYGDKHGAKA
FT                   KFARDQGVSSQQVNSWLKKKCYIENKQIKHPDPNPIDLIKPSWIKSYFI"
XX
SQ   Sequence 80033 BP; 23425 A; 18714 C; 16522 G; 21372 T; 0 other;
     gagcgaacta taaagtttca tgtgaataat tgcgtaacaa aacttgatgg aaataatgta        60
     tacgaattaa aaatgattta taacgccaga ttactaacac atttattact aacttgtttg       120
     cgtgattaac ttcacaaaat cgcaactacg cacatatttt catacacgta tgtataaata       180
     gccagtcaat tgtaagtgat taatatacat acagaaaaat aatacaccta tcacaccccc       240
     tcataaaagt aacctgtcct ttaaggacag gttacttttt ttttctatct gataatttac       300
     cagctacctt tacaccttgt tgaatagaac atatatgcaa aaatcaaaat ctgataccta       360
     tccgacatca catgtgactt gttttttatc ttctttcgca aataaattac ttgaagaatc       420
     aataggacgc tcaaagcgtt caaaaaaaaa agaagctgaa atcagactgg cagaccattt       480
     agacagatac acattaatac caaaatctaa gtgccagtac gatagtgaaa atattgaata       540
     tccatcatca catgtgactt gttttttagc accaacagaa aacgaattac tagataaaac       600
     aattgtcggt ttaaatccct caaaaaaaca agaggcagca aaaagactaa ccgaacactt       660
     aattgaattt atatcaattt cagaattggg taacgcgaca aaacgttaaa aatacagatt       720
     tactcaatta ttgcacttac gtgtagggct tcactttgcc tgaatttagg ttcgaataag       780
     ttgctctttc acaacttggg aaccagtttg ttatcgtgct gaaagacgat aataaatcta       840
     tacgtaatag gatactcgat ttgaatttac ttcaatggct gaactttaac gtattggacg       900
     gtgaatttcg tgccgcctat aaaattaacg aaaagaaaaa atttagatgt ggagacatat       960
     catacccgtg cttggtatcc gtcgggaaaa atgcacgact tttatacata ccaaaaaggt      1020
     tattttggta tatataaaac gaggaagtca tatgtaataa aattacccac agtaccctat      1080
     ggagacgctc atctgaaagg tcgcagtatt cacgacgata aggcgagtgc cacacatcat      1140
     cagtccatga cggcgtaaaa acagctatcg gtattgcgcc aacagaatga atacacccca      1200
     tgacgttacc ctaaccacta atgaatcatg cgatagcgca tcctatcatt acctgtgcgg      1260
     cacaggtatc aacgccgcaa cctaatcatt attgacacac ttgtgtcgcc ctttatctcg      1320
     ataaagggcg ttttttcata agcaaagaga catcctcacg catttcgcat gcgaaatcag      1380
     tgactcccct tattcaccgt taatcacacc cagccctttt gcgctaggcg actgactgtt      1440
     cccgtcagtc tgaatgtgtc tggaaaccac acgtaatatt tcaactataa aaaggaaaaa      1500
     acatgtcaac gaaactaggt gtactcatca ttgctaccgg ggtagccctg gccatcagcc      1560
     aacccgccct cgcagccgat atctttgctg gttcaaaaac ggtcatcaaa gaaaatgcgg      1620
     acggtgattc tgggctttac atgggcatga ccgttgccgg tctgggctcc gcagccctcg      1680
     ggggcttcct cactaaaaac tggggcgggg ccatcggcgg gttcgtcacg gggatgattt      1740
     tcgccaatac cgcaatggct atcgtagggc tctaaccatg gataaccccg cactcttttt      1800
     cagtatcccc aaacaactct caaaaggaaa aaccttcctc ggcttcccga gcgatgaagt      1860
     gcttccggcg ttggttattt ttgggggctt tctggcgggg cggcatgaag cggtggggtt      1920
     cctcctcgcc gctgtttggt tcctcgggct gcattccatc aagaaaaccc atggcgataa      1980
     tttcattcgc ctgaccctct actggtatgc acccgatagc ctcagcacgc ccctctttgc      2040
     catcacgccc agcgcggaaa aacgctactg gatccactaa ggcattcacc atgctcaata      2100
     acaacaagat cactatcctc gcactatcaa aagcccttaa tgggttgtta ttgctgttca      2160
     ccatcgggct tttgttcact gtcgttattc tggggggcgc attggccacc cagatcaaca      2220
     gcaaaagccg gacactggtg ccccctatca tcagtcgggc atttaccatt tctgacggcg      2280
     cggtagacag cagctatcta cagcaaatgg gcgaatacgt cacttactta aaactcaaca      2340
     tgacccccaa gaatgtcgag cggcaatacg gccagctatt ggattacgtc gatagtgaag      2400
     cctggcccaa catacaaccc accttgatgg ccgatgccca gcaaatcatc aaagaaaatg      2460
     tcagcagtcg attcgatata gacacggtga acgtgtcggt cccgaccttg aaagtcaagc      2520
     tcacgggcac cttgcaaaaa cacgttggct ctcgggcact ggagccagag ctcgccagct      2580
     acatcgtgga tttcgcctat gaacacgggg ttatttcatt gctgtccatc cgaaaaatta      2640
     aggagtcaac atgaacagat ggcgatggtt cgcgatcatc atagcagggt gtgtgagtgc      2700
     cacggcacac gctaaaaaca cccccggcac cacttatacc tttaatgaca atgataccgt      2760
     cccggttatc ctctccagtg ttgatatcaa ccgtttggtg gtgaaaaacg acaagatcac      2820
     cggcattgac tgcccggcag gattttgtgt cgtctcgggc accaagacgg acacttcggg      2880
     ctctgcccga ctcaaactca atatttccgt ggcgttcgtc gcctatgtca gcactcaaaa      2940
     aggccgacaa tttgggatgt tcattacccc ccaagccatt ccggggatca cctctgaatt      3000
     tatcggggtg caaaataccc agcacacccc gtcggtgttt gagaaaaaag ccccctacac      3060
     cacccaactg gcagaattta ccgcgcaaat gatccgctgg acgaatacag gggaaatgat      3120
     gggcggattc agcctgcacc ccgtggatcc caagacggtc acgaacacat taacagcgcg      3180
     tttggccgtg atccccgata ccattttcgt cggcaacacc ttctcgggca ttcgttacaa      3240
     actgaaaaat aacaccacga ccacccaaac attgaccact gcccaatttt attcccgtgc      3300
     agcccgctca gccgcgttat caaccgacca gctggccccg aacgacacgg cctggttgta      3360
     cattgtgacg ggaggacggt ggtgatgaat gtattaaaat ggtttaaaac cgatcccgag      3420
     ggggattttg aagacggggc aagcctcaat acccaaaaca agcagcgtaa cctgattgct      3480
     ttggcctcat tcacttctgt ccttctgctt cttattgcag cggcggtggc ctacaacaaa      3540
     tccgcattca gtgctgccac tgataaggat gaaagcaagc cgattgattt cggggccgtg      3600
     gttgatgtcg agttcaccgc caaagataac caatcggcct tatcggcaca gcaagtgagc      3660
     gttacccgac tggaaaagac attggccagc atggaaaaaa ccttgaagac gcaaaccgcc      3720
     agctatgacg cgtttagggc caaaataaaa agtgaacaag aatctgttgc gagagggtat      3780
     caagaacaag tggcgttcat gcaagacgac ttcaatactc gccttgaagc cctaaacacc      3840
     cccggcgaca gtgatattcc gtcccacact accatgacga cacaggggcg gtatttgggc      3900
     caaaacacca ccggcgcaag gcagccccct agctcagatg gattagccca agacggacgt      3960
     tatgaccatg acagtcagag cttgggcgtg caaggtggca tagaccacac cgccctggtg      4020
     tggaataccg gccccactga tgcccgtaaa cgcaccattg agaactatgt cccctccggc      4080
     accgtggtaa cggccgtcat caccggcggc gccgatgcca atgcaggggt taatggtcaa      4140
     ggtgatacta cgccgattgt tttccaaacc ttggataatg gcctgctacc caacggaaaa      4200
     aaatcccgac tcaacaactg ctctattacc gccgccgtgt acggtgaagt ctcgtccagc      4260
     cgaggcattg cccgaacgga cagaatgagc tgtatctttg ccgacgatga gatcatcgac      4320
     attcctattc aagcaacggt ctttaatttc gggcgaaatg gcattcgcgg aaacaccgtg      4380
     attcaaaatg gaaaaatcgt gcaaatggcc gggatctcta gcctattgac ggctactggc      4440
     tctgccgcaa agtccctgtc agaaacgact tccacctcgg cattgggctc aaccagctcc      4500
     gtcaatagcg gtgacatttt gctcaatatg ctgggtgaag ggggggaagg agcaggtaaa      4560
     accttggccg attactacat caaactggct gagcaatatc accccatcat tgagctgaac      4620
     cccggcaacg tggtcaatat cgtgatcctc aaaggctttc cccttgatgc agttgggatt      4680
     gaagaatacg aagctaaact tgcccagcaa caaagtactg ccccctcccc ggcggcgcaa      4740
     attatggaaa ccatcaccaa tccactattg agccagctac cagcgggcac ccgaccgaca      4800
     ccgagacagg ctaacctcaa cacccaacct tttgggcaac cacaataagg aacttaccca      4860
     tgcgctactt catgttatct ctgatcgcac tgctgctcac gggctgctct gcggggatga      4920
     aaagcaattt ttcgtgtgaa aaaataggcg ggattgaggg ctgtgcatcc atgaccgatg      4980
     tgcgcagtgc catggaccga ggggaatttt caccccaagg gcacgttatc aagggggaag      5040
     cctcccacgc ctatttaacg ccgacgccca gctttattcc tctgcctcgc cgtaatcgag      5100
     aaggtgcccc cttgcgcaca caagaacacg ttcaaaaaat aacgattttt ccctttacca      5160
     cccccgacgg gtattacatc gataccaccg atgtgtatat cgccgatgat agccagtgga      5220
     cgggccgccc tgttcaagcc atacgtaagg attaaaccat gagaaatgcg ttctctgatt      5280
     tggcggggtt cgtcaaatcc agtaaagaca gcaactatca tattcaccga gagttgccct      5340
     accgttttta tgatgacacg acaggcatct tcgaaaacca tcacagcctc ggttttggtt      5400
     tgtcgctttc ggtccttggc ggggccaatg acgatttggt gtcatcattg aacgccatca      5460
     tctgtacctt gcccgaaggg gataagtggg attatcagtt tgtgttggtc ggcaataacc      5520
     aggtggccga tttgattaaa caaaatacac aagccatggc catccgtggg gggatctgtg      5580
     agcagtttgc caccaaccag gggatttatg cccagcacag tgcccagcag ggattcagta      5640
     cccggcttaa taaagcctat cactacgatt taaaagatta caacgcctgc ttgtttgtct      5700
     cgaccaccga tagcaagatg gctttacaag aaaccaaaga catgttggcc gccgagctga      5760
     cccaatgtgg catcaaccat accccggtca cgccagtggc attgatgacc catgtacgtg      5820
     aacacctcaa cttcaatcgg catcaggacc gccctctgcc tgccacgtac aatgaatttg      5880
     agaccatcaa tacccaaaca ttgagccctg acagcgaata cctgctgaat cgcacctatg      5940
     tggatacgcg tcataccccg ttagacagtg atgacgcggt gcgtactcgt atcgttaacc      6000
     ttgggctggc tcgattaccc aatgactttc gtttatacgg gttttcaaac tgtttggcct      6060
     cactgaaacg caccgccaac agcttgcaat gcccccaccg gatcagcgtc cattttcggg      6120
     ttgagccctc tggggagcaa attacaaaaa atgacagtaa aatccaatcc ctaaccaaga      6180
     ttgtcgaatc caaaatgcgc ttgctggtcc cctctgccga ggaagagctc aaagagcgca      6240
     aagaactgca acatgggttg atgcaccaag aatacaaggt ggccaccatg gtcatgaccg      6300
     tcagtctcta taccaccgaa gaaaaagccc ggacccatac cacggtggcc acctcaacgt      6360
     ttcgtgaagc ggggctgaat ctagtacgga ccaatatgct gcaagggcaa agtaccctgt      6420
     ctaccctgcc gtttgccatg agtgaagggt atttcgagga ctgcaagaaa gccgctcgca      6480
     cccgcaccat gaaaacatcc aacgtcgtca atttcctgcc gatagtcgcg gaatacaaaa      6540
     acttttccgg tggggtcatg gtgccgacca tgcgccatca aatcagctat tttgatccct      6600
     tcaactgtgg cagtgacaac tacaacattg ccattacggg cgggtcgggg gccggaaaat      6660
     ccgtgttcac ccaattgatc gcccaggcta tccatgcccg gtcgggtaaa gtgtggattt      6720
     tggataaagg atcaagttac aaaaagctca ccttgatgct tgggggtacc tacatgaccc      6780
     atgaaagtat cttcctcaac ccgtttaccc atttggataa aatcgaagaa gcccgcgatg      6840
     cgggcacctt cggtgacatc accgatgacg atggcaatat tgttgatccg atagccttgg      6900
     tgcttgacaa catcaccggg ctcatcggct ccatggcatc cccccgtgaa gagctcgaaa      6960
     cctatcagga ggcgatgctc ggggacgcca ttttaatcgc gtggaaaaaa atggggaccc      7020
     aaacacgcat tgatgatgtg caagatgcgt tatacgcgct ggccaaagaa aaaaatgatg      7080
     accgtcgtat cagtgatatt gcggcccagc tcaataaata ttgcagcgca ggggtgtacg      7140
     gcgatgtatt taacaaaccg tcgcaattgg atccaacgat ccacatcacc acgttggaat      7200
     tggatgggtt tgccgatgcc gtcaaacgcc cggttatttt tgcccttatg gtcgcgatta      7260
     accagcagat gtacctgtcc ggcagtcgct ccaccccgaa gatgtgcatc attgaagaag      7320
     cctggtcaat gatgggcggg gccaacgccc aagcccggga gtttatcaat accgggtatc      7380
     ggacggtacg aaaattcggt ggcagttttt gtaccgtcac gcaggggatt gaagatttct      7440
     tcctcaatga agaagcccgc gccgccttta acaactccga tattcacatc accttgcgac      7500
     aaggtgaagg gtttgaaaag ttcatcaagg aaaaccccaa gcactttagt ccctatgagc      7560
     aaaacatgat caagaacttc ccccgcgcac aggatgcagg tcattcttgc gccatgataa      7620
     aagcaggatc gtatacctct tttcaccgta tttttgccga tccgtggtca cgctccatgt      7680
     tatccactga gccacatgaa tttgaatatt gtgaaacctt gatcaaccaa ggtaccccgt      7740
     tgctcgatgc catcgaaaaa acggccatgc actttaacgg cgaggcaatg tctgagttcg      7800
     ccgcactctt agcgacctat tctgcccgtc aggagagcca cccatgaccc cattacgtac      7860
     catcacccta agcgtgacgc tgtcactgtt tatatcgacc gccgtcaccc tcttggtcat      7920
     tggccccttg aaccctgcgc cctcactggt gcaaatggac atgaacgcca ccttgaccgc      7980
     ttttgagaaa gatatccaac aacgtgatct taaccctgcc caacaaaagg ggcacattgc      8040
     gcgtttcacg gcagcattgg acaccgtgct gcgcacgtat agccacgaca ataacgcggt      8100
     gattgttgtg agccccgcca tcattggtgg cgcaccggat atcacccgta ccatttcgca      8160
     agagaccgtg aatgtgctga cgaataagga aaacaagcaa tgaaaaaaaa gaatattgat      8220
     cacagccttg aacaaggctt aacggctgag gaagcacgct atatagcgac catcgttgat      8280
     gatgcgaccc acgaaccaga tgccaattta aatgccttac ttcacccaca gggaaatgac      8340
     gtcgaatcgt taacaccaca agggctgcat gagtttaata ccctgataaa caacagcgaa      8400
     aaggagtgtg cctcatgggc aaagccaccc aaggacaatg cataacctta tttctgctta      8460
     gctttttctg tctcccttta ccgaccgatg ccaaaaatct cggggtgttc ggcccggtct      8520
     ttcccattgg ggaaattgat atgttggatt ggattgacaa tcgcttgcga acgtttgaaa      8580
     aaaacgggga aatagacgca atgaaacagc gcatgcaagc acgcgttaag gccagcgtga      8640
     tgcgtccttc cccggtacag ggattaagca ccaccacggc ccctaaaaca tactttatcg      8700
     atccgaccct caccttggcc gcccccgtca aggacagtct gggcaatgaa ctctacccca      8760
     aaggcacccg tatcaacccg tttgacagta caacctggcc tgctgctgaa aaacaaaacc      8820
     tgccgaggtt taccttttca aaacaactgg tcttatttga tggtgacgat cctcaacaac      8880
     ggcaatgggc acaacagtat ttagctcccc tacccgtcaa atggatctta accaatggcg      8940
     agcctgccgc attaagtcga ttgttagata gccgagtgta ctttgaccaa caaggtaagc      9000
     tcacccgcga atttcaaatt aagcatgtgc ctgtggtgat tagccagtca gggactcgtt      9060
     ggcaagtcac cgaagtggat gtctcacccc tcaaggagaa ataacccatg cgccggacgt      9120
     taccttgggc ttatctgctc atccttttct ttacccgccc tctctatgct ggcggctccg      9180
     cttgtacggg gacgtttgtt aaccccgtca ccgatatttg ttggtcatgt atctttccca      9240
     tgaccattgg cagtgtgcct attgtcgcgt ccgtctaccc tgatactgaa aacccgacga      9300
     tgccgatatc attctgtccg aaacccccgc ctgtctatat gcaaatcgga ctcaatattg      9360
     ggtattggga gccttattca ttggtcgatg tgacccgaaa accctactgc atggtcaata      9420
     tgggcatgga actcaatgcg ggagaaatgc aacaaattgg tgggcgttca accagcagag      9480
     acaatgattc ctccgatggc ggcttttacc atgcccattg gtataaatac cccatcgtct      9540
     actggttgca aataatccaa agcgtcgcct gcatgtccac ggacagtttt gacgtgtcgt      9600
     acatgaccga aatcgatccg atgtgggatg acgatgaact ggcgttcatc ctcaatcccg      9660
     aagcgatttt atttggcaac cttatcgccc agttggcttg tgtacccgaa gccataatga      9720
     cctcaaccaa tgtcgcctta ccgattgatg cgctgttctg gtgcctgggc tcccaaggct      9780
     cggcctatcc cctaacgggc accaccaatt accgggacac cccaatacaa gcaggcaccc      9840
     tcattatgga acggttgaat ttcaagctgc accgagaagg aattgtgtgg gaaacccgag      9900
     gggctgacgg ggcgatttgt taccaatggc cagagccgat cctccctaaa tcccgctatc      9960
     gctaccagat gaccaatgtt attcccgatc cattgtggtg ccacccctac accacgacga     10020
     ccgcattgtg ggaaatgggc catgacaatc cggtcacggg tgacaacttt gggttcgtga     10080
     attttagaaa acgtaactgt gtctttttat agaaagacac acatgacatt ggctgaaagt     10140
     ttcgcatgcg aaattttcag ccaataaata gaggcgtatt tcctcagata tgccgtcact     10200
     tatctctggt gcataaaaac gggcaaacac atcgagccac tttgaggtgt cattgcccct     10260
     ttttctgcac ccgacaaacg cagtacgtca ggtctcttac ttatgccatt accattatta     10320
     tcaacaaccc gatcacacag gatcgcaggg ttaatcttgc tatccgcttt gaactgcaac     10380
     ctaacggcag ccaacaccct tggctacagt caaacagagc tcaaggcatt gcagcaacga     10440
     gaaatcgcaa tacaagcccc cgaacatgca cccacgcttg atttggatgc gctatggcaa     10500
     aacgccaaac aatttgaaac cgacatgcgc accacccaac acgacgccct atcaccgata     10560
     ttgaaacaag ccaatatcgg ggacaacccc aacagtgccg ctaaaggcgt gattattttt     10620
     gcttctctga ccatgccatc gactgccttg aaacaattaa tgatgcaaag cagtgattta     10680
     caagtaccga tcattattcg aggggtatta ccccaagggt tccccgccac cgtggccgcc     10740
     attcaatcgc tgatccacag cgaagacgat gaggtcatca acagcggcat ggccatcaat     10800
     ccgttgtggt tcaagcaact ggggatccaa cgtgtccccg cgtttgccgt gataaaaccc     10860
     ggcgcttgcc tgccccaaca accctgccaa gacagcgact ttgatgtgct ggtcggcaac     10920
     gtttcattgt atgacgcact ggcaaccctc gcccgcgacg gtgatgtccc caatattgct     10980
     caacaggtac tttcaaggag aaaataatat gacaggccga gtgtgtacag tcatcgcgtt     11040
     gatgttcatc gcatcaacgg ctatcgccag ccaagagcaa cgttataccg acaatgttaa     11100
     ctgggctaaa caatcagcca ccgtcacgca gggccaatca gggttcaccg cattttcagt     11160
     caatgaatac tgtaaagaca ccgcctgtca gcagcaactc agcaacccgg aacaaacccg     11220
     ttatcgcaat gatgccaccg ccatggacag cgcgaaagcc gccgccatcg caaccgatga     11280
     caatgcccaa gcggtgcaag ccaatttcaa tgcaggtcgc cccacaatag atcccaatga     11340
     tcccgcttat agccaagcgg taggatatat gaatgatgcc tataccatca gtcatgggtt     11400
     ggtgtctcaa taccatgact gtaaaaaagg gcagacgtgt gagttcagtg aatctattaa     11460
     acattgtgcg caaccgaccc atacacccta tacctgtgat attaccccgt atgttatctc     11520
     taaaaatgag catactggca gtcaacgctt ccccatgagc tatccaagaa gtaacgcagg     11580
     caatgcaagg gtgacatccg caggattgca aataaccctt cccgcaaagg tcattgtcac     11640
     aagaatagag ctcccccctt tcggggtgca atcaaatacg cgatcagtat ctattgatgc     11700
     taatggacgg cctatcaaga atgcaaccgc atcgccctat tggtcagacc catgggatat     11760
     gtgtggcccc ataggcagct tttgctggtc tgaggtaggg gcacaaacga tgaatgtctc     11820
     tatcgatacg tccaccctta atttgactat tcgcgccgcc gatggacgca ccggtattca     11880
     cctgatggac aagggaacga ttacagtaca ttggaaaaca cgcactctga atattggttg     11940
     gaaaaacagt tgcggcccca cgctgccagc gtgcagtaaa acacaagaag tctgcgtgga     12000
     aggcggtggt tcacgttggt tacacggggt ctatcaatac ctgccttgtt ggaagaaacg     12060
     ccaaacctat cactgcacct acccggatac ctgtgccgcg ctgtctacct gtgtcgagca     12120
     atctcgccag tgcagcaaaa acacccaagg cgtctgtgtt caagagaaag tgaccaaaaa     12180
     atgcacggtt caaacctgtg tcgataccaa cctgatttgc ggtgaacaat ccttttgtct     12240
     tgatggggag tgttatagcc caaccagaga acaaaatacc gaatttaatc aagccgcttc     12300
     cagtctcgcg gccttggccg atgccgccaa gggattaggg gatccgccgc tgctgttcac     12360
     gggtaaagcc atgacctgca gcaaaaagcc cgtcggactc agtgattgct gtaaagacag     12420
     tggctggggc agtgatgttg ggcttgcaca gtgcaatgat gaagaaaaag ccctgatgca     12480
     agccaaagaa aagaaactca ccatcagcct cgggcaatat tgcgcagaaa aagtgcttgg     12540
     ggtctgtatt cgcaagaaaa aagcctactg cacctatgac agcaagctgg cccgtatcgt     12600
     ccaagagcaa ggcaaacccc agttaggcat gaactttggc agtgccaaac accctgattg     12660
     ctcggccatc accccagagc aaatgcagca gatggacttt agcaatatgg atttttcaga     12720
     cttttacagt gacctgcaca acaacatgac cttgccggac aacaaccaaa ttcagcaacg     12780
     tataaaagaa accctcggag gcaaacaatg acactgacac cctcattgcc cttcggggca     12840
     ctgtttttta ccactccttt attagtgatg gccatactga ccagcccagt cacccgtgcc     12900
     gaacaaccac ccggttggaa gtggtataac gatccgttat tgatcaaaga aaaagccctg     12960
     acaccaccac cgcccacccc gtcggtcacg gtgacacgca ctctctcacc gacccagcaa     13020
     atgcaatggt ttcatcgcta ccacgatgac accaagaacg atgccctgat taataaggac     13080
     gatgtaaaaa aggcagaaaa gctcatgctg ctcaatcaat ttgcgtacaa catgtcgtct     13140
     gattttggca tgacctttca aaaagccctg ctcatgaacc cggacctgtc ctacaccaaa     13200
     gaccgtccga cggaacaagc cgcccgctcc acctacctgc agatggagcg ggaaaagaaa     13260
     attcgggccg tgcgccaact ggcaggtagt ggctggggct tatttttcgt ctatgaaggg     13320
     gcttccccca tggccgaaaa actggctccc tcagtacaac aatttgctga tgcccacggc     13380
     attgaggtac ttggcattag ccttgacggt acacagctgg ccagcattca ccagaatcgg     13440
     gataacagca atcatatcca agtgcccttt agtcccgcct tggtcctggt caaccccaac     13500
     acccaagaaa tgaaacccct cgcctacggg ttcattgctc aagaagactt attggggcgc     13560
     tttttgaacg tcgccactga ctttgcccct gacttttaag gaaatagccc atgtaccgcc     13620
     tactcatcgt taccctgtca ctcgttttat gttggatgca acccgtcact gccagcaccg     13680
     ataatcaacc acacttcaag caagatgact acgccctggt ctttttcttt cgatctgatt     13740
     gcagttactg ccatttgttt gctccgacac ttaaacagtt cgagcaacaa accgggctga     13800
     caacgtatgc cttttcactg gacaataaag gcatgacagg ctttgaggtg cctattccgg     13860
     tcacgaaaga gatagctgag accttttttg acaacccgcg cagcatcacc gtgcctgcca     13920
     cctttctcat caacgtcaac agccgcaagt ttgctcggat ggcacaaggt caggtgtcac     13980
     tgcacgattt gcaaacgacc tattcccaaa tccgtcggga tccagccgtg atagaggcat     14040
     tgcgaccatg aacaaaaccc tgatagcctc ttttcttctc atcgtcagtg gtacttgccg     14100
     ggccgatgtt aacggctcac tgaacagctt cttcgacggg ctcggttaca gcaacgtcac     14160
     taacccttca tcattcaaag gacaaagtgc caattactac acgggcggca acctgtttgt     14220
     gcgcaccaaa atagtcgatg cacagctggt cagcatcaca ctacccaaaa tcagtgcagg     14280
     ctgtgggggg atcgacatgt ttatgggcgg gttctcccac atcaatgctg accaaatcgt     14340
     gcagttaggc aaaagcatcg tcgccaatgc aaccccgttt gccgtggatt tagccttgca     14400
     gacctgggcc ccgcaaatca agcaaattcg cgataactta caggccatcg cagataagta     14460
     cctcaaccaa tcggtgaact cttgcgaaac cgcgcaagcc agtgtctctg ccctcgctgg     14520
     ttttgcaggg gtcgggagtc aaaaatacat ttgttcgacc atgggtaccc agaacaacgc     14580
     ctttgccgat tgggtatcag cccaacaaga atgcggtgca ggcggtcagg ctaataccca     14640
     gcttaaccat gccaaagccg atccggcatt aaaagacatg gtgcgaaaaa gccataatat     14700
     tgtgtggtca gccatcatga agaacgcctt tttagccagc gatacccacc tcgcccaatt     14760
     tttgatgaca atatccggca cctatattta tgataccaac ggcaagcccc gtcattatgg     14820
     ttcgctactc acccacaata acaacctcat caataccctg cttgtggggg ggaaagccaa     14880
     gagttacacc tgtgatagca aggcagcaga cgcctgcttg agaccgacaa aaaaaaacct     14940
     caccattgcc gttgataaaa gtctgcgcca tcgcatccaa accaccttgg acaccatggt     15000
     gaataaattg ctcgctgata caccattaag taaaaaggag caggcatttt tagaatacac     15060
     ctcactgccc gttttgacct tcatgcgcaa tgcactggaa gccggacgac cacccaacac     15120
     cgccgcgtac tcaacggtga tcagcgtgca gttcgtgacc ctttacctgc gcaacatgct     15180
     caccattacc aaggaatcgt tagcaggcac cagtaacgat cccaaagata ttgccagggt     15240
     tgaaacggaa atcatcaatg ccaaccgttt cttggatgga ctggaaagcc aagcgatgca     15300
     aagcatcatt gccgaacaac agctgattga acaaagccgt gagctacgtc gccaagtgac     15360
     cgggcaactg tccgctaggg cccgtgctaa cttacaattt gggagttaac cgcatgacat     15420
     tagccgtcta tacctacagc aatggggacg tcgcgaaaga agtcttcaat gccatcgcca     15480
     ccttttttgc gaccaacagc tttgccagta tgctgcaaat ctgcaccttc tttgcggtca     15540
     tcgccacagg gtttcatttt ttcatgacac gggatgccaa cgctatcccc aagtgggcag     15600
     cggtctattt gatggtgccg ttattgctca ttaacaccaa agtcggggtg caaatcattg     15660
     atttaaccga tccaacaggc aactatgcgg tggccaatgt gcccatgatt gtggcggggc     15720
     cgacttactt atcctccacc tatatgtacg gggtcacgtc cagtatcgaa agcatttttc     15780
     attcacccga tgatgagcag tacagtaaga caggcatggt cttcggggcc aagttataca     15840
     aactatcacg ccagagtcag ttagaagact cgcagctcaa agggcattgg gtgcattacc     15900
     tgcaaagctg tattgtcggg gacattacac ttaatcaaaa atacacctgg cagcaattgg     15960
     ccaataccga tgatattttt gattttttga ccaatcacag cccttccccg ttgcgccgta     16020
     tccaaatggg gcccaatgat tttccgacct gcaaagacgc cttgccccgc ctcaaggcgg     16080
     gctttactgc cgacgcacag aaatccctgt ctttgatggc acacaagctg tacgccaata     16140
     aagtcgccac caatcaagct cgctttactg cagggctaca aggcagctac gccaaatacg     16200
     cggggatcag tcgcaccgcc tcacaaatca ccacacagaa tatggccatc aatgccattc     16260
     gcaatggcct caccgacagt gctgcagtga atggtaatac ggccgcggct tttaactatg     16320
     cctacaccca aaacaagatg cagaccacct cgatgtggac cggcatggcc ttacaggctc     16380
     gcgagttctt accaatgatg caatccatct tgttcctgct ttttgggtgc gtctccattt     16440
     tggtggtcgc actcgccatg ttgcctggca tgaccaagtt ggtcttgtcg aactatatca     16500
     aagggttcgt gtaccttggc acttggccta tcttgtttgc tttcatcaat ttcatcatga     16560
     ccacccgctt atccttgagc agcagtgccg tggccaacct gtataacggc atcaccctga     16620
     gcaacgtgga tgccctggca gaaatgcact ctcgttatgc tgccatgaca ggcatgctga     16680
     tgatgagcgt gcccgttatc gtgggattta tcgtcaaagg tggcgcgtcg gtcatgagca     16740
     acatgagcca ccaactggcc gccaccatgg gcagtgtcaa cagccgtact tcggccagtg     16800
     ccgccagtgg tgacattaac ctgggcaatg gtcaggttga taacttctcg ttcaataaca     16860
     tgaacggcaa caaaactgat acctcggccc tgcagcgtac acacggtatg accgtacaaa     16920
     atgacacggg gggcatgacc accacctttg ctggaggcgg ccaagtcctc gatggctcta     16980
     ataccatatc acggggactc ggggttgatt tgaacagtcg ggagggcgtg agccgcagcc     17040
     tacgcagttt ggccagcgag accctcagcc aagcagaagg gcaccgttcg caatataacg     17100
     agagcaccga caagaccttc gatcaaatcg tgcaattggg gcaaaacacc agtaaggggt     17160
     taagctacgg cgacacggcg tccaacaaag aaggggcgtc agccatgaaa gcggccagca     17220
     ccatgcagag cacggtcgag gaatacgcca aggtaaacaa catttctcat gagcaagcgg     17280
     aatcacaact gacatcaaag tgggttggtg gatcattctc agtaggaggc agctcgccta     17340
     aactgtttgg attgggtgtc agtggttcgg cagaaggtgg aataagaggt acttgggata     17400
     aaagaaccag cgatacggcc agtaattcag aaagtgagcg tgaatcacaa gccttgcaaa     17460
     agcagttcaa tgaatcggcc aacgtgctca agaactacga cttgaccgac agcagcagcg     17520
     agactcggac taaaaccgat accgctttat cgaatatcgg ggacagctta cgtgacaccg     17580
     aatcactggg gctcacggca catactgagt tcagtaaatc ccagtcactc aaccgtcagg     17640
     cggacaaagt cgaggatgtc agcaacggtg tctcgttcaa cctcatgcct gattttcagt     17700
     cctacatgag gcaagaaaac cccgatcatt atgaagggat catgtacggc agtaccgaat     17760
     cattacgtga agagcgagcg ggctatgttc gacagttcat gaatgagccg gaaacgcagg     17820
     ccaagctcga acgctacaca gatgacagcc ttccacaaac agaaaaagaa ttagtgaacg     17880
     attttgacca acaaacgggc gaactggcac tgacaccggc gcaacgcaca gcccaacaac     17940
     agcaatcaga ggaattgcag acccgtcatg atgaaggggc cgaactcatt attgaaggaa     18000
     aaggcgtacg agaatacttt gatgaaaaca agttcaatac tatcgacaga gaagtacatg     18060
     agagtattaa tacaacccaa gaaacagtga ccgataatgc cgttcaacat ccgtcaccgg     18120
     agcctgcacc tcaaaaagat attgaggcag tcaacgacaa tgtagagccc caatctcaac     18180
     ccatcactca ccctgcaatg ggcaggggat cacgataacc attaacgttt gaggaaataa     18240
     cccgcttttt taaaagcaaa tgggattgtt cgaagcaaca ttacggcaaa gcaaaataac     18300
     atccacccca tagctggcaa aaaaacatct tcaacattag atgaaggcca aaataagatc     18360
     gtaatgaacc cgatacccat aacaagcatc aatccagtgt gcacttttgc atgattgatc     18420
     gtttcatcca cctgttcatt atattcctca gtcgctgccg ttttctcagt ctgtaacgtt     18480
     gcagacggag tggcatccac cgctagaatt ttatcgattt caccatccga gaaccccgct     18540
     tctgacaaag ctttgacttt cgccgtaatg gaaacagccg ttgcttcttg atcgccctgg     18600
     tcaatggcat ttttctttgc ccgcatggcc actgcagcca gcaatgtgtt atcggaatca     18660
     ctcatgagaa acctcactct aacttgatga tttattaaca atcattatac cacacggtca     18720
     atatttaacc ttatatatac tggttttatg atcagttaat cacaaaaaaa ggctcactat     18780
     gtcttgcgtt aaacgcttat ttttcatcac ctttctctca cttgccacac cgttgcacgc     18840
     ggcctccatc cagacacatt tggacagtat aaacggcccc gaccccacgg tacgggctgt     18900
     cgctgaaacc tacctaaacg gcattgtgga tgccagcatg tatatcaatg ccctgttagg     18960
     tgccaacaac aaaccacggg ctttttgctt gccaagcaaa caacccctaa accgtcaacg     19020
     gctcgctgac atcattgctg atacctatca caacgcgccc acggacaaac aagaccccac     19080
     actcaatacc gggatgatag ccatcatcgg tttgacgaac acctacccct gcaaaggaga     19140
     cctgcaatga gtaatcaacg gcctaaaaac agcaactaca cccgtggcgg gcaaatcact     19200
     ttccacaata tcaccatgtt ctttcaaatt aatgccaagc tcgttcgctg gatggggtac     19260
     ggcatcctcc tgctcaccgc cctgctgtgt ttttctttta tcgatcaaga caccttaaaa     19320
     ggcacctatt actactggcg ttacagcatg gtcggcaaaa taaaacccga cacccacgag     19380
     gtcttcaccc tctggcaagg cgtcacttat aaaagcaccc tgggccagca acggctcaat     19440
     cctgtattca ttgacgccaa tcgccaattt tggctgtcac tgcaactgta ccttcttgcc     19500
     agcctgataa gcggcctaac ggtctttagc cttgccatgc ggtatttcaa aaagaaaggg     19560
     gatgaacaaa ccgatgacca ctttattcgt ggaatacaaa tagccacccc gcccgagctg     19620
     gctcgcatcc tcaagaaagc caataagcag tcagatttcg cgctcgatgg gcacaaaatc     19680
     ttcaagcagc actttgaatg ccagcaccta ctgttcgacg gcaccacggg atcaggcaaa     19740
     tcggtggcac tgcgcaagtt tctgcgttgg attaaaaatc gaggcgataa agccatcatt     19800
     tacgacaaag gctgtacctt cgtcagtaaa ttctacaacc cggaaaccga catcattctc     19860
     aatgcctttg atgaacgctg cgcttactgg gatgtatggt gcgatgccaa ggatgccact     19920
     gactttgaaa acatgtcagc cgcgctcatt ccgatgcacg gcgatggcga tccgttttgg     19980
     gtgcaatctg cccgcacgat tttcacctcc accgcttaca agatggtgaa tgagccaaac     20040
     cggacgactg aacgcctgct cgaactcatg ttgacctcag agctggagtc gctcagtgaa     20100
     taccttaaag gcacggaatc cgcgtcactg gtctcggata aaatccaaaa aacagcgata     20160
     tccatcaaat cggtattggc cgcctacatc aaatccctgc gatttttaga aggactcgat     20220
     aggaaagatg atcaaggcaa cctagtacgc ccacgatttt ctattcggga gtgggtgaaa     20280
     aacaaagatg aaaacggctt cctgttcttg tccagcaacg cccaacaaca cgcctcttta     20340
     cgcccattat tgtccatgtg gttatccatc gcctccacct ccatcttgga gcaagaagaa     20400
     gatcacgacc gccggatttg ggtggtcatg gatgaagccc cgagcttgca taaactgccg     20460
     gagctggccg agaccattgc cgaagtgcgt aaattcggtg gctgctatgt cattggtatt     20520
     cagtcctttg cccagcttaa gaaaatctac ggcaccaatg cagcactgga aatgtttgat     20580
     ttgttgaaca cccgcttctt tttccgctca ccgtccaacg aaatggccaa gatttcctcg     20640
     caggatttgg gggagcagga aatggacatt tccaaagaga attacagcta cggtgcccat     20700
     gccatgcgtg atggtatttc actgggacac cagaccatca cccgccctgc agtgaccccc     20760
     tcagaaatca tgcaattgga tgatttacag tgttggcttc gcagtccagg ggatttccct     20820
     atcaccaaac ttgatctcaa attcgacaaa atgcgctcaa tctgcccccc cttcattcga     20880
     cgtgaatatg cctcgtcaga gaccatgcag tctatcgaac acatgctgac ctattgccaa     20940
     atcagtgcgc tcaatctgct gtcatcggat gatcaaaaca agttgatgtc agtacatacc     21000
     ggacaatttg acgatgacac tgaacgtaat gcagaagaag aacgcatgaa agccaccatt     21060
     gacaaggcca aggctgcgaa gaaaaagcac gtcgataaag aaaaagacac caagaacgtc     21120
     aaagagaaag aagcggaaaa aaaagtaaaa gctctggagc aagctgacgg tcaagccgtt     21180
     accgaacaat tattccagga agagcaaaat attaatgcca tggatcatga catggttgat     21240
     ttcggcgagt aaccgtcgag aaaaacaaac gcccacgtaa taaggctgcc cgatgctgtc     21300
     cttcagctaa cggcacctca tcaccctctt aaaggaaaaa tacaatgaac gatgttgact     21360
     gaataacaac gttattctca tattacctaa tagcaggagc ggttctaata cctgtatcac     21420
     tcttgattaa aaatgacaaa aaagtgcaac tcatgaaagt ttttcttatc ttgttttgct     21480
     tttatggtgt ttttgatgca tctatcacta atgcattttt cctcttacct attcccctgt     21540
     cggggatgta tttcctcgca cttgatgccc gaatgaaaac caaaaaaaac attcaactat     21600
     tcatacatga aatcatatta gtactcactc atttcatgtt agtggctttt ctactcttcc     21660
     ttttcgccat tgatacaaac atatctcagg aatggtaaga acaagcaacg acaccaacat     21720
     aaaccccgtc gctacaggca ccaaattacc gaccacggag cccctatgtc ttcctacgcc     21780
     atgaatgaat acctgacgga aatgtttttc tgcatgagca ggctggcact ctgttacttt     21840
     tctgtgctgt tcgtcatcat cacttttatc tcgaaaaaac gtacccatat tgtccaggcc     21900
     attgtgctgg ccggcattgc cgtctacaac agcttttcag ccatcccggt tttcacctat     21960
     ctatctttgt ttatcatgac cctgttattc cttcgccgat cattcgacat cgtcgaggcg     22020
     ggcaatttct ttaacctgcc cgcctttaaa ataatcttgt tcatgagcac ggtaatcatc     22080
     gccatatggg gcatcatggg cctaggcttg cttggcttct tcattatcta tattctcaga     22140
     atcgacccaa tgttttccct ttaacaacga aaaaacaggg ctcatctctg acacgacttc     22200
     cttgcaaaac gtctcctcaa aaagaccgac acaaaaatca cgacgacaag aacgccaatg     22260
     accccagtca ccaacaaata acgaatacgt tggcgactct caaaaatttt ccagtccttg     22320
     agatactccc tataaaaatc agaaatctgg gctccctgtt catggtaacc gaggtgatca     22380
     gcccaagcct cgatccccag ccagatacaa tcataggtac aaaattgcgg aggcagcccc     22440
     cccaggactg acagcgctcg gtcagtatcg cccagcttca ggtaccagtc cgccagtatc     22500
     agcgacaggg tctccgatgt ggtcgcggtt ttcagccttt cggtaatgtc ggcaatctca     22560
     tcgggcccta tccggccatg ggtcatcagg tactcataat aagaatcagc caccaacgta     22620
     ttgtccggca gggcatcgaa aagaccgaca atgtatccct tgtcggccat ctggcggtaa     22680
     acgaccgcct gatagagcac aaaagcggcc tcgtcgtcat aaggggtata gtaggtgtcg     22740
     tcgttggtgc ggacatagaa agtatccttg atatcagcca gcttgccccg gttgtcgctc     22800
     accgtggtct cgaggtagta ggtcttccct tcttccccgg cccaggtgac aagggcatgg     22860
     ccgggcgtgt acatcaccga cgtctcgacc ccgtgcatgg cagccgcatc catcacaagg     22920
     aaggcattaa ggtcgcagtc tgaatgcccc attgcatagg tgttggtcgc atctgccgtt     22980
     ccctcgtact caaagtactc acccagcacc cggttggcac acagaagaaa gtcgcgggcc     23040
     tggcggtacc ggccgcaccg accgtccacc tggcgaaagt aggtaccgat attggcccgg     23100
     gccctgtctg ccgccttcct gtctgcaata ccgttctcga catcgaacct gaccagccgg     23160
     taggccagcg tcgatgcata gtttacctct gcctttaaga tttcatctct cgcgattttc     23220
     tcggcgccac cgcccaacac aaaccaaaca gcaacacagg taaccagtgc cattgcaatg     23280
     gctgttgcca agcctttatt catccctatt tttgtcatta cgtaccacac ttctccgccc     23340
     aaccctaaga attgtacaac gtttcagaat ggcaagacga cccgataaca atctaacggc     23400
     ctatcccaaa acacactatg cacaaccccg aaaaaacatt tcctagatgc atctattttg     23460
     cataacagcc tatcgcccca aggagcaccc gatgttatca atcagtcccc tatcacaaag     23520
     cgccggtgat gcggccagct attaccttac cgaagaaaaa catcacgacc tacctgacgt     23580
     ctcattagag gtcgataccc aatcccccga gaaagaaacc aactactacc tcaaagagca     23640
     cagtgacgag cccaacaccc aatggtttgg taaaattgct gaacaagaag gtatgctcgg     23700
     caagcctgtc gaggaaaaac agcttgaagc tgtgttatct ggcaccctca atggcaccac     23760
     ggtgcacggc aaacgggaaa accaccgtaa cgggtttgat ttcaccttct cagccccaaa     23820
     atcagtcagc accctcgcgc tcgttggcgg tgataaacgt ctgataaccg cccatgatga     23880
     cgccgttaaa ttcaccctgt cccacatgga aaaagacgcg gctcaggcca agtacaccga     23940
     tgagcagggc aagaccgcct ttgccaacac cggcaacctg ctctttgcca tggttcgcca     24000
     caaaaccagt cgcgaagatg agccgcagat gcacacccac gcattgacca gcaacatgac     24060
     caaagacagc gaagatacct tgcgggcatt ggcgtcgtgc ttcaaacagc aaggcggggt     24120
     gattaatggc accaatgagc ggatttataa ccatcaactg tattacggta tgctttatca     24180
     aagctatttg agcaagcaag tcgaatccct cggttatggc attcacagcg tgggcaaagg     24240
     ccagtttgaa atcgagggtg tgcccgaggg atacctacaa agtcagtcaa cccgcagcca     24300
     gcaaattgat gaacacgcgc gcagtgtcgg catggattca gccgccgccc gcgatatggc     24360
     cgccaaaggc acccgaaaag gaaaatccta cgccagtgac gccactctga tggaaaaatg     24420
     gcaaggcgat gccaaagcca gcggttttga catacaagcc tttgtcgcca gcagttatgc     24480
     ccgcgccaat agcgaggcac ccagtcagag cttaaagccc gccgccatgg atgcggccca     24540
     ccgtgctatc aaccaccaaa gccagacccg caaccagctg ggatatgaaa aactcatcga     24600
     atccgccgcg acccaattta ctcagggaga aaaactcgat gtcatcgaca tcaaactggc     24660
     cgtcgatacc cttattttgc aaggccacct catcggcctg aacgacagcc aatcgctgtt     24720
     taccacccaa accatgatcg acaacgagca aaagctgatc gccagcaccc aaggacaaaa     24780
     gcgtcacttg cgcactctgg tgaataccca aagtctggag cagcaaggac tcagcgccga     24840
     caaccaggat aaaatcaata ccctgtttgc cagccgcaaa caaaccaaca tcgtcaatgt     24900
     gtttggccaa agccaacaga tcgccagcgc cctgctccat gtcggcactg aaagtggcca     24960
     gcggatccac atcatcaccc cggataccct gagcaaacaa acgaccggcg ccaaagtacc     25020
     tcgcgaagcg ttcaccgcca cccaatgggt gaaaaacctg tttcgccctg agcataccca     25080
     caccgttcag cgcctgcttc atgacaaaga caccccgtac agcaaccgcg acctgtttgt     25140
     ggtcgaggcg gccaacaagc tgggcgtcaa cgaggtacaa ggattgattg ataaagcaaa     25200
     ggtcagtaac agcaaactga tcttcctcaa ccacacccat gcccgccagg gcatgaaagc     25260
     cggtcgcgtc atggacaccc tgaaaaaagg caacgtaacc gaacacagct gggtcgatac     25320
     caaggacaat agtgctcagt tgtttgttca tgagaaaaac gacggcgagc gtatcgatgc     25380
     gatagccagg gcgtacagtg acctcaccga cacgtctcag gtacaggtgc tgggcaccac     25440
     ccaaaaagat gtgcaggcat tgaacaccac gatacgccac accctgcagc aacgcgggga     25500
     catcaaccgc cacggcgtca cggtgagaac cctgaacccg gttttcttgt ccgatgccca     25560
     gcgggaagtg gtcagccatt ataaaaaagg gatggtactc agtgagtggc agaaggtaca     25620
     tggccgcaac accaaacagg atttcactgt caccgccatt aaccgaaaaa ataacctgct     25680
     caccctaaaa gacagcaaag gcaaaaccca agacatcaac cccaacaccc gcgaagccaa     25740
     agcccgtcaa ttttccatta gccgctcgga cagcattgaa attgccagag gcgataaact     25800
     gcgggtcaat ggcaaccact ttgccagcaa gctcacccaa catcagacct taacggtcag     25860
     tagcagcaat gccctgttca ttaacctcaa agacaatgat gggaaatacc atttattggc     25920
     cacaaaccag ctaaacgacg caccactcag ctataacttt gcccagcccc tgagcaaagc     25980
     agacgacacc aaggcacata ccttaattgg tatgaagtcc tatgccgcct ccaaagaatt     26040
     attgcatgac ttgaaccatg gccaggccag ccgcctcgat gtctttactg atagcgggga     26100
     aaaactcgat aagcacctgg aaaaaagcac gatccaaccc agtgccattc accgtgtcat     26160
     gcaggcacat ggcgatccgg aaaagttcat caacagccaa acgtttgatg tactgcgcca     26220
     ggacgttaac gccacactgc atacactgaa agacaaggct ctcgacaaag gactcatcga     26280
     gagcgccgtc caatacgcca ttggcaccgt ctccgaaaaa gaagcagggt tcagtcaaaa     26340
     gcaactggtg attgaagcga tcaagtacgc ctttgaagag aaaggacagg ccattaaaga     26400
     aacagagatt gtggcccacc tcaagcaggc cgagaataat cagcagctct tgtctgccga     26460
     gtaccacgac ggcacccgct ggaccaccca cgcggccatc gccaccgaaa cccgcattct     26520
     tgagcggctg gccgcaggca agaacaccgt taccccgctg gcgactccag cacaagccaa     26580
     cgcgttctta gacaaacatc cccggtttac agatggacaa aaaagcgctg tccacttaat     26640
     taccaccacc gccgaccgtt ttgtagcggt gcaaggactg gcgggcgtgg gaaaatccac     26700
     catgttggaa agcgggatcg acctggttaa aggtattcag gccatgaacc ccgagcaaac     26760
     caccttcatt ggcttggcac ccacgcacgc agcggtcaac gaactcaaag ccaaaggcgt     26820
     acaaagtcaa accgcccaat cattgctcac ggattttctc agtgagaaac acacaccagg     26880
     gcaatttcgt aacaccgttt ttttactcga tgaaagctcg atgaccagca accagcaaat     26940
     agaccagttc accgaattgg tgaatataac tggcgcacgc gccgtcaagt tgggcgatat     27000
     ataccagctc acgtcacagg aagccggcaa accttttgag ctggccatca ccaacaatat     27060
     catcgacagc gtcaccatga aggacatgaa acgccagcaa aacgacaccc tgctcggtgc     27120
     cgtccataac atcgttgacc gacagggaga aagtgcctta gaaaaattaa agcaacaagc     27180
     cccgctgcaa gactatcagc cccttcctgc caccaagaac gaacaacaag ccgacgacca     27240
     agaacaagct agcatcaacc aaagccacaa tgtgatatcc acctatcaca acacgggcaa     27300
     cccgaaaaaa gaccaggaga ccgccaccct ggcgctagcc actaccgtgg ctctggaata     27360
     cctatcacgg acaccgcaat cacgggaaaa caccctcatc attgcttaca ccaaccaaga     27420
     gcgtgatgac attagccaca ttatccgcca ggggctgcaa caacaaaaac acttgagcgc     27480
     ccagcaatat aacgtgccac gtttgcgcag tgtcggggca accaatatcg aaatggccac     27540
     catgatgccg tataaatcag ggcttatctt acgtaccggc aaagacaact acgccgccat     27600
     cactgacgtt gaccgccaac acggtgttgt gaccgtggct gacatgaaaa cgggcgaaga     27660
     gcgcccgttc ttccctaaaa accacgacca cacttttacc cagctctgga gtcaatcaga     27720
     acaaccactg gccaaggagg acagcattat gctcaggcaa accgataaaa gccgccaatg     27780
     gcaaggtaac aaggtctacc gcgtcactga tatcaacaac ggaaaaatac aactagaaag     27840
     caaagaccgg cacaccttga gcctctcaac cacccaaatg aaagatgcac actgggatta     27900
     tgcctacacc cgaaccgctg acatggcaca gggttcaacc tatgagaacg tcattaccac     27960
     catcaaaggc aaagggatac tgaccaatat tcgccgggcg tacatcgata tcacccgtgc     28020
     cagtcatcac gttaaactca tcactgacaa caccgagaaa accatgctgt catgggtgaa     28080
     caatgagacc aataaaccct cggcactgga aaccagggac aagtactacc ccgaacataa     28140
     agcgcttttc aacgaccgtc ctatacccaa agacaacccg gtctatcaag acatcaatgg     28200
     tcgcttagat atcaagacca tggggaaagt cattaaccag caattacctg cctatacaga     28260
     atcactggcc acccaactat tggggcagcc cgatacgacg aaatcgggcc gggacacact     28320
     cactttccag caaccaaaag gggaattgaa aataacctta accggccaat atcgcggtca     28380
     ctttaaaaac tggggcaccg gtgaaaacgg cacgttaata tcgctgataa tgaataaaga     28440
     aggactcagt tataaagccg ctttatttaa agcagacacc ttattatcag agccggataa     28500
     acatcaactg actatcaacc cacaacatga acaattaaaa gccaccgtcc cgcttaaaca     28560
     aagtcagtta gaagcgcgtg ctcagcaata ctttaatgac ggcatgcctg tcaccaatac     28620
     cttggcgcag acctatttag acacgaaccc caaccgtccg tttaaagaca atgacagcat     28680
     tcgctatcac cctcgggtat attcatcaga aacacgttca acccacccgg cccttattgc     28740
     caaactggaa acaccggaca atcaaattaa aggcatttcg gtgacttatt taaatgacgc     28800
     cacaggagac attagcgacc tcaagattaa taaacgggta ctgggtacaa aatcgggcaa     28860
     ccatattccg attaatgaag gcatacaggc tgattacagc attttggccg taggaattga     28920
     aaatgcatta ctgattaatg acaacaaccc aaccaatacc gacattattg ccgtcaccaa     28980
     taataatgat tgccgaaccg tcaacaccga caacctccgc gaaaacatta tcattgtgtt     29040
     gaatcaggaa aacaccgaaa taagccaacg tttgattgac gatattacca gcaagcttga     29100
     gcgcgatgga aagcacgcaa cgataattga accgaatgat ataaataaca ccccaggatc     29160
     tacattatcc gaccacatta aaactgctat caacgatatc actatcaaag acaattatat     29220
     tcctgatgct atcaccaccc tcaccaatga cattaacaat gcaatcactc cttatataaa     29280
     tacaccactc acagaaactg aaaaaagcac agtgcgagat atcgccatta atgaacacat     29340
     tgaaaaacaa accaacatga tcctacttga gaaggaaacc acactcgaca caaggacaac     29400
     gcaattggaa atagatagag aacttacgcg ataaaaaagg gagcccattg ggctcccttt     29460
     ttttattcct cttttccaag caactcatca actttatctt ttgaaatggc attggctttt     29520
     tctatgatgc tttttaattc gaatgcctca ctattatcgt catccacctt tttaatattc     29580
     ttattgccag ataaatgcaa gaaggcttgc gttgaatatg aagaacgcaa taatttctcc     29640
     agcatatcca tcactgtcaa ctgctcgcca tcatcctctt gcgaatgctt ccatacccgt     29700
     gcgccaatgg ccatcaaatc accgcatgcc tcagactgac ttttgtctgg gttctgcttc     29760
     atgtagagat ctaatgtctt cagcaattcg ctgtcttcga tataaacctg cacacgttta     29820
     ctctttgtca ttaccacttt ctccgtcatt tatacgcgtt atcaccctga acattacgac     29880
     tcatcagaga gtcatattgg gagtcgcctg caagtcacca tagtattttt gcaagtcacc     29940
     cgcaagtcat atcacgactc gcttacaagt cactagcgag tcactaacga gtcactaacg     30000
     acttgcgcta gagtcgcatg caagtcgtaa aaacaataaa tcatttaaat acagaaactt     30060
     aaacaagagt cgcgcacgac ttgcaatgtg acttacttgc aagtcacatc acgataagtg     30120
     attgttttat atgttgatag tcacatgtaa gtcgtaaagc gagtcacatg taagtcgtat     30180
     ttttacaaag ctaagtttaa cttttttaga agtcgataat gccgaatttc gtaaaaacat     30240
     tccttttttc actttaaata tcagcaagtt acgaaccacc aacaacaacc atctcgattt     30300
     atcgagatag cgaggtgtgt agtcttattt tattgcaata tccaacccat ccgagtcgat     30360
     catccttttt ctttcttttt aggggatcat tgctcagtag acacattcag gcagactgat     30420
     tgccaactga aatcagaaca ggaaaggtaa gagaaaacaa agtaacgagg gagaaatagc     30480
     ggtgcagaac gcaccaggac aacagaagaa aaggtagaga acatcgcaca acaatcaaag     30540
     cgtgaccgcg tcacatttta attctgagtg tttcgtttaa ataacactgc gtcgtattaa     30600
     cagagcataa gtaataatcc acacatcact caacataaac aactcaatgc cgctcgcggc     30660
     atataagcca acccattaat catcaataag ccatcatcct tcaattggcg aaaccttaac     30720
     aaggccaaat aagaaaagaa aaccaccttc ttgctcggcg actctttata cggcggtaat     30780
     cattccacaa aaaatagggc taccagtcga agacaaaaaa gaggcatagc gcatgccgtc     30840
     atgcttttta tgacgataaa taaaaaaggc cgcacaaatg cgaccttaag aatataacca     30900
     tgaataattt aataataacg gtccattatt acgctattat cacctcgatt aatatttagc     30960
     gaaaaaagag acagcttata tttacccgat gaggtgatat gaaaaaccaa tgcgggcacc     31020
     aaacgattga atcgtgtatt tatccaagca ccaccattaa acaatgtgat tgaccacggc     31080
     aattctgtcg cggtatttaa tgactcttcc agcaattgta aatcactata atgatagaaa     31140
     cgttggtcgc caaccctatc acatacccgt tgactaaacc ccatggcccg caattgcact     31200
     ttatcgcgtt cacataatgc cgtgtattga cggctcattg tgagttgttt attaattttc     31260
     ttttttgcta acaataaacc gttaacctga cgatgtgaac aacgaagggt atgcatagca     31320
     ttaataaggg agacagtatt catgacgacc tcgcagcgac ttatcattta aataatgacg     31380
     agaaagaata aaacgaagat atttattagc gttgacggtg gcagcattaa aaaaccaata     31440
     cggacggaca aataaatatc tttcagcttt tatttactta tattgagtga cagaggaaaa     31500
     caggattgac gttatgataa ataacaccaa tattgcctca caccttcttt atcgacatca     31560
     ctgctcatca ccaaggtatg attaatccaa attgaaaact caatcccata ttcccgattg     31620
     cgttgtttca actgcccagg ttgtgttttc atggccacgc tatcaaattg cgtttctgtt     31680
     attggcgaac gattgttatt agccatgata gtcaccgcca acaacacgct gtaattcaga     31740
     acagaacagt tgaaaatcta accatgaccg agttttacaa tgcagtggta ttaataacgt     31800
     tgaggctaat acgatttttt gcttgcggtt aatacacgtt tgtctattat gatttgcagt     31860
     aatcatttaa tatttcctca tagatttagt tgtgattatt cgcccccttc tagttcgtgc     31920
     tagaaagggg ctcctcatta tttatttaat aaaaacgcat gggctttact ggcaaggctg     31980
     gccgccttga aaataaaacg cttgtcgtca ttcagttttt tgagccatcc cgcgatatag     32040
     tcctcgtgct gcacctcacc aaacacactc aaatcagcac aacaaaaagc cgcgcccaac     32100
     tcagcgacca attcctcaaa tgcataatct tttgaaccaa agctattttt taaatcacga     32160
     tctaaacggc ttttatgacc agaccagtga gtcagctcat gcatggccgt cgcgtaataa     32220
     tcgttagacg atgcaaaacg atctttcgtc ggtaacgtaa tcgcatcatg actcggcgaa     32280
     tagaatgccc tcacacctaa atggctaatt gtcgcacctg tctccaccat cgcagcttca     32340
     acgtggtcaa gtgtgacaaa gtcaccttga actgtacgcg cctcactgac cgtcactgag     32400
     ggcttatcaa tgttctctat ttgatcgaga ttaaagaccg taaaagactt caacatcgga     32460
     atagtatctt tctcgccctt atcgttatct ttttctaaca tcttataaaa gatgattgcc     32520
     gtgccctttt gccctttgat cacattcccg cctaattcgg ctgcttgctt gtaggttaac     32580
     cagtaaggac ttgagtaccc tttctcgaca atttcagacc ataacaacag aatattcacg     32640
     ccagaatact ggtgctttgt tttgaaattc atgggtaaca aggtgcattc ctgcgttctg     32700
     tcccacgggc acacccacgg cttaaccccc ttttctaacg attgaataat acggtcagtg     32760
     acaatctggt acatgtcttt tgccactttt gccacacgac ggggcttgcg ctttgaagag     32820
     acatttttgt tagagcctga ctgctccagc ggggatacgc tggtcgcctg gtgctgctta     32880
     gtgattgttg agttgataac ggttgaatgt gtcatggctg tgcttcctgt ttaagtggat     32940
     gttcatttcc gttcttcgcc tgactgttcg atttcttgcc accgttctgc tttacaaggg     33000
     cgcgaagcgt ttatataccc ttgtgaatca ggttgtggtg agaaacgatt aacaggcagt     33060
     agcggaaggg gaaatgaatg gacacgcagg aagtacaatg actcatgaag ccgttagcca     33120
     cgattacaag cacttagcag gataaggtga aagctcgatg aggaggacgc aggacaacga     33180
     atgctgttgc gatagccgaa cggagtgagg gaaggattgt tcgcaggaac tgagcagccc     33240
     ttcgcgactt gtcgggttag ggatgccagt tatcgcggga ggaccggagg gacggaaaac     33300
     ccggccatcg cccggcttaa gaaaaagaac cagaagtcca tgacaggtca aatgtcacca     33360
     acacttgacg agaaacctga tacaaagttg tgacaccttt tttcgatgat tcataccact     33420
     gtccagttct tgtctaaata ctatttcctt taacttcaca taatggcttt atatttaaca     33480
     gcttccatca ttttttaatg acatcataag aaagtaatgg atataatatt taaaaatcat     33540
     attcaggaca cgcattatgg ataatcagga aacatacaaa gcgtttgaag cactgaggca     33600
     aggtgcggaa aactatattg ttcgcagaaa caatgcctat aagaaagaag tgcgttactt     33660
     cactcgtatt gaagcttcaa actatttaag tgtggatggt aagacggtag ataaatacgt     33720
     caaaatggca gggatagatc caaaccgcca tgaagatgca gcttggttga ttgacattaa     33780
     cgaaatgtac caagtgcgtg agttattacc gcttgataaa cggattgaac ataaatttac     33840
     tcgccctaaa aatcacaaac ttcaggttat agtggttcaa aaccaaaaag gcggcgtggg     33900
     taaaacaatt agtgcagcaa ctatcgcttc aggtcttgca actgagttcc atgaagaatt     33960
     tcgtgttgga gtgattgatc ttgatcctca gaacaccctt tcaacctact acgcaccaat     34020
     agttgaaggc gaagaaaacc aatggctatc cgttggtgat ctaatggctg gtaagtttga     34080
     aatggaagaa gatgagacat ttagtaatgt agtgtctgaa agtttcctac aaacaactat     34140
     tcctaatcta agaatcctcc ctgcaactca agacgaccga agccttgaga actggtttca     34200
     ccgtcagttg cacaaccagt cattagacaa gccgtatcat cttctgaaga acataattga     34260
     cgcagttgaa aacgaattcg acattatcat tattgacact ccaccctcta tgggctttgc     34320
     cactatcaat ggctactttg cagcaacaag cgtgatcttt cctatgcaag ttgcagaaaa     34380
     cgacattgac gctacatgta actacttcaa attcatccct gaactttggg agcttattga     34440
     cgatcacggt cataccggtt atgactttat gaaaatattg cttaccaatc acaaaacaag     34500
     cagctcaacg acaacactac agaataaact aagtaatgta tttggcagct tcatttactc     34560
     gcgtgaattt aataacagtg aggctattaa agagtgttca cgattagttt ctacgctgtt     34620
     tgatatatcc aagagtgagt atcctggtcg aacaaagagt gtctttcaaa aagccaaaga     34680
     caacgcctat gaagtaacga gccaagtcta ccgtaatatt gttgatgttt gggataagga     34740
     taattaatca tggcacgaaa aaaaggaagt aataacgaag gaacatttgg tcaaccaata     34800
     aacccgcaaa gccaaactaa aagtgcatta cgaacggcat tggataacgt tgataatttc     34860
     tctgaagaac agcgtcaaca attgtcttct gcgttaggtt tacaggttga gtcaaaacct     34920
     gaagtttggg agctgaagtc tggtgcaaaa gctaccttta cttctgttct gctaactcgc     34980
     aaacaggttg aagaagaaac ctttgtttcg tttgaagtga acggacgtga ccaagaactg     35040
     ctaactgacg agtcgctgaa aagtctttca tcaatggcta accagcaatt ctaccctgcc     35100
     attggtcgta aaattaacgg taagctcgaa attcttgatg gttctcgacg tagagcaacg     35160
     ttcctaagaa cggagtcgat tgagttattc aaagtattgc ttactgatga tgatgtatca     35220
     gttggtgatg caaaagcact ggctaaagat ctgcaaacag ccgaagcgca taacctttat     35280
     gaaattgggc aacgctgctt aattcttaaa ggccaagatg aaaaagtaac tcaaaaggaa     35340
     atggctgaac aattaggcat tagtcagtcg tcaattagca gagctattaa agccgccaat     35400
     attgataaag agctaataat atttttccct aacgccaaca atttaactcg taaagactat     35460
     gagctgcttg aaaaagtgac acatcaattt gcaggaatgc caagcgcaat gtcagatttt     35520
     attattgatg ttactaatga gcacaaccaa tcaaattttg aattgtctgt agacgaacaa     35580
     cacgatgaac taattaagtt aatcacatct aaacttgcag accaaaagaa agctgtcaaa     35640
     aaggatactg gtcgaaaagt tttgccaatt gcagaattta ccgaatcagg tgttttcgct     35700
     cgaaaagtca aaaaaaatag gttctttggc tacgaatttg gccgaattcc taatgatgtt     35760
     caggataaac ttgattcagc gattcaagca attatctgtg aataccagaa tacggactca     35820
     gctaaacaag actaatcatt tattaaccaa attaaaaatc gaaccttatc actaattggt     35880
     tcttttttta tcttaaagtt gtcattattc cacggaataa aatggtaata attgttactt     35940
     aacaacaagt tgacaaccat tacggttgtc attattccgt ggaataaaaa tactatttcg     36000
     acttaaatgc catccaaaaa tcctttgatc aacatctcat caattttaga acttttacat     36060
     tgggcatctt ctttgaccct tagatcacgt ttaatggctt ctttggcttt acgctcttta     36120
     atgcgctcct ggatcttttg agcagctaaa gactttcaac gttttcataa tcaactggat     36180
     ctgcctcaag taagcggtag catcgcgtcg gtatttaatc cacccgacgg tggttccgga     36240
     ggtagcagtt cgtcgacatc aatttcaaaa agcaattgca gcttcaacaa gctgtgcctg     36300
     gaaaaaggag tccaagaagt ggaagaaaag gtgacgacag aattacagtg ccgtggtttt     36360
     actttggaag tatctaccga gggggacttt aagccagggt tcaagacaag gttaggctcc     36420
     attacttttc cttaatctat aatttggttt ttgattgccc gggtggcgac acccagcaat     36480
     agcatatcct cagtgactat tccgcgccgg tcgtcggttg ctgcgtacca ttgccccttt     36540
     tgccaataca gctgggcaca gaagatatcg ccgtccaatt ccatcatggc cgtgcagcca     36600
     tcatgcgggt tccggccctg ctcgataacc aggtgatccc ctttctctaa atgcagccgg     36660
     tcaaagtccc ggtcgagcgc cacaatccgg gtggccgatg gcttagaaac aaggtgatcc     36720
     atcagcgtct cgccgataga tgattcttca tggccgtgcg tggggggcgg gaatggcatg     36780
     gtgggttccg ttcgttagcg tcgttgcctg gcattatcta gcatcttgct gaactcggca     36840
     aagcccaccg gacggcggtg gcatttgctc tctgccaggt ggtttccttc cacgttaatg     36900
     acagcgcgtt ttcagcacgt tgttcacgtt gccctgcagt ttttcgatcc gctctgcgcg     36960
     tttacactcc caggcactca ccgggaactg cttgtcccag gcagccatta actgccgctg     37020
     tgacttgctc atgcggtagc gtgaatatga ttgttccata tacagataag tacgggcaat     37080
     acgcccacgg gctgctattg gcggctctgc tttacggtta tcaattttca cttggcatga     37140
     gccaaaatct gccggttccg ccggtagcat cgtgaagttg tagttgctcc gggccgcatt     37200
     gacggagcca atggccggga acaggttgta aagatcggac tgcattaagc gatattcctt     37260
     gctggccttg ttcgcacaac gccgtccttt atatgccttc cctttgttgt tgacgcattg     37320
     ggtatcgccg tcacgccact ctataaaagt acggccaaag ttttcggccg gcaccacgtg     37380
     ttcccactcc acctttttag agcgcttcac atacttatca gacttaaacc caggaggggg     37440
     ggtgatgttc tttttggtat cgaaactggc accgcaatac aaggtggtac ggtgatcaaa     37500
     gtagacattt ttttctagag ttttctttgc cttactgaat gactcaatgt gtagattagc     37560
     tgccgttgca ttgaacgcta gcagcaaacc cacaatgaat aaaatccgtt tcacaataga     37620
     tttccttact ttgttaatat gacttgtaaa cgacggcgag ccctctaagc gatagtgttg     37680
     cactctcgcc atttccattt ttttctggaa tccacagaca ttcgccgtat aaaaaacact     37740
     caaataaacc ctacaggcgg catgattgct gacttgtacg gaaagttact ctaccgctca     37800
     tcaatagctt gacgtacagc ctgggcaacc gggctagtct ttatccctga gtcctgtttt     37860
     tcctgctgta atcgttctag gtctggcaat ataaggcccc taagcttcca ccatattgct     37920
     gctgaaatga tgaaaaaagt aaacatcgcc agcaacgtga agtggccaat caagaacatc     37980
     acggcaagat aaatactcgc ataagacagg gctctagcat aaaaaagcca acgactattt     38040
     tgtagcgtgt cgaacatccc ttttggaaga tttgggttca tcaagctcat gcacagaatg     38100
     gtaaatatcg tgaacaaagg gagcgcaata gaaaatagca atacagacag gtgtaacatt     38160
     atcgattcct cgacacctcc ttgcgcacta aacaaagcca gaaagaatgc ggcgctgaat     38220
     cccattagac ctgcatgtaa ccatttgtct tgttctaaag ctctctgtgt catgtttctc     38280
     tccaaaccgt gtcatcgcgt caaacaatat gttctcatat tcttgacaaa caagcagtta     38340
     ctggccgttc agtttagggg gaatctgact tggaagtaaa atgggtaaag tcgcatatcc     38400
     acttttctat tggcaaataa agtgagccga gatttcccga tgtcatcagg ccttgtggat     38460
     tatgtatgca agcgactaca actacgttac ttcactggat gaagtaaaat atgggattgc     38520
     tgattgttcg agtcactttc ttttagttca gcactaaata gttgggtcgc atttatgaac     38580
     tcaatcagtt ccagtgaacg gtcagattca atcaacatcg acactggcgc tatctgtgta     38640
     ccgttgtcct caaaacaatt ttctaagtga tcttgtaaga catagatcac ttcgggttct     38700
     gcttgggccg actcatcaaa tatcttcgaa tcaaaaccat gcttactcaa taagatactg     38760
     agcaaatcaa acagcttctg agcatcattg gctttctttt gaaaatccac cgacatggaa     38820
     tgcagctcat tgagtttagc ttccaaatca ccgtctttac gttggccgac taaaatcatt     38880
     cgcttgatgt cgcctttgat ggatttataa cacggctgtt ttaattttgg tttaaggaac     38940
     ttgcatacga tgtcgttgcg tcttgccagg ggaacaaacc ggtcattgct cgccacctgg     39000
     ccataaagat ggagtaggct gttctcgatg acatcagaaa gctgttgatg atatttttct     39060
     ttgctcaaaa cggaagatac tcagaatgaa ggttaaatgt aaatgctatc cattatatga     39120
     ggggcatcgc ccctgaaagc aacccataaa caaccaagcg cataccaatt taagaaaact     39180
     gatcattttg acgatttgag ttaaaaatca gtctcaaatg aacccgtcga ttctggcaac     39240
     aaattactca gggtatttat ggatagaaaa gtggtgcttt tggggcttag ggcagaggat     39300
     ttgaattgta caatgttcgt cggtgtcgat tatgtacata ctgtcaaata ggcggtacat     39360
     ccccgtgagt acggggaaca cttgtgggat atttaacgga agctaaagtg gatgcggttc     39420
     agccccgtga gtacggggaa cacttaatga atctaagtga agccgttaac gttatcggtt     39480
     cagccccgtg agtacgggga acacttaatg ggtgcagtgg gtacgggtga caacttcggt     39540
     tcagccccgt gagtacgggg aacacagcaa caacaggctt tcggttcgaa cctcaaccgg     39600
     ttcagccccg tgagtacggg gaacaccgat acgttagagt tcatcgctag aatgaacccg     39660
     gttcagcccc gtgagtacgg ggaacacaca aaaagctatc tggtgctgta gttctatatc     39720
     ggttcagccc cgtgagtacg gggaacacag gttcaaggga caacggccca actgttacaa     39780
     cggttcagcc ccgtgagtac ggggaacact tcgagggcgc acattcaatt aaacgggtgt     39840
     gcggttcagc cccgtgagta cggggaacac tttcccatcc tcgcgctttc tatttttgga     39900
     acacggttca gccccgtgag tacggggaac acatcagtga tcttaatgct acagcttgat     39960
     tcaacggttc agccccgtga gtacggggaa cacacgttgt gccatttatc tcgctaatct     40020
     caccgcggtt cagccccgtg agtacgggga acacgtagca agctgagtca gtaagataga     40080
     taccatccgg ttcagccccg tgagtacggg gaacacgttg atgaaacaaa ccgacctgat     40140
     tcaaccgacg gttcagcccc gtgagtacgg ggaacactac accaaaagcc ccatcaggca     40200
     cgccggaagc ggttcagccc cgtgagtacg gggaacacac cttaccgatc actttaatga     40260
     tgaccgcatt cggttcagcc ccgtgagtac ggggaacact acatacgttg ggttgtgaac     40320
     atgtgattct ccggttcagc cccgtgagta cggggaacac atatttatcc gaaacttacc     40380
     ctttcctata tccggttcag ccccgtgagt acggggaaca ctatcagggt attgctcttt     40440
     gaactcgtca atgcggttca gccccgtgag tacggggaac acatggctat gaaaactcaa     40500
     atagcaatat gttacggttc agccccgtga gtacggggaa cactccatac agaacgccgt     40560
     ggaaaaccgt gtgcgcggtt cagccccgtg agtacgggga acacaaagaa ggtagttctg     40620
     aaattgcgga taccaccggt tcagccccgt gagtacgggg aacacttgtt caactcgtcg     40680
     atgatgtccg gcatgtccgg ttcagccccg tgagtacggg gaacactctt catcagtacc     40740
     gttcggaata ttcccgtacg gttcagcccc gtgagtacgg ggaacacgct aggcctagaa     40800
     cgcttcggat acctgttaac ggttcagccc cgtgagtacg gggaacactt tctcgtggtc     40860
     aactcttaca tggaacattg cggttcagcc ccgtgagtac ggggaacacc tctacctgag     40920
     tttccttttt attctcagca tcggttcagc cccgtgagta cggggaacac ctggcatcga     40980
     taagcgtgac cgcgatgcgg aacggttcag ccccgtgagt acggggaaca ccgttgacag     41040
     tctagcgttc atctcattca ttacggttca gccccgtgag tacggggaac acgccgtcca     41100
     tgcagtaacc gtcctgagag aacgcggttc agccccgtga gtacggggaa cacgatttac     41160
     tagttacgct aattctaatt agtggcggtt cagccccgtg agtacgggga acacatttga     41220
     acgttacctg gtggtgtttt ctcgcccggt tcagccccgt gagtacgggg aacactcagg     41280
     tagtgcattc aaggtaaatg atggtgacgg ttcagccccg tgagtacggg gaacacaccg     41340
     cctgaaagcc acgaaggtta caaggtaacg gttcagcccc gtgagtacgg ggaacacaaa     41400
     aagaggtata aagtcaaacc cctcaccctc ggttcagccc cgtgagtacg gggaacacat     41460
     gcttgggtga tctcaacatg attttgccgt cggttcagcc ccgtgagtac ggggaacact     41520
     gtatctccca attgggcact aaccttcgag tcggttcagc cccgtgagta cggggaacac     41580
     tttaacagcg tgtcccattg gtatttcata accggttcag ccccgtgagt acggggaaca     41640
     cattcagcct catttttgtc attgtcctag ctccggttca gccccgtgag tacggggaac     41700
     acgcgataaa tgccagcatc catttttttg catgcggttc agccccgtga gtacggggaa     41760
     cacatctcat tatctggcca cagaaaacca agatgcggtt cagccccgtg agtacgggga     41820
     acacactttc ataacatcaa ataactggag taagaccggt tcagccccgt gagtacgggg     41880
     aacaccacac aattgcagtc ttcacagaat ggctttacgg ttcagccccg tgagtacggg     41940
     gaacactgta tcgaaatgat gcacaaccag tacgtcaccg gttcagcccc gtgagtacgg     42000
     ggaacaccat tgcatgtgcg taatcgtcaa ctttgattgc ggttcagccc cgtgagtacg     42060
     gggaacacgc agcaatgagt tttattggtg agtcgagaga cggttcagcc ccgtgagtac     42120
     ggggaacacc gggaacagtt acgccccgcg ttggctgatt acggttcagc cccgtgagta     42180
     cggggaacac acgaacagaa acctgatagt aggcatagtc aacggttcag ccccgtgagt     42240
     acggggaaca cgcgtaaaac gccctttgat tgttgtttgg ttacggttca gccccgtgag     42300
     tacggggaac acggtcgtat gcctatggct tcggttggta tggacggttc agccccgtga     42360
     gtacggggaa caccatcaac gattatcgaa gatggcgtta tcaagcggtt cagccccgtg     42420
     agtacgggga acacattcaa agttgattca gtggaagaac ttgtaacggt tcagccccgt     42480
     gagtacgggg aacacctcac ccagtgtcac attacatttt ttgtatgcgg ttcagccccg     42540
     tgagtacggg gaacacctac aagcccgtat gttagccggt gggggtgccg gttcagcccc     42600
     gtgagtacgg ggaacacgtg atggcaaaac gttggggtac cgctcctggc ggttcagccc     42660
     cgtgagtacg gggaacactt cgtcgtaccg ttggctcgca tggtgcagct cggttcagcc     42720
     ccgtgagtac ggggaacacg taaacgattg ctggcttact gggctgctaa acggttcagc     42780
     cccgtgagta cggggaacac gtggccatgt tgctgcccgt tactacaaag aacggttcag     42840
     ccccgtgagt acggggaaca cattcctact cgcatttgct aagcgattgc tagcggttca     42900
     gccccgtgag tacggggaac acatgtgaca tgccttgaag gtgatgttaa ttggcggttc     42960
     agccccgtga gtacggggaa cacatgaaga gcgacaacag cggcttttgc tttttcggtt     43020
     cagccccgtg agtacgggga acacatcgcg acaagagcag cggcgattac tgatcacggt     43080
     tcagccccgt gagtacgggg aacacttctt tcattgctgc ctgctcagcc tgctcagcgg     43140
     ttcagccccg tgagtacggg gaacactgta acacagatgt tccacttgtc gccctagccg     43200
     gttcagcccc gtgagtacgg ggaacacaga ttgaaaaaca ataccatcag atcctattac     43260
     ggttcagccc cgtgagtacg gggaacactc taaaagtata cacttgtttt tattgaagaa     43320
     aactaagctc ataaaagtta ccaagttttt aaagagcaca aacagctaat tttttggctt     43380
     tttatctatt tcttgtgatg taaatttaac cagcctaaga ccttctaaat caacgggcat     43440
     acgtgcgttt tctccatagg taacaaaatc aaaccctgat tctgtgttcg ttgcccatgc     43500
     catcactaca ttgccttgtt ctgccaactt atccacttgg aaccagatca tctctctaat     43560
     tcggcggcta acatcaccaa catagacacc agctcgtatt tcaagcaacc atacagctaa     43620
     acgcccacgt aaccttggag gtacagcctc ggttactaca acacacatac tcataatgtt     43680
     tcctaccccg ttctgtgccc ttcatcacct atcgattccg gctcaggtaa agcaggcggt     43740
     tgtgcgtctt catatggaat cggaggacta atttcacccg cattcaaaat atcttcaatt     43800
     agcggaatta atcgtttaag cgttctatct tttcgaaacg cttcgcgaca agcaatgcgc     43860
     acttgcctgt ctggagtatt cggtttttta ctggctacga gaaaggcaac aggaaccacg     43920
     gtttcaaatt taatgacatc ggcaatatca taaacaaaag aaagtggctt acctgaatgg     43980
     agaaaaccaa tcgcaggtgc atagcccgcg gctaatatcg cggcctccgt aacaccatac     44040
     agacaagatg tcgcagcact aatgcactga ttaatgacat cgcctttttc ccagtctttg     44100
     ggatcgtaac gtcgtccatg ccactcaata ccgtattgct ttgccaacat ttggtaaatt     44160
     tttcgaactc ttgccccttc aataccacgc aattgatcaa cactgcgcct ttctggagct     44220
     ggttcaccaa agcgtagctc aaacatttta cgtacaactt ttaaacgcaa agtttcgtct     44280
     aacgctaatt ttgcttgata caatagtttg tcagatcgag cacctccggg ttgacctacg     44340
     gaatacagcc gaaccccagc ctccccgacc caaataagca aagtacctgt ggttgccgcc     44400
     agttttactg ctgcatggct aattctggtt ccaggttcaa gcatgatgca gacgaccgaa     44460
     cccacaggaa tatgcattcg ttcgccatta acttcatcaa ttactacaaa tgcaccatct     44520
     ttgacatcaa tacgaccttt gccgatgaaa atcattgaat tacggtcttt aatggggata     44580
     ggctttaaag gtacaaagga catccttgtc tccttatgtt atttgtttga tggctgataa     44640
     agtacgtgct cgcctttaac taaggcttta aatagcggta aatcatgttg atatttacgc     44700
     tgtacagccg taaatatttt tttcgcgtct tgattcaatt tttcaactgc accttgtctt     44760
     aaggcttgcg cctctttgcg atcaacatcg agtaatattt gctgaataat ttgttgagca     44820
     tttgcggtga aacgctgcat tgcttgctct tttattcccc ccacaaactt cttatcgtaa     44880
     ccaataccaa atagcttatt aaaggaaatg gacagtcttt ctttttgttc taagcccgcg     44940
     tcaacaacgc cgctaatacg ccccacattt ttggaaagag aggatggcat agaatataaa     45000
     tcgtagactc gccctaatat ggagccttga tcggcaatgt tccctccaac cagtaaatcg     45060
     agcctcccga taagtaactt gcggtattgg tcaatgatca gggctggttt aacactagcc     45120
     ttctccacct ccttaccaac aacatacgct gtcaactctt gccacgattg ccaatgttga     45180
     tttcgagcac ataccgcata cgttccgtcc tctttctctg ttcgaggcgt ataaggatgt     45240
     aaccaccacc cagcatgagc atctcttcca ttctttgttg atccataaga gcctgtatat     45300
     ttgactcgtt ggaatgttgt tactgtatat tcactgctat atccgcaaac atcacataca     45360
     cattttttgt cttcaatagg aaaattgata tggtaggcaa gcgcaaacaa ccccctttct     45420
     aaacctatct tttgcgcaaa ataaacatca ccactgggtg gtaaatccca catataacgt     45480
     gattctgcac cttcgtctag atttgcaaac gtctcaaaaa aatcgatggc aaccgtattg     45540
     gctaacaccg ttgtttttac gttttttccc gccactaatg tggttattgc accaccacct     45600
     ctgatccccg ttgcgccagt cggtccaaag cattcgcctt ttatgttcat atgcaaattg     45660
     taattcaata catgaacaca atcagcgcac acggcgtcgg cttgttctac ttccgaaaat     45720
     agtccaagcg cattcgctga gcctccacat tcaataccag aaatcaattt ggttatcgga     45780
     ccatcggcta tcttggcttc tacgggaaat gttgactgca taaaacaatc atcttcaaac     45840
     catttggttg ctattttttc tatcgcctca tcatattgct gctcggtaac accatgttgt     45900
     aaataactct ttaattcaac caccgtaggc tttaataaga cagtggtaag cgatgccaaa     45960
     agttgcaaca tcgctaattg agtttcatca aaatagtatt gcagctgata gtcatgttcc     46020
     gaggtaagaa tggtttttaa cgacactttc ccttgagtgg tcgaaataaa cggatcttta     46080
     agcagattca caagcctctc cttctgagcg accactaaca tacacggttc ttatggcgta     46140
     ttttctggct acaggggtaa ttagatctct cacttgtaag gtagcaacgt ggttactacc     46200
     ttgaatgtca ctgaatattt gccctttttc acctaaatgt ttcagtgcat cgctagggtt     46260
     agactcttcg agtacacatt caagcaatgg gcgagtcaag ggacaacatt tacgcccttg     46320
     aaaaatagta aacacaggtg attttaccgc ttgtatcaat agcttaatcg tttgttcatc     46380
     cgcagatatt gcaaaactat gctcactatc acaccaatat tcacggtagg tcggtttagt     46440
     acctttttgt atttttccta atggactacg aaagttttcc accgtgtgat aatccatcat     46500
     tttttcaccg gtatgatgaa cttgtaccgc aatcgtcaat ttcgtagaga gttcatgaat     46560
     ttttgcatgc tcatcacgag atattccgag cgccgcacaa agtattccca caattgcaga     46620
     tcgtgtagga aaatgattaa ccctgcggtg aacatcgaat gtttgcaacc cgtaagctga     46680
     aagcccttcc gttttcaaaa ttagggtttt catcacatgg tgcatattat tttcatccat     46740
     atttcacccc aattaaaagc gaatatcact gatagtattt accacattaa ttcttttact     46800
     ttgagcaacg tcggtcatat caaaaacaat cgctttagaa tctaactcgt acccttctac     46860
     caatttttca taatgcttta ccaagctttc aatcgaatgc tccatcactt cacccgtatt     46920
     caagatgggc tttctgaaag cattcgcaag ggataatggc tggttagatt gagtgaccat     46980
     cacgaaatcg gcgtgattat gggctgcaaa cgttttctgc tttgctgatg gtgtcacctg     47040
     agcaaaacat cgcaccatgg tgtttattat atcgctgact tcctcaacgg acttaccgat     47100
     attcttggcc aacaagtcaa catcaataga ggcatagcgg taaaatacac ctgagctaaa     47160
     ttcagttgta ccgatgtggc ccgagccctg cgtggcaagg tcatcacaag cggtaaacca     47220
     atccacttct atatctgcac tgtgtgtggt taaactatgg gcaacactca ttgcagcttc     47280
     tacattacgc tccggacagc tggcatccat acgtccagac aaagcgacat cgatcgtggg     47340
     gatctgaaca atttttttta gtgcttttag ctctgtaccg gattggacca tattaatcgc     47400
     ctcacggatc gcaccaatag aatacggctg taccgcatca aaataacgag aggtttcacc     47460
     cgtctcttta tttttctctt ttttaacttt agaacccata ttaagcaaaa catcttcaat     47520
     tacagatgtt tctacttctg gcaattgctc aatacacaaa gtgagcagct catccatttt     47580
     attggtgcga atagataact cggcaacgct ctctttataa atatcactct gacgaatggc     47640
     acgttttaaa cattgacttg aaatacggct acgcgttgtg ccgccaaata ctgcggtttt     47700
     ttgtaagcca gaatcatcac ggttcatcat cgatgatgaa tgggaaatta aagtatgaat     47760
     attgataaat gtcgtcattg gtaaatcctt gatagtttaa attcactgag ctattcggtt     47820
     aatcttgatc ggccaaaata tattctttta acaattgtct tcgggtattt tcaccccagt     47880
     attgcgccaa tttccctaag ctttttagct gtatgttttt acagcgaact aattgacgtt     47940
     ttagatattc gatgccgtta tctccgctac ggataatttg ttggatctgg ttttcgttca     48000
     cgcctgcttt tagtaacgca atagccacac tgctaccgtc ttcttcttgg gttagatcaa     48060
     tagcaaccat caggtataga attctttgtg tctgtttatt gtcattagtg cctgaaaact     48120
     ttaaaactcg aaaataagcg gaagaatcag cgagcttgct caagttacaa cgcttaagat     48180
     cagcttgatc gccctttggt aaacgacaat aggcttgata aatctgttga tacatctttt     48240
     tccccttgag ttaacttgct ttagctaatg acaaaagacc tgctccagcg tgttttttcc     48300
     gaccaatccc catcactaag acgctgtaaa tttgatctgg cttatcgacc tgcaatatcc     48360
     cctcaaaaca tacgaatcgg ctagtaaaac ttttgcgact tttcactaac acggattcta     48420
     atgcggtaac cgtcacattt gcccctctaa gctttctttg tagccattgg atctgttcat     48480
     tttcatcttt aatttcgatg acttttttac cttgactcaa acactttgtc ggattggcta     48540
     acaacttaaa tttgtagtat tccccttggc taatctgtgg atcaaacagc ttactctgta     48600
     acactgtggc tttaacatta ctctgaggtt cacttgccga ctgtaacagc accattactt     48660
     gtccggatgt attgatattt tctacgcgaa aaagatgatc tcttttacgt tcagacgagt     48720
     taggaaataa ctcccatata gcctgatgct gttcatacgt atcgataaca ctaagcgcca     48780
     ccattgatat atacatcacg atctcccgtt aatattgata taaattggcc atatctttga     48840
     ttaattcttc ggcaaaatta caccgagttc ggtgtaatca atatcttgtc ctaccgtggc     48900
     tttaacgcag taataatcag catcttgaat acctcgcaca tgtttctttg caatagaaac     48960
     cgtactcaac tccctatctt gctgttcttg ataatctccg ccgtgaagta actttccatg     49020
     ttcatcaact aataccaccg atactgtcat ttcaccttca cgagtcagta atgcgcaccg     49080
     tgggtcaacg tcacttaagg gtttggattc caaattagcg ttcattttgg caacataaga     49140
     agatgccgag ttgctatctt gatactcatt gaataagctt tctaacgctt caggttcttc     49200
     tgcaaacatt tgttcagcgt gtacatattc aattgcctct cgataacaat caggaaacgt     49260
     tagtacttga tgctcatgta aatactgctc tgtccgatag agtgagcgga tattacgata     49320
     aacaaaacca ctcccttgat agtgtgtttt ccaatcactc gcttttgttg agggtattag     49380
     cgtaataaat actggttcgt ttacactaat cgtacgttta gcaagttcac tatccactct     49440
     atcgtgtcgc cataaacgcc ccattcgctg cattaaaaat tcaatcggag caatttggct     49500
     gaccattaca tcaaaatcca gatcaagaga ttgctcaacc acttgtgtcg cgataagaat     49560
     ccgacctttt cttggtgcat ttttaccata aacattcaaa actgattttt cgattttagc     49620
     gcggtcagcg aaggtataac gagcatggaa aatgtcaata tcaagctctg ggccttgatc     49680
     tttaggtaac acttcttgca gagataaata caatttctgg gcgtcattga cggtattaca     49740
     aatcaccccc accattgcgc ctttcattgc ccaattgagt aactgttgct gttgctgttg     49800
     atttggcagt aatgttgctg aacaccattt ctcagccttg atctgcttac gtacggtgcc     49860
     tgtagttaat gtaaattcat tcgtttcccc ctcaacggag gtatgagtta tcaatggata     49920
     acaatcgctc tgagtactgc ctccataagg gcgaagtaat ttgtttttct gcgtattcgg     49980
     cagtgtggct gataataaaa tgacacttga aaacgcttgg tgttgtcctt tgaggacttg     50040
     ctcaatcaac ccatacatat aggcatcaaa actatgaatt tcatcaagta ttaaaaccga     50100
     ttttcgtgta ccaaaggatc ggataaattg gtgtttaata ctcaacaccc ccattaaaat     50160
     ctgatcaacc gttgctacgg acatcgaacc taagaaagca cgtttattag atcgatggag     50220
     aaacccattc tcgtctggtg ataaatattt atcttttaat atatagcggg atttaccatg     50280
     agctaaagtg acagtgctgt cgggaaatag tttttctgct gcatcaccaa tacgatcaaa     50340
     cagtccgttg gctgtcgctt gcgtcggtaa gccaaagaca ataccgtcgg ctaatttatt     50400
     ctctatcaac cgagaagcat aagctaaagc aaactctgtt tttccggaac ccgtatcaga     50460
     ctcgacaata gttaaacccg gttgctgtgg tatttgttct atgagcgttt gaatgcctcg     50520
     tggtgtatag ccattaaata agaattcaaa acctgcacca ctcaagactt gaaccatgcc     50580
     agattctata agtgcagcgt ctgctttcgg tagaatttgt ttatagtact gataaagatc     50640
     taaatctggt tcttgggtga aattggtaat cgaagaacca atccagtctg atacgctgca     50700
     caagcctgct aacatcggga tctcacccac gtcaggtatt tgcgataacc ccgtccattc     50760
     taaacagaat ttaacccact cttcgcgtgc atgtttatca agttcgatca actcatcatc     50820
     agcatcaggt tcggcttctg gactaaatgg gtcaagagaa acatcacagt aaccatgatg     50880
     ccctgccacc gctttcatcg cttcattatt gccgtgtact tttcggaaat gtaaatatcc     50940
     aaaagatcca tgagaatagg cttctgattc cacctcatat tcattacctt gaagcttgat     51000
     acgaatcgac tcaacaaagt tctgaaaacg ggcatcaaac ttaccgaagt catgaagaag     51060
     aacaaaaaac agcacaatag agcgtgcttc ttgttccgtt tttccaatat gtgcagaaat     51120
     ttgctttagt aatacattcg agcgagtaag ccatttatct gccaccgctg cgacatctaa     51180
     acagtgataa ggaagtaaat gataacctat gtcagcttgt tctgagtctt tctctacttt     51240
     tccccagtat ttgaaatatg tggcactaga cataaataaa ccctttgaaa atccataagc     51300
     aacttcgcgc ctgctcaatt agacaccaca cagaatacca atataagcaa ttgatttaaa     51360
     tgaccaacaa taagaaacat atgtcactca tcacttataa tgaaatacct aattgatggg     51420
     tagcggttcg ttactttatt aaagttaaaa gacaggtaaa gggatgattg gccttcaggc     51480
     catattcatc taaggacgta atctaatcac taatcattca tacattatat ttatatggta     51540
     aatatcattt agccgtatat gtatgagtta aaactcatat ttggtttggg gggttctgtc     51600
     gcaaatagcg ttttttagcc aaaatccaaa tttaaaatcg attgaaaaca gatggttaaa     51660
     aaatgaaaaa acgtccaaat ttgctatttg cgacagaacc agacattgcc ttaccgagta     51720
     ttcgataagc tacgaagggt taatcaagcc gttgttgggt gcagcattag cttttgctaa     51780
     gcggagtcag gatgaaagaa gtgagatgtt agagagaacc cgccaagtca atccagtatt     51840
     gttcgactca gtggactctg atgattaagc aatgtgacat ttttaaactt gctctaacat     51900
     cgggaatacg gtttacaggg gttatattaa aacactatca attcttattt ttttctcgca     51960
     tgtaccgtgc gaatgctttt acgtgttcta aaacatcttc aatacctttt tcacaatcaa     52020
     gaagctgatc aggagtactc gttaatattg gtaaacactt aacttctggt tttggctctg     52080
     acaaccatct ccaagctcgt gggatcgttt ttaacacatc agatgcggtg agaatttcaa     52140
     gaatctcttc aactttttga tggtgtttaa accatgatgt tggtttgatt gctgaagatt     52200
     tcttacccgc aattcggcat ggtagttgag attctgacag ttcgctattc ttaatatatt     52260
     tcaccgtcca atcagccaga ttactaagtg acttattagg cttacgatat tcgttattct     52320
     ctctggaggg gacaacaaga ccaattttta ttggcgagcg aagcgatttt tgattgtgct     52380
     cacgtatttt ttttaaagca gggacaatat cggtgtcatt ggtaacaaag ataatttgtt     52440
     ctaacgtatg atccataact gcgtcataga cagcttcaat cgctacattt acatcgctct     52500
     gtttttcttc taatttccaa accttaaccc ttgcacaatc ttttggttct ttttcgattc     52560
     ctgcctcatg atgctccact ttcgggtatt cgactttatc aactgcgtag ctacctttga     52620
     acgtttttag ccaattttca ctatggagat aaagcgcgtg atgataggaa cgctggtcat     52680
     tgactgaatt agggtctgct gctgctttat tggtaatctc agcggtaaag tatttgatcc     52740
     ctacatcatc gtgtaaggtg gcattgcgta cgtcagaacg agggataata tgttcttcaa     52800
     aaagcttaac taagtctagc catttatatg gtgtaccttt caaacagcca taataaaaat     52860
     tgtaaccatc aatatagatt cgagtacgca cgatattatt cttattttta ggcttcagat     52920
     acgaaaaaac cgaccagagg tcggttcgtt ctgcccagct ccaggggtcg taatgccacg     52980
     cgtggaagaa gggtaagtag tgatataatc atatcaatac tgacgtgatt ttcaagtgtt     53040
     ttttataaaa aaatacttcc caccaacaag ttgatgggct tatatctcga tgcagtatgt     53100
     gcccattacg taaaattgcc aattttagct ctcaaaatta tcaccagaac accttaaagg     53160
     ctcgtagatg caatttcaga gaactgatca aaacagtatg ctttcgaaac ggcctgtaaa     53220
     ttggcaacag ttttagccaa tttacatatt ctaattcccc ttcctagagt tcacacacaa     53280
     atattcgtta agagtctatt tttatcatta ataaatcaga ccaatcaaaa ctgtaaagtc     53340
     agtcggcaaa accaattaat cgtcactaac gattgttttt tgtaatttcg catataaaac     53400
     catatgccat gccgtctgtg acgtataggt tatgaattta gagtatctat gtggctgtca     53460
     cctcagaatt aatctctaac atttattaaa tggatagatg aataatcgtg tatgtttcat     53520
     gacacaaaat aacagtgaca gcgtaataac aaagggcgta tccattactg gataaacata     53580
     aattaccgaa tgtaggattt tttgaaaaaa gctaatcaaa aacggatttg gacagaacct     53640
     tgttacaaac ttcaggcggt ttctaccctt caaataactt ttggtatccc aaatagaaat     53700
     acgccatcat tgcgacaggc ggaacttgtg attacttttg gacaaaagtt ctttagttca     53760
     attgctaatt ttcctaatca tggactagct agggtatggc agcccacctt agcaaaaggc     53820
     aagacctgac cctcatggtt cttctttccg ttgaaagtta ctagaacttg atactgagca     53880
     aactattacc cttatgtatc atgtcgttgt atgagtgcat tgcattgagt ggcacaatgc     53940
     atgtttctac gtttagattt tgaattctcg ctcggtaagt tggatgccga atttaaaaag     54000
     gatatgtagc cctctttcga tcataagttg tacatcatga agctatcaaa agtccgtatc     54060
     tcaaatttcc aatgttttga ccaaagtcag acagaaattg attttgaaga acaactcaca     54120
     gctcttattg gattgaatgg cagtgggaaa acgtcaacac tccaagcatt aagtcgaatg     54180
     tttggcgtca gtgaatcagc tagaaaaata aaggttgatg actttcatag tccatctgtt     54240
     actgtgcaaa gagcggatga actgtcaata gaggcatggt ttacttttcc agaagtcgaa     54300
     tctgaagcgg acatgatcgc tgttgcagga acgtttaacc agctatgttt taagtcttca     54360
     ggcaatgaaa tgatgcttag gttgaagctt gaagcaaaat taacggttga tgatatatcc     54420
     cctgacggtg tcgtagatga aactgtctac tatgtactga gtgacagtga tacttacgct     54480
     agtgataaat gtcgagagct gcgtaggtct gatagaaata acattcaagt acattacatc     54540
     ccagcgagta gaaacccttt taaagaaata agctcatcta caaagatgct actgggtaga     54600
     ttgctaaatg caattcaatg ggaccaaagt gcagatggcg agcttcaaaa ggctttagag     54660
     ttaactgaac aagcaagtga agaaatctct aagaatagtg cgataaaact tattgagaaa     54720
     cagcttcaaa atagctggca agaaatgtat tcaggagatt atctgagtaa ggcgaaagtc     54780
     aattttttgc cattgcaaac tgatgagcta ttaaaaacaa ttactctctc tttcgagtct     54840
     gatacaaata atagaaaggc tacgatggat aggttgagtg atggtcaacg ttcgctatta     54900
     catatcgcca taatacaagc agtacatgaa ctagagtcaa aaacgcttag agagcaaagt     54960
     aatcgagttc attttgattc taaaaagttg aataccccaa tttttactct actagcttta     55020
     gaagagcctg aaaaccatct agcccctcac ttcttggggc gaatagtaaa atctatgagt     55080
     tccttggcta aatctacaaa cgcacaggtt ttggtcacta cgcactcccc aagtttagta     55140
     ggtagaatcg aaccgactca aattcgttac tttaggttgg atagtacatc gagaagtacg     55200
     gttgtctcaa aaatacagtt accagaccag caagatgagt tgtataaatt tgtggcaggt     55260
     gcagttaagg cttacccaga gatctacttt gcccgtttgg ttattttagg tgaggggcaa     55320
     agtgaacaaa tagtcatacc aaaattgttg tccaaagttg gtattgatat tgatgatagt     55380
     ttcgtttctg tcgctccttt aggtggtagg catgtaaacc atttttggaa gcttttgaat     55440
     gggttaggca ttccatacgt tactctttta gacatggatt acggtcgaaa tggtggagga     55500
     tggggtcgta taaagtacgt agtcgaccag atggttatgt tagggaagag tgaaataatt     55560
     acgggtatac ccaattggga tgtaagcgac tctaacccta tgactgatac gctatctaac     55620
     agcaaaaata ctgcggaggg attactgaat cagcacggtg tattcttttc tacgccactg     55680
     gatttagatt actcaatgca gttgtcttat cctaagaact ataatgaaaa gcttactggt     55740
     gaaaatggtc cgcaagataa agattgggag tccttaaagt ctgctgtttt aaagactaag     55800
     tattcaaagg gaattgctga ttattattat gatgagatgc aagatgaaga tgctttctta     55860
     tggtacaact acaggttcct tggtagtaaa ggtaaaccag tttcacacat aaatgctcta     55920
     gagaaaattg actttaatct agctgaaaat atctcccgaa tccctacagg tattcaggag     55980
     atgataaagc acatagaaaa tgaaatttct aatctctcgg agtaatattt aatgattgat     56040
     gcttcagtgt gggaaccaaa ggacggatta aaatttgacg ataagtctct aggtatcatc     56100
     aagtgtgata ataacatttc aattatggct ggacctgggg cgggaaagac tgaaattctt     56160
     gctcaaaaag cttgcttcat acttgaaacg gaattatgtg cttggcctta taatgtttta     56220
     tctatttcaa ggaagcgaga atctgcttca aatataaaaa acagagtatc acttagatgt     56280
     ggaaatgtgc tatctgaaag gtttcactct tttacaattg aagcctttac gaaaagtatc     56340
     gttgataggt ttatgcatat attgcctaaa cacgaacaac cgaatgaaga ttataaattg     56400
     gtttttaatt ccagagatag taacttcaga gacaagttaa cttttgatca acttactatt     56460
     accgctttga aaattgtaaa ctcttcttcc accttaatgt catcgataag agcgacatac     56520
     aaatatgttt ttattgatga gtttcaggat ttgaatggcc atcaatatga tttcgtgaag     56580
     tcaatatttt gtgggtctca aagtgttgtc actgttgtag gggatacgaa gcaggcggta     56640
     atgaagtttg caaacgcttt gccagatggc tttattaagt tcaaacaaga ttttaaagct     56700
     gacttaaaga taatttatac caattttaga gcagctccag aactgaaaca attcatagat     56760
     tgtataggta atgaatggtg gccgattaat actgagagtg ttgaatctaa tattgacagt     56820
     gttgcattgg acaaaggtga ctattctcta cttaatttca atgacgaaga gcatgaggtt     56880
     aagcaactat ctctaaagat taagaaatgg atttctgagg atggaattaa acctaaagag     56940
     attgctattt tatttagaat aaatacaaat aacaactaca gtaaaaacct caatattgcc     57000
     ttactagacc taggtgtttt aagtataaat gaaagtaata ttcaagacta tctgtccgag     57060
     cctttaggaa aagtgctagt ttcattatta tgcttattga ctcgccctag agatataaaa     57120
     gcatgggagt gccttagaga ttcatatctt tattgtagtt ctagtaactc tctacataac     57180
     gattttgagt taactagaat actcaaacta ataggggata ctccgtttta cggtgatgga     57240
     gatgctaaaa cattcgatag tatattagat gtaaccatcg aaatcatgaa tgaattcttc     57300
     tatgagaact taaagaaaac ttggacacaa tatcgacaag gtactctaat ggatgagact     57360
     tttcatggtg tactagaaga gttaaaagaa gcaagaaaca taagttcttc gtggtcaggt     57420
     gctgttgatc ttatttcagg agttggagct gttcgaatga tgactattca taaaagtaaa     57480
     ggtttggaat ttgaagctgt agtcttactt ggactggaag attattctta tttccgatat     57540
     ggaatgaccc aaaaaaaatt ggatgaggag cgttccacag tttttgtcgc attgtctaga     57600
     gccaagtcaa aactattaat atcgagtgca atgagtcgga aacatacagg tccatccaag     57660
     tttatgcatg ttaatagtat tataaatgac ttaactaagt tcggtatgaa tagatcacgt     57720
     gttgataagt tagacacttt gaagatatga tttttagtta cgatcaagga aaacagcaac     57780
     accgccgcat ttctaaaaat gttggcagat accgaaacac taatggctgc tgagcagatc     57840
     aagctggaag aagtggaaga gcataggaag attgccgcct agtttccaat ttatctcatt     57900
     ctataaagcc cggttcgccg ggctttattt ttccattaat atttaattct tccaggcata     57960
     gcggccatta tcacgcacaa aagcatgttt aatgttgtag gctgcaatta aatctccacg     58020
     ctttactgca tccctgtagg ctcccttcac gatcttcagc accccccagt tacttttata     58080
     atttttcaat cccagtcgtt tgagtattgc ccgcaaccga cctgctttca tgttctgacc     58140
     ttttgccgag aggttcgcgg aaatggttgt aattgttaat ttagtttttg ctttgctggc     58200
     catggttata gctcctttgg ctgtgttgaa tatatacata aaggcgagca gagcttcttg     58260
     agtttacaaa actatcaata acaaccagac accctgatgt tgatgcgcac acatttgtac     58320
     atacaaaagt gagtacaaga tttgaccagc agcgctgcat tcggtaccat gacagcaagt     58380
     aaataaccat aaaaacaatg caatacaatg acctatgaaa ataatgtgaa atttaccgat     58440
     acgtcttctt agctctatgc gacagttcaa acgattaaaa acagaaggca aagtatttgg     58500
     ttctatgaat gattttatga agaaagcatt taaaggcgct ttagatgaaa ttgagaaata     58560
     ggagactgta aaaatcgata cgacatatgc ctgttacgtt aaatccgccc cgaacggacg     58620
     tgatcgtgta actgccagat acgagaaagg ccgcatgata gcgacctttt ctgatagcga     58680
     ccattagggt tggtttttac gacacattac ggatgttatg ttaactaccc accaagctcc     58740
     gtcttaacag acaaaaagga tgtatcgtta acatcagtaa aaataagcga aaaatgagat     58800
     tcacctaaat taatatgaat tacgttttga cctctaagtt cttcacaaat aaaaaaagaa     58860
     acgacctttt tcttatcgat gaaaagaaca ccttttgaac aactcggagg aagaaatttg     58920
     tctttattgc catggataca aacagttttt gttaagcata ttttgattaa atcattcatc     58980
     atcaatttct ttaagtttaa atgtccagaa gatatatgcc tgttattgct cagcttttca     59040
     agctgccccc cccaatttca actcaaaatc cagcacacta agtacatatc gcatcaaatt     59100
     gcctgttttt tatccatgtt ttcagtgggt aatcaatgct aggctagacg ttacaggcaa     59160
     ccaaaatcat caccctgtaa cacaaaaaag gccgccattg gcgacctctc tacgattctt     59220
     acttcggggg ttacgttaaa ttccctgtat ccagtaaaga aaaggctgca caaggcagcc     59280
     taatatcaaa caacgagaga ctcacagtag aggctagaac gcctttcatc ttgataagga     59340
     atacctttac cttcattaat ctctacaaat ggctgaaagc atccatattc agtatcaaaa     59400
     tgtccctctc tcttcatttc agcgcgacga tcagggccat atacaatttt tccgtcatcc     59460
     gttaaccgtc tttgtggaac tgagcaagca acgaggaaaa cgtctccatc ccataaagct     59520
     acatttccat ttcgaccacg cccaagataa taagagccga gatttaaatc acctactgta     59580
     agcatcgttt tcatgtctga acccttttac tactaatctg ctttcttata acgagttgct     59640
     gttttaaaga tggttttatt tacaacctga acaccagttt tatctatgac ataaccaagg     59700
     tgctccataa tttggcgcat catatttcca ctgagttttt tgtgagcatc aaaaacactc     59760
     ttctctacta aatctttatt aaaaacatca aagctactat gcaaaatcgg acctagagct     59820
     tccaaggcag gtttctttaa aaacgtagct gtttcagctc gaataatatt gtcaccttca     59880
     cataagaact cccaaatttt gattgctgtt tcttcttgag ctaattgagc gaatgctggt     59940
     gatggttggt aggttaattc tcgattttgc atttctgtac cctctgattg atgaacgagt     60000
     acattttaac ataaaaaaag taacctagta aatatataag gttacttttt tactgggaat     60060
     gtctggaaga tctaatttct ctgattccga ttatggctgt tacgttaaat aggcaaaaaa     60120
     acaccccaag acgacaggcg taatggggct taaaactatt aggtgcatct cttttaatag     60180
     ctatgagtat gatttcatat gctgatcgcg agctttgtga tctatttcaa atttctggcg     60240
     tagaaataac atgaccgtat aattgccata tacgagaaag gccgttaaat agactattat     60300
     ttagacatga aaagacgcta atagtgacct ttcagaagaa catgctccgg tgattatgga     60360
     aaaataagtt attggcaatc ctatcaataa aggttgggta ccgtattatc ttaattcata     60420
     cttaaccgta tgtttcttaa tagctaattc aaagccgtga tttcttcact cacggctttt     60480
     cttcatttct tgccctgatt gggctctaga ccgcacttaa accaaaaaca aaccgaatct     60540
     aaaccgaaaa ttattggctt tacgtcacat agtcgatacc caaaagattt ggtattaagt     60600
     gcaaaaagac cgccataaaa ggcggcctaa aactgatacg cagttttttc tgcatcagga     60660
     atgctttcgc gttccagtgc acttaaaaaa gatatgaaga attgagagcc attgcaaggg     60720
     ataggggtag aaaaccctat tagcagcttt gaaacgcttt acgagtgtta tattcaattt     60780
     agctttaatg cgtctatgct ttaaaagaac aatacttttc ttctacatac atgcaaaagg     60840
     ccaccgctcg ggtggcctta cttcgggtgt catggtaaat atggcatggg tattgctaaa     60900
     gccactccaa tggcaatgaa tggccacata cgaaaggttc ttggtatgat gtttttaaga     60960
     aagatttgca gtgtaatgag taaagaaaaa aaacaattaa aaaaacaaaa agctttaaaa     61020
     gaaaaattac tatttgctat gtcacaatca attgaacgaa ttgtctaata atatcttgct     61080
     ataccagaga cccacaaggc tacccgcaag cgtgagacgc tttacgaacc ttacgttaaa     61140
     tcccttcgtt tgaaatgacg gagtttaatc aaatacatcc ttacaaaagg aaactgcgtg     61200
     aattttcttg atcgtctaaa tatctatttt tatcacaaag acaggcataa aaagtggccg     61260
     agcaatcccc ccaaaattct tggctggcga gatgaagaat cacagctgtc acgctttcgt     61320
     atcattgcca aacaacacga ctttaaccat aaaagcgtac tcgacttagg ctgtggttac     61380
     ggtgacttta agccctacct tgatcagaac tatgatattg ctcattacac aggcgtagac     61440
     caactaaaag ccttcgttaa cgcagctaaa aaacgtcgat tgactgcaag ccgattcgtt     61500
     cacgcggact ttgctcgaca aactttgcca aaatacgaca tagtgattgc ttgtggctct     61560
     cttaactacc gcagcagtga tcctaattac ctcactagaa tgataagtaa aatgcaccaa     61620
     gccgccaatg aagccgtgat atttaaccta ctaaatgcag agacgtttcc cgaagatgcg     61680
     cttttaaaaa gttaccattc agagcatgtg ctctcttatt gtcgcaactt atccgcagac     61740
     agctatatcg tcgatcaata tgccactgac gatttcacgg ttgtattaaa gaagtcagca     61800
     aactcagcct aaaagacaga taaactggtt ttgatattta acctactaaa tgcggcatat     61860
     atgttgcaac actaaaactt tgtggtcttt tgatacggtt aggcgactcg gtagctattg     61920
     ggcatcccga gtttagtaaa gcgatttaaa acagaacaac caagtaacat ttcctttgac     61980
     tggttttcaa tctttctgat gtgtaatgta ttgcctatta tcttcttgta acgttgcatg     62040
     gcagtttctg aaatattcct tttaccgtat tgccgcacgc tctgccaacc gataatgcca     62100
     agtgcgaagc aacctatcag gttgctcatc ctcttagggt gatgagcctc atcggcaaac     62160
     gtattgtctt tcggtggaat aacaatctct gcatccggaa aatgagcgtc taatgtctgg     62220
     tacaccgcat tggtatcata cattttgtcg gcactgacgt gctcgacatc cgtaatgatg     62280
     aactgacata acgtcccgac aacctgagca tccattgtgt ttttaccagt gaggactgcg     62340
     ctttgaatga agtgagcctc atcaacagcg aaatgcgcct ttcgccagct tcgttttgca     62400
     ttaaccttat gtttttcttg atgccattca tccttcccga accgcttgag ccccattgaa     62460
     tcaatggcta ttgcagcaat tttgtcatct ggcctttcat gctttctaaa tcgggctctg     62520
     tcgcaaatag caaatttgga cattttttgg ttttttaatt atttgttttc aaatggtttt     62580
     aaatttgaat ttttgctaaa aaatcctatt tgcgacagaa ccccatttac caacaattct     62640
     atatttccta tgaccttacc aaataggcag aattagaaat atgacacatg gtgcaagtta     62700
     tgaaagttga ccttacaaac acagtgcgat atgtatcctt tatgataaat ggctcatttt     62760
     tcatccacaa aatcggtgga taaccaatgc caagccacgg tttatggcag ctgaccgaaa     62820
     acacttaaat caattgcacc atatttctgt gcaattgatt taagtgtttt ttatttgtgt     62880
     cgctttataa agagagaaaa cactatgacg tgtagaagtg gaagaaaaaa aagctgcatg     62940
     gaagcagcat ataacagcga aacccttcat caaaacatga tattcaaagt gcctgttacg     63000
     ttaaatctgc gcagaacgag cgtgatcgta taacgtcaag agacaacaaa acccacataa     63060
     ttgccagctt tgcacgtagc cttgtttatt gaaattcatc accatgattt tcaagctttc     63120
     tatgaccaca atcctgacat tcaacatacc tgtcaagcaa ctcaagagaa gccaacactg     63180
     ggcttgccgt tccagagaaa aaaccttcaa gaaaggcttt aaactgttcc tttttacttt     63240
     tgccgtattt cgatggtttt tgcttgatga tctctttttg ttcagttttt ttacagcatt     63300
     tttcacaaaa ttgcattgcc ataatctaac ctttattaat cgtatatcta gtatctagcc     63360
     atactactaa acacttacta attttaattt tactcctacc ccacagttta aaaaatcact     63420
     aacatcatca agactcggta gtgattatgc tctttacgtt aaattgccaa ctttaactct     63480
     caaaactccc atctgaacat cttaaatgct cgtagataca atttcataga gctaactaaa     63540
     gctatatggt ttcaaaacag cctgtaaatt agcaaccgtt ttggccgatt tacatatttc     63600
     aattccccgc cctaaagttc acacacaaat cttcattaag agtctgtttt tatcattaat     63660
     aaataatacc aatcaaaacc ataaaatcag ttacctaaac caattaatcg tcaatgacaa     63720
     tcggtactga agtatcaatc acaaaacaac atgccactta cctatactta tttgtcagta     63780
     gtaaactcca tacatcaaaa cacatttgtc ataacttata tgtcacgtat gatagtgtca     63840
     ttagttaaat ggcacattaa gagacactat gtacatattt gggtatttaa gagcatcaac     63900
     taacgagcaa gatgcacaaa gagccaagag cagcttaaag tcttttgtgg aagaaaaagg     63960
     tcgtcgtgtt gctagctggt attgggagaa tgtttcaggt gcatctttaa aaagacctga     64020
     actcatgcgt ttactcgatg atgctgcacc tggtgatgca attttaattg aacaagtcga     64080
     tcgcctttct cgtctcaatg acgaagattg gatcacactc aaagcactta tccaagaaaa     64140
     gaaccttaaa attatcagtc ttgatttacc aaccagtcat acagcccttt cagcacatat     64200
     taatgatgag ttcacaaatg caatgctcag agccattaat aatatgatgt tagatatgct     64260
     ggctgcgatt gcacgtaaag attatcaaga tcgccgtcga cgccaaaaag aaggcataga     64320
     aaaagcgaag aatgaaggta aattcagagg gaggcaggct gatttaaata agcacgaaca     64380
     aatttacaaa ctacgtgtaa taaacgggct cagtattgct gatacagcta agctcgctga     64440
     cgtgtcatac cgaactgtta ttagggtggc tcaaagctac aaagccaatg agccagaatg     64500
     aaaaacactt taggacacag gattggaaga tgccgaaaac caactacctg atttatcgag     64560
     ggcgattatc gccgattgtt acgaccatct tttaacactc aaccaacgca ttgaagatca     64620
     agagaactgc ttcaatatgc tggtatcacg tagccataat gccaagaaaa taatgaaagt     64680
     agctggtatt ggcccaatca cggctacggc tgttattgcc agtatcggta agggtgagca     64740
     gttcgataaa ggccgcgact ttgctgcttg gctgggtctt gttccttccc aatactcgac     64800
     cggcggtaaa cctcggctag ggcgtattac taagcgaggc gataaatacc tcagaacgtt     64860
     gctcgttcat ggcgcgcggg cagtcattgc caacctcggc gctcagcctc tggtgtaaag     64920
     gcctcgttga acgacgaggc ttcaaacggg ctaccatggc tctggcagcc aagaatgcgc     64980
     gaattatctg gtcgctactt cgtcacgata ccgactacga accgattaaa aactaacagc     65040
     tgtagaaccc catttaaaat ggagtaacaa gcttcaccgg ggcactgcaa tagccaatga     65100
     tgatatatgg ttcagaccat ttgcgggaaa acctgataat gcggcgggca ctttagatgc     65160
     cttctaacga atgaggaacc gcaaccgcgt agtttcatca gggtcatggc aaatatgcca     65220
     ataaacagac cgaatgtaga gcggcagtcc caaactttat attacctgac gctgttgttg     65280
     acaatcgcga agcgatggcc aactgttaat tttccgttta aatgaatctc aaatgacaat     65340
     aaaacagagc taatttagac cattttaatt aattctgcat tttttgtttt tttccactgt     65400
     agaaaatcca tatttttaat aagttggatt gtagacttat atcctaattg tttaacatta     65460
     atacttagct tgttgttaat aacgtctacg cgaacccatc ctgagctatc tttatgctta     65520
     cttattaaat tactaatagt tccttttaat tttttaattt cacagttttt cgcctttggc     65580
     tgtgctgctt tgggttttgc tgctttgggt tttgctgctt ttggttgtgc tgcctttggc     65640
     tgtgcttcct ttggctttat attattgcat tctatataac atacaccact gattgttttt     65700
     ctttgtagct tagtaataat tgaactgtat atgtttttaa tgaaaatatc ttgatattct     65760
     gctgaaaaat tacttatgat acttttaatg tttttatcaa tatcgcttaa tctataccaa     65820
     tattcttcat cttcgttttt tgataaatca actgcataat tcattactga atatatatca     65880
     tcgcagtcta taactggcgg agattgctct atattatgat tttcttttgt tatttttgtt     65940
     tcgctttttt ctgtgcatat gaaatgtgta catgattctt ttaaaggtgc gggggtttta     66000
     ttttcacctg cacatattac gttaaaacca gactgcctaa ctctagtaac tagaggtgta     66060
     aaatcacaat ccgaggtcat aagacagatt gtatctacat ttaaatcctt cctatggatg     66120
     aaatccatca cactaattgt aatagctatg tctgtggcat ttttgttttt tgttaagtca     66180
     aactgttgaa ctgactcaat accattttta cataagatct tttcccatga ttgtaaatta     66240
     ggtcgtttcc aattgccaaa agctttcctt atacatgtgt ctccatgatt ttttagttca     66300
     cttaatacaa attcaagatt tgatgatgat gcattatcag catcaataaa caatgcaact     66360
     tttgattggg cagtattcat acatattata taaaagataa atttagccta ttataaccaa     66420
     tgatcacata tatttccttc ttgaatgttc attaaatatg gggttcagca ataaaggtta     66480
     tgaaatatac tataacttaa ctcaaatatt gaatttgaat aaatggtgtc cgattactac     66540
     aatcaaactc ccatagttga aaaaacagtt ccaaccacac cgattaaatc acaaggaaat     66600
     agtccagcta atattcaggg ttctgtcgca aagttatgaa gaagtacaag cgtactgatt     66660
     ttcagataca attaggctgc tagcgcgtaa aactgccccc aaacagataa gccttcaggg     66720
     ttgtcgagct gtccattttt aatcatcgcc cacagttcgg gtctgttgca aaaaatttaa     66780
     ccaaggctca gaatcccttc tttaccctct ctaatctagc gactcaatga ccaaccacga     66840
     atttaaatgg aaacactttg cccctgagat cattctttgg tgccttcgtt ggtatggttc     66900
     gaccccaatg agctacgcga acctcagcga catgctggca gagcgaggga tttcggtgaa     66960
     tcgttcgacc atttatcgtt ggttcattga atattcccct aaattacgta agaagttacg     67020
     tcgccatcaa taagcaaggc gaaacgctgg atttctattt ttcccacaaa cgcaataaag     67080
     aggctgctta tcagttcctt aaacggtgcc tgagatatta cgacgtagat aatcagccta     67140
     aaacgttaaa caccgacaag cattcctcat acgccaatgc gattgcccgt ttgaagaagg     67200
     aaggacgact gcgagcggat gtcgagcagc ggcaagttaa gtgcctcaat aatggtatcg     67260
     agtccgatca cgcccccatc aagaagctcg ttgtagccac cggcggtttc aaaatacgaa     67320
     agcgagcctg gtcaaccatc cagggattcg aatcattacg gatgttgaac aaaggccagt     67380
     ttgatttttg gcttcgtcat gatgaacgta aaactcttgt gcgggagaga tccgccttca     67440
     tgaatcgtct cttcaatgtt gaggttgttt accagtaatc attgagccca tcactggggt     67500
     cgctctgcct tacctgatta gttgcaacag acccgtatct gaaaatcagt acacttgtac     67560
     ttctacagaa ctttgcgaca gagccaacaa gcacgatgcc tctataattg ctatcaatga     67620
     cgcaataatg aaaagcccct atagccgaca aaactaaaga ggctttgatt gtatagcaat     67680
     gcaactaagt gagtacaata tcacttgcat ttacttagtg cagatcctac atgtgaagat     67740
     actaccttta atttttcaga gagatttcgg ttttcttctt caagtagatc acgctcattt     67800
     tcaaggcgat ttacttcatc ttcaaagtca gtcgttgtat cttccacacc atcatcgtat     67860
     ccaaccccat aagcttgagc catgttgatg cccaatgttc cgatgagctt ttcttcactg     67920
     aggataaact gagcgaactc actatccgtg ttttttggta aagccatgct ctctcctttt     67980
     catttctcgt agtgccaagc gtttttcctc tggaaatgca atcgaataca actccagagg     68040
     acggcaactt gatgagttgt tcagggtact ttttcccttt attgggaaat ggacaatatt     68100
     gttttctctc atcgtttacc tctactagca gcaattattg acagccaact cagttagtta     68160
     gtgatcaact cttaggttgt aaactatgat aagtattcaa ttcgcattat catagaatca     68220
     agtcaaaaac aaaaaattaa cccaacccac cttgacatgc aggcaattcc atgagtgaaa     68280
     aagcgtataa tctaactgaa ctagaggaca aacttaggcc tctctttgag gctgggatag     68340
     catataattt gatgctttta gatgagtgta ttgacttgaa taaagttaat aagcttgagg     68400
     atctactaca taaattagaa ccttcttcga aacccaaggt tactgaaata ataaacacta     68460
     tttttgaaca taaattacca cttaaaaaaa ataaaatact atcaaagcta gaaatagatt     68520
     ctagcaatga gatatttgag catatagaat acatatattc acattttcca tcatggcatt     68580
     gggatttata tcaaaaaaaa acaagagaaa ctattaaccc taaattcctt ttatctttat     68640
     attttaaaat tagaaaaata tttgacaatt cgaaacaaaa gaaaataaac cctcacatac     68700
     cacataactt aaatgaagct ctaaacctat tatatcgtct taattacgca ttaaccatta     68760
     atatggtttc agtaataaac tctggatata ataaccaaac atcattgtat gaatgccata     68820
     tattatacaa taaacataac acaacaagag caaaagcctt aagagtttcc ttagctaaca     68880
     tcaaatcaaa taacccatta tctttagtta aacatcaacc actcaaggga aagaaattac     68940
     cagattggga aaaagtacta gttactttgt catgccttca atctggaatg tctaattcag     69000
     agtttctaaa agcacattta aagtcgattc caaaaatgta ttggaattct tacatagaac     69060
     catctatctt aactcatcat cgaaaacacc ttgctaaatg taaaaatagt ttaaagtcct     69120
     tttattacac tcaagactta aatacagaaa gtagtcataa aactaaccaa gatacagcag     69180
     aaatggtcgt tagaacaact attgccaact tatctaaagc atacgccatt atgattaact     69240
     attctgattt tattattgaa ctaacttcat ttagtcatcg aatattaaac cacctaaata     69300
     acaaacatat gatacattat ttcctgaata aaatatcatc aaccgacata tcaaccaaac     69360
     atggatatgc agagttagac gatctaataa atattgattt gaaagagttt ataagaattg     69420
     aatatcaagc attgtcatca ttgctgagct ataatttccc ttcaacatgt tggggctact     69480
     ttattataga tggatttata ccgcctccca tgaaattact ggcagaatat gtttcaataa     69540
     aggaaaagtg caataaaaaa tttagttcat taaaacatga acaaatagaa aattttaaag     69600
     aagaatctat atatgaatca tcttcagcca tggtcaatat attacgcact gtatttcaac     69660
     cgattcttcc ttcatggatt atgctgaaaa caacaccatc attcactgtt tatgataaag     69720
     ataatctaga tatggaagtt aagttaaatc tagctttaac atttgaagaa ggaaggttca     69780
     atattaattt agacaaccct tcttttagtt ttgttaaact agaagagcta ctaataggtt     69840
     tagcctatca gtatcaaaat tcaatcatca ctccaaaatt atccatggat aaattcatga     69900
     ctactcttga ctcttgctac aaagagccaa ttaataatgg taagttaaaa agaggaaaaa     69960
     aatcagctga agagttttta aatcatttta atgagggtga ttattctaaa ggtatttagt     70020
     cagtagcaga aggaagtgtt gttcagagag caattaatat ttaatgtatg acatcttggc     70080
     tatctttaaa agccacacta caagcagtgt ggcggatcta attgatttga gttatataag     70140
     taaattgtgc gttcattttc aaatgtggta tacaccaaca gggcttggga caactctcag     70200
     cgagattttc catacttaat gtagttcatt gaaatctaat ttagcaaaat cactgacaca     70260
     cttttgtcca aatgtgtgtt taaaaaaggt cgcagaagtg acctttttgc attgtttttc     70320
     cgttgttaat gcttgtgttt ggtttacgcg tgttatgttc aatacaaggc atcgtgaatc     70380
     tacttaatcc gcattgttaa gtcttttagc acgccactga ataagtgcct taactgtatt     70440
     ttatataccc ccttcaatac cccatgagca ttcgtaatgt aatcaagatg gtttttaact     70500
     ttttctgatt taccaccagt tatattgtca tagataatat tagttttaaa catatcttcc     70560
     tggcactcca ttaaatgaag accaagttga agattaaaca ttactggata attaacatcc     70620
     ttaatagtca atctggttga ttctttaggg tatttagtaa tatcttttcc tgaaataaat     70680
     atactcctgc gattctcgtt atcaaagtta aatatacgtc tatcgtgttc ggaatcatat     70740
     aataaacctg acccttctgt gagcttatca tcctttaact ttattgcttg tagtaacgtg     70800
     ataccatttt cagggaatct atttataaac gaaggtatag ctattttttg tgtgccgtcg     70860
     gagaaggaat accatgatat ttctgtttca gaatctatct catgtaactt tggatatgaa     70920
     agccctaact ctttatggac taataacggc gctgatatac taatgaaata aaaattgttt     70980
     attttcaagc caaatacact tggcattgtt tgaaagatag ggccatccgt gccaataaaa     71040
     ttaacaccgt ctgggtcttt atcattttta tatataatta acgctctgtc actacgagct     71100
     actctatcag atataaaata atgggggttt ataccattat gatttttatt taatacataa     71160
     tctgagagcc acaacccagt tcttattttg tcaaaccaat ctaatagtgt gttcaggtct     71220
     ctttcttcaa cattattccc actcataaca tcaatgagta ctggtttagt ttctctttct     71280
     aaaatcccaa attcatcatt acaagatttg catgcaggaa atgtatacga cgaaaatcta     71340
     aatattttat ctttaaacgt tccattcgcc cagtctctgc caaccaatat ttctctattt     71400
     aagtcacctg tcatttcgat aagccacttg ggaattatat gttctttgtt tgggcttgtt     71460
     gcaactaatc agatagtgca gatctaccca gcgatagact taatgattac tggtaaacaa     71520
     cctcaacatt gaagagacga ttcatgaagg cggatctctc ccgcacaagg gtttcacgtt     71580
     catcatgacg taaccaaaaa tcaaactggc ccttgttcaa catccgaaat gattcgaatc     71640
     cctggatggt tgaccaggct cgctttcgta ttttgaaacc gccggtggct acaacaagct     71700
     tcttgatggg ggcgtgatcg gactcgatac cattattgag atacttcact tgccgctgct     71760
     cgacatccgc tcgcagtcgt ccctccttct tcaagcgggc tatcgcattg gcgtatgagg     71820
     aatgcttgtc ggtatttaac gttttaggct gattgtctaa gtcgtaatat ctcaggcagc     71880
     gcctaagaaa ctgatatgca gcttctttat tacgtttgtg agagaaatag aaatccagcg     71940
     tctcgccttg cttattgatg gcacggtaaa ggtagtgcca tttccccttc actttgacgt     72000
     aggtttcatc gagctgccac gaagagtctg tccggatgaa ttgatggcga cgtaacttct     72060
     tacgtaatgt cggggcatat tcaatgtacc aacgataaat ggtcgaacga ttaaccgaaa     72120
     tccctcgctc tgccagcatg tcactgaggt tcgcgtagct cattggggtc gaaccatacc     72180
     aacgaaggca ccaaagaatg atttcaggag caaagtgttt ccatttgaat tcggggttgg     72240
     tcattgagtc gctagattag atgggaaaga cggaattctg agccttggct gaattttttg     72300
     caacagagcc ttattgcagg cgttatggca atttgcccta taaaataatg gattacgcta     72360
     caagtgaaca tggaggttcg agtggcaaac cgtattaagc ttggaattgc tttcttttta     72420
     atttcttttt tgcctagctc gataattgta tatgctcaat atatgatttt gggttttaac     72480
     tgtgattcaa aatttggttg ctctggtagt tttaccataa tggttatggc tatagcatat     72540
     ttatcactat tgtcagcctt ggctgttttt ttatccgatt ttattcgtgt ttataaaagg     72600
     ggctgtggtc tatcaggaag tggaaaagta atagttctta tttttggttt tatcttaggt     72660
     ttgtctatta atcttgtgtt ttattttctg ggtgatttaa cattaaagta cttagttata     72720
     ctgtattttt tagtgccatt tacttttagt tatttggtca gtttctggaa aaattaactt     72780
     tttgccataa tcgggtagcc gagggtctct aaccctcagc ccccacaaca ccctgcatgc     72840
     ggatccgcac agggcgtttc ccaaagatgt ttaaagaaag ttggccgatg agctcctact     72900
     ttccccaatg ctggctactg tattatcaac gccaccatgc ctaaagtccg gtcggatata     72960
     gcatgttgag ttgcacagac tcctcattga cctctaggtt caggccttca ccgtgtccca     73020
     accattacga tgggcgtttg gctactatgc cgtctgctga cttctgctta atcacttaac     73080
     gagttacctc gtaaagcgct atcgttgttc atcggtttcg ctcgcgtaag ttgatgatgc     73140
     ttacacgcca ggcctgttga accagagacc aagctggtta ggttaacgat cgcatgttaa     73200
     gcagatctcc ccagataagg acatggactt tcactgcgca actgcatcgt ttacggtggt     73260
     cattaaatca cttggcttcg tcgtcttgtg ccaactcgcc tctgacctac gcctcagatg     73320
     ttcttgttca tcagctcgca gttttgctag cggcttcctt cagaccgttc ctcgcggaaa     73380
     agcccttgcc attcgctagt agttaacatt taatatcaac gagttgaata ttaaatggtg     73440
     attttcctac agaggacttt cacctcatta gttcatgccc atgctgggcg tacacaaaac     73500
     catcaagttg acacgtttta ctcagcggtt ttggtatgga gttcagtgcg cttggtgagt     73560
     tagccgtggt gcaacttatg ttagacgtta tatgccagtt atcgattgtc tctaggaagg     73620
     agttgttgtg aatatttttg aattttggcg tgaggtaacc gaagataaat ctggtcggta     73680
     tattcaccat gaagatgagt ctgttttgag cgaacttagt catcttgttg gggatgactt     73740
     agatttttca tttccacctg gcccaatatt cggccctcta aaaactgcaa aaattgtttt     73800
     atgctatgca aacccaggaa ttgatgactt gtcattagat acaattcgaa gacctgagtt     73860
     tcaaacagaa ctatttgatc aattagcagg tattaataac tatccacatc acttgtcagg     73920
     ttggaaagaa tggtttaatc aaagagctaa tagtttattt gatggtgata ttgagcttgc     73980
     tggcaaacac atttcagttt ttaatttaat tccttatgca tcagtcaaca tggataaagt     74040
     tgaaaaagtt gctaactgcc ttccaagtgt ttgggttgcg caaaattatc ttagatctgt     74100
     tcttatacca aaggcaaagt ctggtgatat tttactcatt atgtgtagat caggtcattt     74160
     gtgggggctt aaatcagcac atgggtgtga caatattcta ataaataatg ttcgttctgg     74220
     atttagtcag gatgttaaga acaaagttaa agaatggtgt catcgacaag gcatataatc     74280
     gggtagacga gggtctttaa ccctcagccc ccacaacacc ctgcatgcgg atccgcacag     74340
     ggcgtttccc aaagatgttt aaagaaagtt ggccgattag ctcctacttt ccccaatgct     74400
     ggctactgta ttatcaacgc caccatgcct aaagtccggt cggatatagc atgttgagtt     74460
     gcacagactc ctcattgacc tctaggttca ggccttcacc gtgtcccaac cattacgatg     74520
     ggcatttggc tactatgccg tctgctgact tctgcttaat cactgaatga attactccaa     74580
     tcagcgctat cgttgttcat caattcgctc atattggttg atgaggtcaa tatgccaggc     74640
     cagtttaaaa cagcgaccaa gctgttaaac cgttcagtta gatgccttta aattattgta     74700
     catgaacagt tagtgataat tggactttat gaacggttta gtgatgagga acgagaatgt     74760
     ccaataaggt acacctttgt gtgcactgtc acccccttga acgaatcgtt cgattcgttc     74820
     ataatgaacg aatagacgaa taaaaaggaa aatgacttat gcaatcttta acggccaata     74880
     ctgccaaaac taaatttggt gatctactca tgaaagtgca acgtgagcca gtacagatct     74940
     gtaagaacgg ttcacctgtc gctgtcgtca tgtcatgtga agaatatgct caactagaag     75000
     ccttaaaact gcaatttata aaaatgcgct ttgctgccgc agaaaaagac attgctgaaa     75060
     ataaccttgt cgatggcgaa acgtttttta accaactaga acaggacatg ttggactaat     75120
     gagcaaatat gtactgtcaa ctggcgccca aacagatctc attgatattc gacaatacac     75180
     gctagataaa tggggacaag ttcagtggaa aggctacttt gcagagctta agtcgacgat     75240
     gatcctgctg gctgaaaacc cagcgattgg ggccaaaacc ttagatctag gcgataacta     75300
     ttttcgtttc cctcttaaac atcatgtcat ctactacatt cagcaaccga cacaaattgt     75360
     cattgttgcc gtgctaggta agtcgatgtc ccctcaaaag catttcgaaa tcattaacta     75420
     gcttactcct taatttttcg cctttttatg tagaccctca acgtgcttgg ggctttatca     75480
     aatcccccca aaagagcaac tgtaaatgct tactgtaatt acgataatta cagtaagtat     75540
     cgtaattaca gatttacaat gatgagtgtt ttttatacaa tggtttaaat gagtattttg     75600
     gctgggagaa ggtggatggt tgcggcaaaa gtaacagtag aaaatgtgtt taccacggca     75660
     aatcggattg ttgagcaagg tgaaaagcca acagtactca aagtccataa agccttgggt     75720
     gttggtagct acagcacgat ccagaagcac ttgaaagtgt gggaagaatc tgatgctggt     75780
     caggttgcaa tgaaagctgc attgccagaa gagatcatct tgcccaataa tgctcaggat     75840
     gccatgggtg atgccatgaa aataatttgg agtgcggcac agaaagcggc caattcactg     75900
     attgaaaaac accaactgac tatccaatct gaccatgaag aacaagaagc cattgttcga     75960
     gaggtactga gtaaagttga tgtggccgag cagcgcttaa aagaaacgga agcacgagtt     76020
     cgccaactgg aatcagagcg tgatgcttcc atcgatgagc gtgcaacctt acgccaacag     76080
     ttagatgtct cacaacttga actatctcgt gagcagagca ccaataaaga gaaaataaac     76140
     cagcatgctg tggaagtggc tagcctaaat gctcaggtgg atgaactaaa gcaagcgctt     76200
     acccaatcga atgacaacct atccagcagc cagcataact tgattgctga gttagccaag     76260
     catgatgaaa gcaagcagca actcgcatcc gtgtcggctg aactgaaagc cagtgaacgt     76320
     ctattaggta attttgaaag ccaaatttct gagttaaaag tgagtaatcg tgaatatagc     76380
     gataatgttt ctgaaacccg tcatgcgcta accgatgcaa gagtatctga gtctgcacta     76440
     ggtgccgaac tgaaagatgc gcgtaatgtt attgatgagt tgaaagttca gctatctgaa     76500
     tcacaacaag gctttaacaa ccttaagaac gataatatta aattgcgtaa cgtgttggat     76560
     ggtgaaattg gtcggtattt gcagggtttg agcaagaaat aaaggtctaa gggtctctgt     76620
     ggtaaatttt ggcgtttttt aactgtcggt attcagtaga ttttaaatta aatgggttat     76680
     ttagcatctt gcggtaagtt ttaaaatcga ttttttggct gcagcctagt gataccaagg     76740
     gttacagagg agcctggtga caaaccgttc ttttagtcag agagccctaa aaagaaaacg     76800
     cagtcatgat attcatcata agtaaaagcc tgcgaggcaa ccaatacttt ttttcggtcg     76860
     ctcaacccgc agattgcccc aaaacagtga acattaaccc accaatgtga cattaatgtt     76920
     cataaagcca ttcatctgct tcatcaaaca tttcttcaag taattgactg actaattttt     76980
     tatcggtact cgatgccctg agtacagtta atacattgct gttcccttta cgaacgcgaa     77040
     taatcgcttc cggccaacgt gacaatatac gacgattaaa ttcgttttcg agctttggaa     77100
     accctttatc agggaggccc gttttattca ccatcaattc aatgttcata caacaccttg     77160
     aaacaataac tgtatataat tacagtgatt atatacacag catgtttaaa agtaactgcc     77220
     ttacatcaca tattaaccgt ctaaaaataa ttcatttgtc gtgttacatt gtcactgttc     77280
     atctcatcta aaaatacctt cagcgatcga taaagagcat cgttcaatat aaacccgctt     77340
     acgctcttat attgaacgca gtgaaatata ctaagcctaa ctacccctaa gcatgaatga     77400
     atcgcttctg gtgcgtttca gtgccaatat tgctgtcatt ccactccctt ttctccctgc     77460
     taagctgcac ttattccgat gaaggttgaa ataagtggat tattgtcctg tcggatgaca     77520
     aaaaagtgtt atcacgcgtt ctttatgttg acagtattga gaggggtaag aggtcgatga     77580
     ataagtagat tacctcgatg gggcccgttc aatgatctaa taagataaag agagtggagg     77640
     tgctgatgat tgaatgggag gtacttgata gcagcttgct gcgtgttgtg ttctttttac     77700
     tatttatttt tatatttatc ttactattaa tctaactaca gagtcttcta acttacatcc     77760
     cttattgagt ccttttattg aacagctttc tagggcttat ttcttgcact atctttcttg     77820
     tgaataagtc tttccttata ttcgtattgg aaacatcaat ggataaacag agggagatca     77880
     cacttctagt gggtagagag taggaagttc gaagaatatg agtcattcaa caaggttcag     77940
     acgtgcagaa tcctccgctc tcgcggatac gttaagatcg ctataatggg acttgttgag     78000
     ggtgttggta agcagagaac accgttgagg tcgtgtcagc atagtcatca agtatcgagg     78060
     cattgaagat ttgctgtacc ccttccatca agagacgtcg agctacccaa aagaaccgta     78120
     gccctttttt cttctgccgc tctcttgtgg caatgatcat ctgacaaatg ttgctataac     78180
     gcacgacttt cagatcagag aagaaacgct cggtaaattg cttgaatgcc gcggcactac     78240
     gcaccgtgcc gcccttttta tcgacacaca cattgatgcg ttcggaatga aagtaaccgg     78300
     cgtggcctaa gtgttggatc gcttttttga agctgttcgg ggaaatgaat tcaccgaatc     78360
     gaagcgcata gtcttcttgt aactgatcgt agctaatcgt tctaatgcct gcctctgtcg     78420
     gcacaccgac acggccacca atcagatcgg tattcggcaa gatgcaggca agcaccttgg     78480
     caataagacg tcgagattga acattattgg tcgcatcaca ccaagcacgc aatgaaggga     78540
     atcgattcgg gttctcgatg aactcttcac acccttttaa aatacgggca aattcctgtg     78600
     gcagagtttc aacctcacca tttctcagta atcgtctcgc acgaaagcca attgcaaaat     78660
     tagcagtttt gtcctgggct tgcagttttt ggttttcgcg ttcaaccacg tcatgatgca     78720
     actcgattaa cgtttgcttg cgtaacttac gcttagcacg gtattcggca tcatactcac     78780
     ccttattcgg cgcgacgggt ggtgacggtg ggatcgaagt tgagggttca gcgaatgtca     78840
     tgacacacat cctcagcata attacacaaa gcaaacgcta aggcattatg gtgatagaaa     78900
     tggtgtctag atctttggaa ctgcaagagg cagcaatatg aaaatgtcat gattatttct     78960
     ctagctgatt gaaggtctgt ttgggtctca ctccaaacat tgataccaat ttacgataaa     79020
     agatcagaaa gatcaaattg ttattaattt ttgaatttca gatacaaaaa aagccgactc     79080
     agctagagat cggctttttc tgcgaatgct atgttgttag attgagggtc taacacattc     79140
     taaattggtg agtacagtac ctaattcact actcgaaact aggtgctgtg ctctctaaat     79200
     cttcctttat tctaacctac taattttata gttcaagaaa tttcatcctc taaaaattgg     79260
     aatctgattt agatttcaac ttatatacca attcgatata aacataagct ttatttgtat     79320
     accgcttggg agtaacatca atgagcaaga ctttataaag aaagagataa acatgaaaaa     79380
     agctgttgat gaattagaac atgagttaaa tgaaagccgc ttatttgcaa aacaaatgga     79440
     taattcacag gtactagtaa ttgactatat ctacttttgg tatggtgata agcatggtgc     79500
     aaaagcaaag tttgcacgag atcaaggtgt ctcctctcaa caagtaaaca gctggctcaa     79560
     aaaaaaatgt tatatcgaaa acaaacagat taagcatcca gatccgaatc ctattgattt     79620
     gatcaaacca agctggatta agtcctattt catataagga gagataacga aaacaattat     79680
     taaagtgcgc aaaatcatta ttaatagtcg ctaattacga gagattaggc ctctcgtaac     79740
     tagctaacca aaataaccgc gttgaggagg ctataatggc taaagtcaat cctatggatc     79800
     taactcataa gatcaaccat tctttaccta caaagctatc agatataatt aattgtctac     79860
     ttcctgaact atcgccaaag gaatcagagt gtctttattg gatcgcgaat ggtcatcctt     79920
     atgcaataat tgctaaacga atgaacatat cagagcgaac tataaagttt catgtgaata     79980
     attgcgtaac aaaacttgat ggaaataatg tatacgaatt aaaaatgatt ata            80033
//

If you have problems or comments...

PBIL Back to PBIL home page