(data stored in ACNUC8465 zone)

EMBL: CR380956

ID   CR380956; SV 2; linear; genomic DNA; STD; FUN; 1195132 BP.
XX
AC   CR380956;
XX
PR   Project:PRJNA13831;
XX
DT   30-JUN-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 12)
XX
DE   Candida glabrata strain CBS138 chromosome J complete sequence.
XX
KW   complete genome.
XX
OS   [Candida] glabrata
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces;
OC   Nakaseomyces/Candida clade.
XX
RN   [1]
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RG   Genolevures
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
RN   [2]
RA   Frangeul L., Sherman D.;
RT   ;
RL   Submitted (05-MAY-2004) to the INSDC.
RL   B. Dujon, Institut Pasteur, Unite de Genetique Moleculaire des Levures, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   lfrangeu@pasteur.fr E-mail:david@labri.fr
XX
RN   [3]
RP   1-1195132
RA   Sherman D.;
RT   ;
RL   Submitted (25-JUL-2008) to the INSDC.
RL   INRIA uipe Magnome,  CR INRIA Bordeaux Sud-Ouest Laboratoire Bordelais de
RL   Recherche en Informatique, FRANCE
XX
DR   MD5; 31184417e7ff5c4b4c1b338c05aae0ba.
DR   BioSample; SAMEA3138172.
DR   CABRI; CBS 138.
DR   EnsemblGenomes-Gn; CAGL0J00143r.
DR   EnsemblGenomes-Gn; CAGL0J00231r.
DR   EnsemblGenomes-Gn; CAGL0J00979r.
DR   EnsemblGenomes-Gn; CAGL0J01133r.
DR   EnsemblGenomes-Gn; CAGL0J01551r.
DR   EnsemblGenomes-Gn; CAGL0J01617r.
DR   EnsemblGenomes-Gn; CAGL0J01705r.
DR   EnsemblGenomes-Gn; CAGL0J01749r.
DR   EnsemblGenomes-Gn; CAGL0J01826r.
DR   EnsemblGenomes-Gn; CAGL0J01994r.
DR   EnsemblGenomes-Gn; CAGL0J02596r.
DR   EnsemblGenomes-Gn; CAGL0J02772r.
DR   EnsemblGenomes-Gn; CAGL0J03410r.
DR   EnsemblGenomes-Gn; CAGL0J03883r.
DR   EnsemblGenomes-Gn; CAGL0J04730r.
DR   EnsemblGenomes-Gn; CAGL0J06446r.
DR   EnsemblGenomes-Gn; CAGL0J06644r.
DR   EnsemblGenomes-Gn; CAGL0J08503r.
DR   EnsemblGenomes-Gn; CAGL0J09438r.
DR   EnsemblGenomes-Gn; ENSRNA049500934.
DR   EnsemblGenomes-Gn; ENSRNA049500955.
DR   EnsemblGenomes-Gn; ENSRNA049500964.
DR   EnsemblGenomes-Gn; ENSRNA049500974.
DR   EnsemblGenomes-Gn; ENSRNA049500989.
DR   EnsemblGenomes-Gn; ENSRNA049519520.
DR   EnsemblGenomes-Gn; ENSRNA049519541.
DR   EnsemblGenomes-Gn; ENSRNA049519564.
DR   EnsemblGenomes-Gn; ENSRNA049519597.
DR   EnsemblGenomes-Gn; ENSRNA049519621.
DR   EnsemblGenomes-Gn; ENSRNA049519646.
DR   EnsemblGenomes-Gn; ENSRNA049519685.
DR   EnsemblGenomes-Gn; ENSRNA049519726.
DR   EnsemblGenomes-Gn; ENSRNA049519745.
DR   EnsemblGenomes-Gn; ENSRNA049519771.
DR   EnsemblGenomes-Gn; ENSRNA049519801.
DR   EnsemblGenomes-Gn; ENSRNA049519830.
DR   EnsemblGenomes-Gn; ENSRNA049519854.
DR   EnsemblGenomes-Gn; ENSRNA049519880.
DR   EnsemblGenomes-Gn; ENSRNA049519936.
DR   EnsemblGenomes-Gn; ENSRNA049519951.
DR   EnsemblGenomes-Gn; ENSRNA049520000.
DR   EnsemblGenomes-Tr; CAGL0J00143r-1.
DR   EnsemblGenomes-Tr; CAGL0J00231r-1.
DR   EnsemblGenomes-Tr; CAGL0J00979r-1.
DR   EnsemblGenomes-Tr; CAGL0J01133r-1.
DR   EnsemblGenomes-Tr; CAGL0J01551r-1.
DR   EnsemblGenomes-Tr; CAGL0J01617r-1.
DR   EnsemblGenomes-Tr; CAGL0J01705r-1.
DR   EnsemblGenomes-Tr; CAGL0J01749r-1.
DR   EnsemblGenomes-Tr; CAGL0J01826r-1.
DR   EnsemblGenomes-Tr; CAGL0J01994r-1.
DR   EnsemblGenomes-Tr; CAGL0J02596r-1.
DR   EnsemblGenomes-Tr; CAGL0J02772r-1.
DR   EnsemblGenomes-Tr; CAGL0J03410r-1.
DR   EnsemblGenomes-Tr; CAGL0J03883r-1.
DR   EnsemblGenomes-Tr; CAGL0J04730r-1.
DR   EnsemblGenomes-Tr; CAGL0J06446r-1.
DR   EnsemblGenomes-Tr; CAGL0J06644r-1.
DR   EnsemblGenomes-Tr; CAGL0J08503r-1.
DR   EnsemblGenomes-Tr; CAGL0J09438r-1.
DR   EnsemblGenomes-Tr; EFT00001981307.
DR   EnsemblGenomes-Tr; EFT00001981308.
DR   EnsemblGenomes-Tr; EFT00001981309.
DR   EnsemblGenomes-Tr; EFT00001981310.
DR   EnsemblGenomes-Tr; EFT00001981311.
DR   EnsemblGenomes-Tr; EFT00001981312.
DR   EnsemblGenomes-Tr; EFT00001981313.
DR   EnsemblGenomes-Tr; EFT00001981314.
DR   EnsemblGenomes-Tr; EFT00001981315.
DR   EnsemblGenomes-Tr; EFT00001981316.
DR   EnsemblGenomes-Tr; EFT00001981317.
DR   EnsemblGenomes-Tr; EFT00001981318.
DR   EnsemblGenomes-Tr; EFT00001981319.
DR   EnsemblGenomes-Tr; EFT00001981320.
DR   EnsemblGenomes-Tr; EFT00001981321.
DR   EnsemblGenomes-Tr; EFT00001981322.
DR   EnsemblGenomes-Tr; EFT00001981323.
DR   EnsemblGenomes-Tr; EFT00001981324.
DR   EnsemblGenomes-Tr; EFT00001981325.
DR   EnsemblGenomes-Tr; EFT00001981326.
DR   EnsemblGenomes-Tr; EFT00001981327.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00479; snosnR71.
DR   RFAM; RF01177; snR67.
DR   RFAM; RF01261; snR82.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 93937; 0.
XX
CC   This is an updated version of the complete genome sequence. The Candida
CC   glabrata sequence is made of 13 chromosomes (A to M). The sequence was
CC   annotated by the Genolevures Consortium.  For more information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195132
FT                   /organism="[Candida] glabrata"
FT                   /chromosome="J"
FT                   /strain="CBS 138"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5478"
FT   gene            complement(<1577..>4151)
FT                   /pseudo
FT                   /locus_tag="CAGL0J00110g"
FT                   /old_locus_tag="CAGL-IPF16371"
FT                   /old_locus_tag="CAGL0J00121g"
FT                   /old_locus_tag="CAGL-IPF7831"
FT                   /note="no similarity frameshift"
FT   gene            complement(<10142..>10213)
FT                   /gene="tRNA-Glu (CTC)"
FT                   /locus_tag="CAGL0J00143r"
FT   tRNA            complement(10142..10213)
FT                   /gene="tRNA-Glu (CTC)"
FT                   /locus_tag="CAGL0J00143r"
FT                   /product="transfer RNA-Glu"
FT   gene            <12254..>12577
FT                   /locus_tag="CAGL0J00165g"
FT                   /old_locus_tag="CAGL-IPF7824"
FT                   /old_locus_tag="CAGL-CDS5408.1"
FT   CDS_pept        12254..12577
FT                   /locus_tag="CAGL0J00165g"
FT                   /old_locus_tag="CAGL-IPF7824"
FT                   /old_locus_tag="CAGL-CDS5408.1"
FT                   /note="highly similar to uniprot|P07282 Saccharomyces
FT                   cerevisiae YLR333c RPS31B and highly similar to
FT                   uniprot|P07282 Saccharomyces cerevisiae YGR027c RPS31A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00165g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60666"
FT                   /db_xref="GOA:Q6FPX5"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPX5"
FT                   /protein_id="CAG60666.1"
FT                   /translation="MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQE
FT                   KFDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLEREGIIKPISKHSKQAIYTRA
FT                   SAE"
FT   gene            complement(<12843..>13682)
FT                   /locus_tag="CAGL0J00187g"
FT                   /old_locus_tag="CAGL-IPF7823"
FT                   /old_locus_tag="CAGL-CDS3763.1"
FT   CDS_pept        complement(12843..13682)
FT                   /locus_tag="CAGL0J00187g"
FT                   /old_locus_tag="CAGL-IPF7823"
FT                   /old_locus_tag="CAGL-CDS3763.1"
FT                   /note="similar to uniprot|P53217 Saccharomyces cerevisiae
FT                   YGR026w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00187g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60667"
FT                   /db_xref="GOA:Q6FPX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX4"
FT                   /inference="similar to AA sequence:UniProtKB:P53217"
FT                   /protein_id="CAG60667.1"
FT                   /translation="MAKKIKIIKKRDRKRVDPLAKQKLAWTTGHSLVVVCGILFSIAYF
FT                   FQILLFFKYRNWKWLFLRENKNYTFIKGTRWYHTILRHTPLLLYKTSLIGVFVSYGVTL
FT                   LQNWKGVDPSWNDLLASQNFQSIMIAALWFVSGGKSFYKLVPFMVLSYLHLINMKNEFN
FT                   GVDNHKEFSKKYKFQLNIVAYSELVVMLRLLIDALVMRTGTSGYMFVIYLGIYWLRLNY
FT                   SAYAQASVVQIIKLVDHKIPKQAQPLWTGFKKFLSLKISECIERNRQIEKEDAIIAT"
FT   gene            <14366..>15079
FT                   /locus_tag="CAGL0J00209g"
FT                   /old_locus_tag="CAGL-IPF7822"
FT                   /old_locus_tag="CAGL-CDS4103.1"
FT   CDS_pept        14366..15079
FT                   /locus_tag="CAGL0J00209g"
FT                   /old_locus_tag="CAGL-IPF7822"
FT                   /old_locus_tag="CAGL-CDS4103.1"
FT                   /note="highly similar to uniprot|P53215 Saccharomyces
FT                   cerevisiae YGR024c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00209g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60668"
FT                   /db_xref="GOA:Q6FPX3"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR025845"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPX3"
FT                   /protein_id="CAG60668.1"
FT                   /translation="MAKSKYEYVKQFESHDTLLPQCYIVVRIDGKKFHEFSKYYDFKKP
FT                   NDERALKLMNACAKNVVLQYRHEMILAYGESDEYSFVLKKDTELYKRRRDKLSTLIVSL
FT                   FTSNYVALWSKFFPGTNLHPKHLPFFDSRCVIYPNLETIRDYVTWRYVDTHINNLYNTA
FT                   FWQLIQKCGMNPQEAEKRLSGTVSSEKNEILFKECGINYNNEPEMYKKGSLITNKGEIL
FT                   HINVIDSLDSLFEGY"
FT   gene            complement(<15352..>15423)
FT                   /gene="tRNA-Asp (GTC)"
FT                   /locus_tag="CAGL0J00231r"
FT   tRNA            complement(15352..15423)
FT                   /gene="tRNA-Asp (GTC)"
FT                   /locus_tag="CAGL0J00231r"
FT                   /product="transfer RNA-Asp"
FT   gene            complement(<15883..>17376)
FT                   /locus_tag="CAGL0J00253g"
FT                   /old_locus_tag="CAGL-IPF7821"
FT                   /old_locus_tag="CAGL-CDS2093.1"
FT   CDS_pept        complement(15883..17376)
FT                   /locus_tag="CAGL0J00253g"
FT                   /old_locus_tag="CAGL-IPF7821"
FT                   /old_locus_tag="CAGL-CDS2093.1"
FT                   /note="similar to uniprot|P53214 Saccharomyces cerevisiae
FT                   YGR023w MTL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00253g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60669"
FT                   /db_xref="GOA:Q6FPX2"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX2"
FT                   /inference="similar to AA sequence:UniProtKB:P53214"
FT                   /protein_id="CAG60669.1"
FT                   /translation="MFVVLLLLSFAFAQIEPPAGGVGINNNNNNNNNNGTDLSSSNIIP
FT                   SSDPYSFTPDESTQLQVPSSTSSVVPVEPSSFTNSFSTLISQSPSTFSSTFSSTFSSII
FT                   PSSFSSLPSSSRSSQYTPSSTISSISSSSSLSSSSSYFSSSISVRSSYSSSSRSSSSII
FT                   SSSSRSTIAPSSSSSSFFSSAITSSSSSVYSSFSSFSSSYSSSSSSISPSSTLSTFSSS
FT                   SSILPSSTTSSSTTSISSSISSTTITTSSTPSSSSSINTSNVIITSVIEGKTILSNSYT
FT                   TITYSPESTAHKSPQNKSGNHGLSSKNKKIVIGCVVGIGVPLLIAILVLLYIFCIMPTR
FT                   TDFIDSDGKVITAYKRNIFVTIWYSLLGKNLDDARNFSSESPMGSDDNSSDFIITNDKD
FT                   VANTYEVPDIDTTQASANEEDDLINNIRGRNFKAHRHSTSLTSNIYTESSVDEFTTPSQ
FT                   GRQYDHLSIVNSIASENIIPEDFDDGYYHRGGNLNVTNY"
FT   gene            complement(<19390..>20301)
FT                   /locus_tag="CAGL0J00275g"
FT                   /old_locus_tag="CAGL-IPF7814"
FT                   /old_locus_tag="CAGL-CDS3583.1"
FT   CDS_pept        complement(19390..20301)
FT                   /locus_tag="CAGL0J00275g"
FT                   /old_locus_tag="CAGL-IPF7814"
FT                   /old_locus_tag="CAGL-CDS3583.1"
FT                   /note="highly similar to uniprot|Q05636 Saccharomyces
FT                   cerevisiae YDR280w RRP45"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00275g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60670"
FT                   /db_xref="GOA:Q6FPX1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR033100"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX1"
FT                   /protein_id="CAG60670.1"
FT                   /translation="MAKDIEISTSEATFIVEALRQKQRLDGRRLDQFRDVQIEFGKEYG
FT                   DVTVRMGKTLVQCRISCQITEPYEDRPFEGLFVISTEISPMAGPQFENGNSTGEDEVLC
FT                   ARIIEKAVRRSGALDVEGLCIVAGSKCWAVRADVHYLNCDGGFIDASCIAVMAALSHFR
FT                   KPDISVHGEDVVVYPVDEREPVPLGILHIPICVTFSFFNPQDTEENIKGDSNAEISIID
FT                   ATTKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALQLMQCCHKAYEITEQLTDMILK
FT                   EVKHDLAKRDKYSSILSSENAR"
FT   gene            <21048..>22742
FT                   /locus_tag="CAGL0J00297g"
FT                   /old_locus_tag="CAGL-IPF7812"
FT                   /old_locus_tag="CAGL-CDS1703.1"
FT   CDS_pept        21048..22742
FT                   /locus_tag="CAGL0J00297g"
FT                   /old_locus_tag="CAGL-IPF7812"
FT                   /old_locus_tag="CAGL-CDS1703.1"
FT                   /note="similar to uniprot|P38775 Saccharomyces cerevisiae
FT                   YHR045w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00297g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60671"
FT                   /db_xref="GOA:Q6FPX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX0"
FT                   /inference="similar to AA sequence:UniProtKB:P38775"
FT                   /protein_id="CAG60671.1"
FT                   /translation="MFDIGFLIKLSITVLAFVLGTNWLLSSFVLDFMRDWTQVALNQQS
FT                   NVSSVRKEKESAHYRNFLIPLGFPLTTGLSLSLGYKSRNGNVCDIWNAVMEVGEGQNTI
FT                   QLYNENGQLEKFSLSRLNGLVKKILQLEGIEKCRRIGITVPINTIQGFVLTIAGMVRSV
FT                   THSAPIQMLSSVPRSKIDGLDIIVIPTWKSYTRLNGSENWYSKILILEKEPMIENIPAN
FT                   VIFWDDLVNGSLTDSEFDYTCPEDMSDDKKDLMYVTSPQNQTNRFSQMNLVSTVASCIK
FT                   GFPVDHSLSEKDNLLVGAQQSKPLESLSVWPKLFAVLLHGGSVSFLKVTDTNLNNLDGV
FT                   TLASLSRQEIEILHREILSNNTSIFDRIKKKWAETLFSEGIFTQFAKKKISSIKNMRCI
FT                   YVVNELLNADIISSLDSSKIESYDTATVGNVLSSKLLGDIRSEFGCRVVQELVCPYMLM
FT                   GIISGTNYYDYRVFPENVDKLLACFGTLETNLEAKMVEVISKKKLDVTKRQGMLCIRGY
FT                   SIGKPLDEERLNHALQLSDTVGGADGWMPLIGVFGLFGTDGCLYIYK"
FT   gene            complement(<22849..>23733)
FT                   /locus_tag="CAGL0J00319g"
FT                   /old_locus_tag="CAGL-IPF7811"
FT                   /old_locus_tag="CAGL-CDS3660.1"
FT   CDS_pept        complement(22849..23733)
FT                   /locus_tag="CAGL0J00319g"
FT                   /old_locus_tag="CAGL-IPF7811"
FT                   /old_locus_tag="CAGL-CDS3660.1"
FT                   /note="highly similar to uniprot|P38710 Saccharomyces
FT                   cerevisiae YHR046c and highly similar to uniprot|Q05533
FT                   Saccharomyces cerevisiae YDR287w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00319g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60672"
FT                   /db_xref="GOA:Q6FPW9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW9"
FT                   /protein_id="CAG60672.1"
FT                   /translation="MDLLSIEKFLCDLSVNQVGPIIKKKSGTQHVYDLKTGERAVDIVT
FT                   AIDKQVEKLIWDSLKEQYPDFKFVGEESYVKGVTTITDDPTFIVDPIDGTTNFVHDFPF
FT                   SCTSLGLTINKEPVVGVIYNPHLDLLISASKGNGIRINREPFDHKAKLESMGPLYLNKS
FT                   VVALQPGSAREGNNFKTKMKTYESLLSCDEGFVHGFRNLGSTAMTLAYIATGNLDSYWD
FT                   GGCYSWDVCAGWCILKEAGGIIVGANPGEWDIPIDNRSYLAVRGTTEEGGKELQKKYVD
FT                   DFWKCVKGKLSYD"
FT   gene            complement(<24103..>26676)
FT                   /locus_tag="CAGL0J00341g"
FT                   /old_locus_tag="CAGL-IPF7810"
FT                   /old_locus_tag="CAGL-CDS0674.1"
FT   CDS_pept        complement(24103..26676)
FT                   /locus_tag="CAGL0J00341g"
FT                   /old_locus_tag="CAGL-IPF7810"
FT                   /old_locus_tag="CAGL-CDS0674.1"
FT                   /note="highly similar to uniprot|P37898 Saccharomyces
FT                   cerevisiae YHR047c AAP1 alanine/arginine aminopeptidase or
FT                   uniprot|P32454 Saccharomyces cerevisiae YKL157w APE2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00341g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60673"
FT                   /db_xref="GOA:Q6FPW8"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW8"
FT                   /protein_id="CAG60673.1"
FT                   /translation="MDREILPSNVTPLHYDLVLEPSFETFKFDGSVTIDLQVNDSTVDS
FT                   ISLNTLEIDIKAVTLDGSITPSEIKVDEAAQVTEFVFEKGTLSEKKSVKLEIKFIGILN
FT                   DQMAGFYRAKYEDKQTGETKYMATTQMEATDARRAFPCFDEPNLKSTFDVTLISDKHLT
FT                   QLSNMDVKSETIEGEKKITKFNTTPKMSTYLIAFIVAELKYVESKEFRIPVRIYSTPGD
FT                   EHLGEFAASLTARTLKFFESTFDIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVVDLLL
FT                   DKENSTLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPQ
FT                   WNVWQQYVADSLQRALSLDSLRSSHPIEVPVKNADEINQIFDAISYSKGSSLLRMISKW
FT                   LGEDIFIKGVAEYLNKFKYGNAKTEDLWDSLSEASGKDVTKVMNIWTKQIGYPIVTVNE
FT                   EGEKISFTQHRFLSTGDVKPEEDETLYPVFLAIKTKDGIDNNINLDEREKTIELKDNEF
FT                   FKINGNQAGVYVTCYSDERWAKLSKQAEFLSVEDRTGLVADVKSLASSGYTSTTNFLNL
FT                   ISNWSNEESFVVWTQMINSISALESAWVFEDESIKTGLKNYVTKLSIEKAHKLGWEFSN
FT                   EDSYSTQKLKVLLFDVACSNDDEKAQSAAIDMFNKYISGDKKAIPALIKPSVFNTVASK
FT                   GGEESYQKLYNIYKNPMATDEKLAALRALGKFKEDKLITKTLSYLLDGTVLSQDFYIPM
FT                   QGLRTHKEGILAMWEFLKQNWTEIIKKLQPGSPVLGGVLTVSVSSLASVEKIDDVKQFF
FT                   SDKPTKGFDQTLAQALDTATSKSKWVARDGEVVRKYLEDNGYFIN"
FT   gene            <27627..>29123
FT                   /locus_tag="CAGL0J00363g"
FT                   /old_locus_tag="CAGL-IPF7808"
FT                   /old_locus_tag="CAGL-CDS2085.1"
FT   CDS_pept        27627..29123
FT                   /locus_tag="CAGL0J00363g"
FT                   /old_locus_tag="CAGL-IPF7808"
FT                   /old_locus_tag="CAGL-CDS2085.1"
FT                   /note="highly similar to uniprot|P38776 Saccharomyces
FT                   cerevisiae YHR048w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00363g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60674"
FT                   /db_xref="GOA:Q6FPW7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW7"
FT                   /protein_id="CAG60674.1"
FT                   /translation="MSESISMKDSDSCNQIDAESKSALSANEQTEFEVSFSEDGDPDPE
FT                   NIARHLPLVRKYYISSLITLTSTVITIISSCWSLASPNIMKHFHISHEVSTLGITLYIF
FT                   GLGFGPLFLSPISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFGSVF
FT                   LSVAGGAISDIFSKKQIGIPMAIYTTAAFLGPSLGPIISGALYHANYKWTFVTLLIASG
FT                   VCLTLIVISVPETYAPVLLIKKAQRLREETGDDRYYAPLEITRKETSIFKSVVLSAKRP
FT                   FGLLLRDPMMGVLCFYTGLVLAIVYLYFVAFPYVFETLYHFTVMEVGCSYIGLMVGMLL
FT                   ASPTSYIFQKRYDAKVERNGGVRTPEMRFEPLYYGAFCTPIGLMIFAWTCYSHVHWIGP
FT                   QIGSAIFGVGVYFVFVGVFGYTVDAYRKYAASGMACNSFVRSVMSGVFPLFGLQMYKGM
FT                   GVNWAGFLIAMVTVLMIPVPFLFDRYGPYLRSKSPYAWDD"
FT   gene            <29762..>30487
FT                   /locus_tag="CAGL0J00385g"
FT                   /old_locus_tag="CAGL-IPF7806"
FT                   /old_locus_tag="CAGL-CDS4079.1"
FT   CDS_pept        29762..30487
FT                   /locus_tag="CAGL0J00385g"
FT                   /old_locus_tag="CAGL-IPF7806"
FT                   /old_locus_tag="CAGL-CDS4079.1"
FT                   /note="highly similar to uniprot|P38777 Saccharomyces
FT                   cerevisiae YHR049w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00385g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60675"
FT                   /db_xref="GOA:Q6FPW6"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW6"
FT                   /protein_id="CAG60675.1"
FT                   /translation="MTASAAPRLLFLHGFLQNGKVFSEKSSGIRKLLKKADIQCDYIDA
FT                   PVMLEKKDLPFEMDDEKWAATLEADVNRAWFYHSEISKELDLTEAINTVANHIKENGPY
FT                   DGIVGFSQGAALSTIITNKISELVPSHPEFKVSLVISGYSFTEPDPENPGQLRITEKYR
FT                   ESFKPNPESQTKMLFVYGASDMAVPSERSKYLYNLYKESFGEDAEGTKLHAFEHPGGHM
FT                   VPNKKDIIRPIVEQITSSL"
FT   gene            <31269..>32894
FT                   /locus_tag="CAGL0J00407g"
FT                   /old_locus_tag="CAGL-IPF7804"
FT                   /old_locus_tag="CAGL-CDS1835.1"
FT   CDS_pept        31269..32894
FT                   /locus_tag="CAGL0J00407g"
FT                   /old_locus_tag="CAGL-IPF7804"
FT                   /old_locus_tag="CAGL-CDS1835.1"
FT                   /note="similar to uniprot|P38778 Saccharomyces cerevisiae
FT                   YHR050w SMF2 or uniprot|P38925 Saccharomyces cerevisiae
FT                   YOL122c SMF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00407g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60676"
FT                   /db_xref="GOA:Q6FPW5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW5"
FT                   /inference="similar to AA sequence:UniProtKB:P38778"
FT                   /protein_id="CAG60676.1"
FT                   /translation="MPVARESSRNSLSQMFLREESEELPMIATSSRMQNLIRIGKKYAR
FT                   FIGPGLMVSVSYMDPGNYSTAVAAGSAHKYKLLFSMFVSNLMAGFLQCLCARLGAVTGL
FT                   DLAQNCKKHLPYGLNITLYILAEIAIIATDLAEVVGTAISLNILLGIPLPIGVVLTVID
FT                   VLIVLMAYKPNGDLKLIRYFELFVSFLVICTVICFAIELFYVKLGPASDIFKGFLPSKA
FT                   VIEGDGLYLSLAILGATAMPHSLYLGSGVVQPRLRDYDIKHGYYSPDELDIDNNHQDYK
FT                   PSLESVQETLHYTVAELLVSLFTIALFVNCAILIVSGATLFETPQDADIADLFSIYELL
FT                   SNTLSKSAGTIFALALLFSGQSAGIVCTLSGQIVSEGFLNWTIAPALRRSLTRAVAITP
FT                   CLILVMVSGRSGLSNSLYASQVVLSVLLPFVSAPLLYFTSNKNIMRIEMIDRKLPATSI
FT                   FSTPGNVEQNKKKYGKVRLDEDEEEVIPLQDMETETETDQSQHQDQNIEYKDMSNSTFV
FT                   NILAVTVWLLISGLNLYMLKNLDK"
FT   gene            <34645..>35103
FT                   /locus_tag="CAGL0J00429g"
FT                   /old_locus_tag="CAGL-IPF7801"
FT                   /old_locus_tag="CAGL-CDS4818.1"
FT   CDS_pept        34645..35103
FT                   /locus_tag="CAGL0J00429g"
FT                   /old_locus_tag="CAGL-IPF7801"
FT                   /old_locus_tag="CAGL-CDS4818.1"
FT                   /note="highly similar to uniprot|P00427 Saccharomyces
FT                   cerevisiae YHR051w COX6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00429g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60677"
FT                   /db_xref="GOA:Q6FPW4"
FT                   /db_xref="InterPro:IPR003204"
FT                   /db_xref="InterPro:IPR036545"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW4"
FT                   /protein_id="CAG60677.1"
FT                   /translation="MLSRTLLRAPVFKRTLLTSATRATPLSLRVATWSPQITSIRKYSD
FT                   HHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDL
FT                   PTAVRVFEALKYKVENEDQYKAYLDELKEVREELGVPLKEDLFPSSSQ"
FT   gene            complement(<36171..>37169)
FT                   /locus_tag="CAGL0J00451g"
FT                   /old_locus_tag="CAGL-IPF7800"
FT                   /old_locus_tag="CAGL-CDS3312.1"
FT   CDS_pept        complement(36171..37169)
FT                   /locus_tag="CAGL0J00451g"
FT                   /old_locus_tag="CAGL-IPF7800"
FT                   /old_locus_tag="CAGL-CDS3312.1"
FT                   /note="highly similar to uniprot|P00359 Saccharomyces
FT                   cerevisiae YGR192c TDH3 glyceraldehyde-3-phosphate
FT                   dehydrogenase 3 or uniprot|P00358 Saccharomyces cerevisiae
FT                   YJR009c TDH2 or uniprot|P00360 Saccharomyces cerevisiae
FT                   YJL052w TDH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00451g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60678"
FT                   /db_xref="GOA:Q6FPW3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPW3"
FT                   /protein_id="CAG60678.1"
FT                   /translation="MVRVAINGFGRIGRIVLRIAMKRDGIDVVAINDPFITNDYAAYMF
FT                   KYDSTHGRYDGEVTHDDKDLIIDGKAIKCYQERDPADLPWGDNDIDIVIEATGVFTAKD
FT                   LAEKHITAGAKKVVITGPSATAPMFVKGVNDDKYTSDVTVISNASCTTNCLAPLAKVLQ
FT                   DNFGIEEALMSTVHSQTATQKTVDGPSKKDWRGGRTASANIIPSSTGAAKAVTKVLPEL
FT                   EGKLTGMAFRVPTVDVSVVDLTVRFAKDVTYDEIKAAIKKASEGEMKGILAYTEDAVVS
FT                   TDFLGDTHSSIFDASAGIQLSPRFVKLVSWYDNEYGFSARVVDMVELVSKA"
FT   gene            <39305..>40402
FT                   /locus_tag="CAGL0J00473g"
FT                   /old_locus_tag="CAGL-IPF7798"
FT                   /old_locus_tag="CAGL-CDS3027.1"
FT   CDS_pept        39305..40402
FT                   /locus_tag="CAGL0J00473g"
FT                   /old_locus_tag="CAGL-IPF7798"
FT                   /old_locus_tag="CAGL-CDS3027.1"
FT                   /note="similar to uniprot|P38779 Saccharomyces cerevisiae
FT                   YHR052w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00473g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60679"
FT                   /db_xref="GOA:Q6FPW2"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW2"
FT                   /inference="similar to AA sequence:UniProtKB:P38779"
FT                   /protein_id="CAG60679.1"
FT                   /translation="MAKKGVKKQVKNKEEGLSRERIGRALGSLKKYLEAQEGGEKTQLL
FT                   EDESLGDLQLLFTNAESFTGSKKSFKLKLVDVKHSLYAKWKAASATEIKDFKVLLILKD
FT                   SDVSKVTQDELYDQLNESGIEIDEIICGKDLKTTYKAYEARNAFISQFSLVIADDSVVT
FT                   ALPKLLGGKAYSKVETTPIPIRCNLKGQFSLNALTNQIKKIYLHKLPVRAPRGNMLNVH
FT                   LGRVNWFTDEEIIDNIESVADALIKDAKIRNIMLKTTTSPSLPIYRNDNVIDEMVKENT
FT                   VDDEKAEDVKTVKIGEVDVELSNFDRALMEVANPEEYETMFSKQISKAKRAREEEPEVE
FT                   EKTPVKKGKNDSKQVKGKKSPKSKK"
FT   gene            complement(<40807..>42804)
FT                   /locus_tag="CAGL0J00495g"
FT                   /old_locus_tag="CAGL-IPF7796"
FT                   /old_locus_tag="CAGL-CDS1212.1"
FT   CDS_pept        complement(40807..42804)
FT                   /locus_tag="CAGL0J00495g"
FT                   /old_locus_tag="CAGL-IPF7796"
FT                   /old_locus_tag="CAGL-CDS1212.1"
FT                   /note="similar to uniprot|P38767 Saccharomyces cerevisiae
FT                   YHR032w ERC1 ethionine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00495g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60680"
FT                   /db_xref="GOA:Q6FPW1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW1"
FT                   /inference="similar to AA sequence:UniProtKB:P38767"
FT                   /protein_id="CAG60680.1"
FT                   /translation="MPNQFKYTTDERRSSVIYSTSVGKGGLYVPQDYIPPEATERVIDE
FT                   EMERGDSSDEPLTYQSLSVNRNSNAGSNKRRSDEYQSLIEANNARTLQREHNARQSITN
FT                   ADGYGAISNYRKNSINKELLEEERDLLIDNHLLDTSKSRRHSQSVGINAAQDFFLGQGY
FT                   NENTNSVHPDLFIEGEEEVEEEEEEEEIINTWEDAIESGKEISTSFHREIQVISVNAFP
FT                   LVFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANITCLAAIQGLCTCLDTLCSQA
FT                   YGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMIPEKELCSLAASYLKIT
FT                   AIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYILVWDKNIGIGYLGAPT
FT                   SVAISYWAMALGLLAYTVLTKHPANPMKCWNGVIKPNQLFRNWKKMFNLALPGIIMVEA
FT                   EFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISVSTSTRVANFIGASLYKS
FT                   CIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSLVVSTLPILAFMQLFDA
FT                   FNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAFVFNTGVGGLWYGITCALVMM
FT                   SICQGYAVFHCDWKQIIEAAKVRNSESCRP"
FT   gene            <44256..>46373
FT                   /locus_tag="CAGL0J00517g"
FT                   /old_locus_tag="CAGL-IPF7794"
FT                   /old_locus_tag="CAGL-CDS1078.1"
FT   CDS_pept        44256..46373
FT                   /locus_tag="CAGL0J00517g"
FT                   /old_locus_tag="CAGL-IPF7794"
FT                   /old_locus_tag="CAGL-CDS1078.1"
FT                   /note="similar to uniprot|P38766 Saccharomyces cerevisiae
FT                   YHR031c RRM3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00517g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60681"
FT                   /db_xref="GOA:Q6FPW0"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028880"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW0"
FT                   /inference="similar to AA sequence:UniProtKB:P38766"
FT                   /protein_id="CAG60681.1"
FT                   /translation="MRRQAKKDPKQKSINSFFFKAAKSKSLIVNSSSRSQAHSTLPSSQ
FT                   GSSRSDGTSFGSGRVMKQRSTLTKSNLFTFQGSFNDEDCNPQNEFRKLMNPQEINNFKT
FT                   PSLSRMPSFTRSNSSMSLSPVKRTTTVLSSDDEFREVTTFQSQDAKRQLSFTSSVDTSA
FT                   MRQHNNLINTNNDLANFSGLKFRKLKAPNQNSNKKSTSSPYGKPLISLTKEQQTVVDYV
FT                   VKKNMNVFYTGSAGTGKSVILRTIIDKLSSMYGKESIAITASTGLAANTIGGSTLHKWS
FT                   SCGIGNKSVDHLVRQIRRYHDQYAIWRHTKVLIIDEISMLDGHYLDKLEAVAKQLRNND
FT                   RPFGGIQLVLTGDFFQLPPVSKKDDDKNVVFCFDSKMWKKCIQKTILLTKVFRQQDNEL
FT                   VDILNAIRYGELQNDMIKRIKSLGRDVYYPDGISPTELFPTRREVDISNSRQLEALPGE
FT                   AKIYESVDVAPPSYQNMLDNSVMAEKKLTLKEDAQVMMLKNKPESELFNGTLGRVLFFS
FT                   TEKLIRRMKELYGSSPLDEDLITDMRLVSRVIARPDIASSERFMKEVNMRPMERFHKLQ
FT                   TMINDAVTTSIKEQVFPYVKWSLNHGRYNYELMLPERFPVDIPGDKLGLERNQLPLMLC
FT                   WALSIHKAQGQTIQRLRVDLKNIFESGQVYVALSRAISMDSLQVLNFNPKKISIDPKVK
FT                   EFYRQLEILDT"
FT   gene            <47095..>48561
FT                   /locus_tag="CAGL0J00539g"
FT                   /old_locus_tag="CAGL-IPF7793"
FT                   /old_locus_tag="CAGL-CDS2134.1"
FT   CDS_pept        47095..48561
FT                   /locus_tag="CAGL0J00539g"
FT                   /old_locus_tag="CAGL-IPF7793"
FT                   /old_locus_tag="CAGL-CDS2134.1"
FT                   /note="highly similar to uniprot|Q00772 Saccharomyces
FT                   cerevisiae YHR030c SLT2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00539g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60682"
FT                   /db_xref="GOA:Q6FPV9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV9"
FT                   /protein_id="CAG60682.1"
FT                   /translation="MDVERQTFKVFNQDFTIDKRFELIKEIGHGAYGIVCSARFTEASE
FT                   ETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYL
FT                   YEELMECDMHQIIKSGQALTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADC
FT                   QLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILA
FT                   EFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSEL
FT                   FPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPADEPECNEKFEFSFESVN
FT                   EMEDLKRMVVDEVQSFREFVRQPLMDDKSQEDEQQQGSPENYQQTSPTNISPQRLHNNG
FT                   SHDLLQEPEFLTQTPNQNSTIPDQLQESFVGIHSDNLPEHDTDFPPRPQENILASPMGL
FT                   PSASDRNSMNNDSFLDLERELEFGLDRRYL"
FT   gene            <48915..>49796
FT                   /locus_tag="CAGL0J00561g"
FT                   /old_locus_tag="CAGL-IPF7792"
FT                   /old_locus_tag="CAGL-CDS3671.1"
FT   CDS_pept        48915..49796
FT                   /locus_tag="CAGL0J00561g"
FT                   /old_locus_tag="CAGL-IPF7792"
FT                   /old_locus_tag="CAGL-CDS3671.1"
FT                   /note="similar to uniprot|P38765 Saccharomyces cerevisiae
FT                   YHR029c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00561g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60683"
FT                   /db_xref="GOA:Q6FPV8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV8"
FT                   /inference="similar to AA sequence:UniProtKB:P38765"
FT                   /protein_id="CAG60683.1"
FT                   /translation="MLQVPFKQVNVFSGEPFKGNPVAVINCLDLDESNYLTDEEMQSIA
FT                   NWTNLSETTFIYKSQNPQADYKVRIFTPVSELPFAGHPTVGTCKAYLDIVGKPISGNYI
FT                   VHQECAAGLVPIEIKDGIVSFSAPRVAPTELSDEVIAEYTKIVGHPYTHRPQMIDSGPQ
FT                   WVVYLVEDADTCYNINPNFQNLKLLNLDNDHSGVIIAGPRSDNEWEMRAFVPVLSVPED
FT                   PVCGSGAAAFIGHLQQRFQYKETTNVKITQGGRLNRNGLIVGQINLDNEKPVYKIGGVP
FT                   VTVVDGTITVRV"
FT   gene            <50462..>52915
FT                   /locus_tag="CAGL0J00583g"
FT                   /old_locus_tag="CAGL-IPF7790"
FT                   /old_locus_tag="CAGL-CDS0762.1"
FT   CDS_pept        50462..52915
FT                   /locus_tag="CAGL0J00583g"
FT                   /old_locus_tag="CAGL-IPF7790"
FT                   /old_locus_tag="CAGL-CDS0762.1"
FT                   /note="similar to uniprot|P18962 Saccharomyces cerevisiae
FT                   YHR028c DAP2 dipeptidyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00583g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60684"
FT                   /db_xref="GOA:Q6FPV7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV7"
FT                   /inference="similar to AA sequence:UniProtKB:P18962"
FT                   /protein_id="CAG60684.1"
FT                   /translation="MEEQPERIRDDAFYWKKRFVVDRMLKFAVLLVLLVWGSVLLLKMV
FT                   TPLKEDHKRHQLPSNTTVDGKLLINFDNIRNGTFKPTRHNLQWIKSTKKGSDDDMGLYA
FT                   TKIDDKFVIKSVLDEDYEDVLLKEKTFEYDGKNYTADDIIASPDLSKLLVRSSTVKNWR
FT                   HSNFGTYFLYDAKKAEFDQLAENVALAVWSPNSVDVAYVQNNDIYVYSTKTDETIIVTD
FT                   DGNENVFNGIPDWVYEEEVFSNDRALWWSPNGDYLAFLKTDETNVGEFSIPYYAQKEDD
FT                   VYPEVKTIKYPKSGTPNPVVDLWVHRFNDDSTYPLNISSHHESDSTLITEVTWISESSL
FT                   VTKFSDRSSDVRLVLHFNADTKHAKVARKEPADDGWWEITHNTLRIAKDENMGIIEDGY
FT                   VDVANIDGYNHLVYFSPADSKYPQVLTSGEWEVIDGTLAFNSKTGNLFFIGTREGKSTE
FT                   RHLLYVNINKPKEVHQVTDDSKRGVYTASFSSKTRFALLSYDGPDVPYQKIIELDTDKR
FT                   DEHIHGNSIGKTLYYLEENKKIRDNLKDYARPRKTYQELNLGKDKDGNNIIVNSYEILP
FT                   VNFDSKLKNEYPVFFFAYGGPNSQQCIERFSIGLDEVIATELNAIVVVVDGRGTGLKGR
FT                   PFRAVVRDNLGNYEAEDQIRAAKLYKSKPFVNSDKISLWGWSYGGYLTLKTLEKDAGEN
FT                   FKFGISVAPVTDWKLYDSVYIERYMHTPQENPEGYEKSKVSDVEALGKARRFLIMHGTG
FT                   DDNVHFQHTLKLLDRLNLKAIENYDVHVFPDSDHAIKYHNANDMIYNRIVSWTRKAFNG
FT                   EFDPK"
FT   gene            <53432..>56383
FT                   /locus_tag="CAGL0J00605g"
FT                   /old_locus_tag="CAGL-IPF7789"
FT                   /old_locus_tag="CAGL-CDS0467.1"
FT   CDS_pept        53432..56383
FT                   /locus_tag="CAGL0J00605g"
FT                   /old_locus_tag="CAGL-IPF7789"
FT                   /old_locus_tag="CAGL-CDS0467.1"
FT                   /note="highly similar to uniprot|P38764 Saccharomyces
FT                   cerevisiae YHR027c RPN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00605g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60685"
FT                   /db_xref="GOA:Q6FPV6"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="InterPro:IPR040892"
FT                   /db_xref="InterPro:IPR041433"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPV6"
FT                   /protein_id="CAG60685.1"
FT                   /translation="MSTDKKKEEVPKPETEDLTVKDETKNKDKKKANEEEELSEEDQKL
FT                   KGDLEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDLCKAYD
FT                   KWSDKDQKSSLADMLSVLAMTYSDTHQHDSLRFRLLSDTSNIASWGHEYVRHLALEIGE
FT                   VYNEQVEKEAEDNSTSTESSPQPPHMNFEFSKDVILQLSLEIVPYFMKHNGEEDAVDLL
FT                   LEIEAIEKLPQFVDENTYKRVCQYMIACVQLLPPPEDISFLQTAYSIYLSELQLPEALS
FT                   LAIRLGNEDMIRSVFDATSDPIVHQQLAYILAAQRVPFEHPELQEIIGNTKLSEHFLYL
FT                   AKELNLLTPKIPEDIYKSHLDSSKSVFSSAGLDSAQQNLAASFVNAFLNLGYCNDKMIT
FT                   DNDNWVYKTKGDGMTSAVASIGSIYQWNIDGLQQLDKYLYVDEPEVKAGGLLGIGIASA
FT                   GVHHDVEPALLLLQEYINHSDTKISTAAILGIGIAFAGSKNDEVLGLLLPVVSNTENSL
FT                   ELAAIAALALSHVFVGTCNGDITTAVMDNFLERTPLELKSEWARFLALSLGLLYLGQGE
FT                   HVDDVLETINAIEHPMTSAIEVLISSCAYTATGDVLLVQDLLHRLTPKAVKSSDEDEDE
FT                   DNEELSQEDMNGISAFLGKKENEIAEEPQGNEGADNEMEVDSHQDETTTGENNVKKEEN
FT                   EEEKTEKSEKTENDEEEEDEEESKDEGANDELAYAVIGIALITMGEEIGKEMSLRHFGH
FT                   LMHYGNEHIRRMVPLAMGLVSVADPQMKVFDTLTRFSHDPDLDVSMNSIFAMGLCGVGT
FT                   NNARLAQLLRQLASYYSREQDALFITRLAQGLVHLGKGTMTMDIFNDAHVLNKVTLASL
FT                   LTVLVGLISPSFILKHHQLFYMLNSGVRPKFIITLNEEGEQIKVNVRIGQAVETVGQAG
FT                   KPKTITGWITQSTPVLLGHGERAELENDEYISYTNNIEGVVILKKNPNFQEEE"
FT   gene            complement(<56779..>57414)
FT                   /locus_tag="CAGL0J00627g"
FT                   /old_locus_tag="CAGL-IPF7788"
FT                   /old_locus_tag="CAGL-CDS4348.1"
FT   CDS_pept        complement(56779..57414)
FT                   /locus_tag="CAGL0J00627g"
FT                   /old_locus_tag="CAGL-IPF7788"
FT                   /old_locus_tag="CAGL-CDS4348.1"
FT                   /note="highly similar to uniprot|P23968 Saccharomyces
FT                   cerevisiae YHR026w PPA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00627g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60686"
FT                   /db_xref="GOA:Q6FPV5"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV5"
FT                   /protein_id="CAG60686.1"
FT                   /translation="MAVVADKPLVGKINYSRYFYYLVLFVVVVYALRKMLTGHGSDIDI
FT                   GRFLSKTSPYMWANLGIASCIGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIF
FT                   CEVVAIYGLIMAIVFSSKLTVSSKDSLYSKSNLYTGYSLFWAGLTVGVSNLICGVSVGI
FT                   TGATAAVADAADSSLFVKILVIEIFGSILGLLGLIVGLLMAGKAADFQ"
FT   gene            complement(<58040..>59113)
FT                   /locus_tag="CAGL0J00649g"
FT                   /old_locus_tag="CAGL-IPF7787"
FT                   /old_locus_tag="CAGL-CDS3108.1"
FT   CDS_pept        complement(58040..59113)
FT                   /locus_tag="CAGL0J00649g"
FT                   /old_locus_tag="CAGL-IPF7787"
FT                   /old_locus_tag="CAGL-CDS3108.1"
FT                   /note="highly similar to uniprot|P17423 Saccharomyces
FT                   cerevisiae YHR025w THR1 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00649g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60687"
FT                   /db_xref="GOA:Q6FPV4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV4"
FT                   /protein_id="CAG60687.1"
FT                   /translation="MVRHFKIKVPASSANIGPGYDVLGVGLNLFLELDVEIDALNAQET
FT                   NDDKNNCKLSYTEDSEGYDSVPLESDANLITRTALYVLRCNDIRKFPSGTKINVHNPIP
FT                   LGRGLGSSGAAVVAGVVLGNEVGQLGFSKQRMLDYCLMIERHPDNITAAMMGGFCGSFL
FT                   RDLTTQEMERREIPLSEVLPEPSGGEDTGLVPPLPPSDIGRHVKYQWNPAIKCIAIIPQ
FT                   FELSTADSRGVLPKAYTTQDLVFNLQRLAVLTTALTLDPPDAKLIYPAMQDRVHQPYRK
FT                   TLIPGLTEILNSVTPTAYPGLLGICLSGAGPTILALATENFEDIAAEIINGFHKKNVKC
FT                   TWKLLEPAYEGVTVEQL"
FT   gene            <59501..>60946
FT                   /locus_tag="CAGL0J00671g"
FT                   /old_locus_tag="CAGL-IPF7786"
FT                   /old_locus_tag="CAGL-CDS2189.1"
FT   CDS_pept        59501..60946
FT                   /locus_tag="CAGL0J00671g"
FT                   /old_locus_tag="CAGL-IPF7786"
FT                   /old_locus_tag="CAGL-CDS2189.1"
FT                   /note="highly similar to uniprot|P11914 Saccharomyces
FT                   cerevisiae YHR024c MAS2 processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00671g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60688"
FT                   /db_xref="GOA:Q6FPV3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV3"
FT                   /protein_id="CAG60688.1"
FT                   /translation="MLRNSLRVAQRRGYFQVSRLKNGLRVATSDTPGHFSALGMYVSSG
FT                   SRYETGSLKGCTHIVDRLAFKSTKNIDARSMMETLELLGGNYQCTSSRESMMYQASVFN
FT                   RDVEKMLNLLAETIRFPKITEEELQEQKFTAQYEIDNIWTKPDLILPELLHNTAYSGET
FT                   LGSPLICPREILPSITKKSLLNYREKFYNPENTVAAFVGQPHEKSIELAEKYLGDWTTT
FT                   GEPLDKTAAHYTGGETCIPSAPVFGTMPELMHIQIGFEGLPIDHPDIYALATLQTLLGG
FT                   GGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVSFNHAYSDSGIFGISLSCIPQAAPQAA
FT                   EVIAQQFYNCFANGALRLTDAEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGKKI
FT                   PVSEMVSKIESLTTKDISRVAEMVFTGKAHNKGNGTGRATIVMQGDRAAFGDVQEVLGH
FT                   YGLGSSSFSTDQSKSSTTKLKWF"
FT   gene            complement(<61246..>66900)
FT                   /locus_tag="CAGL0J00693g"
FT                   /old_locus_tag="CAGL-IPF7785"
FT                   /old_locus_tag="CAGL-CDS0045.1"
FT   CDS_pept        complement(61246..66900)
FT                   /locus_tag="CAGL0J00693g"
FT                   /old_locus_tag="CAGL-IPF7785"
FT                   /old_locus_tag="CAGL-CDS0045.1"
FT                   /note="similar to uniprot|P08964 Saccharomyces cerevisiae
FT                   YHR023w MYO1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00693g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60689"
FT                   /db_xref="GOA:Q6FPV2"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV2"
FT                   /inference="similar to AA sequence:UniProtKB:P08964"
FT                   /protein_id="CAG60689.1"
FT                   /translation="MNQDMRVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKDN
FT                   DGETATFKISEIFPVNPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLV
FT                   AINPYKEISNLYSNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGES
FT                   GAGKTENTKKILQYLASITSDSFEVSNNFEMKILQSNPVLESFGNAQTVRNNNSSRFGK
FT                   FIKIEFDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLS
FT                   SNDFAHYQILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNI
FT                   EFVSEKSEQASFKSDISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFII
FT                   NSLCRTLYEHLFGYIVDTINMSLNHGSMTANYIGLLDIAGFEIFEHNSFEQLCINYTNE
FT                   KLQQFFNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETI
FT                   LPKSEDSSFYSKLISTWQQNSTKFKRSKLDMCFVLKHYAGDVEYHVNGWLAKNKDPLNE
FT                   NLVNILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTALSR
FT                   HREQQSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGY
FT                   PNRILFKEFYERYRILSEHLDKSSDAINYKQSSQILISELHLDPTTYKVGTSKLFFKAG
FT                   TLAELESKKESILFEITVRFNSIIRGWSQRKRTKGEIQKMRASEMIGNVFRKYNEKMQD
FT                   PWFNMYMKIKPLLASSQNIVDSRKYTEKIKVLEQKLTAVETEKKIHTAKHNDLLNELND
FT                   VKNLLDVEKEKLKRNEQLLSKSNEQQREIETMIKEIREDKSTLLSEKEAAISKIQELEL
FT                   VRQKLEEKNNEKDASIAELTRKLSSLESEKGDITRQISMDTEVLKKLENEKMEKERVIE
FT                   KLSHDIKERDHIIDELKQKEHISNKDLDIKLQTLEKNCNVALTKLKSLLNENAELREEV
FT                   GKNKKLHANTIQQVSSKEKEIERLKARFASNQGEINEILKQRDSLMAENDKLSKELSEM
FT                   KMALRKANENYAQMKNQIEEMAKQEHINRENSPMESRSDISLLKKQLEDEKSLNKYLNQ
FT                   KLLGDRVVQRSLHLDDLSNADKDVLLKKYYEIKTALHEQSTSLEEAIEENKNLISRLRF
FT                   TETRLASSSFESQTVKAQLKKLKHFLENKGMQADIDQLLSDIKPSDVNVEQILLEVQHL
FT                   KMQLNAEQKAHKEAEAAITALHSKFELIQKVDSTSDIYKIKYEASEEHVRALENKLRSL
FT                   PFKDRTNLPSGEIFTNKDSISKYEEELRFYKIENFKLQDKLSEFENICGSLKHEIKQGS
FT                   VKEVLLEEQVERLQKDLESTERQKEMLTSNLRQQRQQYEDCLSDLNANETQLREYNHAL
FT                   KQAEDDIKGMATVIEKLKSSNKQKDKTIWDRETEKNDLDMQLQETLLELKRVQDMNQLL
FT                   QTDVHHFKERLNTSSDVSRYTNEIERLKEALDESSKYSGEFKKEISTLKYKLETLKNDS
FT                   EAKIEHLLKQSEHYETIVGQLGEERDENQEIIKDLNQKLIDMESNLKKLNDDYEALSQQ
FT                   RDTLLQESDRLRSELGNSTEQFNATVKHNVDVNDKLRNLEETLRLQTEQNERNEQLVKS
FT                   IQMDLESYKMKYDEEKQKNIDLVEEAETLKSVTVRLEETIKDLDQRLSDTSEKEAWLRK
FT                   IHEVETLLNDERDMKIEEMKKSKALERTINELEARNASQVEVIETANGDRTKFEETVMK
FT                   YNEQMHQLEKYISQQEIDMKKVVRENMEYQEKMNEMERELMLWKQRYHVASGGTNNFSQ
FT                   RNEEEVMVQT"
FT   gene            <70057..>70941
FT                   /locus_tag="CAGL0J00715g"
FT                   /old_locus_tag="CAGL-IPF8994"
FT                   /old_locus_tag="CAGL-CDS3663.1"
FT   CDS_pept        70057..70941
FT                   /locus_tag="CAGL0J00715g"
FT                   /old_locus_tag="CAGL-IPF8994"
FT                   /old_locus_tag="CAGL-CDS3663.1"
FT                   /note="some similarities with uniprot|P01119 Saccharomyces
FT                   cerevisiae YOR101w RAS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00715g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60690"
FT                   /db_xref="GOA:Q6FPV1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV1"
FT                   /protein_id="CAG60690.1"
FT                   /translation="MEILLYDVSDNPTPRCLDNTARITVMGEHGSGKTTLITRWLRNMF
FT                   IQVDQGDYDIYTTHVARQNIHQYDHEINAALSKTKSEMLAKNPSDENITPAMTRASSYK
FT                   NRHPLKVQILDAEPVEIGEYSDLRNMQIEQSDAFILCFDCADSNAVDELRGYKRKIDSI
FT                   RGNALIMLCCTKVDLSAERVFGIEETQDILEKLNISPSDYYEVSSKHAIGTERLLYRTL
FT                   AHIEDCKTSERIDMVKNSIATSEEEKSSTDSVSTETLKEDEKKTRGRLLHPRAIRKLSH
FT                   NDSPAQQQCCCIM"
FT   gene            <72900..>73831
FT                   /locus_tag="CAGL0J00737g"
FT                   /old_locus_tag="CAGL-IPF40114"
FT   CDS_pept        join(72900..72902,73586..73831)
FT                   /locus_tag="CAGL0J00737g"
FT                   /old_locus_tag="CAGL-IPF40114"
FT                   /note="highly similar to uniprot|P38711 Saccharomyces
FT                   cerevisiae YHR021c RPS27B or uniprot|P35997 Saccharomyces
FT                   cerevisiae YKL156w RPS27"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00737g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60691"
FT                   /db_xref="GOA:Q6FPV0"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV0"
FT                   /protein_id="CAG60691.1"
FT                   /translation="MVLVQDLLHPTAASEARKHKLKTLVQAPRSYFLDVKCPGCLNITT
FT                   VFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
FT   gene            <74694..>79826
FT                   /locus_tag="CAGL0J00759g"
FT                   /old_locus_tag="CAGL-IPF8997"
FT                   /old_locus_tag="CAGL-CDS0059.1"
FT   CDS_pept        74694..79826
FT                   /locus_tag="CAGL0J00759g"
FT                   /old_locus_tag="CAGL-IPF8997"
FT                   /old_locus_tag="CAGL-CDS0059.1"
FT                   /note="similar to uniprot|P47054 Saccharomyces cerevisiae
FT                   YJL039c NUP192"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00759g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60692"
FT                   /db_xref="GOA:Q6FPU9"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021827"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU9"
FT                   /inference="similar to AA sequence:UniProtKB:P47054"
FT                   /protein_id="CAG60692.1"
FT                   /translation="MKWSVSQFSDLYASIDAKAISSELFTQLLPDLKELLKYPPKNTES
FT                   RNKLEKLQDYKTDDGSIFKLNQDFIISIISLSDELNLDELEAVNLVLENSPGSQIYASE
FT                   VVNNGKISFFLRRQYILQIVSYICNAEDVMSPYYKKFFNAETNTTILSKVLENFDIISK
FT                   HLSDIKQEVNRNQILDNMNPLITQGIHFKRDFFSKEYDLLSQVLYGLSKRSLINTQISS
FT                   VDLIIEHSLKMETNDFFVVYFLPTLLNLFSNLNTFSDVDIFGLHKKYTNELITKQEQVY
FT                   KKPMKVLIMFIFLTFLIGWCKEDPQNRVTKLNFKSDIDDPMTIAVELGAIEQLLIVIAD
FT                   LSRIDESTAVQYYDFRALLERHLPRFIPLQLVDENVIQKYNQMSSLTERSDSTKINGPH
FT                   ESFSRNTYRPPSMISPNNYSKDNRFTNGLGSTSISMDRLNEGRVFFSTSDMNKEISKFR
FT                   ENISEMFEMFLEENIHHFIQTFISDCAFLLTKLKDAEEDSLLSGEDLDLDDIATKADLE
FT                   RFFVSVFYFYSKRPHYVAAFWEDKESAAYGFVEWASKCNDNLMKSCFYLMLGGLSSGKE
FT                   NALNVYYYLGDSNPTSWKRIADTIGSYSSKILNLGKAIQAKEQENEGELNTTLLALEEG
FT                   LNEETIVFLSSLLTLISSVADQMEPDEKLMFSHLFVDVIFELTKCETPLVGACFNTIST
FT                   LVPILESDRASIWHKLDSTLFKGVALSDTSQYISAFSSILTTYSDVLGFLALIRNLLQI
FT                   ESFDCNKEFLVFGHLQYPNQLGRPYRKSGIWPYLEFVMNEVFVNSDKITDSFKRHELQE
FT                   RVLEIILTCLNSFDYSVLLNSISVGANLDNLVHGENFASYVQDNAAPAMFNFLFQENVY
FT                   TKLYSIASVGIDNSSLLKPHSQLQTLLRLSLSVIERTLDYEKTYTEELLTIIKKYQSGE
FT                   FYRPKYYGLHGLVSFTQTVFFNLDFVTCLGLYIGLDNDSIPIISINILRKLALLFNSTE
FT                   PDPILGNKLFTLFDSIDESARIKDAFIDQLDCPIENSDNLMLKVEILEFLKDSLDIESS
FT                   KPSVAHLLLGFQYDNTLTFGPNLSTFIQSGHSLFHSVIRLLISALNELSSYKIDFAPMR
FT                   LAALSLQLLELMCKSQLTSDLVIEHITNNEIIKKIMDVDPQTSNHTLWNGLNLESTTQS
FT                   TKARFIQGSSAGAYLMFLRYRTSMIQFLNVVIHTISLKGTISRVAPYTSYLISNSIYSA
FT                   RIFSLLRPLHQNIILKEKIVPENLQLLKDLPVDLDKVQLRKSCTGNIYDFDEISSVLEL
FT                   HSKTYSVSQLNSKEFMDKILSEFEEVKQLITLFLVRKESFSQQLAILHNWVQLVQIIVS
FT                   DGNLGERKRSTFILEVFDMVTPKISVYVDIDVKFAEELVSLMVFLFHIYNQSNASSSGK
FT                   YFLDSKLHNLFQVCIRGISSPLSSLKLRSDFYVIANNYLLRVLKNSGMAYAIVKDLRLN
FT                   NERLVEVICNDAIYGEGAIKITGLLLLDSLVQLGNHHQENFIVMTLMRSTKLFHIIRSL
FT                   KATDSLLNASTENVNVENFLYELTAFKATAYFLIRIAETREGAVALIESKVFDILAELN
FT                   FLKIDPDLGLELVFDETSNNTSSLLRVNITFDEPLILGKEATSVSIFELIIPIFQLMLA
FT                   IVISSGRFNDAVRLATTSLLKQYQKLIIGTFKRDTLYKSGKKQASDELKYKHHQEFIKL
FT                   VVLICTITKYEDK"
FT   gene            complement(<79993..>82593)
FT                   /locus_tag="CAGL0J00781g"
FT                   /old_locus_tag="CAGL-IPF8999"
FT                   /old_locus_tag="CAGL-CDS0657.1"
FT   CDS_pept        complement(79993..82593)
FT                   /locus_tag="CAGL0J00781g"
FT                   /old_locus_tag="CAGL-IPF8999"
FT                   /old_locus_tag="CAGL-CDS0657.1"
FT                   /note="similar to uniprot|P14907 Saccharomyces cerevisiae
FT                   YJL041w NSP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00781g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60693"
FT                   /db_xref="GOA:Q6FPU8"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="InterPro:IPR026010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU8"
FT                   /inference="similar to AA sequence:UniProtKB:P14907"
FT                   /protein_id="CAG60693.1"
FT                   /translation="MSAFGNSGGGSFSFGNNSSSAFGAAANAGSNNTGGSSAFSFGANQ
FT                   NASTPFGGAATNNSANNGGANNTASPFGMNANQNKPLFGGATAGQSSSPFGAASNNTGA
FT                   TPGQTNNTSASQGLFGSNSNNVSQKPAFGFGASNTQATPSFGGFGSAQNGSSNNTTGAS
FT                   AFGAATSNTQNTTPAATNTGSAIGSTPAFGFNSANNNNNNAQNNKPAFSFGSTQPQSNN
FT                   TLGTAAGTNSNPGSSGKPAFSFGASNTTSTTGTAGAVGNTSNTPVPPSGSTPKPAFGTS
FT                   ASTTPAPGAGSFSFGSSIGTDANKTDAAKPSLFGGLNKPADAASKPTLSFGSTAPSSNT
FT                   TNDKPASDAKPAFSFGNSSTTNNGPSLFSQAKPADEEKKTTPALNFGSASQSGEKTEEK
FT                   KPAFSFGAAATGSTTQSKPSLSFGSTTKEENKSSSTPAFSFGSKPANDDKKDTPETSNK
FT                   PEASKPSFSLNLSAGTSEKKDENSTKPFSFGTKTAEKDETKTDKPAFSFGKTTTDTNES
FT                   KPALSFGGKNENSDKKSTLTFGSQSEKKEDSGAKPAFSFGSKSDKKDEPPKPAFSLGTK
FT                   TDKTEISESKPGFSFGAKTDKPSTTTDVNKTETPKAGFSLKSDSKADDKSKNFSFGTSK
FT                   DGKNTSETDKTESAKSNLGTEASSQQKLESKPVEVKPVSLDNKTLDDLVTKWTNQLSSA
FT                   SKHFDQYSKRITDWDRILVDGGKQISQLYTEAVNAEQAQNKIDQSLQYIERQQEELETF
FT                   LDNYESRTEALLSDILPSNSGVPGNNNDQKRLQAYKTAESLDENLNALSANLSSLIDEV
FT                   NDVSNTFNNVTSINLNNKDESAQLIKLLNVHLDALKSLDNNALLLENKIDSIQK"
FT   gene            complement(<83483..>87427)
FT                   /locus_tag="CAGL0J00803g"
FT                   /old_locus_tag="CAGL-IPF9003"
FT                   /old_locus_tag="CAGL-CDS0182.1"
FT   CDS_pept        complement(83483..87427)
FT                   /locus_tag="CAGL0J00803g"
FT                   /old_locus_tag="CAGL-IPF9003"
FT                   /old_locus_tag="CAGL-CDS0182.1"
FT                   /note="similar to uniprot|P43638 Saccharomyces cerevisiae
FT                   YJL042w MHP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00803g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU7"
FT                   /inference="similar to AA sequence:UniProtKB:P43638"
FT                   /protein_id="CAG60694.1"
FT                   /translation="MGGLHSAWSRMQVRKTMDRRKSATDVDVAWLIRNSSHRKGVVYSE
FT                   GDEASEVCKLPMREVKEEGVPLRRTKSASSAPAPTFSESAANASNASVEGGRRGSVSKG
FT                   KIGFFKSLFSHHRHEVPKPVESAPQSPELSPMQSVQSNGSSPTRRLSQPRTISNESSYA
FT                   VSAENSKRLDDFIAHCKETLSERQRGIDERQRHASIGRPQSFMTPAQSAPRRLDSRGRP
FT                   IPPHPSKSAFPPILKRGNCDERKLNVESTVSLSSVDGPAPETPSSATHKFGAFLKKVTS
FT                   YGSQPSLNPNGTFDSIDRTVSNISDSSHRTTQDRYGTVPGLENCKQLKHVAFATTTYFN
FT                   DPPQQICSKNPRKGEVEVKPNGSVIIHRLTPEERKKIMETSSAGIVVGGSGQLKVLNPI
FT                   EQQSSDDEDSQKRNIAIAAEEAAAEARGNNKKEEDIEVSKLASHLTIDKPMVSRRPREN
FT                   PIRTSSSSSLLSILSDEENKNGTDQSPKGSESDSGTDEEEIYPPPNLKIPHDVVYTRCC
FT                   HLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISPVLCVSLDGVS
FT                   LTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVALDLTMVPTI
FT                   KTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGGIEEFVLAGA
FT                   CMSYTQFKNFIELACTNTDRLGLAYNKLTMEQCKVLAEWIVTSNIRGLDLGFNDLKGKT
FT                   SVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLRLLSVLCYSENLKFL
FT                   DLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLAESLPLCSKLHHLSL
FT                   LGSKLNLASAKALTEAVNKSNTLMTLDLEYNTVPESIKERMSLYTMRNIQNELDNVQKT
FT                   KRKAGLSLPSVPQEEMAANEKQISTLQEELSSLLTDKFEDSLEYDKLVVEFIEKITKVR
FT                   TKIEKVVSDLFDLRVKNELSCEGKETLINLCLIDSSFEQGIHLLKQRHNKLQKHTVAAP
FT                   TSIHDEKTNLTSNKAMNKLLNNPMFSDPFANDSMSKLSNNDSDQSLERTQRDRTILSSS
FT                   AFGNTGHSALLPFGTATVEESNKAADDTVEFRESENSYKTIVRGPSTDPIGTKYDILNK
FT                   ELEHLQKNKANKPAEKLYTLDSGVSINSDELTRAAESLESEKIKDFLLKNDVATIVNVI
FT                   DELHEKGYHLHDIFRKQEVDDHKKEEILKTLQEDQSHNKSNNPFLESTGNGASAEAKKA
FT                   IPKYMEEKAIDEAYDQVLDNIARIRSKTHE"
FT   gene            <87530..>88843
FT                   /locus_tag="CAGL0J00825g"
FT                   /old_locus_tag="CAGL-IPF9006"
FT                   /old_locus_tag="CAGL-CDS2505.1"
FT   CDS_pept        87530..88843
FT                   /locus_tag="CAGL0J00825g"
FT                   /old_locus_tag="CAGL-IPF9006"
FT                   /old_locus_tag="CAGL-CDS2505.1"
FT                   /note="similar to uniprot|P32806 Saccharomyces cerevisiae
FT                   YJL044c GYP6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00825g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60695"
FT                   /db_xref="GOA:Q6FPU6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU6"
FT                   /inference="similar to AA sequence:UniProtKB:P32806"
FT                   /protein_id="CAG60695.1"
FT                   /translation="MGKSYWYKQRSRMDWFSQRAVDLGYDHGGVVARGVWLGEFYEGMS
FT                   RSDERCAGRGSRSWLWTHLAGEELPELEMPGAEYRHEESRSVSGSGSGSGSGGRAGHTH
FT                   ATYGGHGGLGKGNVRVLTPVRATAHPLAGAEKGDLSERLNTSMEIVDLDLKRLLIHPMF
FT                   SEPQHVKNMKLLLYNYLLDSIEYKQGFHEIMGMIYMQIYDNDENSETKLRTVLKLFTTL
FT                   MAPLNKVFYEEDNLLNWEQKIFRPMLMGLSPKVFSIIYSGHGKHHNNNLIWIIRWTRLL
FT                   FIREIASKVDILELWDHLLTVPAAQFPLFMAAFISVMLLSIYDQVVEFSRDKTLDHDDL
FT                   IEILLLRYKEMNPHIDVVKYCQVAMEATEQFNAGELDKLFGTATKFLEWKYRDSPQILA
FT                   MHQQSRDMKLGRPDIPPDPNRLRMEEKLKQRVLQRLHR"
FT   gene            complement(<89492..>91624)
FT                   /locus_tag="CAGL0J00847g"
FT                   /old_locus_tag="CAGL-IPF9010"
FT                   /old_locus_tag="CAGL-CDS1059.1"
FT   CDS_pept        complement(89492..91624)
FT                   /locus_tag="CAGL0J00847g"
FT                   /old_locus_tag="CAGL-IPF9010"
FT                   /old_locus_tag="CAGL-CDS1059.1"
FT                   /note="similar to uniprot|Q00711 Saccharomyces cerevisiae
FT                   YKL148c SDH1 or uniprot|P47052 Saccharomyces cerevisiae
FT                   YJL045w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00847g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60696"
FT                   /db_xref="GOA:Q6FPU5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU5"
FT                   /inference="similar to AA sequence:UniProtKB:Q00711"
FT                   /protein_id="CAG60696.1"
FT                   /translation="METDFSENQSETTKCEAAQCCPLYAALVPYPSLPAGSRARARARV
FT                   LCGSETYIRDMLRYVVGLGGETIHRSGEQEISKNPNTSTHKKMLRTGLRLRQLSTSCVR
FT                   RHAAPAGLGAGKYNVIDHEYDCLVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTV
FT                   AAQGGINAALGNMHKDNWKWHMYDTVKGSDWLGDQDAIHYMTREAPKSIIELEHYGMPF
FT                   SRTEEGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHDCHFFIEF
FT                   FAMDLLTHNGEVVGIIAYNQEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNA
FT                   MVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDL
FT                   ASRDVVSRAMTMEIREGRGVGKHKDHIFLQLSHLPPAVLKERLPGISETAAIFAGVDVT
FT                   KQPIPVLPTVHYNMGGIPTKWTGECLTIDENGEDKVIPGLMACGEAACVSVHGANRLGA
FT                   NSLLDLVVFGRAVANTVADTLQPGTPHKPLPADLGKESLASLDAIRNASGDKTTAQIRL
FT                   NMQKTMQKDVSVFRMQETLDEGVKNITAVDKTFKDVHVTDKSMIWNSDLVETMELRNLL
FT                   TCATQTAVSAAERKESRGAHAREDYPSRDDENWRKHTLSWQQHTGDPVSIKYRKVIATT
FT                   LDEAECPPVPPAVRSY"
FT   gene            complement(<92049..>92699)
FT                   /locus_tag="CAGL0J00869g"
FT                   /old_locus_tag="CAGL-IPF9015"
FT                   /old_locus_tag="CAGL-CDS4295.1"
FT   CDS_pept        complement(92049..92699)
FT                   /locus_tag="CAGL0J00869g"
FT                   /old_locus_tag="CAGL-IPF9015"
FT                   /old_locus_tag="CAGL-CDS4295.1"
FT                   /note="highly similar to uniprot|P35718 Saccharomyces
FT                   cerevisiae YKL144c RPC25 DNA-directed RNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00869g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60697"
FT                   /db_xref="GOA:Q6FPU4"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU4"
FT                   /protein_id="CAG60697.1"
FT                   /translation="MFILTKLKDLVRIPPDQFHRDAVSAITHELNVKYSNKVVPHVGLS
FT                   VSVYDLLEVDEGQLRPGDGASYINVTFRCVVFKPFAGEILTGWIKRCDGEGIQVSMMGL
FT                   FDDIFIPKKMLFEGSYYSPEDGAWVWPMDEETKLYLDVNEMIRFRVEEEVFVDVKPPSP
FT                   KELELERERELQLQEQQEHQQHQQQESKLEKPPAYALLGSCQTDGMGLVSWWD"
FT   gene            <92958..>94358
FT                   /locus_tag="CAGL0J00891g"
FT                   /old_locus_tag="CAGL-IPF9018"
FT                   /old_locus_tag="CAGL-CDS2284.1"
FT   CDS_pept        92958..94358
FT                   /locus_tag="CAGL0J00891g"
FT                   /old_locus_tag="CAGL-IPF9018"
FT                   /old_locus_tag="CAGL-CDS2284.1"
FT                   /note="similar to uniprot|P34078 Saccharomyces cerevisiae
FT                   YKL143w LTV1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00891g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60698"
FT                   /db_xref="GOA:Q6FPU3"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU3"
FT                   /inference="similar to AA sequence:UniProtKB:P34078"
FT                   /protein_id="CAG60698.1"
FT                   /translation="MSKKFTSKNSQKFAVVHRPHDDPNYYDADATEHVLVPVDPKGKQA
FT                   VKQRPQRQRKPVNEHVGEARIYGIGFDDSKYDYTQHLKPIGQDPNAVFIAKTPAQAPAK
FT                   KKNIEDLFVEDTYKGEAPTRPDSVFKFGMAKPEYLKHQQDVPDDIRGFKPDMNPALREV
FT                   LEALEDEAYVVNEDIVVEDPKKKKGKKKVEVADDLEEEDDDIFAELLQGGEVGSDGEFQ
FT                   DEFDEWDMDNLDEYEETHYQDEMKQFDNIDNLEDLQGIDYQADVMRFQKQQKKKFEEFE
FT                   SDNEFDSDAEGDDLSRGGNVSEDEEEEEDGDVLGDLPTINKKTTGKKKRKERKKKGAMS
FT                   DISGFSMSSSAIARTETMTILDDKYDNIIASYENYEEEQLDDEYENAKPFNMEEERADF
FT                   ESMLDDFLDNYELDAGGRKIVKKDAERDRIKQAADEVSKGKLSLRRNRERQKKEVEKVT
FT                   SSLNSLRF"
FT   gene            <94620..>95756
FT                   /locus_tag="CAGL0J00913g"
FT                   /old_locus_tag="CAGL-IPF9019"
FT                   /old_locus_tag="CAGL-CDS2918.1"
FT   CDS_pept        94620..95756
FT                   /locus_tag="CAGL0J00913g"
FT                   /old_locus_tag="CAGL-IPF9019"
FT                   /old_locus_tag="CAGL-CDS2918.1"
FT                   /note="some similarities with uniprot|Q07913 Saccharomyces
FT                   cerevisiae YLR007w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00913g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60699"
FT                   /db_xref="GOA:Q6FPU2"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU2"
FT                   /protein_id="CAG60699.1"
FT                   /translation="MSFKLIKSHLLHLKAIARSKKSNGVEVATQMSEGTPNNDVGDDLA
FT                   GEVRIGLSESEKEKHLLQYLLNCRGVCHENVLLKVMLLMENEQGDLEQGLSVFEWQAKL
FT                   QERVARINLKLQPLKYQVKKAIYGSGRAIVSEKVRSQLELNSANSFGKVNFPNSSQYYV
FT                   YIDTSPFGEMKHATTFTDKELEYIKAFIKVLADRGSVIHEVDDVSGVDSKIVEQIDEIR
FT                   QKAYGNKRRHDSDVESGPENAENNEPVQSSSVSRWTHYASYTADIAALTDTTDLQPLET
FT                   QELLDKLCRLRWLYKTGKGKYGLDLRLLVEMNDYLSDNYSMSSCERCKDIVAQGVQCST
FT                   RDCNSVWHVDCYEHDILHENRICRSCGESILDRGVYVT"
FT   gene            complement(<95878..>96339)
FT                   /locus_tag="CAGL0J00935g"
FT                   /old_locus_tag="CAGL-IPF7899"
FT                   /old_locus_tag="CAGL-CDS4803.1"
FT   CDS_pept        complement(95878..96339)
FT                   /locus_tag="CAGL0J00935g"
FT                   /old_locus_tag="CAGL-IPF7899"
FT                   /old_locus_tag="CAGL-CDS4803.1"
FT                   /note="highly similar to uniprot|Q07914 Saccharomyces
FT                   cerevisiae YLR008c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00935g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60700"
FT                   /db_xref="GOA:Q6FPU1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPU1"
FT                   /protein_id="CAG60700.1"
FT                   /translation="MDGTGISDGSSVTGDAAAGFPAGATQAPGSKQGMDLYFDNALQYM
FT                   GEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQILNLK
FT                   ENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGIVRK"
FT   gene            <96608..>97201
FT                   /locus_tag="CAGL0J00957g"
FT                   /old_locus_tag="CAGL-IPF7897"
FT                   /old_locus_tag="CAGL-CDS4470.1"
FT   CDS_pept        96608..97201
FT                   /locus_tag="CAGL0J00957g"
FT                   /old_locus_tag="CAGL-IPF7897"
FT                   /old_locus_tag="CAGL-CDS4470.1"
FT                   /note="highly similar to uniprot|Q07915 Saccharomyces
FT                   cerevisiae YLR009w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J00957g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60701"
FT                   /db_xref="GOA:Q6FPU0"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPU0"
FT                   /protein_id="CAG60701.1"
FT                   /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRN
FT                   PRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRE
FT                   RAFYKNRMKGNSERDFLRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEESEEE
FT                   EDMEVDSEEEEEEKLQKQKILLKNKKRNAKKLAF"
FT   gene            complement(<97960..>98041)
FT                   /gene="tRNA-Ser (AGA)"
FT                   /locus_tag="CAGL0J00979r"
FT   tRNA            complement(97960..98041)
FT                   /gene="tRNA-Ser (AGA)"
FT                   /locus_tag="CAGL0J00979r"
FT                   /product="transfer RNA-Ser"
FT   gene            <98637..>99929
FT                   /locus_tag="CAGL0J01001g"
FT                   /old_locus_tag="CAGL-IPF7894"
FT                   /old_locus_tag="CAGL-CDS2565.1"
FT   CDS_pept        98637..99929
FT                   /locus_tag="CAGL0J01001g"
FT                   /old_locus_tag="CAGL-IPF7894"
FT                   /old_locus_tag="CAGL-CDS2565.1"
FT                   /note="similar to uniprot|P47057 Saccharomyces cerevisiae
FT                   YJL036w SNX4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01001g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60702"
FT                   /db_xref="GOA:Q6FPT9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT9"
FT                   /inference="similar to AA sequence:UniProtKB:P47057"
FT                   /protein_id="CAG60702.1"
FT                   /translation="MDSASADASVTGSGNAKGSSAERVNGGGKFYKLEILVSDPQKRAG
FT                   EAGLGPYVSYQISTRTDNPSYHGNQKASFDDIIVVHRRYNDVVLLHDILQNDHPTCIIP
FT                   PLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRRVSQHPILSTSKVLEIFLVGNEWDTY
FT                   RKNIAGTLQNAQKEDVTDAVMNAFKKVHNQNEEFTEIRDRSDKLDNSVNRINKVFHRVV
FT                   KKNEAIIEDYSKLGLTLQELQELVSSDNDKLADSLKVFIEGVTQFSYGLQDLNMFIDYE
FT                   YLIDLKDLSHYIGSMKQTMRLKDQKQIDYEELSDYLTKSIKEKNNLISGYGGGNFLTSK
FT                   LEELAGYNQEASRRDKINKLESTISSLTTELETAKKVADTFEQETLKEVKKFEEIKNDE
FT                   LKISLNNLADENIKFYERMLETWEKVDQSLR"
FT   gene            complement(<100059..>100838)
FT                   /locus_tag="CAGL0J01023g"
FT                   /old_locus_tag="CAGL-IPF7893"
FT                   /old_locus_tag="CAGL-CDS3934.1"
FT   CDS_pept        complement(100059..100838)
FT                   /locus_tag="CAGL0J01023g"
FT                   /old_locus_tag="CAGL-IPF7893"
FT                   /old_locus_tag="CAGL-CDS3934.1"
FT                   /note="similar to uniprot|P47058 Saccharomyces cerevisiae
FT                   YJL035c TAD2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01023g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60703"
FT                   /db_xref="GOA:Q6FPT8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT8"
FT                   /inference="similar to AA sequence:UniProtKB:P47058"
FT                   /protein_id="CAG60703.1"
FT                   /translation="MDKYLKHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLND
FT                   TNDSLSGTAHAEFVAMRMLRDAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQM
FT                   GIHKIVFGCGNDRFGGNGTVLSIHSDKSTTVAGSTEYDRTILVPGIRRREAIMLLRYFY
FT                   VRENDRAPKPRTKAERNLDKNTFPPMQWCNYLTRDDFTTIFGEPLISKYDNNEDLAGET
FT                   INWDMIDNSHDSIINELQQESQNFELFLQNKKHKHST"
FT   gene            <101282..>103579
FT                   /locus_tag="CAGL0J01045g"
FT                   /old_locus_tag="CAGL-IPF7892"
FT                   /old_locus_tag="CAGL-CDS0899.1"
FT   CDS_pept        101282..103579
FT                   /locus_tag="CAGL0J01045g"
FT                   /old_locus_tag="CAGL-IPF7892"
FT                   /old_locus_tag="CAGL-CDS0899.1"
FT                   /note="highly similar to uniprot|P20448 Saccharomyces
FT                   cerevisiae YJL033w HCA4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01045g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60704"
FT                   /db_xref="GOA:Q6FPT7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT7"
FT                   /protein_id="CAG60704.1"
FT                   /translation="MAKKHRYTTVQRKQERQKEEEYIKELEQRIQDYDVKNNKAVFFKD
FT                   LPISKSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAFLVPVLEKLY
FT                   RERWTEFDGLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNFELERIAKI
FT                   NILIGTPGRILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGNLPPDRQTL
FT                   LFSATQSQSISDLARLSLTDYKKIGTIDSSEDGPATPKTLQQSYIIADLADKLDVLYSF
FT                   IKSHLKTKMIVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQ
FT                   VCLFATDVVARGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSLIILTPQEEA
FT                   FLTRMAAKKIEPGKLTIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVKSIYIQKD
FT                   KEVFKFDELPTEEFANSLGLPGAPRIKIKGMKAIEQAKKLKNTSRSLLSLSKANDDGEI
FT                   NDKKDKQVRTKYDKMFERKNQTILSEHYLNITKSQAQEDEDEDFITVKRKDHELKEEDL
FT                   PQLTVPTSRRAQKKALSKKASLSTKGNATKMVFDDEGQAHPVYELEGEEEFHKKGDAEE
FT                   QKKEFLSKEAEIMADRDVSDKIIQKEKKQEKKRKRLEAMRREMEAAYADEYSDEDEEGG
FT                   NVAYLGTGNLSDDMEEYSSDEESRKTKKSKTVDYRFDKKNKTISEDTDIMEIQEPETIE
FT                   DLESLTARLIEG"
FT   gene            complement(<103764..>104904)
FT                   /locus_tag="CAGL0J01067g"
FT                   /old_locus_tag="CAGL-IPF7891"
FT                   /old_locus_tag="CAGL-CDS4098.1"
FT   CDS_pept        complement(join(103764..104714,104902..104904))
FT                   /locus_tag="CAGL0J01067g"
FT                   /old_locus_tag="CAGL-IPF7891"
FT                   /old_locus_tag="CAGL-CDS4098.1"
FT                   /note="similar to uniprot|Q00618 Saccharomyces cerevisiae
FT                   YJL031c BET4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01067g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60705"
FT                   /db_xref="GOA:Q6FPT6"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR032955"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT6"
FT                   /inference="similar to AA sequence:UniProtKB:Q00618"
FT                   /protein_id="CAG60705.2"
FT                   /translation="MELLKQKRVQDQLKIEKYRQLTDTVLGLKDKREFTIESLKLTTNL
FT                   LELNPEFNAVWNYRRDIIVDLGEKLEPKFWEDELMFVMAQLKRFPKVYWIWNHRLWTLQ
FT                   NYPGASVKIWGRELVIVNKLLDADARNYHGWHYRRIVVSHMQKMTGNDMNKEELEYATT
FT                   MIKSNISNFSAWHQRVQLIQKMLEKNEIEDKTLFIEKEIDFVTNAMFTDAEDQAVWFYI
FT                   KWFIRSDLVLKVLTKERYLEMLKTFWENITMINEDELEFSGKENTWCLKLLLVIQQIQK
FT                   SEGIDIEDHTKIYLEKLLTVDPLRKNRYKHLLKLEC"
FT   gene            <105079..>105666
FT                   /locus_tag="CAGL0J01089g"
FT                   /old_locus_tag="CAGL-IPF7890"
FT                   /old_locus_tag="CAGL-CDS4486.1"
FT   CDS_pept        105079..105666
FT                   /locus_tag="CAGL0J01089g"
FT                   /old_locus_tag="CAGL-IPF7890"
FT                   /old_locus_tag="CAGL-CDS4486.1"
FT                   /note="highly similar to uniprot|P40958 Saccharomyces
FT                   cerevisiae YJL030w MAD2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01089g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60706"
FT                   /db_xref="GOA:Q6FPT5"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR027097"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT5"
FT                   /protein_id="CAG60706.1"
FT                   /translation="MDRNLSLKGSTRSITEFFEYCINSILFQRGVYPPEDFSTVRKYEL
FT                   SLLRTHDDELKDYLRKILSQVHRWLLGGKCNKLVLCIVDKDDGEVVERWQFDVTHFSKE
FT                   QETAAEVTDEETRNQMRTLIKQITASVTFLPELVKEGGYTFTVLAYTDADAKVPLEWGD
FT                   SDSKEVKDGEIVQFRSFETNDHRVGAQVSYKI"
FT   gene            complement(<105760..>108195)
FT                   /locus_tag="CAGL0J01111g"
FT                   /old_locus_tag="CAGL-IPF7889"
FT                   /old_locus_tag="CAGL-CDS0783.1"
FT   CDS_pept        complement(105760..108195)
FT                   /locus_tag="CAGL0J01111g"
FT                   /old_locus_tag="CAGL-IPF7889"
FT                   /old_locus_tag="CAGL-CDS0783.1"
FT                   /note="similar to uniprot|P47061 Saccharomyces cerevisiae
FT                   YJL029c VPS53"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01111g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60707"
FT                   /db_xref="GOA:Q6FPT4"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR031745"
FT                   /db_xref="InterPro:IPR038260"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT4"
FT                   /inference="similar to AA sequence:UniProtKB:P47061"
FT                   /protein_id="CAG60707.1"
FT                   /translation="MLGDSLDYDPTEDITGMLMSRDSLESLDELISVTRSYKLELSKEI
FT                   KQLELEDSGEAATESDALALLQTLIEEYEVTKETSMRTQQSIMDVTQGISRLDNAKQNL
FT                   SQTMSFFQNLKILTDCYIQCKQLLDSGSFRDMVSPYRIMYSLAGTTFAPYKSVQEINKL
FT                   LTSVNRLKSEVFDRIKQKFQQLLSQQEIPPQEDTQQHNELRDGACELLDSDQSAKSTLI
FT                   DWFISKLLYEMNEIFQVDDEAGSLENLARRYIYFKRVLNNFHSNLEQFFLPSWDLPMHL
FT                   TETFMETTRKDLNILLKREFQDKSPTIDLFMNALQETLEFENYINVRFSKKLNDKPKLS
FT                   TCFQPYLSVWVSHQDKLMDKKLLSYMSDPKFPENSTDSFIVPSSADLFRNYRAILTQSL
FT                   ELVQESENTAVLTALATFFTKWLGLYANKILEPLILPDNVEVEDKRECAKYTVLVINTA
FT                   GYCSTTIEQLEERLLEFTSASEQINGIFMQTKSKYDDLAAKGINFLLNRLITVEISFVW
FT                   REFKNVDWSNVMVEDYSRYMQTLKTLLKVTRSQPNTEGNVTILEYILKTFNRDIYKWNF
FT                   LDKVINLVFSEFLGCILKLLQPTPPYASATTKPRLNPRAVVNIGEQLMLDLDLLSNILN
FT                   SIPENMSGDGESTNNSSMKRTKKRIESDMDKLMKLVKLLIAPVDSPETYAETYNEITGG
FT                   NDNSVVWAFILSLKAVPWDLEQWRALRAAYKTKLDERKEEGKPIDHSMLIMEWDSRPMM
FT                   HFQANICRIQDPEWSKLVRNELRIHPPARTIQRPVTPQPQEPRRGIRELVSNSKLFER"
FT   gene            complement(<108526..>108598)
FT                   /gene="tRNA-Met (CAT)"
FT                   /locus_tag="CAGL0J01133r"
FT   tRNA            complement(108526..108598)
FT                   /gene="tRNA-Met (CAT)"
FT                   /locus_tag="CAGL0J01133r"
FT                   /product="transfer RNA-Met"
FT   gene            <109127..>109924
FT                   /locus_tag="CAGL0J01155g"
FT                   /old_locus_tag="CAGL-IPF7886"
FT                   /old_locus_tag="CAGL-CDS3876.1"
FT   CDS_pept        109127..109924
FT                   /locus_tag="CAGL0J01155g"
FT                   /old_locus_tag="CAGL-IPF7886"
FT                   /old_locus_tag="CAGL-CDS3876.1"
FT                   /note="similar to uniprot|Q07897 Saccharomyces cerevisiae
FT                   YLR003c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01155g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60708"
FT                   /db_xref="GOA:Q6FPT3"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT3"
FT                   /inference="similar to AA sequence:UniProtKB:Q07897"
FT                   /protein_id="CAG60708.1"
FT                   /translation="MSFKKQDAEGTGVLMGWDGSSVEMGEKRSNEEELSKRQKKLKHGK
FT                   LAQKRREQAAYEEEKLRKLPMQGAEAISEHFATVIRAQNPDLSAIELDEMYLKKSEFLG
FT                   TEAFDGVRNLHEFPGFMARFSRAPRAIVLSMSNIRVADVYRSLGGSSQCVKLFAKNKLH
FT                   EDVATVESVLGADKDKKDKKDKKDKDSKKKIKYFVATPTRLEKLLESTELFFEGKDKLD
FT                   IILDASYLDSKKNSLLDSENTKVLCKVLRTMLDKKSSVKVLLY"
FT   gene            <111185..>112624
FT                   /locus_tag="CAGL0J01177g"
FT                   /old_locus_tag="CAGL-IPF7883"
FT                   /old_locus_tag="CAGL-CDS2202.1"
FT   CDS_pept        111185..112624
FT                   /locus_tag="CAGL0J01177g"
FT                   /old_locus_tag="CAGL-IPF7883"
FT                   /old_locus_tag="CAGL-CDS2202.1"
FT                   /note="some similarities with uniprot|P14164 Saccharomyces
FT                   cerevisiae YKL112w ABF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01177g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60709"
FT                   /db_xref="GOA:Q6FPT2"
FT                   /db_xref="InterPro:IPR006774"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT2"
FT                   /protein_id="CAG60709.1"
FT                   /translation="MDDGMISEGVKDVYEYSHPIINNALAVSASEQQGKEVRRFATLAD
FT                   WYDVINDYEFQSRCPIILKNSHRNKHFTFACHLKNCPFKILLSYSSAGMHHGHAQDDMY
FT                   RSKDEDVDALNDGAHDHKLEYHDVDDPQVTAAIAAAVAAVGKDSSDPHNAATAAATAAA
FT                   AATNGGEDHKNLVQDTQPSAHSQAQAQASVRPNSNAPETIRGPFVVTKIIPYHDHPVQD
FT                   NLSLDKFVLTKIPRILQNELNFDDVLETLVAEGASDGDVAKFRVSEYVEHSGLLDIIKA
FT                   RYDLMDSDITKKFLSQIARRVTTYKARFVLRKKKYGIIKSDRHHPRANPAPAASGNRPP
FT                   RISRTRRKRSLEDDETEIAQEALKNSMMDDVDHQRHIDDDDEEHARKLARLGEDTDLHS
FT                   GIHDDGDHSSTQNAAMHEINPLASIDEVTDDKLPREVAEQLRLLSSHFKDVENQNLQDE
FT                   EGKKNSAEISDENIQPELRGQ"
FT   gene            <113385..>115256
FT                   /locus_tag="CAGL0J01199g"
FT                   /old_locus_tag="CAGL-IPF7880"
FT                   /old_locus_tag="CAGL-CDS1385.1"
FT   CDS_pept        113385..115256
FT                   /locus_tag="CAGL0J01199g"
FT                   /old_locus_tag="CAGL-IPF7880"
FT                   /old_locus_tag="CAGL-CDS1385.1"
FT                   /note="similar to uniprot|Q03153 Saccharomyces cerevisiae
FT                   YMR098c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01199g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60710"
FT                   /db_xref="GOA:Q6FPT1"
FT                   /db_xref="InterPro:IPR025210"
FT                   /db_xref="InterPro:IPR040152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT1"
FT                   /inference="similar to AA sequence:UniProtKB:Q03153"
FT                   /protein_id="CAG60710.1"
FT                   /translation="MQSLLQLKHYPLLTSYLEVLSTQKLHYMLRIRSIARPIVRRPWAN
FT                   AARVTGISGTRIQVPFPSSVRWYSDREPQTEPVVKDEESEHVPWYMRLEDDSLKSLNED
FT                   ISKQHEVRLPDDCPDSLHILVKHLQKQLALRDILVFDLKNQRLADPENYRLKMCDYVII
FT                   CTAMSTKHCERSYVEINKLLKNEYGVSGYVEGQVNPNDEKKRLKRLARKNNLGRTNIRR
FT                   NALNSTEESSWYMIDCHVDSIFLNILTENRRYEMNLEELYAPLNEKHLYEKSEHSMHIN
FT                   TNNRSQAFDSLEEEDNVLLALRKLAQQKRQYSTESPARSLRNELVKENFDSSKKLLADN
FT                   PELREQLVKVAISTIEQIRDSTGASINTEKWYKFVSHNVPLVIQDTTFWDSYLKFLLLL
FT                   NDCNSQTYSYKRLIPDYLVTKRSMGEELTADDITTFLSVISERVNPQNYWDLVKANTQV
FT                   VEALRLFDEEVIFTDAILSKVIKTLTTNSNEHKLHSFYEVIKFLVWKYEKEIPINTLET
FT                   ILKTLINFGEYDYLLRLWTTKIGYNVGSKDTRPWKVFLKAITETQDVELIRLIIEKGCL
FT                   LDISRGKVDVDPQLAVLLKTAFKTVDPENLIYNDQQRLLIPSSATRQ"
FT   gene            <115478..>116533
FT                   /locus_tag="CAGL0J01221g"
FT                   /old_locus_tag="CAGL-IPF7878"
FT                   /old_locus_tag="CAGL-CDS3148.1"
FT   CDS_pept        115478..116533
FT                   /locus_tag="CAGL0J01221g"
FT                   /old_locus_tag="CAGL-IPF7878"
FT                   /old_locus_tag="CAGL-CDS3148.1"
FT                   /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
FT                   YMR097c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01221g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60711"
FT                   /db_xref="GOA:Q6FPT0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT0"
FT                   /inference="similar to AA sequence:UniProtKB:Q03151"
FT                   /protein_id="CAG60711.1"
FT                   /translation="MSYRCYSSLSFVPRHVLPRFNIPKSDFKGHQVKAIKKFKKLSPGL
FT                   NMLIELRDIRAPLSTRNVIFDNILRSNRSLERLVVYTKKDMTSGNANGKQYFKKLSQWH
FT                   AQLNEKFIILDGRDTSDAKQLLKILQWENHKVESRGMRLPLGYRAFIAGMPNVGKSTLV
FT                   NTLRRVTNPSSSGTKFKKVARTGSEAGVTRSTSEVIRLMPTTNNSSPIYLIDSPGVGLP
FT                   GRLTNQNRMLTLSMCGAVKTSLIEPVIQADYLLYLMNLQNPLPGAEWYPKYKSEPTNDI
FT                   YEVLRRLAKNKESFDENVVATNWVNKWRLDSKNLLFDVETLLPADAFSYRDYVDKQLEE
FT                   LGELTFLRERQ"
FT   gene            complement(<116608..>118011)
FT                   /locus_tag="CAGL0J01243g"
FT                   /old_locus_tag="CAGL-IPF7877"
FT                   /old_locus_tag="CAGL-CDS2275.1"
FT   CDS_pept        complement(116608..118011)
FT                   /locus_tag="CAGL0J01243g"
FT                   /old_locus_tag="CAGL-IPF7877"
FT                   /old_locus_tag="CAGL-CDS2275.1"
FT                   /note="similar to uniprot|P35203 Saccharomyces cerevisiae
FT                   YMR094w CTF13"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01243g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60712"
FT                   /db_xref="GOA:Q6FPS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS9"
FT                   /inference="similar to AA sequence:UniProtKB:P35203"
FT                   /protein_id="CAG60712.1"
FT                   /translation="MVEERFNTLRFLDQPYEVRKLVYYHLDGQYTNANPPALDALYHGA
FT                   IEIPNVRDYGGSKKVKKYYRQLVKKLYPLFEQYLQNFQYSPAMIESWLEYSLWLRYDAI
FT                   VLDSLRLNHLYDGELVGPLDWIEIDGDLRLAVINKLYMLQVWYSYGEYKRWVIRNNITD
FT                   YGDMELGYLRLNLEMQRDGQIPNIIQKLRKKEQLNLISEINFTTNIDTVTNGNANGNVK
FT                   RGTNLKRARSDSPDVYLEDPMVKERYQIPNDPALTETIVNLEEMKQVSSLSVRGKNLYE
FT                   SLINVHGARDNPGRTISYISRRRVMRIAMNQVLNPSETGLADLTKWVNLRVISINDCGF
FT                   IDLNKLILPSKAISLSLSNIRELRWWEFEMDSAIQAQFQQNKLLPYRPLFDLCEAGIHY
FT                   TLDKKSISLVELKKFQTTIWKKLQALNWIKINNVAMISNKFIVIPKTLYESKRTVIFST
FT                   TVHSNIVVI"
FT   gene            complement(<118375..>119928)
FT                   /locus_tag="CAGL0J01265g"
FT                   /old_locus_tag="CAGL-IPF7876"
FT                   /old_locus_tag="CAGL-CDS1975.1"
FT   CDS_pept        complement(118375..119928)
FT                   /locus_tag="CAGL0J01265g"
FT                   /old_locus_tag="CAGL-IPF7876"
FT                   /old_locus_tag="CAGL-CDS1975.1"
FT                   /note="highly similar to uniprot|Q04305 Saccharomyces
FT                   cerevisiae YMR093w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01265g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60713"
FT                   /db_xref="GOA:Q6FPS8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS8"
FT                   /protein_id="CAG60713.1"
FT                   /translation="MSSSHPRIVTSRAAVLPQQTTAEQRYWRQYAATQLVKEHNSVTHV
FT                   AFNPQKPHDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL
FT                   VSVYDSYNPRTLLVSVAASQHPTHVTKFHDHDLKTLVSASDDRVTRVWDISHAYEPQLE
FT                   LTGAADYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLVHDQPVENVVAISP
FT                   TQLVSCGGPNFKVWDLTSNKKIFERANFNKTVTCLDYVNLPSDSGLASNSALLASSLDG
FT                   HVKVFDPLDNFQVKFGWKFSSAVLSCAVSPSDAQGSRHLVAGLTSGLLAIRTKKKEKRN
FT                   SHLAVDDYTAGSTGPKKSNNFQRMMRGSQYQGDLEHIIHDDKVKQQRRLRTFERYINQF
FT                   KWAEALDCAFVPGMAKELTLTILQELRKRGKIRVALQNRDESSLEPLLNWCLKGIEDVR
FT                   SVNVVVDWVTVVLEMYGQVAQESPVLNEMVVALRNKVREEVHKAEEAQRIEGMLQLLTN
FT                   "
FT   gene            <120215..>122047
FT                   /locus_tag="CAGL0J01287g"
FT                   /old_locus_tag="CAGL-IPF7872"
FT                   /old_locus_tag="CAGL-CDS1453.1"
FT   CDS_pept        120215..122047
FT                   /locus_tag="CAGL0J01287g"
FT                   /old_locus_tag="CAGL-IPF7872"
FT                   /old_locus_tag="CAGL-CDS1453.1"
FT                   /note="similar to uniprot|P46680 Saccharomyces cerevisiae
FT                   YMR092c AIP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01287g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60714"
FT                   /db_xref="GOA:Q6FPS7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS7"
FT                   /inference="similar to AA sequence:UniProtKB:P46680"
FT                   /protein_id="CAG60714.1"
FT                   /translation="MLVLEGSIVPVPQGTRNFSARLAYDERSDSVAYGSGKSAYVTGVG
FT                   AGAGGSEGGAGGNDVVQFTGHGANVSVVRFAPVGAYMCSGDESGKVIVWSWNRDGDGGV
FT                   ECVVKAEFQVLAGPVTDISWDFEGKRLCVVGEGRDKFGVFISWDTGNSLGEVTAHSSRV
FT                   NAVHIKQSRPMRCITVGDDGTVVFYQGPPFKFVSSDRTHHDKGKFVRDVEFSKGAGEFA
FT                   VTVGSDRKIACFDGKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKVRVWDV
FT                   RESKCLHSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTLNFLKIGEDKPVRTMHGHN
FT                   KSITALAVNPLVTGSYDGRIMQWVPEKICDSKMQTGHTNLVVSIGSKESGYSSVAWDDT
FT                   LRVNNEVKYKFESQPKCASMDPAGKIAVVTTEDKLLVLDSSTGEKLVETALDVPASAVH
FT                   LSGDLVAIGSEQTNTVSVYNSGDLSLLYKLPDPLRATPSCISIAPSHKLLAVGDVMGKI
FT                   ILYDLETKTVKTSRWAFHTSKINAISWRPEEEDLVATGSLDTHIIVYSVSKPMRTVKVL
FT                   NAHKDGVNAVQWKDRDHIVSAGADACIHTWKFTQ"
FT   gene            <122339..>123667
FT                   /locus_tag="CAGL0J01309g"
FT                   /old_locus_tag="CAGL-IPF7868"
FT                   /old_locus_tag="CAGL-CDS2463.1"
FT   CDS_pept        122339..123667
FT                   /locus_tag="CAGL0J01309g"
FT                   /old_locus_tag="CAGL-IPF7868"
FT                   /old_locus_tag="CAGL-CDS2463.1"
FT                   /note="similar to uniprot|P32832 Saccharomyces cerevisiae
FT                   YMR091c NPL6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01309g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60715"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS6"
FT                   /inference="similar to AA sequence:UniProtKB:P32832"
FT                   /protein_id="CAG60715.1"
FT                   /translation="MSDSETKLRSRSGSQKPDYKIDTEGLEIRDDDDNDVDYHEHDAEH
FT                   DGEDGSGRKKRSREDDDEDEDVSLEDDDEDEDEDDEDDGGKSEAREGPHKRARAKRARS
FT                   ATPMGGAGSTRKSEISYPIDEEGHLLPVYKYEYETLEDPEGEKKITADGDLLDGREFTI
FT                   RSFAIAENNAQKFMLSTEVARTMGYRDSYMFFQYHPSVYKFVLGQNQKNHLIDQNIIPY
FT                   SYRSRKITIVAAKSIYKEFGAKVIKSGKSPHDDYYVTVFPVRGQKPKPTASDLKRQEKQ
FT                   KSATATPTELPKKQSPLLSNPTFLEYRNSVANTFTGNSKLNSTNWLYQHAAACSRFNSD
FT                   LYYDRVRVLLIEQQGLRDPYTNTLHIPQNVQSTKVLDWYKEVDEEQEPNEDAITCETII
FT                   KSSNIARPKTNLCDVAPEIYEGVVDEETKKAILAQQEYERQLY"
FT   gene            complement(<123787..>124473)
FT                   /locus_tag="CAGL0J01331g"
FT                   /old_locus_tag="CAGL-IPF7867"
FT                   /old_locus_tag="CAGL-CDS4183.1"
FT   CDS_pept        complement(123787..124473)
FT                   /locus_tag="CAGL0J01331g"
FT                   /old_locus_tag="CAGL-IPF7867"
FT                   /old_locus_tag="CAGL-CDS4183.1"
FT                   /note="highly similar to uniprot|Q04304 Saccharomyces
FT                   cerevisiae YMR090w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01331g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60716"
FT                   /db_xref="GOA:Q6FPS5"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS5"
FT                   /protein_id="CAG60716.1"
FT                   /translation="MGPLRVAIVGANGKIGHLLTAKLKNSKASFATPVAIVRNEEQVKH
FT                   FQDEMGVDASLASIESATVPELQKAFTGCDAVVFTAGAGGKGVERIFTVDLEGCAKVVE
FT                   ACEKSGISRFVIVSAIKAEDRDFWWGLEGLRNYYIAKKAADQYVRNSKLDWTILQPGFL
FT                   DTNSGTGKLVPQDQLESKKDDNYRIQREDVAEFIVQSLLHPAETKLKTISLANGDVPIA
FT                   DFIKSL"
FT   gene            <124994..>127477
FT                   /locus_tag="CAGL0J01353g"
FT                   /old_locus_tag="CAGL-IPF7865"
FT                   /old_locus_tag="CAGL-CDS0744.1"
FT   CDS_pept        124994..127477
FT                   /locus_tag="CAGL0J01353g"
FT                   /old_locus_tag="CAGL-IPF7865"
FT                   /old_locus_tag="CAGL-CDS0744.1"
FT                   /note="similar to uniprot|P40341 Saccharomyces cerevisiae
FT                   YMR089c YTA12 or uniprot|P39925 Saccharomyces cerevisiae
FT                   YER017c AFG3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01353g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60717"
FT                   /db_xref="GOA:Q6FPS4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS4"
FT                   /inference="similar to AA sequence:UniProtKB:P40341"
FT                   /protein_id="CAG60717.1"
FT                   /translation="MLEWGGCFLLGYLNVNRVVTAMIRTRIGAVARVRVPVFRARFHCG
FT                   PVWRNSADDDLKRVQERINEYMRKNQRAGAGADAGTNAGTDAGAGAGAGMDMERFRKEI
FT                   DRELKRMEQTIQKQTPEAPREEYKDTKDAKESSQESKEPQEAKEKAKGTKQEAREGSSN
FT                   GGNPPPPPLNDPSGNANNIGLFQLGLLFFLLSFLLDLVNDTEGQKEITWQDFRERYLAK
FT                   GYVQRLEVVNKSYVKVILNDMGKNQPENYGQEVVYFNLGSVENFEHKLEKAQNEMDIDQ
FT                   DFRVPVQYVQQGNWARAVFQMLPTVLMLVGIIWLTRKSMQSAGNTRGGIFGISRSKAKK
FT                   FNTETDVKVKFKDVAGCDEAKEEIMEFVSFLRNPQRYEKMGAKIPRGAILSGPPGTGKT
FT                   LLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGK
FT                   ARQKGNFSGANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRR
FT                   IHIDRPELEGRKAIFEVHLQKLKLAGSIFDLKNRLAALTPGFSGADIANVCNEAALIAA
FT                   RHDENAVKLSHFEQAIERVIGGVERKTRLLSPEEKQVVAYHEAGHAVCGWYLKYADPLL
FT                   KVSIIPRGQGALGYAQYLPGDVFLLSKQQLLDRMTMALGGRVSEELHFQWVTSGASDDF
FT                   KKVTNMATAMVTELGMSEKIGWINYKKNDDNDLTKAFSEETGVIIDSEVYRIVQECHKR
FT                   CTDLLKEKAEDVEKIAQLLLKKEVLTREDMINLLGKRPFPERNDAFDKYLNEAETEKIR
FT                   KSEEQNPDDPSPSAA"
FT   gene            <127843..>129537
FT                   /locus_tag="CAGL0J01375g"
FT                   /old_locus_tag="CAGL-IPF7863"
FT                   /old_locus_tag="CAGL-CDS1704.1"
FT   CDS_pept        127843..129537
FT                   /locus_tag="CAGL0J01375g"
FT                   /old_locus_tag="CAGL-IPF7863"
FT                   /old_locus_tag="CAGL-CDS1704.1"
FT                   /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
FT                   YMR088c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01375g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60718"
FT                   /db_xref="GOA:Q6FPS3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS3"
FT                   /inference="similar to AA sequence:UniProtKB:Q04301"
FT                   /protein_id="CAG60718.1"
FT                   /translation="MENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWL
FT                   GSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFA
FT                   VLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQ
FT                   GYANIVFGLGQILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSHLLPV
FT                   EERFKWSNLSRIDILGSSTLVFTISGVLFLCSTELNKALLSIFTVISFIAFILIELYYS
FT                   KERIMPFELLKGSFGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSI
FT                   SVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSAIF
FT                   GAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQQGTVTGIF
FT                   YLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLLSDTSYLRSG
FT                   HFPDGILFELLKVYRNSFLLSYLPNFILAIAGVAICGGLLVVSYAQD"
FT   gene            complement(<129649..>130476)
FT                   /locus_tag="CAGL0J01397g"
FT                   /old_locus_tag="CAGL-IPF7861"
FT                   /old_locus_tag="CAGL-CDS3795.1"
FT   CDS_pept        complement(129649..130476)
FT                   /locus_tag="CAGL0J01397g"
FT                   /old_locus_tag="CAGL-IPF7861"
FT                   /old_locus_tag="CAGL-CDS3795.1"
FT                   /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
FT                   YMR087w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01397g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60719"
FT                   /db_xref="GOA:Q6FPS2"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR028071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS2"
FT                   /inference="similar to AA sequence:UniProtKB:Q04299"
FT                   /protein_id="CAG60719.1"
FT                   /translation="MTRNNTKRKSMNQIRIVICDTNEVVARKLHQYVPKKLTLSQQAVC
FT                   THHGPLESLINSMRTDKKKHPGNKYAIVSPGNSFGYLGGGFDLALFNYFGGKPFESWFR
FT                   KELGNRYHTVGSATVIDLTRCPLNDINELRDGIQYIIHVPTVVAPTKPIYQESQKLKTG
FT                   YEPVFNAMWNSVMHAPHDVDGLIIPGLCTGYAGVPPDISCKSMAFALSLYMLQDKISVE
FT                   LRNALIMYFLGYPFKPFILESCLEECQALGLNIHSLESFNVEEDDIQQLLPKF"
FT   gene            complement(<130812..>133832)
FT                   /locus_tag="CAGL0J01419g"
FT                   /old_locus_tag="CAGL-IPF7860"
FT                   /old_locus_tag="CAGL-CDS0441.1"
FT   CDS_pept        complement(130812..133832)
FT                   /locus_tag="CAGL0J01419g"
FT                   /old_locus_tag="CAGL-IPF7860"
FT                   /old_locus_tag="CAGL-CDS0441.1"
FT                   /note="weakly similar to uniprot|Q04279 Saccharomyces
FT                   cerevisiae YMR086w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01419g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60720"
FT                   /db_xref="GOA:Q6FPS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS1"
FT                   /protein_id="CAG60720.1"
FT                   /translation="MFRSRNYNDQMRYANPNAVAAASALGNIMMPKQPQSQAQPQGAKR
FT                   APVRSSSMMNMRRGSLLRKPEEKKSTPSRTGSLVQRKPSITNQKRHSISSTPQSSAPNR
FT                   TSSLPTKRNSLVSRSGSFTRRMKNAQSTFNEFGPQASGVANVRNSGEQVVKMVTKYIPG
FT                   KNGLIAVQVPATTEQPRKTSSLTRRPGSMTSISNKNGPKRKISQQSLHSHSVQQSNPQK
FT                   PSKKKEVIDSSNPEDSFNRAVDKVDESVPLIETSMREETEQELLEQTVAIDESVIKADE
FT                   NPAGLQNLLEDNIVLEETMEEQKKDGKAPLENDATSNEKVNIEPLPEVAVDSTDIPAPL
FT                   EESERQETNIAPKEDSMKEEIEPEALDNTAKNITEFDSEQMKDNKTVTDSINELENIPG
FT                   TMDNEMQELKESIANDINSQLTTEEMIDEMEGSKTDMMTTDLNEKFSKAELSEQNLPDN
FT                   NDSPLLKQQKFEENKLKESIEAFGKGANEGNENNVLQDNVVGNDITLQHDIVTNIRSNE
FT                   TVSSPTDSEFVDSSSVMENDEQKENVENLASKNKSPNKQKPQNMAQYLRSANPYLTTGG
FT                   SATSAKKSPATSPKKQGSSGPIKSAMKKSSRPLSTTSSVYSDINSPADGAYLSLTTAEN
FT                   TRINAKLAVEEPIDWHPNADKSKRASMPVRSSSKLYKKTSNSQSQEKVGYNRSSRQYQG
FT                   PIQTPPNTTKTPGGVTKMGVVSAAALSSNNNAAAAEDKSNRQSLLKNRALEMAKQVNIT
FT                   PKKAKPVTPSVPSSTVTPPAVNPVLNAALYPKEPLQKKSSFEKLRNTDKNLGFKKLSLR
FT                   DSAFMDGADEQALVNAGSRNSMMNESPGQAPPKLATASTNSGWKSRFQDSDSDVEPVQA
FT                   NAAPVAPPRSEERVNGFSLFKKKSNTGGNTFLKPPQPDFSAGSEMGEKVSRTSSYNSSP
FT                   NKTLNNQYSKGSLRSSSMQTAGPGSTAKPNIFANIEETEKRIYSNPEVMRKDEHNDEGV
FT                   NHGFGKKLKKLFGRKKH"
FT   gene            complement(<134383..>135501)
FT                   /locus_tag="CAGL0J01441g"
FT                   /old_locus_tag="CAGL-IPF7856"
FT                   /old_locus_tag="CAGL-CDS2968.1"
FT   CDS_pept        complement(134383..135501)
FT                   /locus_tag="CAGL0J01441g"
FT                   /old_locus_tag="CAGL-IPF7856"
FT                   /old_locus_tag="CAGL-CDS2968.1"
FT                   /note="highly similar to uniprot|P07246 Saccharomyces
FT                   cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
FT                   cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
FT                   cerevisiae YMR303c ADH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01441g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60721"
FT                   /db_xref="GOA:Q6FPS0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS0"
FT                   /protein_id="CAG60721.1"
FT                   /translation="MFTRVAAAARIQSRRPLRLRLQSTLSIPQSQKGVIFYEHGGKLEY
FT                   KDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGAGVVVAKGSSV
FT                   TNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLSGYTHDGSFQQYATADAIQAAQ
FT                   IPKGTDLAQVAPILCAGVTVYKALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGMRV
FT                   LGIDAGDEKRKLFESLGGNHFVDFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSV
FT                   EYVRPCGTVVLVGLPAGATVKSDVFNHVIKSINIKGSYVGNRADTREAIDFFAKGQVKS
FT                   PIKVVGLSELPEVYKLMEANKIIGRYVVDTSR"
FT   gene            <136518..>137273
FT                   /locus_tag="CAGL0J01463g"
FT                   /old_locus_tag="CAGL-IPF7854"
FT                   /old_locus_tag="CAGL-CDS3992.1"
FT   CDS_pept        136518..137273
FT                   /locus_tag="CAGL0J01463g"
FT                   /old_locus_tag="CAGL-IPF7854"
FT                   /old_locus_tag="CAGL-CDS3992.1"
FT                   /note="similar to uniprot|P28319 Saccharomyces cerevisiae
FT                   YKL096w CWP1 cell wall mannoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01463g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60722"
FT                   /db_xref="GOA:Q6FPR9"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR9"
FT                   /inference="similar to AA sequence:UniProtKB:P28319"
FT                   /protein_id="CAG60722.1"
FT                   /translation="MKFTHQFVLSLIALAKLVMADSQQFGIISIASGSDLQYASAFFDS
FT                   NNLVVGHQPNNQFALVVTDDGKLKSTSGNQFIAVDANSGNLKEVSDSNSASVGFSIKNG
FT                   HLLYLNSESFYAVPGASSGATWSLSTKNTNSAQGAAASPVVLRTQSTTGTDVVADFTPA
FT                   AMSSVSSVVPSSISSVHPSSLVSSGSTLVLSKASGSAVPISQIGDGQIQATATSHVPPV
FT                   QSHNGAIGQHGPYLGMHAGVAAAAIAYLL"
FT   gene            <138326..>139228
FT                   /locus_tag="CAGL0J01485g"
FT                   /old_locus_tag="CAGL-IPF7850"
FT                   /old_locus_tag="CAGL-CDS3601.1"
FT   CDS_pept        138326..139228
FT                   /locus_tag="CAGL0J01485g"
FT                   /old_locus_tag="CAGL-IPF7850"
FT                   /old_locus_tag="CAGL-CDS3601.1"
FT                   /note="similar to uniprot|P38747 Saccharomyces cerevisiae
FT                   YHL013c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01485g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60723"
FT                   /db_xref="GOA:Q6FPR8"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR8"
FT                   /inference="similar to AA sequence:UniProtKB:P38747"
FT                   /protein_id="CAG60723.1"
FT                   /translation="MDAREELLAKHRKEKRDLVNRITGMKKQATKAKRKEVNSKCEQLE
FT                   QELREKHEQELKELDGEGGDVEEVTPEQLLAQLQVEDDGAKEANEANEAKADKEAKVGP
FT                   SQQPKKKRNRQKEKLARREAEIARMKEEAKKEAAEQPDLKKIEQDAIWQLCQMKGLVPY
FT                   DIQPDGHCLFASILDQVKTRHGDPQTEMDVHTLRCLACDYILEHRDEFIPYLFDEATMS
FT                   LKDIDEYTEEMKSTAKWGGEVEILALSKALDCPISVLMSGQATHTVNETGSKPELKLVY
FT                   YKHTYALGEHYNSLRDSKI"
FT   gene            <139697..>143500
FT                   /locus_tag="CAGL0J01507g"
FT                   /old_locus_tag="CAGL-IPF7848"
FT                   /old_locus_tag="CAGL-CDS0206.1"
FT   CDS_pept        139697..143500
FT                   /locus_tag="CAGL0J01507g"
FT                   /old_locus_tag="CAGL-IPF7848"
FT                   /old_locus_tag="CAGL-CDS0206.1"
FT                   /note="similar to uniprot|Q04264 Saccharomyces cerevisiae
FT                   YMR076c PDS5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01507g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60724"
FT                   /db_xref="GOA:Q6FPR7"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039776"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR7"
FT                   /inference="similar to AA sequence:UniProtKB:Q04264"
FT                   /protein_id="CAG60724.1"
FT                   /translation="MAMPGAVRKLQFSKPIISTLENTIAASELVGRLCNLHEELAQFVQ
FT                   DQVDLSSLDAVKGDLINHKLLKHKDLGVRAFTACCLSDILRLYAPEAPYTDGQLTDIFK
FT                   LVLSQFEYLGDPDNGYYVQQTYLITRLLEYRSIVLITDLPTSDKLLFRLFEIFYDDNHS
FT                   YQNKLFNVIGGLLGEVLSEFENMPLNVLKLIFNKFLTYNPEKAPKGLGVASNCGYEVSL
FT                   ILCENYTARMSRYLTKYYSEILYNITNEKNIDDSYEMRTKLIIATEKLHKLVYRLWETV
FT                   PDLILSVIGFVYHELSSENEIIRKLATRLVGKMISKNTMANFVQAHEDTFKAWMTKIAD
FT                   IDADVRVEWISCIPNILEVRSDISDDIGHGLAKTLIDSDARVRKLSVTVFDEVPVKAIW
FT                   ENVKNISVYKSLLQLTREKNREIRELCIHSVGRFYAESRRNIEKESYDTEIWSIVESIP
FT                   STLFNLYYINDAHINQWVDEIVFDYLLPFEDDDTKRVRELLSIVSKLDKKAFSSFIAFN
FT                   KRQVPSAVAMAKFVEFCEVLKQSEYEDDLDTIQKYNKTIDWLSSSMADPIKTADVLEAI
FT                   KELNMGRVFFLIKNCVRADVTYSTFRNSYNELLDKLGDDNLFKKNRVKNSTSVSPQDIA
FT                   HEIKALLLRSSPIIFNISNIGILLDNSVFENEAETSLKRKLVNEVSKISPTLFRDQLKN
FT                   LKDTIIYLEDFNSRQEQALATEALKTIYKISKSVEDNNTFDDKLFSSKLIEFALNGSPQ
FT                   LAKYATKMIALSPDSERELRGLVLKILPLDIDKDQNFTSHLAILMEVFRFTPHLLDDES
FT                   TNIVSYLIKNVLLSNYKIEEDKVEEGESLFEEHIAESNEHACLANKLFTLKLFTNKLRA
FT                   LSLHDDDDDLSKAFIEKTLKLYIYLIASGGELVSETSSSKPTPEAYQTILRLSAALQIL
FT                   KVARISSLNTFIKSTEICKLVNIVEDESLEVRRRFLDQLKDSLSCELISIKFLPLIFFT
FT                   AYEPDKELKASTKIWINYTCAKPSFKKGTLFERVLPRLIHAIAHHPDVIEGFQGTEEEV
FT                   IIALTTAVDYLVFYFDSVASQENFSLLYYLSERVKNYQDILDEDEESSANEDDSISRWK
FT                   PFQYIYVVGELSQIILLTIKERRSWQHIAYPGKLNLPSDLFKPFDSAESAQATFKNYLS
FT                   EKYAEKIKGNIVAKVGKLIHASQTQRQRSQKRLLDQEYREDTSPKKQRTKGSKTQRKDR
FT                   QNDGSDIESDEEIYRGGNVEANASGVRKSNRARKQVDYNEDD"
FT   gene            complement(<143666..>145681)
FT                   /locus_tag="CAGL0J01529g"
FT                   /old_locus_tag="CAGL-IPF7847"
FT                   /old_locus_tag="CAGL-CDS1196.1"
FT   CDS_pept        complement(143666..145681)
FT                   /locus_tag="CAGL0J01529g"
FT                   /old_locus_tag="CAGL-IPF7847"
FT                   /old_locus_tag="CAGL-CDS1196.1"
FT                   /note="similar to uniprot|Q04779 Saccharomyces cerevisiae
FT                   YMR075w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01529g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60725"
FT                   /db_xref="GOA:Q6FPR6"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR6"
FT                   /inference="similar to AA sequence:UniProtKB:Q04779"
FT                   /protein_id="CAG60725.1"
FT                   /translation="MSGQSSNTSSKGSSVTPASDGKTINGLEKVKVKLEKVNERGRSRP
FT                   KRSSSQNVDYDLKKRKIITEDLNLGKKNGDQSEAGSTGNGTPTGSTNGPEFKAEDIIEY
FT                   NRKGEIVKVNEPPTIETVNGANGIPLSQFPPDKVKKEYLWNFKKSNSGQYLLSAAVAAK
FT                   SSKDNEEKPNFTERFEQLLLQAKATTEKERELTKPSHIRHQVKSSSKTEHVLVPKGINL
FT                   HNPHIKTKLKDTHAFDSKTKLISQNPVGQMNDIAMAKKKSSDGTTQEIENDDYCSACFQ
FT                   TGSFLCCDTCPKSFHFLCLNPPLDPDHLPEGDWSCPQCMVKLRYANNTQYLKAQKAYTA
FT                   QMPKGKRLFGKLLFSLQGTNPRQFNLPNFIKETFQSVKTGPRGQYSDDTIKEPLSDKPI
FT                   FNSPYGQSITKLDSYNLDSHIDQTTGKILTCYRCGVSRLGSWSHPEEARLLIKCDYCNT
FT                   RWHLDCVPEVPRASLKNLGSKWQCPLHSEPPNTTKFDDQSKIKKSRKLIKNQRYMEPLQ
FT                   SCGYRNEGNIEVALDEISALPPKNARNINVAYKPIPLLNESNFILDFEEKLRQVKENEF
FT                   RKSVSAQSKILEQLMCTLKKDEKEDIMTLLQFRFKKSKELKQLWDFSELTSKLNAKIQP
FT                   QNETKNEDIQALLALKKIIESKPKEEILRFLDLSDD"
FT   gene            complement(<146404..>146477)
FT                   /gene="tRNA-Val (AAC)"
FT                   /locus_tag="CAGL0J01551r"
FT   tRNA            complement(146404..146477)
FT                   /gene="tRNA-Val (AAC)"
FT                   /locus_tag="CAGL0J01551r"
FT                   /product="transfer RNA-Val"
FT   gene            <151584..>152618
FT                   /locus_tag="CAGL0J01595g"
FT                   /old_locus_tag="CAGL-IPF7839"
FT                   /old_locus_tag="CAGL-CDS3211.1"
FT   CDS_pept        151584..152618
FT                   /locus_tag="CAGL0J01595g"
FT                   /old_locus_tag="CAGL-IPF7839"
FT                   /old_locus_tag="CAGL-CDS3211.1"
FT                   /note="some similarities with uniprot|Q12531 Saccharomyces
FT                   cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
FT                   cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
FT                   cerevisiae YMR164c MSS11"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01595g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60727"
FT                   /db_xref="GOA:Q6FPR4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR4"
FT                   /protein_id="CAG60727.1"
FT                   /translation="MLSICRIFCKLILTPCDFEVSIKPQKTLPIMIAMDDRYYNLENKF
FT                   VPVGLPAVSPSAQYYPADASRPQSNVQSPVYYVPQNQINYIQRPSVSYVPTMEDQQYTY
FT                   TTMAHPQQQMILPVRNASPIEVQQQQLQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QHPLVKLPPISAIIPPGNSSPVNTTGQVQTSDQARNYNPGFRQDVQIALNPKSLSAPTS
FT                   GRNSISINPLMYNPHQQQQLLALAGVSIPPTLMEHQLTDAMTKQEIKLTKRQLKKATTR
FT                   LRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNS
FT                   LNKK"
FT   gene            <154247..>154355
FT                   /gene="tRNA-Leu (TAG)"
FT                   /locus_tag="CAGL0J01617r"
FT   tRNA            join(154247..154285,154311..154355)
FT                   /gene="tRNA-Leu (TAG)"
FT                   /locus_tag="CAGL0J01617r"
FT                   /product="transfer RNA-Leu"
FT   gene            <154646..>155629
FT                   /locus_tag="CAGL0J01661g"
FT                   /old_locus_tag="CAGL-IPF7837"
FT                   /old_locus_tag="CAGL-CDS3349.1"
FT   CDS_pept        154646..155629
FT                   /locus_tag="CAGL0J01661g"
FT                   /old_locus_tag="CAGL-IPF7837"
FT                   /old_locus_tag="CAGL-CDS3349.1"
FT                   /note="highly similar to uniprot|Q12251 Saccharomyces
FT                   cerevisiae YPR011c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01661g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60728"
FT                   /db_xref="GOA:Q6FPR3"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR3"
FT                   /protein_id="CAG60728.1"
FT                   /translation="MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFE
FT                   RVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEG
FT                   CKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSK
FT                   SRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP
FT                   SDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWD
FT                   ALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW"
FT   gene            <156341..>156556
FT                   /locus_tag="CAGL0J01699g"
FT                   /old_locus_tag="CAGL-IPF15788"
FT   CDS_pept        156341..156556
FT                   /locus_tag="CAGL0J01699g"
FT                   /old_locus_tag="CAGL-IPF15788"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01699g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58039"
FT                   /db_xref="GOA:B4UN23"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN23"
FT                   /protein_id="CAR58039.1"
FT                   /translation="MRPAQLLMNAAKKSSGTKVPIELAPLFAAIGVALCSGTFFTYKKL
FT                   TYDDSLRLKSNPDMSGLDDVLKEAKE"
FT   gene            complement(<157157..>157229)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01705r"
FT   tRNA            complement(157157..157229)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01705r"
FT                   /product="transfer RNA-Lys"
FT   gene            complement(<157842..>160781)
FT                   /locus_tag="CAGL0J01727g"
FT                   /old_locus_tag="CAGL-IPF7834"
FT                   /old_locus_tag="CAGL-CDS0472.1"
FT   CDS_pept        complement(157842..160781)
FT                   /locus_tag="CAGL0J01727g"
FT                   /old_locus_tag="CAGL-IPF7834"
FT                   /old_locus_tag="CAGL-CDS0472.1"
FT                   /note="some similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01727g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60730"
FT                   /db_xref="GOA:Q6FPR1"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR1"
FT                   /protein_id="CAG60730.1"
FT                   /translation="MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSAL
FT                   TLNDGSEYIFDGGFRGAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPD
FT                   TVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPN
FT                   ELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDN
FT                   VIHLSPGGAISLRRPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYK
FT                   YNIGCGYNPELASAQEIKIYFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSSVKPSSM
FT                   NPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSPSSINPSSMNPSSPSSMNPP
FT                   FANSSSMNPSSMNPSSMNPSSPSSMNPSSINPSSMNPSSINPSSMNPSSMNPSSVNPSS
FT                   MNPSSVNPSSVNPSSMNPSSMNPSSMNPSSMNPSSVNPSSMNPSSPSSMNPSSMNPSSP
FT                   SSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPPFANSS
FT                   SMNPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNP
FT                   SSMNPSSPSSMNPSSINPSSMNPSSMNPSSVNPSSVNPSVEPSILKPSNVNPSSFDSSS
FT                   MNPSSVNPSSVNPSSMSPSSVNPSSVKPSSVKPSSDKPSNANPSSVKPSSINPSVEPSI
FT                   LKPSNVNPSSFNSSGINPSSVNPSSVKPSVHPSVKPSSEKPSNVNPTSVKPSSASPSSA
FT                   HPSNISSKPTVSVSVSSVSNKPASDVLSSNKYVSSGSVVVSASRVISSRSPSSIVLGNG
FT                   GGLVVSSQRPGSVQNSVRPSASPSSVRQGSAQPAANASTKTVSGTQASRAPSGVNSVSQ
FT                   VRVSSNSASGVVNSRAPTVVSSTFRGSAVMLHVYGIELVLPVLAALLFI"
FT   gene            complement(<163678..>163750)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01749r"
FT   tRNA            complement(163678..163750)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01749r"
FT                   /product="transfer RNA-Lys"
FT   gene            complement(<164808..>172073)
FT                   /locus_tag="CAGL0J01774g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.530.m"
FT   CDS_pept        complement(164808..172073)
FT                   /locus_tag="CAGL0J01774g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.530.m"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58040"
FT                   /db_xref="GOA:B4UN24"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN24"
FT                   /protein_id="CAR58040.1"
FT                   /translation="MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISY
FT                   VDGSEYNFGGGIVSSQEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQTI
FT                   NFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGN
FT                   ILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINLG
FT                   GISGISVKSTSSNIIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGC
FT                   GYDETTLGSTTGYIVYHGESLKTFVIATSLETAPDYQKCYIPGQHENHDSGSGSTPGEG
FT                   SGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGS
FT                   GSGTGSGSGSGTEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSGSGSGSEGGSGSG
FT                   SGSRSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGSTPGEGSGSGSGTGS
FT                   GSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSGSEGGSGSG
FT                   SGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGS
FT                   GSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGSGSTPG
FT                   EGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGE
FT                   GSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSGSGSGSEGGSG
FT                   SGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGS
FT                   GSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTG
FT                   SGSGSTPGEGSGSGSGTGSGSGSGSGCGSEGGSGSGSGSGSGSTPGEGSGSGSGTGSGS
FT                   GSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSG
FT                   SGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGS
FT                   TPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSG
FT                   SGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGTGSGSGSGS
FT                   GSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSASGEGSGSGSGTGSGSGSGSGSA
FT                   SGEGSGSGSGSGSGSTSGEGSGSGSGSGSGSAPGEGSGSGSGSGSGSGSTPGEGSGSGS
FT                   GSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSG
FT                   SGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSTPGEGSGS
FT                   GSGSGSGSTPGEGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSG
FT                   SGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSGSGSGSTPGEGSGSGSGS
FT                   GSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGST
FT                   PGEGSGSGSGSGSGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGS
FT                   GSGSGSGSGSGSEGGSGSNPGTGEGGSGSEGGSGEGGSGSEGGSGEGGSGGSNPVDDGK
FT                   DKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSNPGAGEGG
FT                   SGSEGGSGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDK
FT                   DGKPTVILTQYQSPTPSPGEGGSGSNPGAGEGGSGSEGGSGEGGSGGSNPVDDGKDKTT
FT                   VVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVH
FT                   ITTYTDSDGHTITSTYTEMFKTLIDAEPQYVSETTQTITTTDAEGHTTTITTTYNIDNN
FT                   GNAVPIVPSSSSMSSSSSSSMSSSSSSSMSSSSSSSMSSSSSSSMSSSSSSSMPSSSSI
FT                   ISSSIFSSVSTPSGQDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEK
FT                   DRTTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIET
FT                   NVVSHITTVDTKGNPTTIVTTTTKFNNAHTTTFSNKNGSVDTKTVVGVTTTNQFGQQII
FT                   TSLTFTGSEAHSNNNVHTSAGPNDAAGTSPAGTNNPQTKPTGNAGSTARLSDTTPAPNA
FT                   GSNGSSPAAADAESAVAPKAPASNSAAVPQQSGASSTSHGSAAPTIPQINKNAASSFKQ
FT                   NNFGVIILFALLFTML"
FT   gene            complement(<173901..>177152)
FT                   /locus_tag="CAGL0J01800g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.531.m"
FT   CDS_pept        complement(173901..177152)
FT                   /locus_tag="CAGL0J01800g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.531.m"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58041"
FT                   /db_xref="GOA:B4UN25"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN25"
FT                   /protein_id="CAR58041.1"
FT                   /translation="MKLILLIQLWWLTLVNTKSIYPGPTVLTGNQIFEDEVIIDNGGGL
FT                   VLNDGSEYIFNGGYHGGKQCSIDINAAKGLPFTLTTSSDAKLFENGCVFKIRNANTGAK
FT                   TIQSINFSPIEFKNTNKFILELGHTNSDASSRLILGSPEIVNSGEISYISTGVEIGDSN
FT                   NEGNLLKIGRPTGSINNTGKISFDAASKYYLFGKVFGLGGSISVHRGTLYVDSLSFSNI
FT                   IYLGSNTAVAFKNSISAPITVRGLETSSAISSAGSDGKFNYNDKTGLLVVTTSEGSFIY
FT                   NIGCGYKSELILTSQTKTWYQGKLYDYFSVTFHQVPPTNTICVESSKEFRRVKSTLLDK
FT                   YGDIKGWDIMNLFKRDGENVSPANAPANAPANPPANAQPDVNALANAPANPPANAPANP
FT                   PANAPANAPANPPANAPVNAPANPPANAQPDVNAPANAPANAPANPPANAPANPPENPP
FT                   ANAPANPPANAPANAPANAPANAQPDVNAPANPPANPPANAPANPPANAQPDVDTPVNA
FT                   APNGPAKNGTYVGPQPKPNKPSQEEPNANSPAAGPANPQPQGNTPPVVQPANNDTSSNP
FT                   QPKPDVNSNANSNANSNANSNANSPAAGPANPQPQGNTPPVVQPANNDTSSNPQPKPDV
FT                   NSNANSNANSPAAGPANPQPQGNTPPVVQPANNDTSSNPQPKPDVNSNANSNANSPAAG
FT                   PANPQPQGNTPPVVQPANNDTSNNPQPKPNSPLGKPPHVDTSTPSVNFQQPSVYSPTAK
FT                   PSVINRFANSSSVVHPGIQPSNINSIGSQDIAGSSNGLSSKNSIAIGSPLAVLSPTEEP
FT                   SISQRVVINPALSSSVKLSSSPQAYMNSSSTVSSSSKSSVETSNNRNSDNGYAKPSKVN
FT                   SGIHLNPSSHNIDDSSKSASASPKSSKPSSASSNVSKPNPSGDNRVSTINSKKGNGLSS
FT                   KATPSPKPNVNSSQGGKAGPGNGHSSNNVSKENEKPSTVKSNSGKSNTVKPTSGKSNTG
FT                   KSEAQKPSTKTLSGSASQPKANQGPGGTQPTKGPSPGSNPAQQVNGGSLSGSNIIPINS
FT                   RIPTILSSTFRGNAAMLSIQGIELVLPALVALLFL"
FT   gene            complement(<179238..>179310)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01826r"
FT   tRNA            complement(179238..179310)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J01826r"
FT                   /product="transfer RNA-Lys"
FT   gene            <179922..>183530
FT                   /locus_tag="CAGL0J01848g"
FT                   /old_locus_tag="CAGL-IPF9494"
FT   CDS_pept        179922..183530
FT                   /locus_tag="CAGL0J01848g"
FT                   /old_locus_tag="CAGL-IPF9494"
FT                   /note="highly similar to uniprot|P22138 Saccharomyces
FT                   cerevisiae YPR010c RPA135"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60734"
FT                   /db_xref="GOA:Q6FPQ9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ9"
FT                   /protein_id="CAG60734.1"
FT                   /translation="MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPH
FT                   VGSFNALTEGPDGGLLQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKP
FT                   TANDGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQ
FT                   SNRCHLNKMSPHELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANR
FT                   GASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTS
FT                   DREIFDGIIGSNTNNSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPD
FT                   KSDYEVGQEVLNRIVLVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEV
FT                   LLGGFLYGMILKEKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKM
FT                   QYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKL
FT                   LPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAA
FT                   GPSLCCVQLDGKIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYP
FT                   GLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNIL
FT                   SILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANL
FT                   YDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNR
FT                   SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTY
FT                   HSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT
FT                   IDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEQDTP
FT                   ADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQRLRHMVNDKFQVRSTGP
FT                   VNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQAAICRECGSI
FT                   LTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLFEHEEKTEEKIFIDDSQIWEDGQGQKF
FT                   VGGNDTTTVAIPFVLKYLDSELSAMGIRLRYNVDPK"
FT   gene            <184269..>187109
FT                   /locus_tag="CAGL0J01870g"
FT                   /old_locus_tag="CAGL-IPF6462"
FT   CDS_pept        184269..187109
FT                   /locus_tag="CAGL0J01870g"
FT                   /old_locus_tag="CAGL-IPF6462"
FT                   /note="highly similar to uniprot|P13586 Saccharomyces
FT                   cerevisiae YGL167c PMR1 or uniprot|Q01896 Saccharomyces
FT                   cerevisiae YDR039c ENA2 or uniprot|P19657 Saccharomyces
FT                   cerevisiae YPL036w PMA2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60735"
FT                   /db_xref="GOA:Q6FPQ8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ8"
FT                   /protein_id="CAG60735.1"
FT                   /translation="MVESYVMKAVEESVDDSVEETHEMLPSAPVLDEEAYELLNRPNPS
FT                   LKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVE
FT                   DRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKC
FT                   HLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKD
FT                   AQTIDPEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEK
FT                   PKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPI
FT                   IVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSS
FT                   GTYENAISPEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYIGNPTDVALIEVLTK
FT                   FGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDKSSYYLDKAG
FT                   EVREFDEHSKVMVLEAAHSCASDGLRTIACAFKPTDSDNVISEDDINGLTFTGLFGLAD
FT                   PPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGDKVSELT
FT                   EDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMG
FT                   ISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITT
FT                   IAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLL
FT                   YLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFNAVACRHTTKSIFQIGL
FT                   FSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTLVLVSSSVLIVDEIRKA
FT                   IYALARVNEPVYSSEV"
FT   gene            <187614..>191738
FT                   /locus_tag="CAGL0J01892g"
FT                   /old_locus_tag="CAGL-IPF6464"
FT                   /old_locus_tag="CAGL-CDS0151.1"
FT   CDS_pept        187614..191738
FT                   /locus_tag="CAGL0J01892g"
FT                   /old_locus_tag="CAGL-IPF6464"
FT                   /old_locus_tag="CAGL-CDS0151.1"
FT                   /note="similar to uniprot|P32521 Saccharomyces cerevisiae
FT                   YIR006c PAN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60736"
FT                   /db_xref="GOA:Q6FPQ7"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ7"
FT                   /inference="similar to AA sequence:UniProtKB:P32521"
FT                   /protein_id="CAG60736.1"
FT                   /translation="MYQYSNQTGNGVYGNPPMQPLQNYGSSGYQQTAPMQQPLQTGYQQ
FT                   PMQQTMNQNQGMQLPQQQYQQQQPLQQQPMQQQPMQQQSFQQPQLQQPLQQQPTQTGMQ
FT                   QQPLQQQLTQSGMLQQPLQPQMQQSSQTIQPNQLNVQNTVQSQQSVQPLLPQQTGFYRQ
FT                   GNQPVLEPLKPTATGFVNSFANNGLDNNLKIPAIRLSFITAQDQAKFETLFRSIVTKGS
FT                   NTVSGENCRAILMKSGLQPSQLARIWQLSDTNRAGELLFPEFALAMHLINNVLQGDSIP
FT                   YELDSKTKNEVSSFIDAINLSVVSTESDFKTPFDDLFKPQQSLQPQGTGFLPQTSFGLP
FT                   AQPTGGFGQPQPTTFGQLQAQVTGGFGQPQPTTFGLQPQTTGGFVQAQQVTGGIAQQPS
FT                   MNPLTQQGTGFAQNQQGTGGFLQQQGTGSFNNAGFVQPQNTGSFVPQQQQQPVVQSQPI
FT                   APQSTGGFGPPMPTTFGIQPQSTGGFVQPQVTGGLQPALTGNIPQTSFGAQPFNQQLQP
FT                   QATGYLPPSQFSATMPLTAQKTGFGNNEIYAQSNFNGPSFSTQESDIITSEEKSLFYKI
FT                   FETFSQNRGVLDSATAVEIFRKSGLNRSDLEKIWNLCDINNTGQLNKQEFALGMHLVYG
FT                   RLNGRSIPDRLPPSLIPSSTKILDNVKNQLISSSSDGNRKSFTRMDALSYKNDDNDKLP
FT                   NFRNRRKNYPTDNDADKERQRRQEREREEAAKKKEQERKTKMDIERARKQGSFTNSEPE
FT                   FTDVSVSEIEDIKRRITEAQQKLAVRNQSIPNDLKKRFNEVVARLPTLFVEIYKVDTEI
FT                   MQARIELCKRRTPSSIIGTGPGGSITEDDRRKAKSKALLRSRMNALTGKGDNSDEPDIE
FT                   SESFTKEIEKIQSESAQNKKIIKDIRISISELSAPIRSIMTGSLPTCSSTDFEKWEIGV
FT                   GLENDVREFVLTLKKGLLYVSEPSHMNSNQTLSHPPAAALKKEATGEDRAAQLKEQAQK
FT                   RMKERLAKFGISRRETRDLESSKQQESGSTPDAVPAAQTANASQTPFEEVISSPQKMEV
FT                   TSTAGEDNEEEDEEERKLKEQLELLKQKKNAEKEKRLADLRRQIEEAEKEEEHPSVAQS
FT                   NSGNVQSSSNQPASVPVANSQPQNLQNTHITTKPLSLNQTGSSYDMASNTYFKPTQTSQ
FT                   SAFDREKAEQQRKIQRGLESDDDGWSDDDDDLYSKPNTAPQTAPVLDSSNTPQPGMNAS
FT                   VPAPIAPPIPTPQASSPAVPVAPPIPAVTPSESSIPMTSNADVAGADHLDQDTDISGAA
FT                   ASADKQNTSHVSHIPPVPVAPPLPQVSSIAPPPPLPNLSVPQPHETVDNDDGSDVLSIP
FT                   DSVESDKEDLAPAGHTPAAMGIPPPPPLPNF"
FT   gene            complement(<191912..>192421)
FT                   /locus_tag="CAGL0J01914g"
FT                   /old_locus_tag="CAGL-IPF6465"
FT                   /old_locus_tag="CAGL-CDS4670.1"
FT   CDS_pept        complement(191912..192421)
FT                   /locus_tag="CAGL0J01914g"
FT                   /old_locus_tag="CAGL-IPF6465"
FT                   /old_locus_tag="CAGL-CDS4670.1"
FT                   /note="similar to uniprot|P40565 Saccharomyces cerevisiae
FT                   YIR005w IST3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60737"
FT                   /db_xref="GOA:Q6FPQ6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ6"
FT                   /inference="similar to AA sequence:UniProtKB:P40565"
FT                   /protein_id="CAG60737.1"
FT                   /translation="MNQIKAIQRINEKELEAGILKPEHSWHQEYKDQAYIFIGGLNRQL
FT                   TEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQ
FT                   IKVDHIFFTPRDDIPEYTEAVREFLSKDKIDIHKDHLSTDNIQKETKYTNNEEDELNDP
FT                   MASYSR"
FT   gene            complement(<192784..>194061)
FT                   /locus_tag="CAGL0J01936g"
FT                   /old_locus_tag="CAGL-IPF6466"
FT                   /old_locus_tag="CAGL-CDS2606.1"
FT   CDS_pept        complement(192784..194061)
FT                   /locus_tag="CAGL0J01936g"
FT                   /old_locus_tag="CAGL-IPF6466"
FT                   /old_locus_tag="CAGL-CDS2606.1"
FT                   /note="highly similar to uniprot|P40564 Saccharomyces
FT                   cerevisiae YIR004w DJP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60738"
FT                   /db_xref="GOA:Q6FPQ5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ5"
FT                   /protein_id="CAG60738.1"
FT                   /translation="MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTAT
FT                   ERFQAISEAYQVLSSEELRAKYDKFGKQEAIPKGGFEDAAEQFSAIFGGEAFASYIGEL
FT                   TLLKNLQKTEELNAEDEAQKQKEAEEAQKRKEKEEEMKKNGHVQGSGQDITVHPDPEGT
FT                   KPKDDAVNQKKKTKLEEFEEQQKIEREKRIEELSKTLIERLSILTESVYDDACKNSFQK
FT                   KFEEEANMLKMESFGVDILHTIGDIYCEKAKIFLASQNLFGFGGIFHSVKAKGGVLMDT
FT                   LRTVSAAIDAQNTMKELEKMKEASTEDTEENSKNQQKTETETTTAPKPKPTAEELAQQE
FT                   QLLMGKVLSAAWHGTKFEMTSTLRSVCDKVLDDQKIDLNTRIKRAEALRLLGKVFQKTY
FT                   RTKSEQEEAQIFEELVAEATKKHRNT"
FT   gene            complement(<194396..>196501)
FT                   /locus_tag="CAGL0J01958g"
FT                   /old_locus_tag="CAGL-IPF6469"
FT                   /old_locus_tag="CAGL-CDS1094.1"
FT   CDS_pept        complement(194396..196501)
FT                   /locus_tag="CAGL0J01958g"
FT                   /old_locus_tag="CAGL-IPF6469"
FT                   /old_locus_tag="CAGL-CDS1094.1"
FT                   /note="weakly similar to uniprot|P40563 Saccharomyces
FT                   cerevisiae YIR003w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60739"
FT                   /db_xref="GOA:Q6FPQ4"
FT                   /db_xref="InterPro:IPR021582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ4"
FT                   /protein_id="CAG60739.1"
FT                   /translation="MIPAIPARPQRKKGDSAEDSPVPEVPQRPMRHSTTEEIADLVSNT
FT                   TKELEEMEQLISHGHKGEEPVVPQRRPKVVKAKEHENKQVVDTPEMPSIPQRPRRKQTS
FT                   ESLESVSVADGQGSKATEEMTATDSPMEDKDTNMVENTADVSKAKESTELNVPGGTEET
FT                   FTTEDPLPATTGSHPEAIKEISDELNEVVAGTEKPIEHTISNDKEETTLMKTSEQRDEE
FT                   MKETKSNRASEKLSDNTSENETVKTSDFVAKTAEKTAEMVSPQESRDEIEKSVAKTDEE
FT                   TDDKQIEEQKIESIEESIPESIEVPMKKSTEEPEKEPVEDSSEILVKGQTEEPSEKSVS
FT                   SSPDQSNDAPKTSTESANEIQRKSQEPTTETTSETSEKSTKDSTEPSEKVSQDRSDQNE
FT                   TADGEETKPHVPESRPKKRGPPPVPKKPSSRIAAFQEMLQKQQEAQFEKSQKKGEQNDG
FT                   AMNSDARTKFANNLNGLFALPGMVPGGPPPPALAKVLKDPQDTANDKTSTSNDQDTGSG
FT                   TNLKDVRHGRARGPRGRKLPTKVATTEKVKVSETGNTIEIFSAWKLSIKGQVVHDADDD
FT                   IDCRDQDNYVETEEQNMEEQEEREMEKELMASESTVEEEETVEQEKTVEEEKPVKEELT
FT                   VKEEQTKSAEPVLVNVPTGTSSDILDNEPTKTTLDVQEPSPEQKLDTEAREESGTLPTE
FT                   AEPLDNE"
FT   gene            <196812..>199970
FT                   /locus_tag="CAGL0J01980g"
FT                   /old_locus_tag="CAGL-IPF6471"
FT                   /old_locus_tag="CAGL-CDS0375.1"
FT   CDS_pept        196812..199970
FT                   /locus_tag="CAGL0J01980g"
FT                   /old_locus_tag="CAGL-IPF6471"
FT                   /old_locus_tag="CAGL-CDS0375.1"
FT                   /note="similar to uniprot|P40562 Saccharomyces cerevisiae
FT                   YIR002c SJH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60740"
FT                   /db_xref="GOA:Q6FPQ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ3"
FT                   /inference="similar to AA sequence:UniProtKB:P40562"
FT                   /protein_id="CAG60740.1"
FT                   /translation="MEDSDFDDAELDELYEKAINRRVNETLIRRSLPVQRDLQNGVVPG
FT                   QDTYYEEIRTEVTFGPTHHQLNEELLHSYIYPTNFEVRDYQFDIVRKGLLQNILCAIPT
FT                   GMGKTFIASTVMLNFFRWTKTAKIIFTAPTRPLVAQQIKACLGITGIPHDQTAILLDKT
FT                   RKNREEIWANKRVFFTTPQVVENDLKRGVLNPKDIVCLVIDEAHRATGSYAYANLVKFI
FT                   NRFNSSYRLLALTATPATDIEGVQEVVNNLNISKIEIRTEESMDIVKYMKKKIKDRVNI
FT                   QTTVEIENIVEQLGIAILPVLNQAVELGIYESCPPSAINAFKAMQKSQAIIMNPSIPEG
FT                   IKWRNYFILQLLNHVGQMLKRIKIYGIRTFFSYFQNKVKEFTTKYDLGKSTNKIAAGFY
FT                   YHPMIQAITKECEEKIKDPNFLGHGKLEHLRDELTQFFYENPFESRVIIFTELRESALE
FT                   IVKCIDSMENSEIRPHIFIGQAKGKEGFDEVKFVRKHGPKGRKKSDREKRLEEERRMDE
FT                   EKKQAALQEKLERTSRRTGSSEEAQLSGMNQKQQKEVIKKFKSGLYNVLVCTSIGEEGL
FT                   DIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIVLMFSSNEASKFDQSMNDYYNLQK
FT                   LISQHLVQYRKSDRILPPENQEPECEKKFIEVSEEDQELNNMEDTDDVIRFATQCMLGK
FT                   IPKTKKGRDKGKAKKGKTFFMPDNVITGIITANNLVRKRKSAQNGSGAALLDSIVNDDI
FT                   DLEDEDGQVEILDVDQEVNRRLASNAVQKTNDMALQIRNEETPEIGDTRNKAKASSSMK
FT                   VKKEPTMAVDHSDDEEDLPLSRHVERASRETAKEVPNATNVAEKPFPPLEFGVQRPSKR
FT                   QRLQPEVQPEVQPEVQPEVQPEVQPEVQPEVTVKPEVKIKTEEGSKLYKNIFFSDEGFL
FT                   QPHEKELFLSKYNPEDATVTIEPVPRFVRAHGRVKHSKRTEQLITLFEDMNHNRVARTI
FT                   EMNKLRGIARRLHTVSQSQGQSNSQSQAHSTSQKSQQASQKDRSSQDKDLTNSELEDLL
FT                   DSDF"
FT   gene            <200163..>200405
FT                   /gene="SNR14"
FT                   /locus_tag="CAGL0J01994r"
FT   ncRNA           200163..200405
FT                   /gene="SNR14"
FT                   /locus_tag="CAGL0J01994r"
FT                   /product="U4 RNA"
FT                   /note="SNR14 noncoding RNA U4"
FT                   /ncRNA_class="snRNA"
FT   gene            <200829..>201914
FT                   /locus_tag="CAGL0J02002g"
FT                   /old_locus_tag="CAGL-IPF6472"
FT                   /old_locus_tag="CAGL-CDS3071.1"
FT   CDS_pept        200829..201914
FT                   /locus_tag="CAGL0J02002g"
FT                   /old_locus_tag="CAGL-IPF6472"
FT                   /old_locus_tag="CAGL-CDS3071.1"
FT                   /note="similar to uniprot|P40556 Saccharomyces cerevisiae
FT                   YIL006w or uniprot|P39953 Saccharomyces cerevisiae YEL006w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60741"
FT                   /db_xref="GOA:Q6FPQ2"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ2"
FT                   /inference="similar to AA sequence:UniProtKB:P40556"
FT                   /protein_id="CAG60741.1"
FT                   /translation="MGQDEFYREKSHPEEICFPDSASPLTSTDVIEPFRGDTIDNKMEA
FT                   YKGLVQEVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTR
FT                   TTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNS
FT                   SNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQ
FT                   EGVKALYAGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSV
FT                   SKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRT
FT                   LPASAITLVSFEYVRNFLNKI"
FT   gene            complement(<203412..>204836)
FT                   /locus_tag="CAGL0J02024g"
FT                   /old_locus_tag="CAGL-IPF6474"
FT                   /old_locus_tag="CAGL-CDS2233.1"
FT   CDS_pept        complement(203412..204836)
FT                   /locus_tag="CAGL0J02024g"
FT                   /old_locus_tag="CAGL-IPF6474"
FT                   /old_locus_tag="CAGL-CDS2233.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60742"
FT                   /db_xref="GOA:Q6FPQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ1"
FT                   /protein_id="CAG60742.1"
FT                   /translation="MINNFNFSAGSRWTSFTKKFRNVKESLTSFSVFKWKRSDKLNKFK
FT                   HWFHNGAFSSKSIDVTRNIYEKPVDYSEVIEIVYGPNATLEDYEFDMEVVSNSFCSMNN
FT                   IASRIPSWEDGSGSSAETVLEPQAVYKDARERGQRSLFEAYKQMYPILPYMPDGNESGE
FT                   LSDETNDNSVSQVCETSSIYDGSSCWEGSIAYGHDRTQQEAIDCESINSSTVSMVTIIR
FT                   TKLPKECFSSVMLSDISTYATKNLDLNSDSNSSVSDFNESVPNNPSLFPSGSMKRMKKL
FT                   ARKHGFKNLKEAFSKDIQGRITEIHDDIREEKPEHKVEHKVELKVEHKVEHKNEESDAG
FT                   RESAEETNNSCCSKAKGKLRRGWHVINKKKKKGKKSKSKKNKNKKPLGMKMPVEEFEAK
FT                   VAMSSPTSVAAVINGRNHLEFLPEDNTDDKANESLDQSSPIMSEAAKYRKMIFDQIDAY
FT                   FQDEEYKDGESAWTVQ"
FT   gene            <205632..>205871
FT                   /locus_tag="CAGL0J02046g"
FT                   /old_locus_tag="CAGL-IPF6475"
FT                   /old_locus_tag="CAGL-CDS5726.1"
FT   CDS_pept        205632..205871
FT                   /locus_tag="CAGL0J02046g"
FT                   /old_locus_tag="CAGL-IPF6475"
FT                   /old_locus_tag="CAGL-CDS5726.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60743"
FT                   /db_xref="GOA:Q6FPQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ0"
FT                   /protein_id="CAG60743.1"
FT                   /translation="MLYSRRRNCTGSKDLCFHAQLQDLSDIGALLFTLEFTGKRYTYYI
FT                   FLRQTLQTVWPLWTGSVLPHWIYSIASVGGPSSL"
FT   gene            <207414..>209540
FT                   /locus_tag="CAGL0J02068g"
FT                   /old_locus_tag="CAGL-IPF6476"
FT                   /old_locus_tag="CAGL-CDS1066.1"
FT   CDS_pept        207414..209540
FT                   /locus_tag="CAGL0J02068g"
FT                   /old_locus_tag="CAGL-IPF6476"
FT                   /old_locus_tag="CAGL-CDS1066.1"
FT                   /note="similar to uniprot|P40557 Saccharomyces cerevisiae
FT                   YIL005w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60744"
FT                   /db_xref="GOA:Q6FPP9"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP9"
FT                   /inference="similar to AA sequence:UniProtKB:P40557"
FT                   /protein_id="CAG60744.1"
FT                   /translation="MLYSYLWSFMWLLAIACARPPPKVDERNDKPPRGFPLPLNKKNFE
FT                   VELSNGFHLVEFYSPYCSHCKNLAPIWEDTWVSFREEGKKLNMKLSQVNCVESGDICHK
FT                   EDIRAYPTIRLYGPDGFLEEYHGKRTKEEFLKFARKSIMEYGDTDDLILPSLSKLLSGK
FT                   DFSQLISGKSTKPMLVSFWPTSDMQEDSSVETKFNNCPKCEIYQRKWNLINNAVDGLGV
FT                   DSGHLNCGSEQNLCERLGFADLASSAKSGGNVKPRLALIIPKKVTNNLFIYPEGQDVSN
FT                   QADVLDFIKRISVNSEAAEISESEIIDYSRNSMPLFSEFVHTNAKKVHSGQNIYIIFCY
FT                   NHKTVVPEDFTILEHLVEPLASRPNTYLRKFNGTIPELTKKVYDPFYQVVNYNDSEPRK
FT                   ELNEEFQTMAAVTEYPTFLIIKEGELQTHVFNGFSTTEMRNLDTILDWIDDTIVPSLPK
FT                   LTWDNFEEMLNVNPSKYRTMAILLMSTKWEYDDKVNAAQKFFTSFLDYEHVRMQKMFEI
FT                   VQQERLKKANAIEKMREKQENTKNILAKMRQEISHPNDRKVQYMYLDLAKDERLLKRLG
FT                   VHNANIAPNQVLLIDKARKTLYAENHFEERLTGKDTYGIREALLSINIPEKCQLSTILR
FT                   AQHLKIKLQKKIKIPHVKVSNGSNSNILYFFAILLLLVLLRKSPVYRMVSRKWHSHRAS
FT                   YQANTSYSKLEAQD"
FT   gene            complement(<209869..>210288)
FT                   /locus_tag="CAGL0J02090g"
FT                   /old_locus_tag="CAGL-IPF6477"
FT                   /old_locus_tag="CAGL-CDS4946.1"
FT   CDS_pept        complement(209869..210288)
FT                   /locus_tag="CAGL0J02090g"
FT                   /old_locus_tag="CAGL-IPF6477"
FT                   /old_locus_tag="CAGL-CDS4946.1"
FT                   /note="highly similar to uniprot|P22804 Saccharomyces
FT                   cerevisiae YIL004c BET1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60745"
FT                   /db_xref="GOA:Q6FPP8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR039897"
FT                   /db_xref="InterPro:IPR039899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP8"
FT                   /protein_id="CAG60745.1"
FT                   /translation="MSSEYAESTLYQRDPSRTQLFGAADPTLIDDRTSPYDKGKLDYSQ
FT                   STLAHLESQSEEQMGVMTEKIRALKSLSMRMGDEIRGSNKTLDQLDDTFQRTTVKLKQT
FT                   FNNMMDMAKRSRISIKTWLLLFFFIFLLFFYVWIT"
FT   gene            <210632..>211489
FT                   /locus_tag="CAGL0J02112g"
FT                   /old_locus_tag="CAGL-IPF6478"
FT                   /old_locus_tag="CAGL-CDS3717.1"
FT   CDS_pept        210632..211489
FT                   /locus_tag="CAGL0J02112g"
FT                   /old_locus_tag="CAGL-IPF6478"
FT                   /old_locus_tag="CAGL-CDS3717.1"
FT                   /note="highly similar to uniprot|P40558 Saccharomyces
FT                   cerevisiae YIL003w or uniprot|P52920 Saccharomyces
FT                   cerevisiae YGL091c NBP35"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60746"
FT                   /db_xref="GOA:Q6FPP7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028600"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPP7"
FT                   /protein_id="CAG60746.1"
FT                   /translation="MDPEEQLESTEGVPAKSLSLIKHILLVLSGKGGVGKSSVTTQTAL
FT                   TLCGMGYNVGVLDIDLTGPSLPRMFGIEDSSIYQSADGWMPIPVETNGKGKLCVVSLGF
FT                   LLGSRGTSVVWRGPKKTSMIRQFIKDVTWGELDYLLIDTPPGTSDEHISIAEELRFTNP
FT                   DGAIVVTTPQGVATADVKKEINFCRKVNLRILGVIENMSGFVCPYCTECTNIFSKGGGE
FT                   SLAKQFDVPYLGNIPIDPKFVDLIENQKKMEGTLVELYEKSSLYPIYLEIMKKVQEESS
FT                   KPQE"
FT   gene            <211750..>212034
FT                   /locus_tag="CAGL0J02128g"
FT                   /old_locus_tag="CAGL-IPF13540"
FT   CDS_pept        211750..212034
FT                   /locus_tag="CAGL0J02128g"
FT                   /old_locus_tag="CAGL-IPF13540"
FT                   /note="similar to uniprot|Q3E7Z5 Saccharomyces cerevisiae
FT                   YIL002wa"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58042"
FT                   /db_xref="GOA:B4UN26"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN26"
FT                   /inference="similar to AA sequence:UniProtKB:Q3E7Z5"
FT                   /protein_id="CAR58042.1"
FT                   /translation="MKWPRKLFDKITSIDRPVKITLNIMTIEDHNLTNSEAKNLQDALK
FT                   DILQGEKQASEMEQKLDQVEKNLDMLLKQLESFEDARLQNGKSEKDEQK"
FT   gene            complement(<212192..>215047)
FT                   /locus_tag="CAGL0J02134g"
FT                   /old_locus_tag="CAGL-IPF6480"
FT                   /old_locus_tag="CAGL-CDS0514.1"
FT   CDS_pept        complement(212192..215047)
FT                   /locus_tag="CAGL0J02134g"
FT                   /old_locus_tag="CAGL-IPF6480"
FT                   /old_locus_tag="CAGL-CDS0514.1"
FT                   /note="similar to uniprot|P40559 Saccharomyces cerevisiae
FT                   YIL002c INP51"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60747"
FT                   /db_xref="GOA:Q6FPP6"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP6"
FT                   /inference="similar to AA sequence:UniProtKB:P40559"
FT                   /protein_id="CAG60747.1"
FT                   /translation="MRIFVGRNPRSVVLSSESYSLKFERLYDRSNQTQGNVQAQQGQPN
FT                   QIKAPTVSIKNVSASELVKDGYRELRALRLNGLLGLLTINGDVYVVVVGGVQSIGYPRW
FT                   HLDDSSKITPEQSINKILEVDFISLDTEIYDHLFFDRSEQNFDKLLHEHPCGVYKRLFA
FT                   DGSFYYTKDYDLTNAVKSPGLTHNLDYAIDNFDTSFIWNANLIGEIINWRGRLSMKEKQ
FT                   AFDNAPFLMFVIRGFCKTSIVNDPDLTATVTVLSRVSTEGHKSISDSEGMHEDSRVSTI
FT                   IETETIVTTDSFILSYTQIAGNIPLFYEIIDGQLLSGKKLKLLKQPGEGQNEFNKHFDT
FT                   LESKFGIVSVVNLVKSRSDSQETLASIYKQYSDTRGIKISNIPCGSQTLNKSPHKVLYS
FT                   LKQDIYECGAFAYNIKKGIYFGKQTGVIRISAADPIEKPILLEKLISKEVLELATKELD
FT                   GFSITSPLLEVHDKLWSENHFWLERVYAKNQKNYNKSAKIYLKLFSSHVKLFDPVHFYI
FT                   SQYLRQFRSSFTHMKDIKVFAGTFNVSGKLSKDDISQWIFPNGVTTEEDFADVYVFGLE
FT                   EVVELTPGHMLAIDPYIKQFWEKKLLDTINYYDKDSSYTKVWSSQLGGVLLILLMKSSE
FT                   SLKVKHVEGDVKKTGFGGITSNKGAVAVSFNYSATRFCVLVSHLAAGLENVEQRHNDYK
FT                   MISKNIRFSRGLRIKDHDAIIWMGDFNYRILMSNEEVRKLIALKDYKSLFEKDQLNQQM
FT                   IAGESFPYFHEMPIEFPPTYKFDPGTRQYDTSEKLRIPAWTDRILGRGDVLRQLTYTYA
FT                   PDVLFSDHRPVSAVFSANVTVVDEKKKAELSSVIHTKLMERLEGCDEDERIEILNDGNF
FT                   KLNELDDEISNITNMNAKPEQKRARKLPPPSSEIRKWWVGNGKQVKVFLDTDPEEFMLN
FT                   PEHTPNPFDSNDTSPLFVPRS"
FT   gene            <215693..>217195
FT                   /locus_tag="CAGL0J02156g"
FT                   /old_locus_tag="CAGL-IPF6484"
FT                   /old_locus_tag="CAGL-CDS2077.1"
FT   CDS_pept        215693..217195
FT                   /locus_tag="CAGL0J02156g"
FT                   /old_locus_tag="CAGL-IPF6484"
FT                   /old_locus_tag="CAGL-CDS2077.1"
FT                   /note="similar to uniprot|P40560 Saccharomyces cerevisiae
FT                   YIL001w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60748"
FT                   /db_xref="GOA:F2Z6E2"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6E2"
FT                   /inference="similar to AA sequence:UniProtKB:P40560"
FT                   /protein_id="CAG60748.1"
FT                   /translation="MVEGSATSIDPRFAELCMACRVGDIENADRLISTGININSVDEYD
FT                   NSPLFLASLCGHEEVVKLLLERGAACDRDKFEGARCIYGALTDSIRDILLSHDISKAVD
FT                   LNQPFATHISSLIRDFWFFMTFDLTIDFSKEDINFKAHKFLLNILCPEFFDSNWLCDND
FT                   SIDLSSVTDSATFEYFLGYAYLLPAVHKLSHRDYDELIKFSEVTKLHILTEFLHQSRTT
FT                   YDAAEKSTLVMDFQFKFREYLREALKVFVEDKIINNYEENLNNITNKCLAFHDIYLRVQ
FT                   NHDTQVRYYPCHLAILERAPLFQLVFNSNFREKSVYISKSEYNDSITVNFPNCDFNVVE
FT                   IILRYLYYDCPEIPIEYAAETVVMADILLEDRLKAIATANLVKSKSVFDYYSVFDILKL
FT                   GWEMRSEKLEHFAAKEIAENLFKYEEDQNLKQAILESSQRISARQETDTIELVDDIRYY
FT                   LVSSFVTNVNSDIVEEEDYENIEYQKRIAVVNKILRQLNIDA"
FT   misc_feature    217322..217432
FT                   /locus_tag="CAGL0J02178s"
FT                   /note="Centromere Cen0J"
FT   gene            complement(<217645..>218079)
FT                   /locus_tag="CAGL0J02200g"
FT                   /old_locus_tag="CAGL-IPF6485"
FT                   /old_locus_tag="CAGL-CDS4893.1"
FT   CDS_pept        complement(217645..218079)
FT                   /locus_tag="CAGL0J02200g"
FT                   /old_locus_tag="CAGL-IPF6485"
FT                   /old_locus_tag="CAGL-CDS4893.1"
FT                   /note="similar to uniprot|P40561 Saccharomyces cerevisiae
FT                   YIR001c SGN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60749"
FT                   /db_xref="GOA:F2Z6F7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6F7"
FT                   /inference="similar to AA sequence:UniProtKB:P40561"
FT                   /protein_id="CAG60749.1"
FT                   /translation="MAISPQKISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADAC
FT                   SIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD
FT                   FNGTNLRQHVISVERKRTNIPNYKQNTSNNTDSGTENKNT"
FT   gene            <219375..>220091
FT                   /locus_tag="CAGL0J02222g"
FT                   /old_locus_tag="CAGL-IPF6487"
FT                   /old_locus_tag="CAGL-CDS4096.1"
FT   CDS_pept        219375..220091
FT                   /locus_tag="CAGL0J02222g"
FT                   /old_locus_tag="CAGL-IPF6487"
FT                   /old_locus_tag="CAGL-CDS4096.1"
FT                   /note="similar to uniprot|P40007 Saccharomyces cerevisiae
FT                   YER002w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60750"
FT                   /db_xref="GOA:Q76IQ1"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q76IQ1"
FT                   /inference="similar to AA sequence:UniProtKB:P40007"
FT                   /protein_id="CAG60750.1"
FT                   /translation="MTSVRKRKMNRSSVKKVSRRNKDKQKKKLIACNPIIAKNWDYSLT
FT                   LAQNYEKLGLKAKLQTPAGGQEAKYDTVIKKEATIDPVTQFGEDSDSDSEEDSSNSQED
FT                   NEGQNVEDIDENEIPEGEARIIRDAEGNVVKVVYGKKKVFDIDDDIDTIKAKLADQQKE
FT                   ETEVVKQLEAFASRPIVKKERVQSPREVEWLEKLYKKHGDNYKAMFFDRKLNIYQQSEG
FT                   EIKRKMRKWKSENNIA"
FT   gene            complement(<220448..>221737)
FT                   /locus_tag="CAGL0J02244g"
FT                   /old_locus_tag="CAGL-IPF6488"
FT                   /old_locus_tag="CAGL-CDS2573.1"
FT   CDS_pept        complement(220448..221737)
FT                   /locus_tag="CAGL0J02244g"
FT                   /old_locus_tag="CAGL-IPF6488"
FT                   /old_locus_tag="CAGL-CDS2573.1"
FT                   /note="highly similar to uniprot|P29952 Saccharomyces
FT                   cerevisiae YER003c PMI40"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60751"
FT                   /db_xref="GOA:Q76IQ2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q76IQ2"
FT                   /protein_id="CAG60751.1"
FT                   /translation="MTSDRFFRLDAGYQQYDWGKIGSSSAVAKFAAHSDPSVKIDETKP
FT                   YAELWMGTHSKLPSVNHETKATLNDILAKNSQELIGEDVINKFKSTNELPFLFKVLSIE
FT                   KVLSIQAHPDKELGKKLHMEDPKNYPDDNHKPEMAVAITEFEGFCGFKPLEEIADELET
FT                   IPEFRDVVGDEVANEFIQNYKTGVENSSSACANNKKLLQKVFEKVMTAPCDILEKNADG
FT                   MAKRANENPSSFKSSDLPELVVRLNRQFPKDVGLFCGCLMLNHCKLQPGQALFLEAKDP
FT                   HAYICGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYRYDPVEKQVMSAEEFPRAGG
FT                   DGATIMYNPPIAEFSVLETTFKNKTGKATVEGLKGPSIVITTAGEGYISADGQKLKAEP
FT                   GFVFFIGANVPVELETTDKDFTTYRAFVEA"
FT   gene            complement(<222727..>223485)
FT                   /locus_tag="CAGL0J02266g"
FT                   /old_locus_tag="CAGL-IPF6489"
FT                   /old_locus_tag="CAGL-CDS4586.1"
FT   CDS_pept        complement(join(222727..223258,223475..223485))
FT                   /locus_tag="CAGL0J02266g"
FT                   /old_locus_tag="CAGL-IPF6489"
FT                   /old_locus_tag="CAGL-CDS4586.1"
FT                   /note="highly similar to uniprot|P89886 Saccharomyces
FT                   cerevisiae YER007ca"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60752"
FT                   /db_xref="GOA:Q6FPP1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP1"
FT                   /protein_id="CAG60752.1"
FT                   /translation="MFKKFSKEDVHSRSKVKSSVQRTLKTKLVSQYPKLEDVIDELIPK
FT                   KSQIELIKCEDKIQLYTVDEEVLFFQKFNDLIPSLKLVHKYPEAFPTVQVDRGAIKFVL
FT                   SGANIMCPGLTSAGASLPEAPGLEKGTIVVINAENKENALAIGELMMSTEEIKSINKGH
FT                   GVELIHHLGDPLWHFTL"
FT   gene            complement(<223820..>225445)
FT                   /locus_tag="CAGL0J02288g"
FT                   /old_locus_tag="CAGL-IPF6490"
FT                   /old_locus_tag="CAGL-CDS1833.1"
FT   CDS_pept        complement(223820..225445)
FT                   /locus_tag="CAGL0J02288g"
FT                   /old_locus_tag="CAGL-IPF6490"
FT                   /old_locus_tag="CAGL-CDS1833.1"
FT                   /note="similar to uniprot|P12630 Saccharomyces cerevisiae
FT                   YIL015w BAR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60753"
FT                   /db_xref="GOA:F2Z5X7"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z5X7"
FT                   /inference="similar to AA sequence:UniProtKB:P12630"
FT                   /protein_id="CAG60753.1"
FT                   /translation="MIQFINCYFIFNLVTVVNCLRLTIEKRIVSSHASLSKRSAVDLQF
FT                   RRFNNLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCSG
FT                   LVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNA
FT                   TFSGVLGIGFPAMESVNGYEFAPGKFYPNFPLALKNAGFTNIAAYSIEYNDESKKGSIL
FT                   FGSIDTSRFIGPLYTFPMINEFPGIADEPSTLSLTLDGIGIDGSCEQWVISNTKLPALL
FT                   DTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIP
FT                   LRSFILLPDEESNGLCGLGITSSKGRVILGDSFLTHVYTVFDLDNYMISLAPMAKSSLP
FT                   GKVIEIPANGLIENAVISKSEKWTHFNDITVNEYGFRNYCDGELQDIHSYSSKLNSSSL
FT                   VYSSNFSSDEEQNSSESVSPSIFNTDSSIKEIYPSLSQKEHLSALLTTISTSEIHKPVT
FT                   ATITDSITTTIRVTKILTVLQCAT"
FT   gene            complement(<226364..>226825)
FT                   /locus_tag="CAGL0J02310g"
FT                   /old_locus_tag="CAGL-IPF6491"
FT                   /old_locus_tag="CAGL-CDS4802.1"
FT   CDS_pept        complement(226364..226825)
FT                   /locus_tag="CAGL0J02310g"
FT                   /old_locus_tag="CAGL-IPF6491"
FT                   /old_locus_tag="CAGL-CDS4802.1"
FT                   /note="similar to uniprot|P40548 Saccharomyces cerevisiae
FT                   YIL016w SNL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60754"
FT                   /db_xref="GOA:F2Z605"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR036533"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z605"
FT                   /inference="similar to AA sequence:UniProtKB:P40548"
FT                   /protein_id="CAG60754.1"
FT                   /translation="MDSLIEYVKQQNIDVQGICVATVSAAVFAVLLWKFTSGSGSSKKS
FT                   KSKSYKKKNKKEKVAALTHEMQIENIHLRYKNEFEDRVNNILGAYNPDDEKSVYEKKYC
FT                   NEMLLKLLIELDGVDLVSEEPEKKAILKAKRKAVIKEIQTQLKKLDTLV"
FT   gene            <227226..>229910
FT                   /locus_tag="CAGL0J02332g"
FT                   /old_locus_tag="CAGL-IPF6493"
FT                   /old_locus_tag="CAGL-CDS0609.1"
FT   CDS_pept        227226..229910
FT                   /locus_tag="CAGL0J02332g"
FT                   /old_locus_tag="CAGL-IPF6493"
FT                   /old_locus_tag="CAGL-CDS0609.1"
FT                   /note="similar to uniprot|P40547 Saccharomyces cerevisiae
FT                   YIL017c VID28"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60755"
FT                   /db_xref="GOA:Q6FPN8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN8"
FT                   /inference="similar to AA sequence:UniProtKB:P40547"
FT                   /protein_id="CAG60755.1"
FT                   /translation="MVSFDSVSSSEHSLVALRNRIVGDATAKLDVYLGQNSTIFKELTS
FT                   ISASDDIDLQHLKLDILLILLNVDKNTIESLGESYNDVVVSVLQDIELPKTFLTNNTSI
FT                   NRKYIKLINMSKGYTECDEFPFLKETEQYLSHLIDKLLSDIANSSEIANTIELLTLQLQ
FT                   NGKNRSFLMTKSLKEQIESMLFKCYRKYAELINYKYMIRLRVQKDKKNNKYKPLSNKGL
FT                   NSCISLPNSITISNQQDEKLLYLCLVLYTWSHKINQTASLWESSEFQFFISSFLKGENI
FT                   QLKCAALEFLIAPYLNTENTWKKRKIIIKYLPYLVDLLNYQPLPKWFDIFETLTDLIEL
FT                   YNRHEPMNNPIIMFLSKSNMLYGILGVFFECMSLKTQNNASIKTLTKCVKFCAAFAAND
FT                   EKYRALLLEHKFLLNNLEFGLELHLSLLNEFIEFFNTFKNGNLISSTEPFPCLYDSELC
FT                   FEWLSLLKSFSRSVTALRTSLKRNKLPELLLRLLRKIHRITKECFEVGPEFLGAELKVM
FT                   GQTLGTICNFVVEFSNLQPYLVKNGIIEIIQDLLSDPLLNDSIEWNLQSRKNALQGCNT
FT                   EDVKTNSLWVLRHLMYNCQNEEKLELLAKIPMETILEFVNDPSWPVQAQAFQLIRNLTS
FT                   NSRKVVNILLENFKEVEYNLDPVTGKTKAIGNTYLFEFLVHKMTKLDPRDPPQKKTLEG
FT                   ILYIIVNLAAVNENKKQLVVEQDEILEILSEILAASAQNPTRYGNDSDLKLASLWVLNN
FT                   LLWNSESANHSQFGLDGYPPTSRDSSSAPIDYSEPPSGRVSRNEIHGITSNTDHNSAID
FT                   EDIDDSSALQDNEERNDEFVRHIPEGRSQNNNSTVLRCKKLVDLGIHELVKKNIFDDSL
FT                   SVREKARTLSFHMDLLLRDSNSS"
FT   gene            complement(<230262..>231571)
FT                   /locus_tag="CAGL0J02354g"
FT                   /old_locus_tag="CAGL-IPF6495"
FT                   /old_locus_tag="CAGL-CDS3950.1"
FT   CDS_pept        complement(join(230262..231022,231568..231571))
FT                   /locus_tag="CAGL0J02354g"
FT                   /old_locus_tag="CAGL-IPF6495"
FT                   /old_locus_tag="CAGL-CDS3950.1"
FT                   /note="highly similar to uniprot|P05736 Saccharomyces
FT                   cerevisiae YIL018w RPL5A and highly similar to
FT                   uniprot|P05736 Saccharomyces cerevisiae YFR031ca RPL5B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60756"
FT                   /db_xref="GOA:Q6FPN7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPN7"
FT                   /protein_id="CAG60756.1"
FT                   /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGVV
FT                   KQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPL
FT                   GSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKIISSDAR
FT                   GVIGVIAGGGRTDKPLLKAGRAFHKYKLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
FT   gene            complement(<232589..>233593)
FT                   /locus_tag="CAGL0J02376g"
FT                   /old_locus_tag="CAGL-IPF6498"
FT                   /old_locus_tag="CAGL-CDS3295.1"
FT   CDS_pept        complement(232589..233593)
FT                   /locus_tag="CAGL0J02376g"
FT                   /old_locus_tag="CAGL-IPF6498"
FT                   /old_locus_tag="CAGL-CDS3295.1"
FT                   /note="similar to uniprot|P40546 Saccharomyces cerevisiae
FT                   YIL019w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60757"
FT                   /db_xref="GOA:Q6FPN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN6"
FT                   /inference="similar to AA sequence:UniProtKB:P40546"
FT                   /protein_id="CAG60757.1"
FT                   /translation="MGETDAEYLKMLELQRQAFEAQFGSLESMGYEDKTKEGDDSGSSD
FT                   VDSFSGDSDLSDKEGSDESEQDEEQFRGFDEEDDVEDKSVSKSADIRQPKVIKFSGAND
FT                   TYVPPSKKEQKLLRSGKTLNKNRKLLESEGTETKPGDDEGEDMEMENLQNDIELQRFLK
FT                   ESHLLSAFNSATSGASLTLDGLKDTTVSYQDDEVMGKARARTLEMRLQNISKVNGDGRK
FT                   ISKLEKVPMHVRKGMIDKHVKRIKKYEEEAADAGIVLSKVKSGNFRKIESTYVKDIERR
FT                   IGSSIKSKDLEKSKKRTRGLKVQSVGRSTRNGLVISSEDIARINGSGKSKRRR"
FT   gene            <233987..>234772
FT                   /locus_tag="CAGL0J02398g"
FT                   /old_locus_tag="CAGL-IPF6499"
FT                   /old_locus_tag="CAGL-CDS3907.1"
FT   CDS_pept        233987..234772
FT                   /locus_tag="CAGL0J02398g"
FT                   /old_locus_tag="CAGL-IPF6499"
FT                   /old_locus_tag="CAGL-CDS3907.1"
FT                   /note="highly similar to uniprot|P40545 Saccharomyces
FT                   cerevisiae YIL020c HIS6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60758"
FT                   /db_xref="GOA:Q6FPN5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPN5"
FT                   /protein_id="CAG60758.1"
FT                   /translation="MTKFVGCIDLHDGQVKQIVGGTLKDNDDSLETNFVSKYPPSYYAQ
FT                   LYLENRIEGCHVIKLGPNNDAAAMEALNAAPGFLQVGGGINDENCLQWLEKASKIIVTS
FT                   WLFTKEGTFLMDRLQLLSNKCGPDRIVVDLSCRRTPDSKWVVAMNKWQTLTTLELNKET
FT                   FTELSKYTDEFLIHAADVEGLCKGIETDLVTKLYEWTKDINKEVKIVYAGGAKSISDLE
FT                   LVDKLSNGTVDLTYGSSLDIFGGKLVRFQDCCEWNSKHN"
FT   gene            complement(<234977..>235915)
FT                   /locus_tag="CAGL0J02420g"
FT                   /old_locus_tag="CAGL-IPF6500"
FT                   /old_locus_tag="CAGL-CDS3496.1"
FT   CDS_pept        complement(234977..235915)
FT                   /locus_tag="CAGL0J02420g"
FT                   /old_locus_tag="CAGL-IPF6500"
FT                   /old_locus_tag="CAGL-CDS3496.1"
FT                   /note="highly similar to uniprot|P16370 Saccharomyces
FT                   cerevisiae YIL021w RPB3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60759"
FT                   /db_xref="GOA:Q6FPN4"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN4"
FT                   /protein_id="CAG60759.1"
FT                   /translation="MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLA
FT                   IDSVEVETNTTVLADEFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAV
FT                   GESESTTNVYAKDLLIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGI
FT                   AKEHAKWGPAAAIEFEYDPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYK
FT                   AKADTFYMNVEAVGSIAVDQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNG
FT                   IEEDGDAMMMNGHDGPYGDNGRSSDTYGSAW"
FT   gene            complement(<236641..>237879)
FT                   /locus_tag="CAGL0J02442g"
FT                   /old_locus_tag="CAGL-IPF6501"
FT                   /old_locus_tag="CAGL-CDS2685.1"
FT   CDS_pept        complement(236641..237879)
FT                   /locus_tag="CAGL0J02442g"
FT                   /old_locus_tag="CAGL-IPF6501"
FT                   /old_locus_tag="CAGL-CDS2685.1"
FT                   /note="highly similar to uniprot|Q01852 Saccharomyces
FT                   cerevisiae YIL022w TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60760"
FT                   /db_xref="GOA:Q6FPN3"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN3"
FT                   /protein_id="CAG60760.1"
FT                   /translation="MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKS
FT                   QELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKA
FT                   WDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRL
FT                   KREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVS
FT                   LWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPE
FT                   VLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQP
FT                   QDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWK
FT                   ILEFIRGSSRPFN"
FT   gene            <238695..>241445
FT                   /locus_tag="CAGL0J02464g"
FT                   /old_locus_tag="CAGL-IPF6504"
FT                   /old_locus_tag="CAGL-CDS0577.1"
FT   CDS_pept        238695..241445
FT                   /locus_tag="CAGL0J02464g"
FT                   /old_locus_tag="CAGL-IPF6504"
FT                   /old_locus_tag="CAGL-CDS0577.1"
FT                   /note="similar to uniprot|P40537 Saccharomyces cerevisiae
FT                   YIL031w SMT4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60761"
FT                   /db_xref="GOA:Q6FPN2"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN2"
FT                   /inference="similar to AA sequence:UniProtKB:P40537"
FT                   /protein_id="CAG60761.1"
FT                   /translation="MSRRRAFQGGIMPVDTLSSSPVAETQERRPVSPVRYRRKRDPKVI
FT                   AELNQKGHEIFSIGDEDGLPMRHKEKDVQRGEGEERSSNRPTSTSDGNYESLRYVVVGK
FT                   MKLITLDQKEVDVEEAVLEFSNKKGELNPSMKIRPTDSRSKVKDFKIKILRDCSKIWFT
FT                   ERVAKVGIFLKEKLDVPIVDGSNEVLPIICIVWVRSLQDSTIFLRLSRIQIVLHELAKS
FT                   RKTLHTTLTVLTNLTELELQRCIKSNMITELQKLSRAKRRLISSSSDGINDQDDVPNKG
FT                   VSNTNNVSRKNGIRSLISKASKAAYNTGNGKSIRIPFSVNGANNRKISSTSQSVDPIPS
FT                   SNFYSSSSPSGNTRSNSLNKRANEHKLSDHLLSNVKRTRKSMINGSNNSIKDPMSIDDE
FT                   EIAFDEDKSNAEDELFYETPKIFEPNLVYKFTDGSYYTITNQDFKCLYNKDWINDSILD
FT                   FFTKYFIESAITNNKVRKEDVHIMSSFFYTKLTSTEEEVYSNVKKWVNNTDLFKTKYVV
FT                   IPINNNFHWFGCIITNLDSFFIYYNENKMSKNSKNLANMDREEDDITVSPPIITILTFD
FT                   SLKQTHSREIDPIKEFLIGYAKDKYQLDIDKSLIKMKTCAVPQQANFSDCGVHVIFNIK
FT                   GFFENPHQTVELWYSKKMKNKHDMRYINEYFNKSGRNNSRKFLRDILLSLQKQQVLHNA
FT                   GIEANGQALSNVDEDEDIEIIEDLYDAKDSKLAPIDVKKNVNDIDIGRQSLSSRVGLQS
FT                   EPPSPTPEFQEDQSIPSSSIMNVNSKAEEQGHIISNLSRSSHILASYKDSESNQVYTSP
FT                   YFGKSILKDRVDNYTASTENAHSNSTYSNGHEKSNANNSGSPTMDIGVGENSEISADDF
FT                   SERYNESDVNLIPEGVAPKSEQDEDALDLIRDSLARELNENIDTH"
FT   gene            complement(<241644..>245351)
FT                   /locus_tag="CAGL0J02486g"
FT                   /old_locus_tag="CAGL-IPF6508"
FT                   /old_locus_tag="CAGL-CDS0218.1"
FT   CDS_pept        complement(241644..245351)
FT                   /locus_tag="CAGL0J02486g"
FT                   /old_locus_tag="CAGL-IPF6508"
FT                   /old_locus_tag="CAGL-CDS0218.1"
FT                   /note="similar to uniprot|P40318 Saccharomyces cerevisiae
FT                   YIL030c SSM4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60762"
FT                   /db_xref="GOA:Q6FPN1"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN1"
FT                   /inference="similar to AA sequence:UniProtKB:P40318"
FT                   /protein_id="CAG60762.1"
FT                   /translation="MDIPQGATCRICRGEATEESPLFHPCRCRGSIKYIHESCLLEWIS
FT                   SKNIDISKTGAEVNCDICHHPFNFKTTYVEDMPEKIPFPILLKSTLKATFSKMRKSLEI
FT                   SLALVLFLFGWPLVWNTWARLYTFALDGTIPYEEDTIRSILFGFQENPEYYRNIVLTKS
FT                   TVLKQLLWNYKFTALQIALIVILHIALYFQYDMIVREEVFSKMILHKIGPKLSINDMKA
FT                   RLMERFPMMDEAMIDHLAVALRARENNRQGIQDEAQRPIVVDRVQEREPLHEVNADEEV
FT                   NPQNNINNMHLDSDDDENDPDFVVNDHDSDTDDEANHWGVGQQDEMNDPFRERFEEMMN
FT                   RRAQNQFDNLLAQQQERNAQNAMNRPNAPIFIPPVQEAQPDEAMQDNDGANAVLINVKL
FT                   KLSSILIYFVVGAVVCSLYLLLSYLIPTVVGYGLIRVYLKILEIAFRGFNLLMHYSKLS
FT                   VVYFGLVKYIPFISVVHQELVVATTHQYLEYYQGYFDNSMKHSMLLRALPCLTTYLTAI
FT                   AINTVVSEMISKGYGRHNGLSSNVKRQIFQITFAIRCTLKVFTLFFIELAGFPILAGVM
FT                   LDIALFCPILGSPNKLLSIPQLFRIWPKLSFFAYWIIGTLYMYWFAKYIGMIRKHIIRP
FT                   GVLFFIRSPEDPNIRILHDSLIHPMGIQLSRLCLSMFIYAVFIIAGFGLHTRVIFPMLW
FT                   KSGFSTFSDKCKPDSFFDKTSLTILLAFTVTRNILEKNSVLKRAVKDYWVYVFHVCARN
FT                   LRLSSFIIGKDVPTERGHILYRNWFFKLFASQKAQWSNTELFTSPKTYDEALELFRENK
FT                   SVHAYFIPDGVLMRVPSSDIVSRSYVQTMFVPVTTDDKILKPLDFKKINERNKSTAGEF
FT                   GYLDEQNTEFDHYFVVYVPPNFRMRYMILIGLIWFFSSLLFISICLMSHYTSKLLMLPI
FT                   EVFIMTNSNENKEEHINPYYVCIGLIILSQLLPKVYKLVEKRTLNKTHQVETEVEAENE
FT                   DDENDVEVPMEPEVAFLDIVKDFKESFVFKLILSTLIAMGEFWIALISNIALLVHLIIA
FT                   YNYCIALCGGSRFISFLPSSSGDLFTSTNDKIRTIFTIINSVLLLLKGKRTGSVFIKNK
FT                   NRRTSELLKRLLSAVLTNTLKFHGSNLLVLAVLCVIFNVINGTLYLDMTWSSTAKFIPL
FT                   VFNSVPSHSWSRTEHAYMMTLLLAYFSYFISNFMVTFSKYWNVLEQGVKDTIYTKGKKL
FT                   ENLPEEKDGQ"
FT   gene            complement(<246210..>248822)
FT                   /locus_tag="CAGL0J02508g"
FT                   /old_locus_tag="CAGL-IPF6516"
FT                   /old_locus_tag="CAGL-CDS0647.1"
FT   CDS_pept        complement(246210..248822)
FT                   /locus_tag="CAGL0J02508g"
FT                   /old_locus_tag="CAGL-IPF6516"
FT                   /old_locus_tag="CAGL-CDS0647.1"
FT                   /note="some similarities with CA1576|CaHYR1 Candida
FT                   albicans CaHYR1 and DEHA-IPF10153.1 Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60763"
FT                   /db_xref="GOA:Q6FPN0"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN0"
FT                   /protein_id="CAG60763.1"
FT                   /translation="MSLITIFAFFIKATLVLSLDILTPTTLTGDQTFNEDVSVVSSLTL
FT                   NDGSQYLFNNLLQIAPSSASVTANALAAVSVFTFSLPPSSSLSNSGTLIISNSNTGPST
FT                   EQHIVITPNVMANTGTITLSLAHTNTDSSSTLIIDPVTFYNTGTINYESIGSETNDPSL
FT                   TGNILSIGSSGRTLQNLGTINLNAANSYYLLGTITENSGSINVQKGFLYVNALDFIGNT
FT                   INLSTTTALAFISPVSQVVRVRGVFFGNIIASVGSSGTFSYNTQTGILTVTTNGVYSYD
FT                   IGCGYNPALMSGQQETLSFQGNLYDTFLVLVNQPIPSDLTCAAVSSSITPSSSVEPSSS
FT                   VEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSS
FT                   SVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSPAVPS
FT                   SSAEPSSSVVPPITPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPTVPTSSVSPS
FT                   SPTVPTSSESPSTLSTPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSSAGGGNGGDNG
FT                   QPGADGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAA
FT                   GQPGAAGQPGAGSGGGSEQPTPGAGAGSGSADGNQSGTSSGTGNGQAGSGQAGSGQVGS
FT                   GQAGAGQAGSGQAGAGQAGSGQAGAGQAGLDNTASGQSEGGQASAMDGDQSGRGGQSNS
FT                   GSLLQPNAQQGTGSGTGSDTGADQASGESPGQIGDAQPGSGTDQSSGRHSLAAEARTSQ
FT                   SHSLAADARTRSTTRQTSVIAPGTAPGTAVVTTFHGCGTVNHKGMINILLALALLVLL"
FT   gene            complement(<250629..>252893)
FT                   /locus_tag="CAGL0J02530g"
FT                   /old_locus_tag="CAGL-IPF6521"
FT                   /old_locus_tag="CAGL-CDS0924.1"
FT   CDS_pept        complement(250629..252893)
FT                   /locus_tag="CAGL0J02530g"
FT                   /old_locus_tag="CAGL-IPF6521"
FT                   /old_locus_tag="CAGL-CDS0924.1"
FT                   /note="some similarities with CA1621|CaIFF6 Candida
FT                   albicans CaIFF6 and DEHA-IPF4655.1 Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60764"
FT                   /db_xref="GOA:Q6FPM9"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM9"
FT                   /protein_id="CAG60764.1"
FT                   /translation="MLMFSRILLFFASYVLVKAQQTITTPTTLTGNQNFNEDIDVQSSL
FT                   TLNDGSEYIFNNLLDISLDTASVEANAQSGSVFTFSMPPSSSFSNLGTLTINNNAGVVS
FT                   EQHININPSTFSNSGTLTIRVVHYQSDSSSTMLIDSPSFANSGTINYERTGTEINDPGL
FT                   EGNILHIGSAGHALDNTGIINLAAGNNYYLQGNIQGEGGSINVNYGLLHIDSTSFAGNT
FT                   INLGPEGALAMIRPVPETVVVRGFAAPNFIASAGTNGAFAYNEQTGILTVTTDGNTYTY
FT                   DIGCGYDPALLIGTQSSIGYEGNLVDGYGVAYTGAAPADVTCAAASSSIVPSSSVEPSS
FT                   SVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVDTSSSVEPS
FT                   SSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEP
FT                   SSSVEPSSSVEPSSSVDTSSSVEPSSSVEPSSSSSSSSSSSSSSSSPSSSSSSSSSSSA
FT                   VVTTITTTIEDPGVPPVIITTTITIGAGTGQGEQGQAGQAGQAGQAGQAGQAGQAGQAG
FT                   QAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGSGQAGQAGQAGQAGSGQAGQAGSGQA
FT                   GQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGSGQAGQAGSGQAGSGSGN
FT                   QEHSHSLAALGRTGTTSGRAQPTTILTPSHLATTFHGGVEHVNVGLFNFMLPFIISVLL
FT                   L"
FT   gene            complement(<254862..>257549)
FT                   /locus_tag="CAGL0J02552g"
FT                   /old_locus_tag="CAGL-IPF6528"
FT                   /old_locus_tag="CAGL-CDS0606.1"
FT   CDS_pept        complement(254862..257549)
FT                   /locus_tag="CAGL0J02552g"
FT                   /old_locus_tag="CAGL-IPF6528"
FT                   /old_locus_tag="CAGL-CDS0606.1"
FT                   /note="some similarities with CA1576|CaHYR1 Candida
FT                   albicans CaHYR1 and DEHA-IPF10153.1 Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60765"
FT                   /db_xref="GOA:Q6FPM8"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM8"
FT                   /protein_id="CAG60765.1"
FT                   /translation="MTNMKVFIVLMLGFCLVSALDVNSILSLTGIQLFTEPVHIFSTGA
FT                   LSLTLGNSYAFNDLLTIDGGGSLSATALLDILLPFSFSIPSTSSVTNSGSMTISNGNLL
FT                   GLGGSQSINIIPSSLTNTGTITLDLARTVSDATSLLVIDAGVFVNSGTISYIGGGAGGT
FT                   DPNLLGNILQIGSVGNTIDNTGTIHLNAAPRYNLLGNIIGDGGVIDIEQGTLVISSQTF
FT                   TGNSIALHPNTAAAFVNAQANAIVVTGLLDAAAIISLGVDGSFVYDPTTGILTVTTSLG
FT                   VFLYDIGCGFDPALFLGAQITIQVGGVNVDAYSVVYLGVAPSDTTCAAASSSIIPSSSI
FT                   VPSSSVEPSSSIEPSSSIEPSSSIEPSSSVVPSSSVEPSSSVVPSSSVEPSSVLPSSSV
FT                   VPSSSVEPSSSVLPSSSVVPSSSVEPSTPPIPSSSVEPSSSVVPSSPAVPSSSVEPSSP
FT                   AVPSSSVEPSTPPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPTVPTSSVSPSTI
FT                   STPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSSAVGGNGGDNGQPGADGQPGAAGQP
FT                   GAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAGSGGGSEQP
FT                   TPGAGDGSGSASGNQSGTGSGTGSGQQGSGQAGSGQAGAGQQGSGQAGAGQAGAGAGQQ
FT                   GSGQAGAGQAGAGQAGAGQAGSGQAGAGQAGAGGSGAGSSGSGSGSGAGGAGTSGSGSG
FT                   AGGSGAGSAGSGSGGSGAGGSGAGGSGAGSAGSGSGGSGAGSAGSGSGGSGAGSSGSGA
FT                   GASGSGSGAGAGGAGSGGTGAGSGQASPQPHSVAAQARTTTGGSQPTVLAPSQLATTFH
FT                   GGVEKINVGLFQVLLPFVVSVLLL"
FT   gene            complement(<261092..>261164)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J02596r"
FT   tRNA            complement(261092..261164)
FT                   /gene="tRNA-Lys (CTT)"
FT                   /locus_tag="CAGL0J02596r"
FT                   /product="transfer RNA-Lys"
FT   gene            <261400..>261843
FT                   /locus_tag="CAGL0J02618g"
FT                   /old_locus_tag="CAGL-IPF6532"
FT                   /old_locus_tag="CAGL-CDS4868.1"
FT   CDS_pept        261400..261843
FT                   /locus_tag="CAGL0J02618g"
FT                   /old_locus_tag="CAGL-IPF6532"
FT                   /old_locus_tag="CAGL-CDS4868.1"
FT                   /note="weakly similar to uniprot|P14724 Saccharomyces
FT                   cerevisiae YFR036w CDC26"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60767"
FT                   /db_xref="GOA:Q6FPM6"
FT                   /db_xref="InterPro:IPR018860"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM6"
FT                   /protein_id="CAG60767.1"
FT                   /translation="MIRREATTLTLSQTDINDLVDELEERKLQRIINKQRDRVLRTSTK
FT                   LESGSEDTRLASRDNNDDGIALQYNNGDESLEDAVPIDSFINASPLDNKTMHRTVNFDQ
FT                   GLNVSLGSFAQNTTSNSNWQGNSQSGTSETEAGSTQSNPFYRG"
FT   gene            complement(<262001..>263644)
FT                   /locus_tag="CAGL0J02640g"
FT                   /old_locus_tag="CAGL-IPF6533"
FT                   /old_locus_tag="CAGL-CDS1790.1"
FT   CDS_pept        complement(262001..263644)
FT                   /locus_tag="CAGL0J02640g"
FT                   /old_locus_tag="CAGL-IPF6533"
FT                   /old_locus_tag="CAGL-CDS1790.1"
FT                   /note="similar to uniprot|P43609 Saccharomyces cerevisiae
FT                   YFR037c RSC8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60768"
FT                   /db_xref="GOA:Q6FPM5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM5"
FT                   /inference="similar to AA sequence:UniProtKB:P43609"
FT                   /protein_id="CAG60768.1"
FT                   /translation="MSETVKNEMEIDSENVAKVEEVTDKSNGDDDTSSMEDKTLKFLIK
FT                   QTNEVTIPPFAKWFDMYSVHEIEKRSLPDFFDGSSRFKSEKAYKDTRNFIINTFRLSPT
FT                   EYLTITAVRRNIAMDVASIVRIHEFLEKWGLINYQVDPRSKPTLIGPSFTGHFQITLDT
FT                   PQGLKPFLPEKKIIANKKLKIEAQKKKLVHEDEERVEVLILNDATTKESNEDDQTINEE
FT                   ENSYPTNVSLRQNVYDASKNFNALKEKKLESKDMQKVFVCHICGNDKMTVKYFNLRNKH
FT                   SSLCHKCFSKEQFGEKFQSSDFIKLADENAFPQRKIWTDQEVVSLLEGLEMFGSDWKHI
FT                   AKHVGGNKLIADCVDKYMSLPLEDDDVSKLLDKYKSSANQTTSDTIIEVMENFINALIT
FT                   NGNEDILNSKLPTAAHNCQLKSQYQMRIIAQELITLSAKKLKIKMSKLDSLDKALTEET
FT                   AKYENEVSKISQQKNNLSKQVSEINQKLSDLNVTKKLVIASEQMDSNMDLVDKEEEEEK
FT                   NDNQQLAKEVAQHLDDPKLTEPKRFKIWSL"
FT   gene            <264512..>267046
FT                   /locus_tag="CAGL0J02662g"
FT                   /old_locus_tag="CAGL-IPF6535"
FT                   /old_locus_tag="CAGL-CDS0700.1"
FT   CDS_pept        264512..267046
FT                   /locus_tag="CAGL0J02662g"
FT                   /old_locus_tag="CAGL-IPF6535"
FT                   /old_locus_tag="CAGL-CDS0700.1"
FT                   /note="similar to uniprot|P43610 Saccharomyces cerevisiae
FT                   YFR038w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60769"
FT                   /db_xref="GOA:Q6FPM4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM4"
FT                   /inference="similar to AA sequence:UniProtKB:P43610"
FT                   /protein_id="CAG60769.1"
FT                   /translation="MNTRKRFLRSARKAAAVTVNYAEPDDNDLSANTFASDDENADVSV
FT                   DAEDTPPVWLRDDVRPNEDVQLDSDDENGGDKDDDRDLDDLLLKEKEKHRLEAQTKEED
FT                   SDDEVNELDKASVTSKLKKLDEFVKQSQVYSSIIADTLLKRTLERTEESDASNNDPVKE
FT                   PPAKKAKKSKSILDFFTRRQNTDDNRVEEMAVDVKKETEEERIAKEQPSYLKNCVLKPY
FT                   QMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSFIYEMDTKGPFLIAAPLSTVDN
FT                   WMNEFAKFAPEIPILKYYSQNGQDARQKLLKKFFKNNNREGVIVTSYEMIIRDANIIMG
FT                   EQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDI
FT                   FADFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLK
FT                   DVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEYIGTVSNKSI
FT                   RDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLFF
FT                   FPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQFVGMLDLLEDWSELNS
FT                   FNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWN
FT                   PQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLERMVIQMGKFSNLK
FT                   KLALNERSFLQQSTGMNPNKTSNKELVQELSQLLMSKESSIGFETSKKPKQDDILTEAE
FT                   LKELSDRSLKFYSPDREVEFPHVRLFETTSGF"
FT   gene            complement(<267249..>267695)
FT                   /locus_tag="CAGL0J02684g"
FT                   /old_locus_tag="CAGL-IPF6537"
FT                   /old_locus_tag="CAGL-CDS4854.1"
FT   CDS_pept        complement(267249..267695)
FT                   /locus_tag="CAGL0J02684g"
FT                   /old_locus_tag="CAGL-IPF6537"
FT                   /old_locus_tag="CAGL-CDS4854.1"
FT                   /note="highly similar to uniprot|P40030 Saccharomyces
FT                   cerevisiae YER044c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60770"
FT                   /db_xref="GOA:Q6FPM3"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM3"
FT                   /protein_id="CAG60770.1"
FT                   /translation="MLSLQQLTGGVHSAVTNMAPGYLPKWLLFISIVSVFNSVQTYISG
FT                   LELTRRVYENKPSETTSLSARTFGTWTFVSCVIRFYGALYITEPHIYQLTFISYIIALF
FT                   HFGSELLIFRTCKLGKGFMGPLIVASTSLIWMYNQKEYYTGLPW"
FT   gene            complement(<267965..>269104)
FT                   /locus_tag="CAGL0J02706g"
FT                   /old_locus_tag="CAGL-IPF6538"
FT                   /old_locus_tag="CAGL-CDS2910.1"
FT   CDS_pept        complement(267965..269104)
FT                   /locus_tag="CAGL0J02706g"
FT                   /old_locus_tag="CAGL-IPF6538"
FT                   /old_locus_tag="CAGL-CDS2910.1"
FT                   /note="weakly similar to uniprot|P29467 Saccharomyces
FT                   cerevisiae YER044ca MEI4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60771"
FT                   /db_xref="GOA:Q6FPM2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM2"
FT                   /protein_id="CAG60771.1"
FT                   /translation="MNLSEADWVICIALVKYKLRTISKQNRVYIPLLTDISSFNEDELQ
FT                   YCDLRRHLPSELSKNDKQEELINIFNLMWARRKNWENSLYCCDILLNNRTLLIHLLEDC
FT                   THQRLLLHYYGNYRFLLFYLNQQPCTRPTITTEAATISFRCYELIIISYFGLATNYHVT
FT                   NKGIPNPIKRHLIDGLIFKFIKQELTALITNCPGYLNKSLIIRVQNNMLFLNVCVTSLQ
FT                   KSFIQTVSTIINTMITTRTTVFITNTNVEALMINLVTLLESFVSLLKCHNTKSKTAYAR
FT                   ISSETRECKDKRIYAALYKKNFGKYNHSYKLFLKCVDKTVMFLLCLYKKLRFNKKTDQE
FT                   RMSQSTVAIMQQKRKQILAGLLAARKRELLIKYRKIRWL"
FT   gene            complement(<269575..>272382)
FT                   /locus_tag="CAGL0J02728g"
FT                   /old_locus_tag="CAGL-IPF6539"
FT                   /old_locus_tag="CAGL-CDS0545.1"
FT   CDS_pept        complement(269575..272382)
FT                   /locus_tag="CAGL0J02728g"
FT                   /old_locus_tag="CAGL-IPF6539"
FT                   /old_locus_tag="CAGL-CDS0545.1"
FT                   /note="similar to uniprot|P39955 Saccharomyces cerevisiae
FT                   YER047c SAP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60772"
FT                   /db_xref="GOA:Q6FPM1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM1"
FT                   /inference="similar to AA sequence:UniProtKB:P39955"
FT                   /protein_id="CAG60772.1"
FT                   /translation="MEGTTNKSLFGKLASLGRRPQQPLTDLSELYSKIANESILFLKLE
FT                   EKGRYKQAVQGWKAMTTNVMFQLTMIERQYPHADRYTPEEISLQTGINELYQKSMLHLD
FT                   RVKELNEQYGSQQDNMGNLSYSQVSKGTRINSPVKPLKTHNTSGSIISFSSDNKGRKMN
FT                   TTLRDNVHYTAPKKSNRTANRLAFSGGDNNSLKDAGYREPKVFFATSKPLGQPKLNDHK
FT                   STTADFFDDFDDTAYQDNEFDDPIEDLIDLNSDEDQKFTSPVAIQKSKKVVSENIADLN
FT                   RISKRFTSFNGDEDFEFDVDDYFADDYSDNTDDDSSVDSEQEKQARSQALDKLMGEQKI
FT                   ETNSSISTSSASCKSNASDEDISVPIVPPPLPPLPPLDIQDDKRFWSTKRAELSKINKS
FT                   APTLLGNETGKDLSDINLKKTATNPTEKKSRKTGSLTSLSKPVQKISSNNTKKEVPAKI
FT                   VIPATKPISAAAAAKMVYAKKGATGIPKPNRTKANFSSSVNDQKTMSRPSNLNPTKSVP
FT                   VIKKTSDTQLSTSSKAVKNVKPVLRKTVIKKPAQQKPTSVKINGSTRPTKGVVTSKKPI
FT                   KPTQAKKVVKKVDALEDKKGDPDTNIKQAPDGEADEAKLKEALEDEIINSLPGVDRTAA
FT                   KQIFSEIVVHGDEVHWEDIAGLENAKFSLKEAVVYPFLRPDLFLGLREPVRGMLLFGPP
FT                   GTGKTMLARAVATESHSTFFSISASSLTSKYLGESEKLVRALFAIAKKLSPSIIFVDEI
FT                   DSIMGSRNSDGENESSRRIKNEFLIQWSSLSSAAAGNNREDGDDGRVLVLAATNLPWSI
FT                   DEAARRRFVRRQYIPLPEPETRMVQLKKLLSHQKHNLDDAAFAELLNLTEGYSGSDITS
FT                   LAKDAAMGPLRELGDKLLETTRESIRPLEVKDFKNSLEYIKPSVSQEGLEKYEEWAAKF
FT                   GSSGV"
FT   gene            complement(<273009..>274157)
FT                   /locus_tag="CAGL0J02750g"
FT                   /old_locus_tag="CAGL-IPF6540"
FT                   /old_locus_tag="CAGL-CDS2887.1"
FT   CDS_pept        complement(273009..274157)
FT                   /locus_tag="CAGL0J02750g"
FT                   /old_locus_tag="CAGL-IPF6540"
FT                   /old_locus_tag="CAGL-CDS2887.1"
FT                   /note="highly similar to uniprot|P39101 Saccharomyces
FT                   cerevisiae YER048c CAJ1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60773"
FT                   /db_xref="GOA:Q6FPM0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM0"
FT                   /protein_id="CAG60773.1"
FT                   /translation="MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQ
FT                   AKFQAVGEAYQVLNDPALRKQYDEFGKDNAVPQQGFEDAEEYFTAIFGGDGFKDWIGDF
FT                   SLFKELNEATDMMSEDATTDATAAATTSEAGMVKHDGKTDAKDKSGKMTKEQREKLWEM
FT                   EKKRREEVAKQVEELARKLKEKLLQYNLAVKGGHLDDFNRKLDQEVEELKLESFGLELL
FT                   YLIARVYKTKANNYLMAKKTFGFSKIFTSTRDNARTVKSAYNLLSTGMEAQKAMEQMSK
FT                   VDEDQLDQYERAKFENEMAGKALGVMWAMNKFELERKLKDVCNTVLSDKSVSSSERRER
FT                   AKGLLFIASRFASAKRSPEEAEEAKVFEEFILGEKQKHGSKP"
FT   gene            <274420..>274491
FT                   /gene="tRNA-Gln (TTG)"
FT                   /locus_tag="CAGL0J02772r"
FT   tRNA            274420..274491
FT                   /gene="tRNA-Gln (TTG)"
FT                   /locus_tag="CAGL0J02772r"
FT                   /product="transfer RNA-Gln"
FT   gene            <274876..>275187
FT                   /locus_tag="CAGL0J02794g"
FT                   /old_locus_tag="CAGL-IPF13564"
FT   CDS_pept        274876..275187
FT                   /locus_tag="CAGL0J02794g"
FT                   /old_locus_tag="CAGL-IPF13564"
FT                   /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
FT                   YER048wa"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60774"
FT                   /db_xref="GOA:Q6FPL9"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL9"
FT                   /inference="similar to AA sequence:UniProtKB:Q6Q560"
FT                   /protein_id="CAG60774.1"
FT                   /translation="MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALT
FT                   DAAKIESLFQGAQRDLGVLKRQSIISQMYTFDKLVVEPVEPVEPVEPVEPVEPVEPKQ"
FT   gene            <275547..>277424
FT                   /locus_tag="CAGL0J02816g"
FT                   /old_locus_tag="CAGL-IPF6544"
FT                   /old_locus_tag="CAGL-CDS1372.1"
FT   CDS_pept        275547..277424
FT                   /locus_tag="CAGL0J02816g"
FT                   /old_locus_tag="CAGL-IPF6544"
FT                   /old_locus_tag="CAGL-CDS1372.1"
FT                   /note="highly similar to uniprot|P40032 Saccharomyces
FT                   cerevisiae YER049w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60775"
FT                   /db_xref="GOA:Q6FPL8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR019601"
FT                   /db_xref="InterPro:IPR039558"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL8"
FT                   /protein_id="CAG60775.1"
FT                   /translation="MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDS
FT                   SAPYNWGNISGLVNDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLS
FT                   RLPNMYKLRQILYSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRR
FT                   ISFILYLPDPDRKWKPQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSF
FT                   HDVEEVKVDKHRLSIQGWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYP
FT                   KQERDILPYHQVKHFEKVLYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHL
FT                   TKEGIKKLQEQFLENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTA
FT                   MPSHKWRYMYIDGKNPRKLLKASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDL
FT                   AIFYKSTIFKKYLALLTALCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSI
FT                   LVGNLCLTPSSGWESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVN
FT                   NPPSWNTFNLVLRDQSVLEFVKYVSCAAKSSRWDVKMEWDVKYVGEDNE"
FT   gene            complement(<277727..>278209)
FT                   /locus_tag="CAGL0J02838g"
FT                   /old_locus_tag="CAGL-IPF6545"
FT                   /old_locus_tag="CAGL-CDS4736.1"
FT   CDS_pept        complement(277727..278209)
FT                   /locus_tag="CAGL0J02838g"
FT                   /old_locus_tag="CAGL-IPF6545"
FT                   /old_locus_tag="CAGL-CDS4736.1"
FT                   /note="similar to uniprot|P40033 Saccharomyces cerevisiae
FT                   YER050c RSM18"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60776"
FT                   /db_xref="GOA:Q6FPL7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL7"
FT                   /inference="similar to AA sequence:UniProtKB:P40033"
FT                   /protein_id="CAG60776.1"
FT                   /translation="MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGS
FT                   RENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFY
FT                   ARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNFLE"
FT   gene            <278605..>279816
FT                   /locus_tag="CAGL0J02860g"
FT                   /old_locus_tag="CAGL-IPF6546"
FT                   /old_locus_tag="CAGL-CDS2751.1"
FT   CDS_pept        278605..279816
FT                   /locus_tag="CAGL0J02860g"
FT                   /old_locus_tag="CAGL-IPF6546"
FT                   /old_locus_tag="CAGL-CDS2751.1"
FT                   /note="similar to uniprot|P40034 Saccharomyces cerevisiae
FT                   YER051w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60777"
FT                   /db_xref="GOA:Q6FPL6"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPL6"
FT                   /inference="similar to AA sequence:UniProtKB:P40034"
FT                   /protein_id="CAG60777.1"
FT                   /translation="MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGED
FT                   KKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVS
FT                   TNNKTTRDLTVDDITQAVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNV
FT                   ISLEVSHVEDLQYDRPDIVDDKDLVDIVWNNVENLDTENDPRPKVTKYCLMSVKNAFTD
FT                   YHLDFAGTSVYYNLAFGKKKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAME
FT                   LNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPM
FT                   FDEVMGRTCEWLCQNQKKGKQMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQELS
FT                   NLYL"
FT   gene            complement(<279998..>281590)
FT                   /locus_tag="CAGL0J02882g"
FT                   /old_locus_tag="CAGL-IPF6547"
FT                   /old_locus_tag="CAGL-CDS1905.1"
FT   CDS_pept        complement(279998..281590)
FT                   /locus_tag="CAGL0J02882g"
FT                   /old_locus_tag="CAGL-IPF6547"
FT                   /old_locus_tag="CAGL-CDS1905.1"
FT                   /note="highly similar to uniprot|P10869 Saccharomyces
FT                   cerevisiae YER052c HOM3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60778"
FT                   /db_xref="GOA:Q6FPL5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL5"
FT                   /protein_id="CAG60778.1"
FT                   /translation="MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGF
FT                   DNDVAVVCSARSSYTKQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDS
FT                   PLVAKLIDDTNKELALVDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGC
FT                   KAKYVDLSNVVPSDYQTTTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPM
FT                   GLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEAS
FT                   ELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEA
FT                   LSSTFFEKKRRGATAITTKNDIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTS
FT                   EVHVSMALPIPDSDSMKALRSAVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMF
FT                   TTLAEQGINIEMISQGANEINISCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKA
FT                   VDERLEQIKRLNL"
FT   gene            complement(<282119..>283750)
FT                   /locus_tag="CAGL0J02904g"
FT                   /old_locus_tag="CAGL-IPF6549"
FT                   /old_locus_tag="CAGL-CDS1815.1"
FT   CDS_pept        complement(282119..283750)
FT                   /locus_tag="CAGL0J02904g"
FT                   /old_locus_tag="CAGL-IPF6549"
FT                   /old_locus_tag="CAGL-CDS1815.1"
FT                   /note="similar to uniprot|P40036 Saccharomyces cerevisiae
FT                   YER054c GIP2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60779"
FT                   /db_xref="GOA:Q6FPL4"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR016717"
FT                   /db_xref="InterPro:IPR038175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL4"
FT                   /inference="similar to AA sequence:UniProtKB:P40036"
FT                   /protein_id="CAG60779.1"
FT                   /translation="MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQF
FT                   LHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARDDL
FT                   IPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSLPGT
FT                   PGLNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYLNEYG
FT                   IEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQGNAGPK
FT                   LRKSKRFHAIKKKDKDNENNKENVSNPNSTPSSANSSSTSLRDMGTAANQGNTPYSNYR
FT                   TDSGASVSNGGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEV
FT                   FLQELSLHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRN
FT                   VQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFW
FT                   DNNCGKNYCVDLVMDGFRNPFANALK"
FT   gene            <283904..>284287
FT                   /locus_tag="CAGL0J02926g"
FT                   /old_locus_tag="CAGL-IPF6551"
FT                   /old_locus_tag="CAGL-CDS5085.1"
FT   CDS_pept        283904..284287
FT                   /locus_tag="CAGL0J02926g"
FT                   /old_locus_tag="CAGL-IPF6551"
FT                   /old_locus_tag="CAGL-CDS5085.1"
FT                   /note="similar to uniprot|Q02771 Saccharomyces cerevisiae
FT                   YER058w PET117"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60780"
FT                   /db_xref="GOA:Q6FPL3"
FT                   /db_xref="InterPro:IPR031568"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL3"
FT                   /inference="similar to AA sequence:UniProtKB:Q02771"
FT                   /protein_id="CAG60780.1"
FT                   /translation="MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSCA
FT                   VTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQEL
FT                   RKKYESMQPLSGEVVTQDGERVK"
FT   gene            <285162..>286709
FT                   /locus_tag="CAGL0J02948g"
FT                   /old_locus_tag="CAGL-IPF6554"
FT                   /old_locus_tag="CAGL-CDS1981.1"
FT   CDS_pept        285162..286709
FT                   /locus_tag="CAGL0J02948g"
FT                   /old_locus_tag="CAGL-IPF6554"
FT                   /old_locus_tag="CAGL-CDS1981.1"
FT                   /note="highly similar to uniprot|P40039 Saccharomyces
FT                   cerevisiae YER060w or uniprot|P17064 Saccharomyces
FT                   cerevisiae YER056c FCY2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60781"
FT                   /db_xref="GOA:Q6FPL2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL2"
FT                   /protein_id="CAG60781.1"
FT                   /translation="MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRL
FT                   AAMISAETKGIEPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSV
FT                   LTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVN
FT                   TVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLV
FT                   LIARLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYK
FT                   IFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFG
FT                   QFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYY
FT                   FSTFMQYFMDSIAYYLSIYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISL
FT                   VVGAFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRPLELKYFGR"
FT   gene            complement(<286973..>288319)
FT                   /locus_tag="CAGL0J02970g"
FT                   /old_locus_tag="CAGL-IPF6555"
FT                   /old_locus_tag="CAGL-CDS2416.1"
FT   CDS_pept        complement(286973..288319)
FT                   /locus_tag="CAGL0J02970g"
FT                   /old_locus_tag="CAGL-IPF6555"
FT                   /old_locus_tag="CAGL-CDS2416.1"
FT                   /note="similar to uniprot|P39525 Saccharomyces cerevisiae
FT                   YER061c CEM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60782"
FT                   /db_xref="GOA:Q6FPL1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL1"
FT                   /inference="similar to AA sequence:UniProtKB:P39525"
FT                   /protein_id="CAG60782.1"
FT                   /translation="MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGD
FT                   FAKWRGIFPPELRVGAVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLV
FT                   NKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPY
FT                   FVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASE
FT                   ASVHPLSLAGFLRAKSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILA
FT                   EIVGYGLSCDAHHITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDN
FT                   TECCAIQNTLIDNVNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNL
FT                   KNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFGGVNTSLLFRRWHE"
FT   gene            <288611..>289303
FT                   /locus_tag="CAGL0J02992g"
FT                   /old_locus_tag="CAGL-IPF6556"
FT                   /old_locus_tag="CAGL-CDS4170.1"
FT   CDS_pept        288611..289303
FT                   /locus_tag="CAGL0J02992g"
FT                   /old_locus_tag="CAGL-IPF6556"
FT                   /old_locus_tag="CAGL-CDS4170.1"
FT                   /note="similar to uniprot|P40040 Saccharomyces cerevisiae
FT                   YER063w THO1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60783"
FT                   /db_xref="GOA:Q6FPL0"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR040746"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL0"
FT                   /inference="similar to AA sequence:UniProtKB:P40040"
FT                   /protein_id="CAG60783.1"
FT                   /translation="MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDKAKEAAG
FT                   EAAPAPVTEEAAPAPAAAPVAAEVEEAKPEEAKPEEETKAEPASNEAAPAVASEQPAEA
FT                   SEDKPAEVQEKAPEVKEPEKELFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSL
FT                   EKLKVRIDRFGVDRNMSIALELGLVKPKEVRQQNRSNKNNNRNGHKGGNNKNRKGRVNK
FT                   NRGSGRRW"
FT   gene            complement(<290111..>291832)
FT                   /locus_tag="CAGL0J03014g"
FT                   /old_locus_tag="CAGL-IPF6559"
FT                   /old_locus_tag="CAGL-CDS1649.1"
FT   CDS_pept        complement(290111..291832)
FT                   /locus_tag="CAGL0J03014g"
FT                   /old_locus_tag="CAGL-IPF6559"
FT                   /old_locus_tag="CAGL-CDS1649.1"
FT                   /note="weakly similar to uniprot|P40522 Saccharomyces
FT                   cerevisiae YIL056w or uniprot|P40041 Saccharomyces
FT                   cerevisiae YER064c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60784"
FT                   /db_xref="GOA:Q6FPK9"
FT                   /db_xref="InterPro:IPR007147"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK9"
FT                   /protein_id="CAG60784.1"
FT                   /translation="MPFSLSGYGTTHKIREQLRFTDEIKWKQFSSRRLELIDKFELSKY
FT                   KASEQDDNIKQIANMLRIEFEFPVEATQGFEKLVTAAVQSVRRNRKRSKKKSPSSSSST
FT                   SKRVRKPLTPTPSKTQAKRNRSDSVTSNSSDDGHASDSSSMSHSRASSATTSTAAASPH
FT                   STSASNNGTHITRVNTPSSIASPPSTISLPFHQSVLSPPNQNFQTAVQNILLPLPTSLK
FT                   KSTLLSNNTDSNNMPPAQETQKTLTDDDVARSIMSDLIVLPVINNKEFVDLVKESHTCN
FT                   TIINKQDSQANTGNSGNSGNSGPDVSTIFAVFANMEILGEMVLKSSVSFSVEKNFNDKF
FT                   SKFASTKEYITLKTFQQESLTTFAKNLFNKFNINANTFKQNDSPFIVKLLFIIIGALVT
FT                   DHGFEKTLAVLNPFLEDLTITLFTAPTPTPVAPPEQHQRSKSAVGLDILSTVSLQIDQE
FT                   SQQHNSQMTSNQNNLFAQSNGSQTIKLPQIPRRSQTPSNTLSLPIPAPAASIPPRSVSA
FT                   LTTQSKPDLSVIDNIINRIHQKNTTQNQQVSESNNGMKRHLFKDGNLPHPIAQSLS"
FT   gene            complement(<292534..>294195)
FT                   /locus_tag="CAGL0J03058g"
FT                   /old_locus_tag="CAGL-IPF6561"
FT                   /old_locus_tag="CAGL-CDS1632.1"
FT   CDS_pept        complement(292534..294195)
FT                   /locus_tag="CAGL0J03058g"
FT                   /old_locus_tag="CAGL-IPF6561"
FT                   /old_locus_tag="CAGL-CDS1632.1"
FT                   /note="highly similar to uniprot|P28240 Saccharomyces
FT                   cerevisiae YER065c ICL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60786"
FT                   /db_xref="GOA:Q6FPK7"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPK7"
FT                   /protein_id="CAG60786.2"
FT                   /translation="MPVPNSEANEFQALQARIDADAKEIEQWWSEPRWNKTKRTYSARE
FT                   IAIRRGTFPPLTYPSSVMAKKVYKVLEKHHKEGTVSRTFGALDPVQVSQMAKFLDTIYV
FT                   SGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHDRKQWENRAKATSQEELD
FT                   AMGPAIDYMTPIIADADAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGR
FT                   CVIPVQEHINRLVTIRMCADIMHSELVIVARTDSEAATLISSTIDTRDHYFVVGATNPD
FT                   IEPFAEYMDRAIMAGVSGDELQKLEAAWIEKAGLKLFHEAFADEVNKSSVSNKQEIIKK
FT                   FNDKVGPLTETSHREAKKLAKELLGKDIFFDWDLPRVREGLYRYRGGTQCSVMRARAFA
FT                   PYADLVWMESNYPDFEQAREFAEGVKAKYPDQWLAYNLSPSFNWPKAMSVDEQATFIER
FT                   LGQLGYIWQFITLAGLHTTALAIHKFSEDFAREGMKAYAQNVQQIEMDEGVDVLKHQKW
FT                   SGAEYIDGLLKLAQGGVSATAAMGQGVTEDQFKSNL"
FT   gene            <295476..>295949
FT                   /locus_tag="CAGL0J03080g"
FT                   /old_locus_tag="CAGL-IPF13577"
FT   CDS_pept        295476..295949
FT                   /locus_tag="CAGL0J03080g"
FT                   /old_locus_tag="CAGL-IPF13577"
FT                   /note="highly similar to uniprot|P40188 Saccharomyces
FT                   cerevisiae YIL057c or uniprot|P40043 Saccharomyces
FT                   cerevisiae YER067w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60787"
FT                   /db_xref="GOA:Q6FPK6"
FT                   /db_xref="InterPro:IPR022554"
FT                   /db_xref="InterPro:IPR038235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPK6"
FT                   /protein_id="CAG60787.1"
FT                   /translation="MAKKDKKPKVNTIVTKDGESLKVFEDLNDFEMFIKNETEDEEFDH
FT                   IHCKLTYYPPFVLHESHDDPEKIKDTNNSHNKKFVRHLHQHVEKHLLKDIKEALHKPEL
FT                   KFHDKSKDETFEHIVWHYGEETEYHDRKFRIQVTVTCNHDDAMVDVDYKTIPL"
FT   gene            <296729..>298591
FT                   /locus_tag="CAGL0J03102g"
FT                   /old_locus_tag="CAGL-IPF6932"
FT                   /old_locus_tag="CAGL-CDS1403.1"
FT   CDS_pept        296729..298591
FT                   /locus_tag="CAGL0J03102g"
FT                   /old_locus_tag="CAGL-IPF6932"
FT                   /old_locus_tag="CAGL-CDS1403.1"
FT                   /note="similar to uniprot|P34909 Saccharomyces cerevisiae
FT                   YER068w MOT2 transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60788"
FT                   /db_xref="GOA:Q6FPK5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR034261"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039515"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK5"
FT                   /inference="similar to AA sequence:UniProtKB:P34909"
FT                   /protein_id="CAG60788.1"
FT                   /translation="MINPHVQENLQAIQNTLSNYDTSFLSEDEEDYCPLCIEPMDITDK
FT                   NFFPCPCGYQICQFCYNNIRQNPELNGRCPACRRKFDDESVRYVVLTPEELKMERAKLA
FT                   RKEKERKQREKEKKEYEQNNRKHLAGTRVIQKNLVYVIGVNPPVPPEEVAATLKSDKYF
FT                   GQYGKINKIVVNRKAPHGGSNNDHYHHHAPGYGVYITFSSKDDAARCIAQVDGTYMDGR
FT                   LIKAAYGTTKYCSSYLKGMVCPNPNCMFLHEPGEEVDASNKRELSKPQLHTQNSMNSGS
FT                   FRNGSEFGSAAASPLPLKAHLNSATSSVAANNDSSASTPVLTPAPAPPSTSNPWGISQT
FT                   ASAIANINLSKPNSSINLPTLNDNVTQDNDNNNEVPSKPKPVSNTNTSSSKKKNSSKEY
FT                   VDPYDALNGCITFMNERFKSLSNYQNKTFSLRSDAIDQETLKSYPPLFTASNIKISETS
FT                   ENILTQKLVEILAIKPTDYSQSVIQFLQSVSASQPELINLPSVQSFTSANNAQATQTPI
FT                   NNPINPNLAQLGNGGVMGPGTPGPQNVMLQAMQPPQQMQAQPPQQMQQMPMNMGGNANG
FT                   MFVSPQELAQKQAQPQMAQMQSNNVGSNDLLNQLISGKRLAAAN"
FT   gene            <299422..>302043
FT                   /locus_tag="CAGL0J03124g"
FT                   /old_locus_tag="CAGL-IPF6931"
FT                   /old_locus_tag="CAGL-CDS0643.1"
FT   CDS_pept        299422..302043
FT                   /locus_tag="CAGL0J03124g"
FT                   /old_locus_tag="CAGL-IPF6931"
FT                   /old_locus_tag="CAGL-CDS0643.1"
FT                   /note="highly similar to uniprot|Q01217 Saccharomyces
FT                   cerevisiae YER069w ARG5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60789"
FT                   /db_xref="GOA:Q6FPK4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK4"
FT                   /protein_id="CAG60789.1"
FT                   /translation="MVSVLVSTKGFNPAKFKQASKLLNKSTVGFLSTSAKNKYSLQSKV
FT                   QNIKNSEVPKTFTRSKVGFSKRSLSSSNGIGTSGTRSTVIQLLNNISTKREVEQYLKYF
FT                   TSVSQQQFAVIKVGGAIISDNLPELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQGIE
FT                   PDYIDGIRITDEHTMAVVRECFLEQNLKLVTALEQLGVRARPITSGVFQAEYLDKSKYQ
FT                   LVGDITKVNKDAIEASIKAGALPILTSLAETPSGQMLNVNADVAAGELARVFEPLKIVY
FT                   LNEKGGIINGETGERISMINLDEEYEDLLKQSWVKYGTKLKIKEIKELLDYLPRSSSVA
FT                   IINVQDLQKELFTDSGAGTMIRRGYKLLKRSSLSEFQSADALRNVLQRDADIASKAQSA
FT                   ATYLRELEKAQFVSYSDEPLEALAIVRTEPKIPKLEKFLCSNSAWLNNVTDNVFSTLKR
FT                   DFPALQWIVSEDDANIAWHFDKSQGSYLKDGKVLFWYGVKDLNTVSELIGEFTKGVTNS
FT                   GHSSGVFGSQQAKRAYSTVRRTPPKPEATNTSPARVALIGARGYTGRNLVALIDSHPYF
FT                   EISHVSSRELKGQKLPDYKKAEIIYDNLQIEDIKKLESENAVDFWVMALPNNVSEPFIE
FT                   AIDSCNGKSKIIDLSADHRFVSEEEWAYGLPEINDREHIYKAKKISNPGCYATGSQLSI
FT                   APLLKYVDGLPTVFGVSGYSGAGAKPSPKNDPENLNNNIIPYALTNHIHEREISTRLGH
FT                   EVAFMPHVGQWFQGIALTVSIPIKKGSIQSNEEAMNIYKDFYKGENLVHIMEDIPSVKE
FT                   IAGTHGVVIGGFKLNDNKDRIVVCGTIDNLLKGAATQCLQNMNLAMGYGEYDGIPKDKI
FT                   VS"
FT   gene            <302881..>305565
FT                   /locus_tag="CAGL0J03146g"
FT                   /old_locus_tag="CAGL-IPF6929"
FT                   /old_locus_tag="CAGL-CDS0610.1"
FT   CDS_pept        302881..305565
FT                   /locus_tag="CAGL0J03146g"
FT                   /old_locus_tag="CAGL-IPF6929"
FT                   /old_locus_tag="CAGL-CDS0610.1"
FT                   /note="highly similar to uniprot|P21524 Saccharomyces
FT                   cerevisiae YER070w RNR1 or uniprot|P21672 Saccharomyces
FT                   cerevisiae YIL066c RNR3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60790"
FT                   /db_xref="GOA:Q6FPK3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK3"
FT                   /protein_id="CAG60790.1"
FT                   /translation="MYVYKRSGRKEPVKFDKITARISRLCYGLDPRIDAVKVTQRIISG
FT                   VYEGVTTVELDNLAAETCAYMTTIHPDYATLAARVAISNLHKQTTKQFSQVVSNLYHYI
FT                   NPATGKHAPMISDEVYQIVMDNKDELDSAIVYDRDFQFNYFGFKTLERSYLLRINGEVA
FT                   ERPQHLIMRVALGIHGRDLEAALETYNLMSLRYFTHASPTLFNAGTPHPQMSSCFLVAM
FT                   KDDSIEGIYDTLKECALISKTAGGIGLHIHNIRATGSYIAGTNGTSNGLIPMVRVFNNT
FT                   ARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFPALWVPDLFMKR
FT                   VEQNGNWTLFSPSSAPGLSDCYGKEFEELYERYEREGRGKTIKAQKLWYSILEAQTETG
FT                   TPFMIYKDACNEKSNQRNLGVIKSSNLCCEIVEYSSPDETAVCNLASIALPAFIETSED
FT                   GKTSTYNFQKLHDIAKVITRNLNKVIDRNYYPVPEAKNSNMRHRPIALGVQGLADTFML
FT                   LRLPFDSEGAAKLNIQIFETIYHASLEASCELAQKDGPYQSYQGSPISKGVFQFDMWNA
FT                   KPFGMWDWDALRKDILKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSG
FT                   EFQVVNPYLLRDLVDLGIWDEGMKQHIITQNGSIQNLPNIPQELKDLYKTVWEISQKTI
FT                   INMAADRSVYIDQSHSLNLFLQAPTMGKITSMHFYGWKKGLKTGMYYLRTQAASAAIQF
FT                   TIDQSVAQQAANNIADLSNLKRPSYVESEPSYVPSDFKADWENIKPSKITYSETEDESR
FT                   NVSLTPSASSSNDDLSSSVGSLKISEHPATPVSSTTTNIPVKEDKKEVAPEAEDAESEF
FT                   DIYNSKVIACAIDKPEACEMCSG"
FT   gene            <306171..>308612
FT                   /locus_tag="CAGL0J03168g"
FT                   /old_locus_tag="CAGL-IPF6927"
FT                   /old_locus_tag="CAGL-CDS0777.1"
FT   CDS_pept        306171..308612
FT                   /locus_tag="CAGL0J03168g"
FT                   /old_locus_tag="CAGL-IPF6927"
FT                   /old_locus_tag="CAGL-CDS0777.1"
FT                   /note="similar to uniprot|P32844 Saccharomyces cerevisiae
FT                   YIL068c SEC6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60791"
FT                   /db_xref="GOA:Q6FPK2"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="InterPro:IPR042532"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK2"
FT                   /inference="similar to AA sequence:UniProtKB:P32844"
FT                   /protein_id="CAG60791.1"
FT                   /translation="MVANSMNLADILKDEVSLERVKELKDQLLKEKSTIDYQLSKESNK
FT                   NYEAVQESIKLLNISQKDVIEVKDQLSKVKTLSDESKSSISRYDIIFDATRMYEKVDMT
FT                   SEIYDKIVAFSDTVEQVNRMLDTELAQDGLETGCPYLIQIHYLLTTIRNFQDQMTIMAN
FT                   VSTDDVQRTCQKLFSKVSGLVDKFDQLLESLIYDIVEMIRAENYSLVVRLFKIIDFEER
FT                   EDLRIEAIRNIIKKKEIEAEKSTFKKLPSSKNIGRLELESNSKALEYPTDQGLYQEIIN
FT                   GTITTRVQSRGYKNLLYNKIKQSIQEMFIEVRKEYDGDKKFDVLNNLDWVFNELLVVKD
FT                   YVSKYSPPYWNIFDKYYQFYYDELHILINELVDAEPETIIILDIIDFDKTFQNTLVKDF
FT                   GFKRKETKTVIGDTQKETLFKDYLNLIVIKMTEWLGNLQKTEFKTFKDRSIPPQSDAEN
FT                   LLLLEGTKTCFQMFSQQVEVAAGSSQAKILVGVIEKFSELIENRLSNWISVVDEEVRRL
FT                   MKYNELYDLDPNAIAPENEVPGGLLEYVIALANDQMRAADYAMAIGSKYGAMVTKAYEK
FT                   EIQTNIDNILDRFADVSQVCISALLTIIFDDLKKPYSEIFSKTWYKGSQAQQISDTISE
FT                   YLEDIKVLMNPVLYGLFMERLIENTILGYIGALKYEHSIKNKNNKFLESVKRDFEIFYK
FT                   LFATYIGSSDETIEIVKEKFEVMDYFMDLCCEPIDSVMGIWDNFLQRYPDVPVVILEFV
FT                   LKSRKDIDRSRRKKLVQRAIDLSLRPEHLAFISSEEYEPSYLSNFTIKSAKKSEDVGDD
FT                   Y"
FT   gene            complement(<308707..>309045)
FT                   /locus_tag="CAGL0J03190g"
FT                   /old_locus_tag="CAGL-IPF6926"
FT                   /old_locus_tag="CAGL-CDS5303.1"
FT   CDS_pept        complement(308707..309045)
FT                   /locus_tag="CAGL0J03190g"
FT                   /old_locus_tag="CAGL-IPF6926"
FT                   /old_locus_tag="CAGL-CDS5303.1"
FT                   /note="similar to uniprot|P40045 Saccharomyces cerevisiae
FT                   YER071c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60792"
FT                   /db_xref="GOA:Q6FPK1"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="InterPro:IPR038586"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPK1"
FT                   /inference="similar to AA sequence:UniProtKB:P40045"
FT                   /protein_id="CAG60792.1"
FT                   /translation="MVIEKIDDKSSNSPLTAPRLIDLIESQFSESQVSADTLIQHILES
FT                   LNKHSSQYKYIVSVTSIDIPTESSSSCEIDNKFGASWNAKKDGFLTHVLEDKHAGKNHV
FT                   VSVAWLSK"
FT   gene            <310357..>311910
FT                   /locus_tag="CAGL0J03212g"
FT                   /old_locus_tag="CAGL-IPF6925"
FT                   /old_locus_tag="CAGL-CDS1974.1"
FT   CDS_pept        310357..311910
FT                   /locus_tag="CAGL0J03212g"
FT                   /old_locus_tag="CAGL-IPF6925"
FT                   /old_locus_tag="CAGL-CDS1974.1"
FT                   /note="highly similar to uniprot|P40047 Saccharomyces
FT                   cerevisiae YER073w ALD5 or uniprot|P46367 Saccharomyces
FT                   cerevisiae YOR374w ALD4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60793"
FT                   /db_xref="GOA:Q6FPK0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK0"
FT                   /protein_id="CAG60793.1"
FT                   /translation="MFSRTITRTLRAPAVLRLYSTNVPLEVPVTLPNGIKYMQPTGLFI
FT                   NGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKAAKEAFENHWSREDPEVRA
FT                   RALFNLADLVEANLETLAGIDSLDNGKSLLCSRADVALVAKYLRSCGGWADKIYGDVID
FT                   TGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAELTPLSALFA
FT                   SKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGSTATGSRIMKTAADSIKK
FT                   VTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSRIYVQDKCYDEVLDRLK
FT                   KYTESLKVGNPFGDNTYQGSQTSQQQLDKILEYVDIGKQEGARIVTGGERIGEKGYFFK
FT                   PTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMANDSQYGLAAGIHTNDVNKAVE
FT                   VSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAALDNYTQVKSVRMAITKPRV
FT                   "
FT   gene            <313017..>314025
FT                   /locus_tag="CAGL0J03234g"
FT                   /old_locus_tag="CAGL-IPF6921"
FT                   /old_locus_tag="CAGL-CDS4823.1"
FT   CDS_pept        join(313017..313019,313621..314025)
FT                   /locus_tag="CAGL0J03234g"
FT                   /old_locus_tag="CAGL-IPF6921"
FT                   /old_locus_tag="CAGL-CDS4823.1"
FT                   /note="highly similar to uniprot|P26782 Saccharomyces
FT                   cerevisiae YIL069c RP50B and highly similar to
FT                   uniprot|P26782 Saccharomyces cerevisiae YER074w RP50A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60794"
FT                   /db_xref="GOA:Q6FPJ9"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ9"
FT                   /protein_id="CAG60794.1"
FT                   /translation="MSDSVTIRTRKVITNPLLARKQFVVDVLHPNRANVSKDELREKLA
FT                   EAYKAEKDAVSVFGFRTQFGGGKSTGFGLVYNSVADAKKFEPTYRLVRYGLAEKVEKAS
FT                   RQQRKQKKNRDKKIFGTGRRLAKKVARRNAD"
FT   gene            <314612..>315166
FT                   /locus_tag="CAGL0J03245g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.516.p"
FT   CDS_pept        join(314612..314702,314870..314977,315081..315166)
FT                   /locus_tag="CAGL0J03245g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.516.p"
FT                   /note="similar to uniprot|Q3E834 Saccharomyces cerevisiae
FT                   YER074W-A YOS1 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03245g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58043"
FT                   /db_xref="GOA:B4UN27"
FT                   /db_xref="InterPro:IPR013880"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN27"
FT                   /inference="similar to AA sequence:UniProtKB:Q3E834"
FT                   /protein_id="CAR58043.1"
FT                   /translation="MIFGLGRLFYVTLLLINAVAVLSEERFLSRIGLGRSGSEAPAFGQ
FT                   NANSTKSKVVQLIGAVQTLLRNRTMQELTHSVPLIGINILVIVYELLLG"
FT   gene            complement(<315380..>318034)
FT                   /locus_tag="CAGL0J03256g"
FT                   /old_locus_tag="CAGL-IPF6919"
FT                   /old_locus_tag="CAGL-CDS0626.1"
FT   CDS_pept        complement(315380..318034)
FT                   /locus_tag="CAGL0J03256g"
FT                   /old_locus_tag="CAGL-IPF6919"
FT                   /old_locus_tag="CAGL-CDS0626.1"
FT                   /note="similar to uniprot|P40048 Saccharomyces cerevisiae
FT                   YER075c PTP3 protein-tyrosine phosphatase 3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60795"
FT                   /db_xref="GOA:Q6FPJ8"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ8"
FT                   /inference="similar to AA sequence:UniProtKB:P40048"
FT                   /protein_id="CAG60795.1"
FT                   /translation="MDSSSPTGDSDFKCAIRQMAPPSLDIPHSNGSSIVRSPLVKSVTS
FT                   PVFAPSIKQASTFKKPSGCALVSALECNRILENKDIIVLDLRTYSEYSKSSIRDSIHVG
FT                   LPSTLLRRKNFDFNKLVQNLPVDDRVRLENKMNAMALEAKKLSFLIYDNTPNQTDTSLS
FT                   LPCYGVATKISEYRNQDERMENCGLYILNVGYSVFKLLFPDDVIESTETCLKNITECSA
FT                   MNSPMVEHPDLFIPMPHNINTSGEEYIRQTVNGLSFSPSLASTATKSPSISGSSINNSM
FT                   TNSNDFSLESPVSTSSPISALFKFQLPNRQQLASPVFKLPQNEEALSLEDYISAVNARE
FT                   NQENRTKEFKFQSFEFPKKHQSAEYSTRSPNEDKLNFQRKYAKLCTEYNDDLINEVIPQ
FT                   WFQELVTKSKVEIISQFQKLDYLERRRLNKSISKHKSTKSALTTISRPELSKMTPIDEK
FT                   SFDFNSNKGSMSTQIKRKKSQKRSYSQPNCSYLKSDWKCCIDVDDMEDEHDIEISSGVE
FT                   LGVKNRYKDIFPFENTRVKLKRRSVSSLSSSQEQTPNHSRDNSLVNKLNDLTLTQPVDN
FT                   YINANYIELPSLPNTLSDQKKELLKNLSAGKGRNCRYIATQAPMKTTVHDFYTCLLNNK
FT                   VPIILSLTDTFENGIEKCVQYWEDGDYEGFKVKLLEEIEVPKSYGTESEPADKDNKNDI
FT                   VLRRINIEYDEAGCNYEVIQIQIRNWPDLGVLTDPTNIIQIIHLKNSIIDSLFERKMYQ
FT                   PGTRPTVLVHCSAGCGRTGTWCTIDSVISNLDVFEVLRNELQVEMKGKVYDPISWTINT
FT                   FRKQRISMVQNVNQFLFIYDSLVCYFSLCLENHGKKDILTKPLSAIYDQSRHIKSLNEF
FT                   VDKKMKEVEPIFI"
FT   gene            complement(<318843..>320753)
FT                   /locus_tag="CAGL0J03278g"
FT                   /old_locus_tag="CAGL-IPF6914"
FT                   /old_locus_tag="CAGL-CDS1326.1"
FT   CDS_pept        complement(318843..320753)
FT                   /locus_tag="CAGL0J03278g"
FT                   /old_locus_tag="CAGL-IPF6914"
FT                   /old_locus_tag="CAGL-CDS1326.1"
FT                   /note="similar to uniprot|P40050 Saccharomyces cerevisiae
FT                   YER077c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60796"
FT                   /db_xref="GOA:Q6FPJ7"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ7"
FT                   /inference="similar to AA sequence:UniProtKB:P40050"
FT                   /protein_id="CAG60796.1"
FT                   /translation="MSMIAVKVSRVTVRFYHGSLVNFGNTNLKEKLHVLKKKSTVIRKS
FT                   SKELQRLAEKQKIKRNKAQKASYHKDRAVHILKSKYGISDISRDQLGPTSENDIKFLSK
FT                   IKDNRLLYTILGVNGFQLRDAILVTKDVEKFLKRGQVEKAVMLVKLAKAKGSSGANLIM
FT                   DYYLNELHSPKSAVDMYNWRKKNGIPINEYTDVTLFDGLAKQPEPISTKYGEMVLKILD
FT                   SKGEDEEFNIREFNAALGALTNCTDYSLAFQLFDSRSQRYSRKFDAITFTTMIKACNKI
FT                   KDEDLLISMLNEIIAKMTHRSIDPMLVNQLVSALSGSDRSKRLNREALLLASEVFTLDL
FT                   GISDSGVERRIHYDVIKESMRSRGDGLRQDKLYPSIIQACNYSDLPQIGIKFFAKITGF
FT                   PYENETGGEQALLEGPQLTYQLFKNYIDLLVRHRTSVCGSRSMDLFETINSTPSLKQLP
FT                   MKVLLRHVYTAVQRQGNKQSVYCDATRANALLQRVNEFVKHVEPTKDNVVPLAAWKFVL
FT                   PIAEKLQQGSQLSEEPQVHLTQSFLSTISALRLPLNKEAKSTLLAGIRVINSLGEQLRL
FT                   PPTVDLEDIPLELRDKFLYRRLLLRVKTRLVHIVDSIDKNTPQLPDDLSQLISQLGLHK
FT                   R"
FT   gene            complement(<321030..>322493)
FT                   /locus_tag="CAGL0J03300g"
FT                   /old_locus_tag="CAGL-IPF6913"
FT                   /old_locus_tag="CAGL-CDS2139.1"
FT   CDS_pept        complement(321030..322493)
FT                   /locus_tag="CAGL0J03300g"
FT                   /old_locus_tag="CAGL-IPF6913"
FT                   /old_locus_tag="CAGL-CDS2139.1"
FT                   /note="similar to uniprot|P40051 Saccharomyces cerevisiae
FT                   YER078c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60797"
FT                   /db_xref="GOA:Q6FPJ6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ6"
FT                   /inference="similar to AA sequence:UniProtKB:P40051"
FT                   /protein_id="CAG60797.1"
FT                   /translation="MTMMLRRYLSNGAKFVNRPKVQWNLGQRLHENRPFLLQPGELTPG
FT                   ITAAEYYQRRAELVRNLPVGSCLIILANQIKFASGAVFYPFQQDNDLFYLTGWNEPDSI
FT                   MVLEKPSENIEDHELTMFVPPKNEFKEKWEGFRTGVDAVKEFFNADHSYSVDNSMSMVN
FT                   ELAKIIKRNKGIYFDPDSNKNSKINSNILNLIKETNKGTPKKLKSLVADLRKVKSESEI
FT                   RLMRRAGQISGRSYNMAMAQRFRNERTLHTFLEHKFISGGCDKSAYIPVVATGPNALCI
FT                   HYTSNDDVMYDDEMVLVDAAGALGGYCSDISRTWPVAGKWPSSAHKDLYEAVLNVQRES
FT                   LKNCKKALENNMSLHDLHEASVKLTKQELKNLNFSKATEIAEKLYPHYIGHNLGLDVHD
FT                   VPEVSRFNPLVEGQVITIEPGLYIPDSPEYPAEFRNIGIRIEDDVVLKKDGYINLTVEA
FT                   VKEIKDIENVMQNGTTTDFEDDVVSPLQG"
FT   gene            <322732..>324672
FT                   /locus_tag="CAGL0J03322g"
FT                   /old_locus_tag="CAGL-IPF6912"
FT                   /old_locus_tag="CAGL-CDS1287.1"
FT   CDS_pept        322732..324672
FT                   /locus_tag="CAGL0J03322g"
FT                   /old_locus_tag="CAGL-IPF6912"
FT                   /old_locus_tag="CAGL-CDS1287.1"
FT                   /note="similar to uniprot|P40053 Saccharomyces cerevisiae
FT                   YER080w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60798"
FT                   /db_xref="GOA:Q6FPJ5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPJ5"
FT                   /inference="similar to AA sequence:UniProtKB:P40053"
FT                   /protein_id="CAG60798.1"
FT                   /translation="MLRIPSRIGSRQVLACAGRNLKCGSVMRHISRRNISKEPEKVYTN
FT                   LADVNDPKRDQFFKYTWGTWLQNDKLEKDKRTTKFSLNGLNSVLDDIYRQATKNTKDNF
FT                   KSETEIVPQPLTNKNRTVSMPNNIAITKLGTLNPNEKSVTIKTIASVHEGKHHRIYKVQ
FT                   TNLSDEKSFVLRIPYQLDDDKATISHRIRSEVATLDFLDLQLKMKVPKVICYAADDGNP
FT                   LGVPFILQEYIDGSLLMKDWNPLMDDKALMVETGEGSTENPELASLNKVVKSMADFHAK
FT                   LNSISFNAAGSIYFKNDSNLNSETVIDNISNDLASNLKDRWVLGPSVERRLWKKKSDLA
FT                   IEERLKYLGPWKEDKETSISAQILRDTAILELKNAEARLAKSEQNGSKDKNTETLIKKQ
FT                   IETFQNVEKISGDLISSEMKAIPNIKDLLKPTIFHPDLDPMNVLIENKTETPFMLDLEG
FT                   AVVKPFILQSSPQFVAYDGPKIYNMKSDIPEFEKLSEEERKHYEFMYKRTRNQFLWEKA
FT                   VNERLPNLIMTVAPPVKVLRRPYTAVLEQKTDNDYILVDDSFFQLREAWAFFFKNGLVT
FT                   KEEFPLTFTDEQVKQHADDLNSLHEKLVSTPFAATQGWVPQDMFDNLVRAGVIIKDSTG
FT                   NFTVNDINPSA"
FT   gene            complement(<324829..>326460)
FT                   /locus_tag="CAGL0J03344g"
FT                   /old_locus_tag="CAGL-IPF6910"
FT                   /old_locus_tag="CAGL-CDS1816.1"
FT   CDS_pept        complement(324829..326460)
FT                   /locus_tag="CAGL0J03344g"
FT                   /old_locus_tag="CAGL-IPF6910"
FT                   /old_locus_tag="CAGL-CDS1816.1"
FT                   /note="highly similar to uniprot|P40055 Saccharomyces
FT                   cerevisiae YER082c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60799"
FT                   /db_xref="GOA:Q6FPJ4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ4"
FT                   /protein_id="CAG60799.1"
FT                   /translation="MSTEKYRRNANVQRKGVKKTKDVYKTKDKKLKANLRKQDKRYKEA
FT                   VESASATEFLLPESSGFMEAETEMEKTFRVKQDEIRDSVDVLTASKGIDLKLNDFGPYH
FT                   VNFNRNGTHMLITGLKGHVASMDWRKGELRAELNLNETCNAACYLQNEQFFAVAQKKYT
FT                   FIYDHEGVELHRLKQHIEARHLEFLPYHYLLATAGQTGWLKYHDVSTGQMVSELRTKLG
FT                   PTTSMTHNPWNAVMHLGHSNGTVTLWSPSMPEPLVKLLSGRGPINSVAVDRSGYYMATV
FT                   SQDKSLKIWDIRNFKELHSVENLPTPGTNVTISDTGVLAVSRGPHVTLWKDALKSSKSA
FT                   RPCFGSINGDPNRNTPYMTQLFPGNKVRNMKFVPFEDLLSVGHESGVTNLIIPGAGEAN
FT                   YDALEINPFETAKQRQEQEVRTLLNKLPADSISLDPNVIGTVSSKAAATRLTAKDLEQV
FT                   TLQQDNVKNDNSDIPQVKVDTKGKNSGLRAFMRKKTKNVIDERKVRVQKLIEKEKQLRD
FT                   RKHKISKGELDENYTDVVDSALGRFK"
FT   gene            complement(<326713..>327555)
FT                   /locus_tag="CAGL0J03366g"
FT                   /old_locus_tag="CAGL-IPF6907"
FT                   /old_locus_tag="CAGL-CDS3753.1"
FT   CDS_pept        complement(326713..327555)
FT                   /locus_tag="CAGL0J03366g"
FT                   /old_locus_tag="CAGL-IPF6907"
FT                   /old_locus_tag="CAGL-CDS3753.1"
FT                   /note="similar to uniprot|P40056 Saccharomyces cerevisiae
FT                   YER083c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60800"
FT                   /db_xref="GOA:Q6FPJ3"
FT                   /db_xref="InterPro:IPR014802"
FT                   /db_xref="InterPro:IPR028143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPJ3"
FT                   /inference="similar to AA sequence:UniProtKB:P40056"
FT                   /protein_id="CAG60800.1"
FT                   /translation="MSLSEAEKRKILRERRQQKFSRGGASERLNKIVGGQGSQLDTKSA
FT                   LDEKPEVVEEIPREAVKPEMNSSVQAKKESTAQAKAEDPQVELFRQLAEMQGQGATEST
FT                   PDLFSMMKNLGATGDSPFPMAEQQVEAIDPELVEYHKYRVNTLTAKTTLVKWIVLLAYI
FT                   FLLTRTDDTYFPFVVRSYLPEVFTSQSSFFSIFLTFEILATSIYYQLSVGVERETGVKT
FT                   LQDTSKIVSLVSMVPEGILPIADLRGKVILAMKYWNIIAMMIGDVCFVLVAIGLVSQI"
FT   gene            <327822..>329105
FT                   /locus_tag="CAGL0J03388g"
FT                   /old_locus_tag="CAGL-IPF6906"
FT                   /old_locus_tag="CAGL-CDS2593.1"
FT   CDS_pept        327822..329105
FT                   /locus_tag="CAGL0J03388g"
FT                   /old_locus_tag="CAGL-IPF6906"
FT                   /old_locus_tag="CAGL-CDS2593.1"
FT                   /note="similar to uniprot|Q12476 Saccharomyces cerevisiae
FT                   YDL175c or uniprot|P40507 Saccharomyces cerevisiae YIL079c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60801"
FT                   /db_xref="GOA:Q6FPJ2"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12476"
FT                   /protein_id="CAG60801.1"
FT                   /translation="MATFVEDTKGEKMLAPSIEDVNEDPDELRSIRGQSRYFGETEDDT
FT                   IKEPEAKCSNCSETGHFKRDCPHVICSYCGVMDDHYSQQCPTTMRCALCNESGHYRMHC
FT                   PLKWKKLNCTLCNSPKHLRNRCPSVWRVYLLKNEDNKRKVLPMHQIYCYNCGDKGHYGD
FT                   ECDKARSSRVPNDDGSAFSGKNLSSELRGQYTHNIDRQRSSQDMVSSVYDNLRSSQPIA
FT                   YQVGSDRGSLLEDSDKQTDSNRPSRFSNTKIDTARLSKTPARYVQDRSSKNKRKFKDSL
FT                   YDDGEDDEDEEDQLYKENSRHDNHKRSDRRSRYGNKKTNGNSGYNQQQSHFYRPPYQGY
FT                   QSASYEQYPSQNSGYEHHSGILPTRSGVNVGATNTGHYQQQYYQNNSSTYPPQNMIYNQ
FT                   QVPMSAYAPPAPTPVKPSRSGVIKRYDE"
FT   gene            complement(<329320..>329393)
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0J03410r"
FT   tRNA            complement(329320..329393)
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0J03410r"
FT                   /product="transfer RNA-Ile"
FT   gene            <330031..>331899
FT                   /locus_tag="CAGL0J03432g"
FT                   /old_locus_tag="CAGL-IPF6905"
FT                   /old_locus_tag="CAGL-CDS1392.1"
FT   CDS_pept        330031..331899
FT                   /locus_tag="CAGL0J03432g"
FT                   /old_locus_tag="CAGL-IPF6905"
FT                   /old_locus_tag="CAGL-CDS1392.1"
FT                   /note="similar to uniprot|P53974 Saccharomyces cerevisiae
FT                   YNL020c ARK1 or uniprot|P40494 Saccharomyces cerevisiae
FT                   YIL095w PRK1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60802"
FT                   /db_xref="GOA:Q6FPJ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ1"
FT                   /inference="similar to AA sequence:UniProtKB:P53974"
FT                   /protein_id="CAG60802.1"
FT                   /translation="MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPAD
FT                   QFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYE
FT                   VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE
FT                   NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFS
FT                   VNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAK
FT                   NPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNS
FT                   GISTPHSAGKMLAGFQNDMPKPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKK
FT                   AELEATPNPLESSKYIDDDSSSTTSEDSFDDHASFISKTQSAHSVSTVDRFNAYLKAND
FT                   SISEEDSDESFMPGASHLNRFRSDTQETSNKRQTKDEILLKRRSLPFTNNEARRNQSTD
FT                   SELDTLSKAEKKEQLRQRMMSALNASEDVIKKTKSRDGSVSNDNNYLLKSKLHGRRDNE
FT                   QRFSSVVVNPLDNSNNLPTKKTPPVKPPKPDHLKPKVPPKPAFLKT"
FT   gene            complement(<332090..>334171)
FT                   /locus_tag="CAGL0J03454g"
FT                   /old_locus_tag="CAGL-IPF6903"
FT                   /old_locus_tag="CAGL-CDS1119.1"
FT   CDS_pept        complement(332090..334171)
FT                   /locus_tag="CAGL0J03454g"
FT                   /old_locus_tag="CAGL-IPF6903"
FT                   /old_locus_tag="CAGL-CDS1119.1"
FT                   /note="highly similar to uniprot|P53973 Saccharomyces
FT                   cerevisiae YNL021w HDA1 histone deacetylase A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60803"
FT                   /db_xref="GOA:Q6FPJ0"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ0"
FT                   /protein_id="CAG60803.1"
FT                   /translation="MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKT
FT                   GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDL
FT                   MLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRL
FT                   PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES
FT                   VRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKG
FT                   FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPS
FT                   CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAE
FT                   ALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSE
FT                   DFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLV
FT                   VDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTK
FT                   VAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLV
FT                   FTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE"
FT   gene            <334536..>336089
FT                   /locus_tag="CAGL0J03476g"
FT                   /old_locus_tag="CAGL-IPF6902"
FT                   /old_locus_tag="CAGL-CDS1973.1"
FT   CDS_pept        334536..336089
FT                   /locus_tag="CAGL0J03476g"
FT                   /old_locus_tag="CAGL-IPF6902"
FT                   /old_locus_tag="CAGL-CDS1973.1"
FT                   /note="highly similar to uniprot|P25382 Saccharomyces
FT                   cerevisiae YCR072c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60804"
FT                   /db_xref="GOA:Q6FPI9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI9"
FT                   /protein_id="CAG60804.1"
FT                   /translation="MSTQLPPPSKKQKKEAQNAREVVGLVPEDVPHVSIKFKAEDTGEF
FT                   VGGTLRVPGGITEKQLEELLNQLNGNGEDPVPYTFSCTVKNTKNAVTTTHTVDIVDNIY
FT                   SSLLKPGHNSTEDIITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVT
FT                   GGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKP
FT                   LGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTN
FT                   SVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGA
FT                   FDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISR
FT                   MTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDC
FT                   RLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLWTH
FT                   "
FT   gene            <336384..>336755
FT                   /locus_tag="CAGL0J03498g"
FT                   /old_locus_tag="CAGL-IPF6900"
FT                   /old_locus_tag="CAGL-CDS5143.1"
FT   CDS_pept        336384..336755
FT                   /locus_tag="CAGL0J03498g"
FT                   /old_locus_tag="CAGL-IPF6900"
FT                   /old_locus_tag="CAGL-CDS5143.1"
FT                   /note="similar to uniprot|P25642 Saccharomyces cerevisiae
FT                   YCR071c IMG2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60805"
FT                   /db_xref="GOA:Q6FPI8"
FT                   /db_xref="InterPro:IPR007740"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI8"
FT                   /inference="similar to AA sequence:UniProtKB:P25642"
FT                   /protein_id="CAG60805.1"
FT                   /translation="MLSRVARRNGVFVRFQSSAVFPSVSEVRNDELVGHGSYTSKSYFV
FT                   ERSRVGNLPVYSDYRGGGNKVVTEIRRIRGNAVQLKKDLQAVLPHIPEKDWRVISQSNK
FT                   IEIKGNYISELKSVLSETF"
FT   gene            complement(<336992..>337960)
FT                   /locus_tag="CAGL0J03520g"
FT                   /old_locus_tag="CAGL-IPF6899"
FT                   /old_locus_tag="CAGL-CDS3398.1"
FT   CDS_pept        complement(336992..337960)
FT                   /locus_tag="CAGL0J03520g"
FT                   /old_locus_tag="CAGL-IPF6899"
FT                   /old_locus_tag="CAGL-CDS3398.1"
FT                   /note="similar to uniprot|P25334 Saccharomyces cerevisiae
FT                   YCR069w SCC3 peptidyl-prolyl cis-trans isomerase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60806"
FT                   /db_xref="GOA:Q6FPI7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI7"
FT                   /inference="similar to AA sequence:UniProtKB:P25334"
FT                   /protein_id="CAG60806.1"
FT                   /translation="MLANILLFLFTMLFSMQSTLADSADVDLRSMYAPDPPATNRISMT
FT                   ISYFPKGSDVKKEVDFSIDVYGTVCPKARDNFITLIRGIKAVIEGRGSGVMTLRYPGTK
FT                   FTNVLPNKYILGGEILPGISPYSIYGDKWPEENFDLKFDRPGRIAMWNHGQGKQESQFF
FT                   ISTNPKPDTELDGRYSIFGQVVSGLDVILNEVQHAEVSSTKDMILKYMVKEDLRLAKPD
FT                   ELHAKWLKRLEEYNNGDKTKGVSIARYFKAEETAAIPKKMPANALYNGYVRHSGFPLFK
FT                   VFFILVSLAVCFYVFKHRAEFLKRTNIVSLKQWRSVPETKA"
FT   gene            complement(<338756..>340270)
FT                   /locus_tag="CAGL0J03542g"
FT                   /old_locus_tag="CAGL-IPF6898"
FT                   /old_locus_tag="CAGL-CDS2057.1"
FT   CDS_pept        complement(338756..340270)
FT                   /locus_tag="CAGL0J03542g"
FT                   /old_locus_tag="CAGL-IPF6898"
FT                   /old_locus_tag="CAGL-CDS2057.1"
FT                   /note="similar to uniprot|P25641 Saccharomyces cerevisiae
FT                   YCR068w CVT17"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60807"
FT                   /db_xref="GOA:Q6FPI6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI6"
FT                   /inference="similar to AA sequence:UniProtKB:P25641"
FT                   /protein_id="CAG60807.1"
FT                   /translation="MLGRQVTMLLKVIVAVAVLFVWHRSRDSSRGDGSNGDGLSDSSGN
FT                   GFRLEHIWAYDPEDVVSSCVDVSEEMRVSADEYVSMESGSEFVESWWAKTGARPFSHVF
FT                   DLRSRSMDIQRLQDRDPVSMEKYIDFSLENPELARTIELEWETAKIQVPDVRNRNTVLA
FT                   LALMSSNAYVRTPYTGDWRNLSSSWGHTGEEKFGWDKDGLRGHIFVNKITKVVVIAIKG
FT                   TSSQGLFGSGEEDTITNDKINDNLLFSCCCARISYLWTTVCDCYMKSYTCDENCVEAEL
FT                   KRKDRYYAATLKLYKQVTEMYPDSAIWLTGHSLGGALAALLGRTYGVPAVTFEAPGELL
FT                   PAKRLHLPLPPGLPDYEEAIWHFGHNADPIFMGTCNGASSSCSIGGYAMETACHSGQYC
FT                   MYDVVNDKGWRVNLLNHRIHRVIDEVILEYGRPAKCQRAPTCIDCYNWKFVNKRRNRRE
FT                   ESSSSIASSSQLTSSHSESETLTSTDAPEKTCIGRNWLGICTDYGV"
FT   gene            <340647..>343736
FT                   /locus_tag="CAGL0J03564g"
FT                   /old_locus_tag="CAGL-IPF6895"
FT                   /old_locus_tag="CAGL-CDS0404.1"
FT   CDS_pept        340647..343736
FT                   /locus_tag="CAGL0J03564g"
FT                   /old_locus_tag="CAGL-IPF6895"
FT                   /old_locus_tag="CAGL-CDS0404.1"
FT                   /note="similar to uniprot|P25365 Saccharomyces cerevisiae
FT                   YCR067c SED4 or uniprot|P11655 Saccharomyces cerevisiae
FT                   YNR026c SEC12"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60808"
FT                   /db_xref="GOA:Q6FPI5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI5"
FT                   /inference="similar to AA sequence:UniProtKB:P25365"
FT                   /protein_id="CAG60808.1"
FT                   /translation="MVFDSEYDLGYPVYGAQFLSDGMLLVAGGGGVGVMIPNKLTALRV
FT                   NFEKKKVLKRYREITLDSQDDSPSNLGVAQNMILMGCNEGYDKISSTGENHHIRKFVFE
FT                   NDHLKFIGAIDFDGSTDPEVYTKLICMSKDGTIAAIASSKLPTVIRIIDPIDLTEKYEI
FT                   ETGRDVRDIHFSPDGKLLVYITATSLEVVSVVTGRFLFRKTDFNKATDLARVKFINDDD
FT                   FVLASGFKDKAGIALTTFRIRNTNPTILSSKKVFKDYKKITAMDVDPKGQLIALTTDDN
FT                   SLALLSVKKLNVIKLFKQVHKDTITRVTVSPGGQYVATGSTDKTVHIFKISPDAMGGSN
FT                   LWKSLLRFLFNVMKLAVVVIWAHLFYKYDLHHKLYDVTKVQLEKRSIEFPSFLDGILGT
FT                   TTTRSTIIEGDIVSVVTDTAPALTSSVFSEDNKEYAKVEETTPSNSWSSVSESYWPSEV
FT                   SNDIESVQENFDDIENKILENEDVVMKNDAIETEDESVGFDIDDTIKPIAPIDIDLELD
FT                   DPLASTSVDTSEVLSSQVPVQLETLSGQSEIIDDKPEHLDEEVSEGFLGDHSKANLETE
FT                   IENASTSISIEESTNSHSTFIESSSSLEEGRNTTSESSREISSETSIIKEDMLYPTENV
FT                   SEQSATDKVNKNQSIDKIDVSSSSSIPTSSEGSSNSIVGDEAQMHISSLSSIETELSSS
FT                   SIMINEESTIRNADSVVDENHSESKLPTEAKTSIVGSIDNENIDSTELNNLEEAVKTSS
FT                   NESSLSQVTEELVKNNERVSNQSLSTVSTEHTEMKESSNLTEKKPESNSPESNLSESSL
FT                   QTHDFSQISDTERNIVSSSAFVTDLPSEEASVNPGNTEGTIVNASLVDSQSSNSSVKTV
FT                   ETNVSQDEQTSQNETLSVGAATIDVIQGSYTSVSDSLDGMNNEEVGNKVHIEDVSNTLE
FT                   IDSSASALSEQGDNQFSDSTPEVVNVINEFTTTPENETSSPLASSSTTFMTESPSPIAV
FT                   ANEVIENIQQDEQVAQQMEDTNSGSSNFQDTQHNVINDEL"
FT   gene            complement(<343893..>345128)
FT                   /locus_tag="CAGL0J03586g"
FT                   /old_locus_tag="CAGL-IPF6894"
FT                   /old_locus_tag="CAGL-CDS2693.1"
FT   CDS_pept        complement(343893..345128)
FT                   /locus_tag="CAGL0J03586g"
FT                   /old_locus_tag="CAGL-IPF6894"
FT                   /old_locus_tag="CAGL-CDS2693.1"
FT                   /note="similar to uniprot|P10862 Saccharomyces cerevisiae
FT                   YCR066w RAD18 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60809"
FT                   /db_xref="GOA:Q6FPI4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI4"
FT                   /inference="similar to AA sequence:UniProtKB:P10862"
FT                   /protein_id="CAG60809.1"
FT                   /translation="MDVLTSAADFKKSKVPQLQELDDLLRCHICKDFLKNPVLTPCGHT
FT                   FCSLCIRGYLSNEPKCPLCLHELRESMLRSEYLVNEITETYKAARQRLLDELNSLETNQ
FT                   DNSVIEVVSDKEPSLLQIDDDVNENSNHITVNDTSDIIDEDNEIQITGTKRTARTILNG
FT                   SRPTKAAKISDMFTTRKAKTEEKAPCPICSQLFPIRYLERTHLDECLTKPPTSSPPIKQ
FT                   SRLSPKPSESVSHVKRYLNSTNTSTQQRLPKLNFAKMTTSQLKQKLASLSLPVSGTRAN
FT                   MVARYNYYEMLWNSNFIDSINPVSESELRRQLMSWDASHNGNNNSSNGGTNTISQLMKM
FT                   NSKNKGKEYEKLLKDFKKDSFDKKGWMLLHKNSFNRLLCDAKKTRRKTENETLMTSQSP
FT                   RESSTQTELSAT"
FT   gene            complement(<345752..>347398)
FT                   /locus_tag="CAGL0J03608g"
FT                   /old_locus_tag="CAGL-IPF6893"
FT                   /old_locus_tag="CAGL-CDS1782.1"
FT   CDS_pept        complement(345752..347398)
FT                   /locus_tag="CAGL0J03608g"
FT                   /old_locus_tag="CAGL-IPF6893"
FT                   /old_locus_tag="CAGL-CDS1782.1"
FT                   /note="similar to uniprot|P25364 Saccharomyces cerevisiae
FT                   YCR065w HCM1 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60810"
FT                   /db_xref="GOA:Q6FPI3"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI3"
FT                   /inference="similar to AA sequence:UniProtKB:P25364"
FT                   /protein_id="CAG60810.1"
FT                   /translation="MEPEFISMYNLHSTSPANIFIDTSNMKKRAMDEALITPPKSTPAK
FT                   SRLVKNPPMGDSSDSRPLSPARSSPITTTKAKRQKTVGSARSNGTLTLEELFESLAKRK
FT                   ESGDKNSKPQYSYAVLICLAILQSPEGKLTLSQIYCWISVHFPYYRPKDASWQNSIRHN
FT                   LSLNSAFTKTEKSSDGKGHFWQVKVGSESKFFKGDYGDYENLRKQVQTIEKYFDIDPAM
FT                   LEEFDNEKPTYLNRESTNEKKNTSNAQTSASESSSISSTPNADSSFTDLNSTFSIKVSP
FT                   PEDKPKDGSISQGKEEVFNFGMVIRQNDHNLLDSPYPMKKTELPEIATPLSKSKTERLP
FT                   TIGDIQDPITTLNPLNSPPNMRRYMCSFNSSFDTDSPSHARHEPSTLLGPVPMSSSPTT
FT                   LPQITTPYVNRYSEDTTHLKLPPIQVNVLKTPEVNSITNVKTPARFTETPKDSNSILRK
FT                   LQTPSHLFEDTYLSPMFRAMGTPLKFSATPCDTKHNNLSPRSQQIPGFHKATKFPSSGL
FT                   FGVDIFSVLKRAGSTSSNAQDKKDESNDGSK"
FT   gene            complement(<348518..>348964)
FT                   /locus_tag="CAGL0J03630g"
FT                   /old_locus_tag="CAGL-IPF6892"
FT                   /old_locus_tag="CAGL-CDS4856.1"
FT   CDS_pept        complement(348518..348964)
FT                   /locus_tag="CAGL0J03630g"
FT                   /old_locus_tag="CAGL-IPF6892"
FT                   /old_locus_tag="CAGL-CDS4856.1"
FT                   /note="similar to uniprot|P25337 Saccharomyces cerevisiae
FT                   YCR063w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60811"
FT                   /db_xref="GOA:Q6FPI2"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI2"
FT                   /inference="similar to AA sequence:UniProtKB:P25337"
FT                   /protein_id="CAG60811.1"
FT                   /translation="MKVKGYERVEPVLAEFERRLKEIGKDKSKSLGKGQGKEDLWRIVQ
FT                   IHSERSRYVYTMYYKRRAISRELYEWLLKKKVADRRLIAKWRKRGYEKLCCLQCVQQSE
FT                   TNHGSTCICRVPRLQLEAEAEKKGVPVSFKECVNCGCHGCASTD"
FT   gene            <349217..>352498
FT                   /locus_tag="CAGL0J03652g"
FT                   /old_locus_tag="CAGL-IPF6890"
FT                   /old_locus_tag="CAGL-CDS0335.1"
FT   CDS_pept        349217..352498
FT                   /locus_tag="CAGL0J03652g"
FT                   /old_locus_tag="CAGL-IPF6890"
FT                   /old_locus_tag="CAGL-CDS0335.1"
FT                   /note="highly similar to uniprot|P26637 Saccharomyces
FT                   cerevisiae YPL160w CDC60 leucine-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60812"
FT                   /db_xref="GOA:Q6FPI1"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI1"
FT                   /protein_id="CAG60812.1"
FT                   /translation="MSDEKKGLVLENTGRRDALIAIEKKYQQVWAEEHQFELDAPSIDD
FT                   EPITMSTEELHKKYPKFMSSMAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPL
FT                   GFHCTGMPILACADKLKREAEMFGTDFSKAPAEDEEEPQVEEKKAESEDVTKFKAKKSK
FT                   AAAKKGRGKYQFEIMLQLGIPRDEVYKFADASYWLTYFPPLCQRDCSSLGSRIDWRRSY
FT                   ITTDENPYYDAFIRWQMNKLKALGKIKFGERYTIYSVKDGQPCMDHDRQSGEGVTPQEY
FT                   VGIKIEATEFAPEAKKLIDENDKIDKSKKIYFVAATLRPETMYGQTCCFVSPKIDYGIF
FT                   DAGDSYYITTERAFKNMSYQKLTPVRGEYSPVAVINGKAFIGTKIHAPLTPYKELRILP
FT                   METVIATKGTGVVTCVPTNSPDDYMTVKDLIKKSEYYGIDPTWIDMELIPVIKTDKYGD
FT                   LTAKALCEELKIQSPNDTTKLAEAKKIAYKEDYYSGVMIYGDYKGEKVEIAKAKVKADM
FT                   IAKGEAFVYNEPEGLVMSRSGDECIVSLEDQWYLDYGEEEWRKQAEECLSQMEVFAPEV
FT                   NHAFKGVLGWLRNWAVSRTYGLGTKLPWDDKYLVESLSDSTIYQAFYTVAHLLFKDYYG
FT                   KEIGPLNIKPEQMTDDVFDYIFQHVDDVKSDIPLRSLQILRREFEYFYPLDVSISGKDL
FT                   IPNHLTFFIYTHVALFPKKFWPKGIRANGHLMLNNAKMSKSTGNFMTLEQIVEKFGADA
FT                   SRIALADAGDTVEDANLDESNANAAILRLFNLKEWSEEIVKDIDTLRSGEITEIFDVAF
FT                   EHEMNSLIEETYKQYELTNYKNALKTGLFDFQTARDYYREATGTMHKDLVLRYIETQAL
FT                   MLAPIAPHFAEYVYRDVLGKKGSVQTANFPRASKPIDRSILAGLEYVRALQRSIREAEG
FT                   QALKKKKGKGAEVDQSKPVKLTLLVSKTFPEWQAGCIEIVREMFANQTLNDNKMIKEKV
FT                   NPKEMKRAMPFISLLKQRLATESPEAVFNRELQFNETETIKATIDNIKKAAQQLKVEEI
FT                   EVLAFPHGSNVATNIFTGQEVELPSAPKAIESALPGNPSILFNNI"
FT   gene            <352904..>354208
FT                   /locus_tag="CAGL0J03674g"
FT                   /old_locus_tag="CAGL-IPF6888"
FT                   /old_locus_tag="CAGL-CDS2522.1"
FT   CDS_pept        352904..354208
FT                   /locus_tag="CAGL0J03674g"
FT                   /old_locus_tag="CAGL-IPF6888"
FT                   /old_locus_tag="CAGL-CDS2522.1"
FT                   /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
FT                   YOR245c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60813"
FT                   /db_xref="GOA:Q6FPI0"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI0"
FT                   /inference="similar to AA sequence:UniProtKB:Q08650"
FT                   /protein_id="CAG60813.1"
FT                   /translation="MFGNAFHLRNRIHKRSSSSDRLDQDESSDDGDNAPNIVEQKTKDI
FT                   KLVKPLKRPRLSNCCSPTTPMANRLQTMAVAWHISSFVLFSIFSLLIISNPFTWIVVIP
FT                   YLIYFFNDRSPANGDVVYRYSPWVRSLKIWKYYCDYFPIELVKTVDLEPTFTPCNEEEE
FT                   KENKKLQEYYTLRLWPSDYEIRLFKKNTVYSHGYKRTGPKYIFGYHPHGIGALGSFGAF
FT                   ATEGRGWSNKFPGIPVSLLTLVTQFHIPFYRDYLLSVGISSVSRKNALKVLDNNQSICI
FT                   VVGGARESLISIPGTSGLILNKRKGFIKLAIQAGNVSLVPVYTFGENDCYNILATDETS
FT                   IIRKLQLWVKENFGFTIPIFYARGLFNYDFGLLPFRAPLHVVVGRPIHVKEQQENPEQS
FT                   LVDHYHELYVEELKRIYLENRDRYGYGAADFEILG"
FT   gene            complement(<354372..>355712)
FT                   /locus_tag="CAGL0J03696g"
FT                   /old_locus_tag="CAGL-IPF6886"
FT                   /old_locus_tag="CAGL-CDS2434.1"
FT   CDS_pept        complement(354372..355712)
FT                   /locus_tag="CAGL0J03696g"
FT                   /old_locus_tag="CAGL-IPF6886"
FT                   /old_locus_tag="CAGL-CDS2434.1"
FT                   /note="highly similar to uniprot|Q08649 Saccharomyces
FT                   cerevisiae YOR244w ESA1 histone acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60814"
FT                   /db_xref="GOA:Q6FPH9"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPH9"
FT                   /protein_id="CAG60814.1"
FT                   /translation="MAGAEVEEEAGIPKKIESTEEVLIKCQCWVRKDEEERLAEILSIN
FT                   ARVSPSKFYVHYVNFNKRLDEWVTGDRINLDKEVIFPRPKRQLEEDTNKKQKKKKKFPQ
FT                   KAAVVESDAKSSEMGEGSDVMDLDNLNVRGLKDEEISREDEIKKLRTSGSMIQNPHEVA
FT                   HVRNLSKIIMGKFEIEPWYFSPYPIELTDLDVVYIDDFTLQYFGSRKQYERYRKKCTLR
FT                   HPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRD
FT                   EMGHHFVGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKVGSPEK
FT                   PLSDLGLLSYRAYWSDVLITLLVEHGKEVTIDEISSMTSMTTTDILHTLKTLNILRYYK
FT                   GQHIIFLNDDILERYNQLKTKKRRHIDAEKLLWKPPVFTASQLRFAW"
FT   gene            <356163..>358181
FT                   /locus_tag="CAGL0J03718g"
FT                   /old_locus_tag="CAGL-IPF6885"
FT                   /old_locus_tag="CAGL-CDS1190.1"
FT   CDS_pept        356163..358181
FT                   /locus_tag="CAGL0J03718g"
FT                   /old_locus_tag="CAGL-IPF6885"
FT                   /old_locus_tag="CAGL-CDS1190.1"
FT                   /note="similar to uniprot|Q08647 Saccharomyces cerevisiae
FT                   YOR243c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60815"
FT                   /db_xref="GOA:Q6FPH8"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH8"
FT                   /inference="similar to AA sequence:UniProtKB:Q08647"
FT                   /protein_id="CAG60815.1"
FT                   /translation="MTAEKRSAEVADDEVLKRVKLEVTGDIKERDAGITLYLSDLPGFT
FT                   GQIKQRYTDFLVNEITMEGEVVHLVDKGFKVPKRNAEPKMSDEERKAQKQAEYAKREAF
FT                   EVEEELKASLIDIFGEEDFNKIVDVYKNAQKMESQKSFDDKATRTKIHQLIRQAFNNEL
FT                   ESVTTAENTFKIARNNRNSRVNKQTLVESTKDENGVENYGYGPAKEFIHFTLHKENKDT
FT                   MEAVNVLTKLMRVPNKLVRYAGTKDRRAVTCQRLSISGVNLERLNALNRTLKGMIIGGY
FT                   KYSDVSMNLGELNGNEFHIVIRDAKVDPACGKSLKEVLEAGSKSLVDNGFVNYYGLQRF
FT                   GTFSISTHTIGKELLLGNWRAAIEMILSDQENILPASKEARQLWAQNRDPYEAMKKMPK
FT                   QCIAENAILHTLSNHRKEESGDFGTGAYHDAIMKIPRNLRTMYVHAYQSYVWNKVASKR
FT                   IELFGTDIRVGDLVIIEKDEDKQTDKADGSTSDDDFDEDLRSADFIRAKALTEEEVKSG
FT                   KYTIEDVVLPTPGFDILYPSSDELKQLYVDIMGADGMDPFDMRRKVRDFSLAGSYRNII
FT                   QKPKNFEYKIIQYEDPVQQIVNTDLEILNNQRAKENHQKYMKAKLERYVPDKPGSRTAV
FT                   VLKFQLGTSAYATMALRELMKLETSRRGDMCAVTSST"
FT   gene            <358554..>359663
FT                   /locus_tag="CAGL0J03740g"
FT                   /old_locus_tag="CAGL-IPF6883"
FT                   /old_locus_tag="CAGL-CDS2994.1"
FT   CDS_pept        358554..359663
FT                   /locus_tag="CAGL0J03740g"
FT                   /old_locus_tag="CAGL-IPF6883"
FT                   /old_locus_tag="CAGL-CDS2994.1"
FT                   /note="weakly similar to uniprot|Q08646 Saccharomyces
FT                   cerevisiae YOR242c SSP2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60816"
FT                   /db_xref="GOA:Q6FPH7"
FT                   /db_xref="InterPro:IPR034250"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH7"
FT                   /protein_id="CAG60816.1"
FT                   /translation="MDLSNHWARNFSGKLHNIHNGPTLSSIFGLDANYKQDVNISNVHV
FT                   AEVKPFSIRRLAKTLILGSPIESVALNKDNTGKIKKRGAIVLSSYGSCADLKRPKINSA
FT                   DKICRSRTDDNLQKALLGLIQDMSSEDAIELCRNVSLFQKCNKFGNSSILSLGSDTKDI
FT                   TDIVFDNIPANIGLESIVYQLQGGPIAKIQAVPHESNVDQLKKLHVKFTTSKAASDFMK
FT                   LGTRNMFKVNGVYLRPKWVQFCETKTDKWYQDLIKQNTSKNVCRCIILKRYPTKNNMRY
FT                   IQSTKQPPLENIDVNAIRRDFENYGNILDITPVISRKLCISIVYYDIFSAMKAMMSYED
FT                   NTSFLHENYYGKWAIWYGKDISDRPVIPV"
FT   gene            complement(<359858..>361342)
FT                   /locus_tag="CAGL0J03762g"
FT                   /old_locus_tag="CAGL-IPF6882"
FT                   /old_locus_tag="CAGL-CDS2104.1"
FT   CDS_pept        complement(359858..361342)
FT                   /locus_tag="CAGL0J03762g"
FT                   /old_locus_tag="CAGL-IPF6882"
FT                   /old_locus_tag="CAGL-CDS2104.1"
FT                   /note="highly similar to uniprot|Q08645 Saccharomyces
FT                   cerevisiae YOR241w MET7 tetrahydrofolylpolyglutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60817"
FT                   /db_xref="GOA:Q6FPH6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR023600"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH6"
FT                   /protein_id="CAG60817.1"
FT                   /translation="MLITPTLRMASKRTYQDALTALNSLQSNYANIMAVRQSGDRKNRM
FT                   SILEMYEWSRRLGYKVSDFNKLNIVHITGTKGKGSTAAFTSSILQQYQDKLTKIGLYTS
FT                   PHLRSVRERIRINGEPISESKFTEYFFQVWDKLDKTTSPLNEFPHMVPGSKPGYFKFLT
FT                   LLSFHAFMKEECSCCVYEVGVGGELDSTNIIEKPVTCGVSLLGIDHTFMLGDTIEEIAW
FT                   NKGGIFKKDAPAYTIMGQEPAGLKVLQERAKERETSLTEVPTFKQLDNIKLGIAGDFQK
FT                   TNASLAVVLASQALNSLSIIKEDTPINSDSILPEKFITGLKKTIWEGRCQYIKTGKINW
FT                   YIDGAHTKESIEAASRWFAQEVASNNNKKILLFNQQTRDAALLLKVLHSVTNNRLNFSE
FT                   ALFTTNVTWKTGSYNADLVSINVSQEQVDKLEVQKELASVWKDLSSETKSNICANIESA
FT                   INIIEDYDIDEVDVFVTGSLHLVGGFLVVLDKYNNQ"
FT   gene            complement(<361909..>363517)
FT                   /locus_tag="CAGL0J03780g"
FT                   /old_locus_tag="CAGL-IPF6879"
FT                   /old_locus_tag="CAGL-CDS4443.1"
FT   CDS_pept        complement(join(361909..362911,362913..363517))
FT                   /locus_tag="CAGL0J03780g"
FT                   /old_locus_tag="CAGL-IPF6879"
FT                   /old_locus_tag="CAGL-CDS4443.1"
FT                   /note="similar to uniprot|Q08641 Saccharomyces cerevisiae
FT                   YOR240w ABP140"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60818"
FT                   /db_xref="GOA:Q6FPH5"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR026113"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH5"
FT                   /inference="similar to AA sequence:UniProtKB:Q08641"
FT                   /protein_id="CAG60818.1"
FT                   /translation="MGVADLIKKFEQISQESPKTEVKKPTPAVAEPSDATEATEATEAT
FT                   EATEALTDESAEPAEPTPVEASEETPVETTTEETPAEAAQEAEATTEETPAETAQEAEA
FT                   NTEETPAETAENTPATDSETAPEETPAQEAESEKTEDDQEASAEGDNTQENSEQSSKSK
FT                   KNKKKKNKKKAKKAAAKAATEGENGSNEEETPSDSLRPCQSENKEEIKAITQDLHEETF
FT                   EGIAHESAPNEVEGTSRLGRDNPFEFGKRNLTEDSDVWNHNAWDNVEWGEEQIQQAEEK
FT                   IKLQYDCPVSEFDKELYNSNPSRYWDIFYKNNKENFFKDRKWLQIEFPILYQSTKKDAG
FT                   PVTIFEIGCGAGNTFFPILNENENENLRIIAADFAPRAVELVKESENFNPKYGHATVWD
FT                   LANPDGQLPDGVEPHSVDIAVMIFVFSALSPSQWDHAMDNLHNILKPGGKILFRDYGRY
FT                   DQVQVRFKKNRLLDDNFYVRGDGTRVYFFTEEELRDIFTKKYFKENKIGTDRRLLVNRK
FT                   RQLKMYRCWLQAVFDVPN"
FT   gene            <363777..>365039
FT                   /locus_tag="CAGL0J03806g"
FT                   /old_locus_tag="CAGL-IPF6878"
FT                   /old_locus_tag="CAGL-CDS2638.1"
FT   CDS_pept        363777..365039
FT                   /locus_tag="CAGL0J03806g"
FT                   /old_locus_tag="CAGL-IPF6878"
FT                   /old_locus_tag="CAGL-CDS2638.1"
FT                   /note="similar to uniprot|Q12363 Saccharomyces cerevisiae
FT                   YOR230w WTM1 or uniprot|Q12206 Saccharomyces cerevisiae
FT                   YOR229w WTM2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60819"
FT                   /db_xref="GOA:Q6FPH4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH4"
FT                   /inference="similar to AA sequence:UniProtKB:Q12363"
FT                   /protein_id="CAG60819.1"
FT                   /translation="MTWNKTATYEHISSIKPRFISRAFAAENQLKSLAFSNELVPDTDA
FT                   HELKTKLLYSQGSEIYELECAYPLITEDKEPVSDYGDAFKAMENVPLQPKWVYQGETVA
FT                   KMEFLGEEEDTNVIAMSKNGSLAWFTEGVKVPVHIVQEMMGPSTKFSSIHSLTRPDNLA
FT                   VADFSLSLDQETIVKSQSNGDEEDSILKLIDNAGKPSEVLRVIRVPGTTVTHSVRFLDN
FT                   HVFASCSDDNVIRFWDTRTADKPLWSLSDPQNGSLTAFDVSQLSGNLFATGFSTGVVKL
FT                   WDARAVEDATLDLSNRQNGEEPIQKEIANWYHRGGDSVVDLKFSSTSPTEFLTVGGSGN
FT                   VYHWDADYALSNYDPENHAPQEASEQLQNESLTFLHTGGSRRSTTAYGLRNTVAWHPVI
FT                   EGLVAHVDPDTLITTYLPYNN"
FT   gene            <365325..>366728
FT                   /locus_tag="CAGL0J03828g"
FT                   /old_locus_tag="CAGL-IPF6875"
FT                   /old_locus_tag="CAGL-CDS2273.1"
FT   CDS_pept        365325..366728
FT                   /locus_tag="CAGL0J03828g"
FT                   /old_locus_tag="CAGL-IPF6875"
FT                   /old_locus_tag="CAGL-CDS2273.1"
FT                   /note="similar to uniprot|P32490 Saccharomyces cerevisiae
FT                   YOR231w MKK1 ser/thr protein kinase or uniprot|P32491
FT                   Saccharomyces cerevisiae YPL140c MKK2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60820"
FT                   /db_xref="GOA:Q6FPH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH3"
FT                   /inference="similar to AA sequence:UniProtKB:P32490"
FT                   /protein_id="CAG60820.1"
FT                   /translation="MASLFRPPESTRQNARSPRLKLPPLSNVSLAVPGESPTGKLSATS
FT                   SRGSSATSANMKRPMPPPLPKLDVPLSAASSTEGLVRKMKQLSVEDESPQSGSSRGVER
FT                   DDTTAVNQSVDSFFSNLISVYDQSSSAITSPKIDEPEDSAVKDALATRVPRSLTQGKDI
FT                   DELSEEVWHSKNLLAEIETQGVLGEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQK
FT                   QLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRIS
FT                   EKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNSLATT
FT                   FTGTSYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPFGPDKMATTIAPIELLTLI
FT                   LTFTPHLDDEPDKNIKWSRAFKSFIEYCLRKEARARPSPRQMIQHPWIQGQMKKQVDMR
FT                   KFITKCWQK"
FT   gene            <367053..>367748
FT                   /locus_tag="CAGL0J03850g"
FT                   /old_locus_tag="CAGL-IPF6872"
FT                   /old_locus_tag="CAGL-CDS4154.1"
FT   CDS_pept        367053..367748
FT                   /locus_tag="CAGL0J03850g"
FT                   /old_locus_tag="CAGL-IPF6872"
FT                   /old_locus_tag="CAGL-CDS4154.1"
FT                   /note="highly similar to uniprot|P38523 Saccharomyces
FT                   cerevisiae YOR232w MGE1 heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60821"
FT                   /db_xref="GOA:Q6FPH2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPH2"
FT                   /protein_id="CAG60821.1"
FT                   /translation="MRAFSNVSRISRVSRVSRVALAAPARTVPLMNRNAMSMMRFYSED
FT                   AKASEKAGEKAEEKAEEQNLSAEEQKLKDLQEQLDKKTKEAAELKDRLLRSVADFRNLQ
FT                   EVTKKDVEKAKSYALQKFAKDLLESVDNFGHALGAFKEEDLEKSKEISDLYTGVKMTRD
FT                   VFEKTLKKYGIEKLDPLGERFDPNKHEATFELAQPDKEPGTVFHVQQLGYTLNERVIRP
FT                   AKVGVVKED"
FT   gene            <368472..>370457
FT                   /locus_tag="CAGL0J03872g"
FT                   /old_locus_tag="CAGL-IPF6871"
FT                   /old_locus_tag="CAGL-CDS1224.1"
FT   CDS_pept        368472..370457
FT                   /locus_tag="CAGL0J03872g"
FT                   /old_locus_tag="CAGL-IPF6871"
FT                   /old_locus_tag="CAGL-CDS1224.1"
FT                   /note="similar to uniprot|Q01919 Saccharomyces cerevisiae
FT                   YOR233w KIN4 ser/thr protein kinase or and similar to
FT                   uniprot|Q03002 Saccharomyces cerevisiae YPL141c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60822"
FT                   /db_xref="GOA:Q6FPH1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH1"
FT                   /inference="similar to AA sequence:UniProtKB:Q01919"
FT                   /protein_id="CAG60822.1"
FT                   /translation="MATIPKRHTYGGGPEVHYTRNPYSAAPRNSMSSRGKKHVTFGPYI
FT                   VGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREI
FT                   NALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLI
FT                   SGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAP
FT                   ELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKF
FT                   PEYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKLIKNSANV
FT                   QLDHTKRVSRTSQHFETEQENSSVNQPVRSDMVNKAMDTSNTTDDAQHSIPNRQPLANV
FT                   FINSRTYSARSASYAPRHSMSDDPNAIESARHAVQNKHESNLATVMGSPNKDKDDTTED
FT                   NNLETVARTSSHHRKPRPTSYYPVDINRSANNFSPIVLNLTNSDENDNSKHPYSTSTSN
FT                   NPVAPTPQRDQSQVVTDEHGLQLEKNRVREQPLTSDKSRMSSLRSNATAKSSDSKKNKR
FT                   FSLLSFYTNNGSKTSLHNDSKVSVTPSSKEESATVPPSIPSVVHHTDTTENKRNHRASM
FT                   MGPSAGGDKSTARRVIDFFKRRSMRM"
FT   gene            <370868..>371465
FT                   /gene="SNR17"
FT                   /locus_tag="CAGL0J03883r"
FT   ncRNA           370868..371465
FT                   /gene="SNR17"
FT                   /locus_tag="CAGL0J03883r"
FT                   /old_locus_tag="CAGL0J08913r"
FT                   /product="U3 RNA"
FT                   /note="C/D snoRNA SNR17 (U3 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            <371724..>372377
FT                   /locus_tag="CAGL0J03894g"
FT                   /old_locus_tag="CAGL-IPF6867"
FT                   /old_locus_tag="CAGL-CDS4283.1"
FT   CDS_pept        371724..372377
FT                   /locus_tag="CAGL0J03894g"
FT                   /old_locus_tag="CAGL-IPF6867"
FT                   /old_locus_tag="CAGL-CDS4283.1"
FT                   /note="similar to uniprot|P07807 Saccharomyces cerevisiae
FT                   YOR236w DFR1 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60823"
FT                   /db_xref="GOA:Q6FPH0"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="PDB:3CSE"
FT                   /db_xref="PDB:3EEJ"
FT                   /db_xref="PDB:3EEK"
FT                   /db_xref="PDB:3EEL"
FT                   /db_xref="PDB:3EEM"
FT                   /db_xref="PDB:3QLX"
FT                   /db_xref="PDB:3QLY"
FT                   /db_xref="PDB:3QLZ"
FT                   /db_xref="PDB:3RO9"
FT                   /db_xref="PDB:3ROA"
FT                   /db_xref="PDB:4H98"
FT                   /db_xref="PDB:4HOG"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH0"
FT                   /inference="similar to AA sequence:UniProtKB:P07807"
FT                   /protein_id="CAG60823.1"
FT                   /translation="MSKVPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTND
FT                   NSKQNVVIMGRKTWESIPQKFRPLPKRINVVVSRSFDGELRKVEDGIYHSNSLRNCLTA
FT                   LQSSLANENKIERIYIIGGGEIYRQSMDLADHWLITKIMPLPETTIPQMDTFLQKQELE
FT                   QRFYDNSDKLVDFLPSSIQLEGRLTSQEWNGELVKGLPVQEKGYQFYFTLYTKK"
FT   gene            <373116..>374417
FT                   /locus_tag="CAGL0J03916g"
FT                   /old_locus_tag="CAGL-IPF6864"
FT                   /old_locus_tag="CAGL-CDS2530.1"
FT   CDS_pept        373116..374417
FT                   /locus_tag="CAGL0J03916g"
FT                   /old_locus_tag="CAGL-IPF6864"
FT                   /old_locus_tag="CAGL-CDS2530.1"
FT                   /note="similar to uniprot|P35844 Saccharomyces cerevisiae
FT                   YPL145c KES1 or uniprot|P35843 Saccharomyces cerevisiae
FT                   YOR237w HES1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60824"
FT                   /db_xref="GOA:Q6FPG9"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG9"
FT                   /inference="similar to AA sequence:UniProtKB:P35844"
FT                   /protein_id="CAG60824.1"
FT                   /translation="MTQDRASSSTWTTFLKSLASFNGDLSALSAPPFILSPVSLVEFCQ
FT                   YWAEHPDLFLEPSFINETNYKERMGQCDPDIDSPEAARMLAVIKWFLSTLRSQYSSRSE
FT                   KSGSEKKPLNPFLGELFVGKWESKTYPHFGETILLSEQVSHHPPMSAYSIYNEKNNVKI
FT                   EGYNNIKSSISKTLTLNVKQYGHNLLTIGDKETYLVIPPPLHIEGILMASPFVELEGKS
FT                   YIQSTTGMCCQFEYSGRGYFSGQKNSFKAKVYKSGADLKNNGTPLYVISGQWSGSSKIV
FT                   KNLPNGKQSAPVLFHDTNITATESLQVKTIDKQHPLESRRAWKDVADAIRLGDYGLINK
FT                   TKSALENKQREMRKEEAANGTTWKRRWFNEVDYSQNMKDKDLFLTLANELGLSIKNVPS
FT                   GTLVNDREDQKANSSAKHWRFDHSKWVADDEITV"
FT   gene            <374722..>375609
FT                   /locus_tag="CAGL0J03938g"
FT                   /old_locus_tag="CAGL-IPF6863"
FT                   /old_locus_tag="CAGL-CDS3647.1"
FT   CDS_pept        374722..375609
FT                   /locus_tag="CAGL0J03938g"
FT                   /old_locus_tag="CAGL-IPF6863"
FT                   /old_locus_tag="CAGL-CDS3647.1"
FT                   /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
FT                   YOR238w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60825"
FT                   /db_xref="GOA:Q6FPG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG8"
FT                   /inference="similar to AA sequence:UniProtKB:Q08634"
FT                   /protein_id="CAG60825.1"
FT                   /translation="MSSLRKDHAIMVPCHSIWNYFTSCSDYIHLGQDPEQWFLAPFQYE
FT                   GRDHLSFIKHGLAGLDTLLSDFANSTLIFSGSQTKAEAGPVSEAQSYQLLMYRIIKQSI
FT                   DDINVVNGIFGNIDSEILKLIQSIISKMRDQEITLDQLFESHRITLEEYALDSFDNLLY
FT                   SLGQFQAVNGNYPKKMTIVGFGFKQSRYLDLHAKAIDFKNINYISIEPSPTGYNSEQLE
FT                   VYFSTLSAMEKKNAAALFQNDYYGRRSPLLDKKQSRNPFNKQPKYEILNILKGLENYSD
FT                   EEFLQKHIVGHTPW"
FT   gene            complement(<375780..>377087)
FT                   /locus_tag="CAGL0J03960g"
FT                   /old_locus_tag="CAGL-IPF6862"
FT                   /old_locus_tag="CAGL-CDS2515.1"
FT   CDS_pept        complement(375780..377087)
FT                   /locus_tag="CAGL0J03960g"
FT                   /old_locus_tag="CAGL-IPF6862"
FT                   /old_locus_tag="CAGL-CDS2515.1"
FT                   /note="similar to uniprot|Q12206 Saccharomyces cerevisiae
FT                   YOR229w WTM2 or uniprot|Q12363 Saccharomyces cerevisiae
FT                   YOR230w WTM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60826"
FT                   /db_xref="GOA:Q6FPG7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG7"
FT                   /inference="similar to AA sequence:UniProtKB:Q12206"
FT                   /protein_id="CAG60826.1"
FT                   /translation="MLHNRRPNLYQHISEFTPKFVNKLSAGHADRTLAWRHDVIPDKSN
FT                   KNFSTTLIYSQGSDIYEFKGVFPLDILPYTPVEEQASDESAKVEEGKYGIVQDADVVNS
FT                   AKWVYQGETVAKMTYLDDLNDNALIAMSKNGSLAWFKDDCKVPVHIVQEMMGPSTSFAS
FT                   MHSGQKPAELAVSDFSLSMDSETIVKSQSNGYEEESILKIIDNSGKPGEILRTMKVPGT
FT                   VVTHTVRFFDNHLFASCSDDNVIRFWDTRTDDKPIWILSEPQNGRLTTFDVSPITENLF
FT                   ATGFSTGLIKLWDARATYEATQDLSYRQNGEDPIQVEMAKVFHSGGDSVVDIKFSETSS
FT                   SEFVTVGGSGNIYHWDMEYLFSRNDDDNEDYLPSLEPEELQSHCLKFCQPSRVKSGSRN
FT                   TVALHPMVHDLSATISSKNSITVYKPFDGTEFSKND"
FT   gene            <377534..>377881
FT                   /locus_tag="CAGL0J03982g"
FT                   /old_locus_tag="CAGL-IPF10370"
FT                   /old_locus_tag="CAGL-CDS5234.1"
FT   CDS_pept        377534..377881
FT                   /locus_tag="CAGL0J03982g"
FT                   /old_locus_tag="CAGL-IPF10370"
FT                   /old_locus_tag="CAGL-CDS5234.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60827"
FT                   /db_xref="GOA:Q6FPG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG6"
FT                   /protein_id="CAG60827.1"
FT                   /translation="MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRNT
FT                   STFEGYSIQRLPEGIIAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFG
FT                   ITCLSFDTRLP"
FT   gene            <378245..>379111
FT                   /locus_tag="CAGL0J04004g"
FT                   /old_locus_tag="CAGL-IPF6860"
FT                   /old_locus_tag="CAGL-CDS3702.1"
FT   CDS_pept        378245..379111
FT                   /locus_tag="CAGL0J04004g"
FT                   /old_locus_tag="CAGL-IPF6860"
FT                   /old_locus_tag="CAGL-CDS3702.1"
FT                   /note="similar to uniprot|Q12106 Saccharomyces cerevisiae
FT                   YOR228c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60828"
FT                   /db_xref="GOA:Q6FPG5"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="InterPro:IPR039960"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12106"
FT                   /protein_id="CAG60828.1"
FT                   /translation="MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKLQ
FT                   RLSIVPMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIAS
FT                   GVLLRGWKLYKSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMS
FT                   GYVLTPLVLYHLLIMKWVPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAA
FT                   SYHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFT
FT                   KLNFLRT"
FT   gene            complement(<379502..>383098)
FT                   /locus_tag="CAGL0J04026g"
FT                   /old_locus_tag="CAGL-IPF6859"
FT                   /old_locus_tag="CAGL-CDS0242.1"
FT   CDS_pept        complement(379502..383098)
FT                   /locus_tag="CAGL0J04026g"
FT                   /old_locus_tag="CAGL-IPF6859"
FT                   /old_locus_tag="CAGL-CDS0242.1"
FT                   /note="similar to uniprot|Q12276 Saccharomyces cerevisiae
FT                   YOR227w or uniprot|Q03016 Saccharomyces cerevisiae YPL137c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60829"
FT                   /db_xref="GOA:Q6FPG4"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG4"
FT                   /inference="similar to AA sequence:UniProtKB:Q12276"
FT                   /protein_id="CAG60829.1"
FT                   /translation="MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRL
FT                   GRRATISVRETMPEGVARRRPRSSSISNGDLSNDKSAQREAPATDYSRRHSVSHSEKEK
FT                   KKSIFGSLFGKKSDSTDKKPPQSSAKSPVSVKTSTSSASPTASVPININVNREKPKSHE
FT                   PKSPSSPLRLFHFGQSNSESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDK
FT                   ESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTT
FT                   SDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRS
FT                   GSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEG
FT                   YDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFL
FT                   NPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVL
FT                   SSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE
FT                   ELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSV
FT                   QGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLR
FT                   FLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHV
FT                   SMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDIS
FT                   DEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQ
FT                   SDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEKENLLRLVLLEKNLSN
FT                   IMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTSHIRPFLKHLDSDRI
FT                   FGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGKALLYKTSSSTSLLVKKQEHEEG
FT                   EFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPERVTVPKIQTVPSGNELREA
FT                   IIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSRNASEGNTEASG
FT                   RSTSTDSKTDELVTEKYDELLNSISQKRTSKQ"
FT   gene            <383930..>384367
FT                   /locus_tag="CAGL0J04048g"
FT                   /old_locus_tag="CAGL-IPF6857"
FT                   /old_locus_tag="CAGL-CDS4884.1"
FT   CDS_pept        383930..384367
FT                   /locus_tag="CAGL0J04048g"
FT                   /old_locus_tag="CAGL-IPF6857"
FT                   /old_locus_tag="CAGL-CDS4884.1"
FT                   /note="highly similar to uniprot|Q12056 Saccharomyces
FT                   cerevisiae YOR226c ISU2 or uniprot|Q03020 Saccharomyces
FT                   cerevisiae YPL135w ISU1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60830"
FT                   /db_xref="GOA:Q6FPG3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG3"
FT                   /protein_id="CAG60830.1"
FT                   /translation="MFLRSTRLMRPFTRMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVV
FT                   GAPACGDVIKLQIQVNDNTGVIEEAKFKTFGCGSAIASSSYLTELVQGITIEDAEKIKN
FT                   IEIAKELSLPPVKLHCSMLAEDAIKAAVRDYKTKRSSTTLH"
FT   gene            <384719..>385171
FT                   /locus_tag="CAGL0J04070g"
FT                   /old_locus_tag="CAGL-IPF6856"
FT                   /old_locus_tag="CAGL-CDS4830.1"
FT   CDS_pept        384719..385171
FT                   /locus_tag="CAGL0J04070g"
FT                   /old_locus_tag="CAGL-IPF6856"
FT                   /old_locus_tag="CAGL-CDS4830.1"
FT                   /note="highly similar to uniprot|P20436 Saccharomyces
FT                   cerevisiae YOR224c RPB8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60831"
FT                   /db_xref="GOA:Q6FPG2"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG2"
FT                   /protein_id="CAG60831.1"
FT                   /translation="MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTN
FT                   LFPVQVNEQLTVTVASSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGT
FT                   AYKFEEVSKDVIAVYYSFGGLLMRLEGNYRNLNNLKQETAYLLIRR"
FT   gene            complement(<385424..>386329)
FT                   /locus_tag="CAGL0J04092g"
FT                   /old_locus_tag="CAGL-IPF6855"
FT                   /old_locus_tag="CAGL-CDS3593.1"
FT   CDS_pept        complement(385424..386329)
FT                   /locus_tag="CAGL0J04092g"
FT                   /old_locus_tag="CAGL-IPF6855"
FT                   /old_locus_tag="CAGL-CDS3593.1"
FT                   /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
FT                   YOR223w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60832"
FT                   /db_xref="GOA:Q6FPG1"
FT                   /db_xref="InterPro:IPR019413"
FT                   /db_xref="InterPro:IPR025390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG1"
FT                   /inference="similar to AA sequence:UniProtKB:Q12015"
FT                   /protein_id="CAG60832.1"
FT                   /translation="MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVSM
FT                   DTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTEGT
FT                   LNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIE
FT                   LLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAG
FT                   DGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGLFNKRQ
FT                   RMSIIVGVATNVLFCLVRGF"
FT   gene            complement(<386924..>387835)
FT                   /locus_tag="CAGL0J04114g"
FT                   /old_locus_tag="CAGL-IPF6853"
FT                   /old_locus_tag="CAGL-CDS3580.1"
FT   CDS_pept        complement(386924..387835)
FT                   /locus_tag="CAGL0J04114g"
FT                   /old_locus_tag="CAGL-IPF6853"
FT                   /old_locus_tag="CAGL-CDS3580.1"
FT                   /note="similar to uniprot|Q99297 Saccharomyces cerevisiae
FT                   YOR222w ODC2 or uniprot|Q03028 Saccharomyces cerevisiae
FT                   YPL134c ODC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60833"
FT                   /db_xref="GOA:Q6FPG0"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG0"
FT                   /inference="similar to AA sequence:UniProtKB:Q99297"
FT                   /protein_id="CAG60833.1"
FT                   /translation="MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTG
FT                   SGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV
FT                   DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSL
FT                   YNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT
FT                   ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPG
FT                   GGIMLVVFNGMMAFFQEMKYGK"
FT   gene            <388375..>389409
FT                   /locus_tag="CAGL0J04136g"
FT                   /old_locus_tag="CAGL-IPF6851"
FT                   /old_locus_tag="CAGL-CDS3209.1"
FT   CDS_pept        388375..389409
FT                   /locus_tag="CAGL0J04136g"
FT                   /old_locus_tag="CAGL-IPF6851"
FT                   /old_locus_tag="CAGL-CDS3209.1"
FT                   /note="similar to uniprot|Q12283 Saccharomyces cerevisiae
FT                   YOR221c MCT1 malonyl-CoA:ACP transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60834"
FT                   /db_xref="GOA:Q6FPF9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF9"
FT                   /inference="similar to AA sequence:UniProtKB:Q12283"
FT                   /protein_id="CAG60834.1"
FT                   /translation="MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEY
FT                   IFRNPSSPGSIAVCSNFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTK
FT                   ELFEIANYRNDLMVKYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFP
FT                   GSHTISVANANSVKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLR
FT                   PIQEPLYDFIWKIMKNNGTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFT
FT                   KCYDTINRIAEATKDQEDPLDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYHG
FT                   THDL"
FT   gene            complement(<389834..>390529)
FT                   /locus_tag="CAGL0J04158g"
FT                   /old_locus_tag="CAGL-IPF6850"
FT                   /old_locus_tag="CAGL-CDS4153.1"
FT   CDS_pept        complement(389834..390529)
FT                   /locus_tag="CAGL0J04158g"
FT                   /old_locus_tag="CAGL-IPF6850"
FT                   /old_locus_tag="CAGL-CDS4153.1"
FT                   /note="similar to uniprot|Q12044 Saccharomyces cerevisiae
FT                   YOR220w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60835"
FT                   /db_xref="GOA:Q6FPF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF8"
FT                   /inference="similar to AA sequence:UniProtKB:Q12044"
FT                   /protein_id="CAG60835.1"
FT                   /translation="MKTQVLITDVPKNKFDSKWPDTLEKKLFKEKYPQYRKHLQYFTPL
FT                   PFLDRVIIILDDEAATMEIYEYLQKEEPSVVNDKSIKLYLTESLLSNRFRSRSMGESSP
FT                   EDSNAASNGSADSNSAIGDKPILSLDTNPVSTGINVQSLAMGSPSLSPDRRTSLESPTL
FT                   LKFANDEKAHLYREPLPTKSDSSKESSPGTTELHKSQKLTVSTDAVNKMASNTPPPLSP
FT                   SITVDEFFN"
FT   gene            <391191..>393203
FT                   /locus_tag="CAGL0J04180g"
FT                   /old_locus_tag="CAGL-IPF6848"
FT                   /old_locus_tag="CAGL-CDS1198.1"
FT   CDS_pept        391191..393203
FT                   /locus_tag="CAGL0J04180g"
FT                   /old_locus_tag="CAGL-IPF6848"
FT                   /old_locus_tag="CAGL-CDS1198.1"
FT                   /note="similar to uniprot|P43579 Saccharomyces cerevisiae
FT                   YFL013c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60836"
FT                   /db_xref="GOA:Q6FPF7"
FT                   /db_xref="InterPro:IPR038014"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF7"
FT                   /inference="similar to AA sequence:UniProtKB:P43579"
FT                   /protein_id="CAG60836.1"
FT                   /translation="MAKRIYDPIHDVFQDTGDNEPKRSKVLSVSELNSSETSRRNVSSI
FT                   SSLLTSDDQTAEKAIPERAHRNSISNLLSNDPEEDNNAEKEKVVPVPHMTNTKYTRHLK
FT                   KPDGDFFSRKDIQYDMLKALLTDDRCLFTNHLKAQYTNSLAPMSLPNNKIPIITDKEYD
FT                   ARTFVFNDKLTFAQMYALTMATSSKCSKILRDKLLLDGQVAFSTCVLGFLVNIGRLNTT
FT                   INFYLEMTSQLRTYHSVPCLQAHTLDIKSLQDTPRIKSILRNLPTGNNPIHLSLIYKLL
FT                   GVISEEKFNEIGDSASQKLDKQVSSAEKFGLNGKFNCINMLFALCDNATIVRTQFLSKY
FT                   IQLIDPQDNNHRFDLDKDLTLFNILDNSKFDVIDRVNVVLWLLYIHTETDLTEAEVVES
FT                   LKLFIPPTSVPDLQHNKIPLRLTTNNYDVDTEEELKYGKEQKEKRLLFLQKLDKSDTRK
FT                   EEKTSTADSKDDDSITERATRRKRKKTLEKEILLESSKPNKKIKKEEETEDRVKVEPEQ
FT                   DQEALKTAKEKPEAPLLAAERTPDVKKSKESIHQDRADRLINFDQNKEVGILEKSRERK
FT                   TQRELLQDLSDAQEIVKRKRKQIGMLRLFNKYDDIPMGSVIGVRGKKRRKYKDDVLGYE
FT                   TSFLKTLSIAKQKFIKALRSADTKPQQSENNIFHL"
FT   gene            complement(<393611..>393922)
FT                   /locus_tag="CAGL0J04202g"
FT                   /old_locus_tag="CAGL-IPF6847"
FT                   /old_locus_tag="CAGL-CDS5520.1"
FT   CDS_pept        complement(393611..393922)
FT                   /locus_tag="CAGL0J04202g"
FT                   /old_locus_tag="CAGL-IPF6847"
FT                   /old_locus_tag="CAGL-CDS5520.1"
FT                   /note="similar to uniprot|P22943 Saccharomyces cerevisiae
FT                   YFL014w HSP12 heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60837"
FT                   /db_xref="GOA:Q6FPF6"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="InterPro:IPR038399"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF6"
FT                   /inference="similar to AA sequence:UniProtKB:P22943"
FT                   /protein_id="CAG60837.1"
FT                   /translation="MSDAGRKNFSDKLNEGLTPDSQKSTWDKGKEFVTDETDKLAGKFQ
FT                   GEENKGVAQGMHDSAQKGADEANAESYADTAREYMDAAKSKLNDAVEYVSKSVHGGEK"
FT   gene            <395856..>397424
FT                   /locus_tag="CAGL0J04224g"
FT                   /old_locus_tag="CAGL-IPF6843"
FT                   /old_locus_tag="CAGL-CDS1946.1"
FT   CDS_pept        395856..397424
FT                   /locus_tag="CAGL0J04224g"
FT                   /old_locus_tag="CAGL-IPF6843"
FT                   /old_locus_tag="CAGL-CDS1946.1"
FT                   /note="similar to uniprot|P35191 Saccharomyces cerevisiae
FT                   YFL016c MDJ1 heat shock protein - chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60838"
FT                   /db_xref="GOA:Q6FPF5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF5"
FT                   /inference="similar to AA sequence:UniProtKB:P35191"
FT                   /protein_id="CAG60838.1"
FT                   /translation="MKSTRSLLLQRRYLSLTHRRVLSSSVRQPLLRRGFHSTSSVKQEF
FT                   KDPYETLGVKKSSSQSDIKKAYYKLAKKYHPDINKEAGAEKKFHDLQNAYEILSDESKR
FT                   KQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFEDL
FT                   FGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFRALDP
FT                   CGTCNGSGLKSGASKTTCPSCHGSGTTVHVRAGFQMMSTCQTCGGEGTTVNASDFCKSC
FT                   HGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSRGDILVRI
FT                   RVNKDPHFSIKNKYDIWYTKEIPITTAALGGTVSIPTIEGTKIRIKVPAGTAPEQVISI
FT                   PNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADVTNDTNAKRTME
FT                   SFASSVEKSVEDKLSDNDNKTSNNSKETYNTTEDNSMNPDAPSTLGRLEKFISNTFKKI
FT                   KGDKN"
FT   gene            <398083..>399294
FT                   /locus_tag="CAGL0J04246g"
FT                   /old_locus_tag="CAGL-IPF7069"
FT                   /old_locus_tag="CAGL-CDS2752.1"
FT   CDS_pept        398083..399294
FT                   /locus_tag="CAGL0J04246g"
FT                   /old_locus_tag="CAGL-IPF7069"
FT                   /old_locus_tag="CAGL-CDS2752.1"
FT                   /note="similar to uniprot|Q04740 Saccharomyces cerevisiae
FT                   YMR234w RNH1 ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60839"
FT                   /db_xref="GOA:Q6FPF4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF4"
FT                   /inference="similar to AA sequence:UniProtKB:Q04740"
FT                   /protein_id="CAG60839.1"
FT                   /translation="MAKKKGGFYAVQNGRSTGVFTDWNQCSSQVKGYQGAVYKKFDTYQ
FT                   EAQAFSESSSGYGASHSSSGSGSGNRVRGTGGYRGTGGYRDTGGYRDSSSSNHEPVHAY
FT                   FFGSGLTIDSTPNSSPSRSESYKSDNYKSSSSNTYKSPHSSNGKIKKKTYNTRSDKYYA
FT                   VKNSNHPWQNQVFTNWSECQDYVKGRKGVSFKKFESEQGAYDFLDGNTESTDSRILGMS
FT                   REDFKQQYRASDDHKPVQKVTTYCDGSSLGNGTHASKAGYGVYFPHNPSYNISKPLLIG
FT                   PQTNNRAEIMAVSEALDTIWNDLTCHGNKVEYTIKTDSEYVSKLLNDRYSSYTEKEMET
FT                   LPNKDLVKPLIEKYVKVKTYYDVNKDKFSNDKGLKIEWVKGHAGEPGNEMADLLARRGA
FT                   DQRN"
FT   gene            complement(<399703..>401283)
FT                   /locus_tag="CAGL0J04268g"
FT                   /old_locus_tag="CAGL-IPF7068"
FT                   /old_locus_tag="CAGL-CDS1925.1"
FT   CDS_pept        complement(399703..401283)
FT                   /locus_tag="CAGL0J04268g"
FT                   /old_locus_tag="CAGL-IPF7068"
FT                   /old_locus_tag="CAGL-CDS1925.1"
FT                   /note="highly similar to uniprot|P32316 Saccharomyces
FT                   cerevisiae YBL015w ACH1 acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60840"
FT                   /db_xref="GOA:Q6FPF3"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPF3"
FT                   /protein_id="CAG60840.1"
FT                   /translation="MTVSKLLKERVRYAPYLAKVKTPEELIPLFKNGQYLGWSGFTGVG
FT                   TPKAVPDALIKHVEDNNLQGKLRFNLFVGASAGPEENKWAEHDMIIRRAPHQVGKPIAK
FT                   AINNGKIQFFDKHLSMFPQDLTYGYYTRDRTDGKILDYMIIEATAIKEDGSIVPGPSVG
FT                   GSPEFISVSDKVIIEVNTATPSFEGVHDIDMPVNPPHRVPYPYTKVDQKIGVDSIPVDP
FT                   ERVIAIVESKTRDQVGPNTPSDDMSKAIAGNLIEFFRNEVKHGRLPENLLPLQSGIGNI
FT                   ANAVIEGLTDANFKHLNVWTEVLQDSFLDLFENGSLDYATATSIRLTEPGFERVFKNWD
FT                   FYKSRLCLRSQVVSNNPELIRRLGVIAMNTPVEADIYAHANSTNVNGSRMLNGLGGSAD
FT                   FLRNAKLSIMHCPAARPTKVDPTGISSIVPMVSHVDQTEHDLDVLVTDQGLADLRGLSP
FT                   RERAREIINKCAHPDYKPLLQDYLDRAEHYATKHGCLHEPHMLKNAFKFHTNLAEKGTM
FT                   KVESWDPVE"
FT   gene            complement(<403542..>404615)
FT                   /locus_tag="CAGL0J04290g"
FT                   /old_locus_tag="CAGL-IPF7066"
FT                   /old_locus_tag="CAGL-CDS3106.1"
FT   CDS_pept        complement(403542..404615)
FT                   /locus_tag="CAGL0J04290g"
FT                   /old_locus_tag="CAGL-IPF7066"
FT                   /old_locus_tag="CAGL-CDS3106.1"
FT                   /note="similar to uniprot|P16892 Saccharomyces cerevisiae
FT                   YBL016w FUS3 or uniprot|P14681 Saccharomyces cerevisiae
FT                   YGR040w KSS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60841"
FT                   /db_xref="GOA:Q6FPF2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF2"
FT                   /inference="similar to AA sequence:UniProtKB:P16892"
FT                   /protein_id="CAG60841.1"
FT                   /translation="MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIV
FT                   PFDKPLFALRTLREIKILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVI
FT                   ATQTLTDDHIQYFIYQTLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIID
FT                   SGENGDNEVDKIGMTEYVATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFP
FT                   GKDYRHQLLLIFGLIGTPDSSDKSMECIESRRARQYIASLQKYPPVRPLQKAFPGVNPV
FT                   GVDLLSRMLVFDPRERISADDALAHPYLSTYHVPEDEPAGEPIPPDFFQFDQYKEVLTT
FT                   KDLKKLLWNEIFHEQAT"
FT   gene            <406058..>410602
FT                   /locus_tag="CAGL0J04312g"
FT                   /old_locus_tag="CAGL-IPF7064"
FT                   /old_locus_tag="CAGL-CDS0102.1"
FT   CDS_pept        406058..410602
FT                   /locus_tag="CAGL0J04312g"
FT                   /old_locus_tag="CAGL-IPF7064"
FT                   /old_locus_tag="CAGL-CDS0102.1"
FT                   /note="similar to uniprot|P32319 Saccharomyces cerevisiae
FT                   YBL017c PEP1 or uniprot|P40438 Saccharomyces cerevisiae
FT                   YIL173w VTH1 or uniprot|P40890 Saccharomyces cerevisiae
FT                   YJL222w VTH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60842"
FT                   /db_xref="GOA:Q6FPF1"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPF1"
FT                   /inference="similar to AA sequence:UniProtKB:P32319"
FT                   /protein_id="CAG60842.1"
FT                   /translation="MRLPSIFLVFFYLFARTLCWSPEVSLLHGVDSLASIIPFDDSSTI
FT                   LSVGRKGVNVSHDYGRTWETKLRNKGEYPVSVTLNTFRPNSRAFVFLNGKLYGTHNEGS
FT                   DWFESKFPSDRQLTKALTIDFSPFAKDVIIASFVAKDNQNDEKEFNYVSTDDGKSFRVL
FT                   DVGQEYESMRCRFLSISHESNFPHNDNIICMTKTSSPDQNKLLLSENRGKSFKELSIGE
FT                   DIAFDNFYLTNSYLVIRSIRDIHNKAAEVDLYVSSDAKDFKKAYLPTTLRRSDIRRIIE
FT                   LLGRKMFITLTRSSESNVQDDNGNTLFTDGLVSNSDGLKFTSFSTSASKSRTTITPVEF
FT                   LNGTFIQKQVGRNSGGYSISIDNGNTWRKLKYSDKGNKNPIKCQDENDCNLELLIPQIF
FT                   HGPTAGILVMLGHINDNFSDQQTFISRDGGLNWEMGLEFPGIYATGDLGNVIVACPVDP
FT                   SSDNDPQSEIYYSLDQGMTWSEYQLDEMFIPIDVINITPDGSGLSFILTGFSLDKPDDQ
FT                   RPNIDNRVTYLIDFNNVHDGKKCKAKDYEKFELAEGSCINGAKYTFNRRKQSAKCIGGE
FT                   VFKDLLFDMEVCTECQEQDYECSSEFIKDSKGVCVVDEKWLSATGNCPSTDIKKPAMRL
FT                   IADNMCKKELPIQSKSVSCKNKNPSDPKDIPKKPKEGDRPTFGTGDIQATFNTFKGKVR
FT                   FYQYFDTDEDESLILATSEGEAYISHDSGQTYTHFNYNKPKVHEIVFNEYFNSSAYIFD
FT                   IDGNLHVTHDRGYTFDTIRLPASLQLGLPLNFHSKDPNTFIYYGGKNCKSIFDTNCHIV
FT                   AFITRDGGKSFSELLPNAIHCEFVGSSLKLSDSDDLLFCQVKDETSSKTRQRSLVSTTD
FT                   YFETEPKVVFQKILGYMTNGEYVIIAVPGENHEITAYVTMDGDEFAETLLPYDLDIEQP
FT                   EAFTVLGSSTGSVFLHFTSFQENSVAFGSLLKSNTNGTSYVKLQSNVNRNEAGYVDFEK
FT                   VQGLDGIILTNVVTNADEIKDGSSQKHLRTKITFNDGVDWEYIKPPKKDSSGDSYHCKS
FT                   NKLEHCSLNLHSYTERKDFRDTFSSGSALGMMIGVGNVGDKLLPFEECSTFLTIDGGKS
FT                   WTEIKKGAYQWEFGDHGGILILSRDGEMTNSISYSTDFGKSWYDYQFSDEKVLVSDIVT
FT                   VPQDSALRFLLITADRIGRGFESGTVTVDFSGLFKRQCVLDFNNENHDDFDYFSIGNSE
FT                   NECIFGHKVKYLRKNSEECYVGAVSLSQFTRVMKNCTCTRADFECDYNFVRQYDGTCKL
FT                   VDGLQPGNEAAICKKDPDLVEYFQSTGYRKIPLSTCQGGLKLDGRTEPLPCPGKEKEFK
FT                   QKYGISGSSFFLLFFVPFLFFVSAGWFVYDRGIRRNGGFARFGEIRLGDDQLIEENTTD
FT                   KVVNTIIRFGVASFEVMAGGFGIIRRIANNSFNRITGRMNGRYRPSYSNLMHDDFLDEA
FT                   DDLLAGHDDDANDLASFMDDDSNFDIEDETTSVNDSGYRDQSPETENVVDSNN"
FT   gene            <411050..>411427
FT                   /locus_tag="CAGL0J04334g"
FT                   /old_locus_tag="CAGL-IPF7061"
FT                   /old_locus_tag="CAGL-CDS5114.1"
FT   CDS_pept        411050..411427
FT                   /locus_tag="CAGL0J04334g"
FT                   /old_locus_tag="CAGL-IPF7061"
FT                   /old_locus_tag="CAGL-CDS5114.1"
FT                   /note="similar to uniprot|P38208 Saccharomyces cerevisiae
FT                   YBL018c POP8 required for processing of tRNAs and rRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60843"
FT                   /db_xref="GOA:Q6FPF0"
FT                   /db_xref="InterPro:IPR020347"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF0"
FT                   /inference="similar to AA sequence:UniProtKB:P38208"
FT                   /protein_id="CAG60843.1"
FT                   /translation="MGSTKYKEWQYFLLSIRAESDVDHIDEVTWKQAVSNALRKSHGLF
FT                   GEQIELYWLKIDNKRAIIKCGFADKDILKTALATYISSTELVGSPLVITMEQEASQLNN
FT                   LFLPEDDKLWFNKIVEIENGD"
FT   gene            complement(<411562..>413079)
FT                   /locus_tag="CAGL0J04356g"
FT                   /old_locus_tag="CAGL-IPF7060"
FT                   /old_locus_tag="CAGL-CDS2048.1"
FT   CDS_pept        complement(411562..413079)
FT                   /locus_tag="CAGL0J04356g"
FT                   /old_locus_tag="CAGL-IPF7060"
FT                   /old_locus_tag="CAGL-CDS2048.1"
FT                   /note="similar to uniprot|P38207 Saccharomyces cerevisiae
FT                   YBL019w APN2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60844"
FT                   /db_xref="GOA:Q6FPE9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE9"
FT                   /inference="similar to AA sequence:UniProtKB:P38207"
FT                   /protein_id="CAG60844.1"
FT                   /translation="MGAIDPLLPDNIRFVTFNVNGVRTFFHYAPFSEMRQSLRSVFDWF
FT                   ESDVITFQELKTEPLSLNKWGKVDGFYSFISIPQKRKGYSGVGCWVRIPPRDSPKYNAL
FT                   QVLRAEEGITGYLEVKNGKQSVSYRDDSEIGIGGYIPDDSLPDHISTSDALQLDSEGRC
FT                   VIVELKCGIVVISVYCPANSTCTDEGEVFRMRYLKLLFARIRNLQMMGKMVVLMGDLNI
FT                   CRDLIDHAVSLEEYHISIGNESTGTQIDEEYRDFAIKFIVNPEVPHRLLLNQILDDSMV
FT                   PNTDNEFCLIDTTRKVQGRDRLKMYTVWNTLKNTRPSNFGSRIDFILVSKDLGNNIEKA
FT                   DILPDINGSDHCPVFCDINLNNLTLTSNISVEEKIPKFEARYRYNMTNRNIFDMFAKKS
FT                   GKSSSSIGNKLKSEPIKDKVSKPIHKRSAEAITDKMGTTPNQTPKDKIALFFQGSFGPP
FT                   PLCKHKQHAILKTSKTSNNPGKKFWTCSKPRGHQNDENSSCGFFEWA"
FT   gene            complement(<413393..>415048)
FT                   /locus_tag="CAGL0J04378g"
FT                   /old_locus_tag="CAGL-IPF7059"
FT                   /old_locus_tag="CAGL-CDS1757.1"
FT   CDS_pept        complement(413393..415048)
FT                   /locus_tag="CAGL0J04378g"
FT                   /old_locus_tag="CAGL-IPF7059"
FT                   /old_locus_tag="CAGL-CDS1757.1"
FT                   /note="similar to uniprot|P38206 Saccharomyces cerevisiae
FT                   YBL020w RFT1 nuclear division protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60845"
FT                   /db_xref="GOA:Q6FPE8"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE8"
FT                   /inference="similar to AA sequence:UniProtKB:P38206"
FT                   /protein_id="CAG60845.1"
FT                   /translation="MSGADILEKTTRGATFLMMGQLFSKIVTFLLNNTLVRYLSPRIFG
FT                   ITAFLEFIVGTVLFFSREAIRLSTQRIADGNDADNDHDHDRDDSALQVCVNFAMIPLFI
FT                   GIPLSIGLIAWQYHNINGYFVTLPFFQWSVFAIWVGIILELVNEPLFVLNQHFLNYGAR
FT                   SRYESIAVTANCLVNFTVVYSYEKKLILTSYFDDSERFREGIAILAFALGKLAYAATLL
FT                   MCYYYNYLMNFKSNKPFKLSLQKIKSKVNEKQTYYFRSDILEHFKKVYFQLCFKHLLTE
FT                   GDKLIINTFCTVEEQGIYSLLSNYGSLITRLLFAPIEESLRLLLAVLLSKKDSKNLQLS
FT                   MKVLVNLTKFYLYLSLLVMIFGPNNSSYLLQFLIGSKWSTNSVLHAIRVYCVYIPFLSF
FT                   NGIFEAFLASVATGDQILRHSYFMMMCSFAFLINSWIFIEYLDLSVNGLIISNIINMSL
FT                   RIIYSFSFIVKFYRELHTESSIFMNFTNFKATLGAAALVAILNWQMVGYVSSFNGFITS
FT                   ATLALILLSVILIKERATLNELIINRRAANMKSV"
FT   gene            <415482..>415838
FT                   /locus_tag="CAGL0J04400g"
FT                   /old_locus_tag="CAGL-IPF7058"
FT                   /old_locus_tag="CAGL-CDS5203.1"
FT   CDS_pept        415482..415838
FT                   /locus_tag="CAGL0J04400g"
FT                   /old_locus_tag="CAGL-IPF7058"
FT                   /old_locus_tag="CAGL-CDS5203.1"
FT                   /note="highly similar to uniprot|P13434 Saccharomyces
FT                   cerevisiae YBL021c HAP3 CCAAT-binding factor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60846"
FT                   /db_xref="GOA:Q6FPE7"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE7"
FT                   /protein_id="CAG60846.1"
FT                   /translation="MGNTTEDDIDKQIELREQDRWLPINNVARLMKNTLPETAKVSKSA
FT                   KECMQECVSEFISFVTSEASDRCAQDRRKTINGEDILISLHALGFENYAEVLKIYLAKY
FT                   RQQQALKNNYEEDS"
FT   gene            <416515..>419595
FT                   /locus_tag="CAGL0J04422g"
FT                   /old_locus_tag="CAGL-IPF7057"
FT                   /old_locus_tag="CAGL-CDS0410.1"
FT   CDS_pept        416515..419595
FT                   /locus_tag="CAGL0J04422g"
FT                   /old_locus_tag="CAGL-IPF7057"
FT                   /old_locus_tag="CAGL-CDS0410.1"
FT                   /note="highly similar to uniprot|P36775 Saccharomyces
FT                   cerevisiae YBL022c PIM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60847"
FT                   /db_xref="GOA:Q6FPE6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE6"
FT                   /protein_id="CAG60847.1"
FT                   /translation="MLGTRVTRAVYTRAPLKLQLRALGLHRRYVHNGSKNDEGSSTSTT
FT                   TNKEENDKKLPDVYPQMLALPISRRPLFPGFYKAVVISEPRVMKAITDMVERQQPYIGA
FT                   FMLKDSNNDTDIIHDISEVHELGVLAQVTSAFPSKDEKTGKETMTALLYPHKRIKIDQL
FT                   IPPKDVKIEDIVVEKVVDNEVASEETKDEETVDKTESATDKVSEEITEEIAKAPSTEVT
FT                   EDPDNYENPTDFLKDYNVTLVNVSNLEDEPFDIKSPIINALTSEILKVFKEISQLNSMF
FT                   REQIATFSASIQSATTNIFEEPAKLADFAAAVSAGEEEELQEVLESLNIEQRLEKSLLV
FT                   LKKELMNAELQNKISKDVETKIQKRQKEYYLMEQLKGIKRELGIDDGRDKLVDTYKKRV
FT                   EKLNLPENVQKTFDEEITKLATLETSMSEFGVIRNYLDWLTSLPWGINSKEQYSIPRAR
FT                   KILDEDHYGMKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSISRALNRQ
FT                   FFRFSVGGMTDVAEIKGHRRTYIGALPGRIIQALKKCQTQNPLILIDEIDKIGHGGIHG
FT                   DPSAALLEVLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSLDTIPRPLLDRMEVIELTG
FT                   YVAEDKIKIAEQYLVPSAKKTAGLQNATVSMDEEAINALMKYYCRESGVRNLKKHIEKI
FT                   YRKAALEVVKKMSIEDTEPLVSTSEEPQLSQTNQNISSSSAEDSTTDLEDSVNPDTAKE
FT                   ASKPNNSQEGASVEETKKAVKTEEEEDTSMIVPEDIKVEITPEDLKKYVGPPIYTTDRL
FT                   YETTPPGVIMGLAWTNMGGCSLYVESVLEQPLHNCKHANLERTGQLGDVMKESSRLAYS
FT                   FSKMYLSKKFPENRFFEKAAIHLHCPEGATPKDGPSAGVTMATSFLSLALNKPVDPTVA
FT                   MTGELTLTGKVLRIGGLREKVVAAKRSGAKTVIFPKDNLNDWEELPENVKEGMEPLAAD
FT                   WYDDIYKRLFSGVKKSEGNNVWKSEFELIDKKKKEND"
FT   gene            <420259..>422898
FT                   /locus_tag="CAGL0J04444g"
FT                   /old_locus_tag="CAGL-IPF7056"
FT                   /old_locus_tag="CAGL-CDS0633.1"
FT   CDS_pept        420259..422898
FT                   /locus_tag="CAGL0J04444g"
FT                   /old_locus_tag="CAGL-IPF7056"
FT                   /old_locus_tag="CAGL-CDS0633.1"
FT                   /note="highly similar to uniprot|P29469 Saccharomyces
FT                   cerevisiae YBL023c MCM2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60848"
FT                   /db_xref="GOA:Q6FPE5"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE5"
FT                   /protein_id="CAG60848.1"
FT                   /translation="MSDNRRRRRDPEDDEHDSDNENVGMPPSSPQHHGSRNLFGPGSSP
FT                   IGSPVRDEDQENDDELGMLNPEGDDNEIDDAPDIDEVEEQMNEVDLMDDDMYGDYRSDP
FT                   TKDRYEGLGVDDTEQKELSLSDRRRIDAQLNERDRLLKNVAYLDDDDEAMGNEQLDEMG
FT                   LPKQRRRRRRQYEDFEHSDDDLLSDLDADPLREELTLESLSNVKANSYSEWVVQPNVSR
FT                   TIARELKSFLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALFLAKCP
FT                   EEMLKIFDLVAMEATELHYPDYSRIHSEIHVRISDFPTIHNLRELRQSNLSTLVRVTGV
FT                   VTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIKISFCTNCKSKGPFSINGEKTVY
FT                   RNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKNNYDGNLNAK
FT                   NGFPVFATIIEANAVRRREGNLANENEEGLNVFSWTEEEEREFRKLSKDRGIVDKIIAS
FT                   MAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLGDPGTAKSQILKYVEKT
FT                   AHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRT
FT                   SIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVSLTEPILSRF
FT                   DILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQKNDDDIQLSNRQK
FT                   RAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSKVYADLRRESITTGS
FT                   FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKISVRRQLRRSF
FT                   AIYTLGQN"
FT   gene            complement(<423298..>424083)
FT                   /locus_tag="CAGL0J04466g"
FT                   /old_locus_tag="CAGL-IPF7055"
FT                   /old_locus_tag="CAGL-CDS3909.1"
FT   CDS_pept        complement(423298..424083)
FT                   /locus_tag="CAGL0J04466g"
FT                   /old_locus_tag="CAGL-IPF7055"
FT                   /old_locus_tag="CAGL-CDS3909.1"
FT                   /note="similar to uniprot|Q06991 Saccharomyces cerevisiae
FT                   YLR414c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60849"
FT                   /db_xref="GOA:Q6FPE4"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="InterPro:IPR017974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE4"
FT                   /inference="similar to AA sequence:UniProtKB:Q06991"
FT                   /protein_id="CAG60849.1"
FT                   /translation="MRNFVALILALFFALASLVLACIACAGSTKNYYPINQIFCAQLDL
FT                   SNLDIATVIPAASSFSISDLGLPKFINIGLWSYCVASSSTDVTSCTSPNGIQTFNLKNL
FT                   LKDNIENNQVLQLVDDVAKIVLPQQLQDKLVYYNNLVKCMFITLIIGIVLTFLNLVINV
FT                   LRWFLHFSFVNFVGGFVCFLSFASLLISVGTNMGTYIYIRHILNKNYSDYGIHLSLGRK
FT                   FLALLWAAVVAALLNLFCWMTVRQRKKVVYVHQPYNDKY"
FT   gene            <426177..>427742
FT                   /locus_tag="CAGL0J04488g"
FT                   /old_locus_tag="CAGL-IPF7052"
FT                   /old_locus_tag="CAGL-CDS1952.1"
FT   CDS_pept        426177..427742
FT                   /locus_tag="CAGL0J04488g"
FT                   /old_locus_tag="CAGL-IPF7052"
FT                   /old_locus_tag="CAGL-CDS1952.1"
FT                   /note="similar to uniprot|Q06696 Saccharomyces cerevisiae
FT                   YLR417w VPS36 defective in vacuolar protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60850"
FT                   /db_xref="GOA:Q6FPE3"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="InterPro:IPR031558"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="InterPro:IPR037855"
FT                   /db_xref="InterPro:IPR040608"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE3"
FT                   /inference="similar to AA sequence:UniProtKB:Q06696"
FT                   /protein_id="CAG60850.1"
FT                   /translation="MEYWHYVETTESGQPLLRESEKDILIDHNVGLYQGKERIRNRQNG
FT                   RIFLTSQRIIYVDSKEPTKYSLGIELDDIDHLDYSSSFLRRSARLIIFMDVHSASSGLH
FT                   NINNKLTEEVHTTTWVCPICMVTNETEGEFKANTQPPPVCVNCGVPADYELTKNSITIQ
FT                   GNSTDSNSHSDKKENKNSCPACTFINHPQVRNCEICGTRLNNTKIRNRLALSRRKQDSR
FT                   LTIELDSISSVKSSRSAEECFIQVSFRKSDGILFSDAVEKTITDLKASTKFNRNTIEKT
FT                   NKSEENGELNLLETKLSKIGITSLEHSRENQILNNDIIFTSALTDLDKLISLADSIERL
FT                   YRKESIDNQSVKKPNLILDRDTFYNKEQFLSEVSREIYDFVKNGFKNNYVMITLVDLYA
FT                   LYNKSMRIGTGLISPAEMREACEKFGSFGLSDLYLKKINGCVLCVCTDDAFDYIRQKII
FT                   DIIDRSPGADLLTLTQKFNDEPNNNWGIGVIQEVLKSCIDEGQLLIDKQISGIYYYCNN
FT                   AWKL"
FT   gene            complement(<427882..>428994)
FT                   /locus_tag="CAGL0J04510g"
FT                   /old_locus_tag="CAGL-IPF7050"
FT                   /old_locus_tag="CAGL-CDS2984.1"
FT   CDS_pept        complement(427882..428994)
FT                   /locus_tag="CAGL0J04510g"
FT                   /old_locus_tag="CAGL-IPF7050"
FT                   /old_locus_tag="CAGL-CDS2984.1"
FT                   /note="similar to uniprot|Q06697 Saccharomyces cerevisiae
FT                   YLR418c CDC73 DNA-directed RNA polymerase II accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60851"
FT                   /db_xref="GOA:Q6FPE2"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="InterPro:IPR031336"
FT                   /db_xref="InterPro:IPR038103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE2"
FT                   /inference="similar to AA sequence:UniProtKB:Q06697"
FT                   /protein_id="CAG60851.1"
FT                   /translation="MSVLVQLKKQLSSASEFTLVDGTGSTTADITNAEFIQFKEDKLPL
FT                   DEATEFIVDEQPAKLRVIIQCWLHKDDSAAEYLADCQEKKITNISFLQRNDLLKWLSGE
FT                   SETSEYLDVKNIKTDNSEADVNTKTDVSESQKIIDDPVLQEATQKERILIDHNSMLHGS
FT                   KPVDFGYLIKDAELKLVHSIKATLRSKQGSGKPGAVSKHGSQNQKTQKKDPIILIPSAA
FT                   SSLFAISNIKQFLESSQYINPRDATANTGSDVITVEKKFDRISRPIKFIVVNNTRMFTK
FT                   PEYWDRVVAVFTTGHTWQFNNYQWNTPQELFQHCKGYYFHFTGDSVPQNVQQWNVDKVE
FT                   LDKTKRFKDVEVVRYFWNTIEKELMARGFR"
FT   gene            <429277..>433539
FT                   /locus_tag="CAGL0J04532g"
FT                   /old_locus_tag="CAGL-IPF7049"
FT                   /old_locus_tag="CAGL-CDS0136.1"
FT   CDS_pept        429277..433539
FT                   /locus_tag="CAGL0J04532g"
FT                   /old_locus_tag="CAGL-IPF7049"
FT                   /old_locus_tag="CAGL-CDS0136.1"
FT                   /note="similar to uniprot|Q06698 Saccharomyces cerevisiae
FT                   YLR419w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60852"
FT                   /db_xref="GOA:Q6FPE1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE1"
FT                   /inference="similar to AA sequence:UniProtKB:Q06698"
FT                   /protein_id="CAG60852.1"
FT                   /translation="MAKKKGKNETPALEKAANKSNSGPTGGKRGKRVLTEEQKAQQQSN
FT                   RAKVTSTSSWTGKLPHTLLHEFCQKRKWGKVEYDMKKIGSKGFIGIAIISSVDPKTRET
FT                   LLVRLNDPTYDKAVGQGALEPQETTMEARHYAATVALYRLAYNTNTHMMLPPNHKSIWY
FT                   KLDDFRKSLKKDDRAQRYFCDDPFKQLIEERKEKAIKDKQNESRMQQAAKNESTPVIIN
FT                   SVNNNMKDNDGSLTKKVNKPVRKSTKEVTFSRNVWESANFIDLNESSRQQIENCIKRNA
FT                   DWESEMLKSSNNTPERQELKSKLINLGFREAHVNEAMLYKDPLSFLLFNLPEDDFPRYF
FT                   QKRKEDSKNIIEISTLPLQKQITLERLQEFPVSKDEALFALDLYNGSEALAAGYLTQSM
FT                   IPDLPILGTEEIDNPESKEMWIQELESLKCIFEDKIEVIDEPNCYVISLMEKYSLKLKV
FT                   YRTPNYPQHIPGIVVSTFSKKIKLPNYIKKQVMIKLLHHVKESGIIGGEMIYEIYQWLL
FT                   DNIKSIIDNPGKLLNIDDMKSSSNFEIIEARKSKMKLNKKNQEASLTKDELSALLDEYK
FT                   KRILTNNYKLMQDQRMQLPAWKKKDHIVDLIMKNQIVLITGETGSGKSTQVCQFVLDAL
FT                   FTSNNSNELQKKILVTQPRRISAIGLAERVAAERCVPCGEEVGYTIRGVNKSSKFSKIR
FT                   FMTTGVLVRILQSSMKSLENCIIIIDEVHERSIDTDLLVALLKQIMEKVKTLKIVLMSA
FT                   TVNVNLFHNYFPGLVSSHIEGRTFPIKDYFLEDILDQLDFKIKRNKYHEYDDDDDDDSI
FT                   SSHDNQFLRPTADSKFFRTGQINYDLLCQLVLHVNDKLTSENNSGSIIVFLPGVAEINR
FT                   LCRMLENNNLVVLPLHSALSAEDQKQVFKKFSKRKVVVSTNIAETSITIDDCVATIDTG
FT                   KAKIMMYNAKDNSTRLIERFISRAESKQRRGRAGRVREGLSYKLYSKRLYEEDMVEMPT
FT                   SEINRVALDSLYLSVKAMGIRNVKSFLAKGLEPPPLNALEMAEIQLSMIGLLDRKNEEL
FT                   TQLGKYVSMMPLVDPKYGKLLLFGIIFGCVSKCVLIASILSLSNSPFIGGTENRDNIKQ
FT                   MLKEHGDDGDILAIVDIVEKCLSKTNSSDRGKYMKQHYLSFNKLREIESSISQYYSILS
FT                   DLGFLPIKYRQSEGSELERNGKSKSILKAILAGTLYPNIARVQLPDMKYLSTSMGSIEK
FT                   DLEAKQIKYWIRNEELQTELQKLKDEGKEINWRNNDLPPSTKRAFLHPSSVLFQGNEMS
FT                   VVELQALQDDLHRISKKTSPTSLTSPFVAYVSTQLTSKQFINGLTPVSTLVLLLFGGVL
FT                   RYDIDSESLSPGIIMDDWIPIRTWCKNGILLNELRLTLDKAIQTVLEKPQYVSGTQNTS
FT                   KNLEHVFQLVHNLIEIES"
FT   gene            complement(<433719..>434978)
FT                   /locus_tag="CAGL0J04554g"
FT                   /old_locus_tag="CAGL-IPF7048"
FT                   /old_locus_tag="CAGL-CDS2645.1"
FT   CDS_pept        complement(433719..434978)
FT                   /locus_tag="CAGL0J04554g"
FT                   /old_locus_tag="CAGL-IPF7048"
FT                   /old_locus_tag="CAGL-CDS2645.1"
FT                   /note="similar to uniprot|P23542 Saccharomyces cerevisiae
FT                   YLR027c AAT2 aspartate aminotransferase or uniprot|Q01802
FT                   Saccharomyces cerevisiae YKL106w AAT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60853"
FT                   /db_xref="GOA:Q6FPE0"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE0"
FT                   /inference="similar to AA sequence:UniProtKB:P23542"
FT                   /protein_id="CAG60853.1"
FT                   /translation="MVKISATVYNDVEPIKTDILFATKQRYLKDTRGFKVDLGVGAYRA
FT                   DNGKPWILPSVRKAERLVQEEDDYDHEYLNICGLDSLTNSAAKVILGEDCPALRESRVI
FT                   SVQSLSGAGALHVAAKFIKKYTPEKKIYLSNPTWPIHQSIFENVDLETDSYPYWDATNK
FT                   SLDFEGFIKAIDHAPRGSIFVLHACAHNPTGLDPTQEQWHQIIESIQKGDHIPLFDSAY
FT                   QGFASGDLERDAYAIRYTINQLRDCAPIFVAQSFAKNVGMYGERVGCLHLVLPAQKEDI
FT                   VPIKDAITSQLSRIIRSEISTPPAYGAKVVSKIFTTPELKEQWYQDLVTMSSRIISVRT
FT                   RLRDLLAEYNTPGNWDHIVQQCGMFSFTGLTPEMTKRLETEHAVYMVPTGRASVAGLNT
FT                   GNVQHVAKAINEVVNHFMKD"
FT   gene            complement(<435699..>437354)
FT                   /locus_tag="CAGL0J04576g"
FT                   /old_locus_tag="CAGL-IPF7046"
FT                   /old_locus_tag="CAGL-CDS1756.1"
FT   CDS_pept        complement(435699..437354)
FT                   /locus_tag="CAGL0J04576g"
FT                   /old_locus_tag="CAGL-IPF7046"
FT                   /old_locus_tag="CAGL-CDS1756.1"
FT                   /note="similar to uniprot|P32461 Saccharomyces cerevisiae
FT                   YKL191w DPH2 diphtheria toxin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60854"
FT                   /db_xref="GOA:Q6FPD9"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPD9"
FT                   /inference="similar to AA sequence:UniProtKB:P32461"
FT                   /protein_id="CAG60854.1"
FT                   /translation="MSNEDILVPAALSTHQDESDFTFQKFDSDSMERSFYLGPLSSQDE
FT                   LWDKLMQYYSIDKLIAYLQRNPEYVQITLQFPDTLVKDSSFIIRALQDKLDGDGAGRKF
FT                   WALADTAYSACCVDEVAAEHVKGDLVIHFGDACLNAIQKLPVVYDFGKPFLDTDVLLAC
FT                   FTEEFKDKDQKICLMSNASYTHHIPDLYSRLKSNGYTNVVYSVVNTGLLTETAEIIDNT
FT                   TPLSDTDELFTLGNRVLMGARQEEDIDEETLRNEYALFHITMPHDPHLLYLTTVFESIH
FT                   TYDVADQVISNGPYPSLTRRYKNMHKARTAGCIGILVNTLSIRGTRETVNKLIKLIREN
FT                   GKKHYLFVVGKPNVPKLANFEPVDIWCILGCGQSGIIVDEFGEFYKPIITPYELTLALN
FT                   FEVTWTGKWIIDFQKAITEIDNSLAELGIDDSKHGNDSDHDLDAPEFDAVTGKYVSSSR
FT                   PLRALNHLQLDAPSNEDKQVMARVNGGTVIKGTVSTAVEHLANRAWTGLGSDYKDDEGY
FT                   EEDGATVEEGISGIARGYEFDQEDAARKSQNQSQ"
FT   gene            <437730..>438806
FT                   /locus_tag="CAGL0J04598g"
FT                   /old_locus_tag="CAGL-IPF7045"
FT                   /old_locus_tag="CAGL-CDS3096.1"
FT   CDS_pept        437730..438806
FT                   /locus_tag="CAGL0J04598g"
FT                   /old_locus_tag="CAGL-IPF7045"
FT                   /old_locus_tag="CAGL-CDS3096.1"
FT                   /note="highly similar to uniprot|P20051 Saccharomyces
FT                   cerevisiae YLR420w URA4 dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60855"
FT                   /db_xref="GOA:Q6FPD8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD8"
FT                   /protein_id="CAG60855.1"
FT                   /translation="MSEIDLGITCDMHVHVREGDMCELVTPSIRDGGVSVCYVMPNLQP
FT                   PITTLDRVVAYKKKLQELAPETTFLMSFYLSRDLTPELIHEAARAKAIQGVKCYPAGVT
FT                   TNSSAGVDPNDFTAFYPIFKAMEEEHLVLNLHGEKPSVAKEDIHVLNAEESFLPALKKL
FT                   HTDFPNLKIILEHCTTEAAVNAIEEINKNVTNISDVKVAATLTAHHLYLTIDDWAGNPI
FT                   NFCKPVAKLPRDRRALVAAATSGKPYFFFGSDSAPHPLEMKGRHIGVCAGVYTQSLAIP
FT                   YVAQVFHEANAMDKLKGFVSDFGLAFYDVPQSEIRSTQHAILYKQEQTVQDTIQGKNNL
FT                   KVALFKPGEKLDFSVKWQ"
FT   gene            complement(<438990..>439445)
FT                   /locus_tag="CAGL0J04620g"
FT                   /old_locus_tag="CAGL-IPF7044"
FT                   /old_locus_tag="CAGL-CDS4824.1"
FT   CDS_pept        complement(438990..439445)
FT                   /locus_tag="CAGL0J04620g"
FT                   /old_locus_tag="CAGL-IPF7044"
FT                   /old_locus_tag="CAGL-CDS4824.1"
FT                   /note="similar to uniprot|O13563 Saccharomyces cerevisiae
FT                   YLR421c RPN13"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60856"
FT                   /db_xref="GOA:Q6FPD7"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="InterPro:IPR038633"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD7"
FT                   /inference="similar to AA sequence:UniProtKB:O13563"
FT                   /protein_id="CAG60856.1"
FT                   /translation="MSEVVVRAGICEFDESSKLCDPLPVQGSIKMAPHEEGIELGFWSF
FT                   EWSPVEKTAKPMEPISLILIPGETKCVRLSSKNGRVFSLVFSSDQKYFFWLQEKNAGSL
FT                   KLDQFSENDLKFLEKLDSILKGPEEEEEEEAEDLTEKLKHEDVEMKD"
FT   gene            <439679..>445423
FT                   /locus_tag="CAGL0J04642g"
FT                   /old_locus_tag="CAGL-IPF7043"
FT                   /old_locus_tag="CAGL-CDS0040.1"
FT   CDS_pept        439679..445423
FT                   /locus_tag="CAGL0J04642g"
FT                   /old_locus_tag="CAGL-IPF7043"
FT                   /old_locus_tag="CAGL-CDS0040.1"
FT                   /note="similar to uniprot|Q06409 Saccharomyces cerevisiae
FT                   YLR422w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60857"
FT                   /db_xref="GOA:Q6FPD6"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="InterPro:IPR026791"
FT                   /db_xref="InterPro:IPR027357"
FT                   /db_xref="InterPro:IPR031057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD6"
FT                   /inference="similar to AA sequence:UniProtKB:Q06409"
FT                   /protein_id="CAG60857.1"
FT                   /translation="MVEVKRRWVPLNGLQFGVMVRSYLPLKRHPSLFYHNHQFMNVYAG
FT                   AEVYVFEESEDGKWCRAYFCCRPFPEEFIASSSSTNEKLPDVKPVVCVFPKCYVALDPN
FT                   RFVHIISFFKAPDRSDFENEQLAECKSPSLYDTLSESQDHEVAKLANSKPTRPPFPYFR
FT                   YQKRPFVDEMGPVLSLLCSHIYWMYSLGEFEIHTKLVGLYYELDNIRLRLRLQLTTEIE
FT                   RIKLIRAANSLLAKISKFISSKGRTNRFLIQSKSSNPDPYGFEGIFARDIITGELLSYH
FT                   DTELRTLMLSSMLYGLTNNFPNTESSILQFEAPKCEVYDRAKSHILIDFKSITSDPSVL
FT                   NPNLENATAITYLMTPNERLTDPIEFQIPNGKRDTSFVTLLFESLFHSVIKKNKIYLVL
FT                   IITETVDINTNTMKSKAALSSFKEPFIPFKENDESLLHKLKRGIVAGVIDISPVFSKQK
FT                   GIAHADTPHRFVINLFGSRFKSGFCPSSASQNSYDDQETLLGWGALVNNILSDSTMGIA
FT                   INPRALSVPVTVKEILDEPFADKVRSSNIISVLSVPMKVNRNKIEKKESLYLTLGCVCL
FT                   CDIGQKETNIKNIAVQVNSKNDKVKFSYSDLGVKRNNWNFISVRPGESIGETVRIDGLE
FT                   HMAEDESIRVLVFLNGFLMAKSNICIKKNGVFLEYKKFTGFHLMSSIGQKLVNLQLKLK
FT                   YNGANYNIHPSISKFLVFRDYSDMLAECKKQSVDCIISGLQDAPLPQLIVHFHSLLRKL
FT                   LQYFKDVKELNHDKEGKKNRLTVFANLVGLLNSLVVDDVNDICFFEEFYENLPLHEPEL
FT                   SMTGIEIVNCMSDVFEPGFECWHKIGRQACKAFVHLLLLSTISCLDYMNEWKQAVKSLF
FT                   VNITKFLSLTEESIYYDQILILRAYPLCISALHQYFEPYELLIVTDRLFGSCQEKDNKL
FT                   NFTQKCISPEEEKYLGEKFSSLLSVITHKSLQTYLFDCNDNSNMKLEFFSRCIEWVQQP
FT                   YFYYSDNNDVISYTRVANTVMMTLLENITNVQILRNLIRLIPRYCEYFILIRKYCKKAN
FT                   FFRTRRIFTKLFPTQTAPFSIPMDSIVNDEVVIEILLEIATIICKITKMATTLYGKNPS
FT                   FLEIINECKNDTHFQSSAYIKHCSKETVLLITKTQKYFLKGDFFPCKKWLGVTALFARS
FT                   CLIMLTMCKQFMIKEFSPYPITRGNDMHFDEQLWADYFSALFMIANHKVSTLTRLAIIP
FT                   RKAVYLISGNLKKQVSSVLSECWTGLANESFDHDFLCKYGTGDVSSYQLQLLTNHPNIV
FT                   REIFRFGLNRHLQAVKTSTNIIWTMVLLFWNHYESLQPAINLCIPELFNAYQSGKFYMY
FT                   DDELERFMICLFYRIHIDEHDVMYNPLIDFLEKIMGFFHIVSETYKIPTQQEFDDDRTA
FT                   HRIEMFSYLLEADRPELFHKMVYDLFIHFIQKRDNVQAGLCLELLANTYEWDPNDFLSA
FT                   IAYPPLPEQSSFERKEYLFKEAARNFAKGLKLEKALSIYKDLTKAYDEINYDLNGLAFV
FT                   HDQIAAIYTELQSVDRLVPTYFRVALLGFGFPNSLRNRMFIFEGLPFEHITSMHDRLLK
FT                   IYHGSSIVQTLDEVDELLMHPPMGKFIHVCTVEPRFALSEQYSTSRKSELNNKIRMYIE
FT                   NRNLRTFSHFRRLAGSKSVTDLWVEEYTYGTVNTFPTLMNRSEIIEVSRRKLSPLENAL
FT                   RTLQMKIQELYGLENMCYKVIKEQSDYINVLNELSRSITGTISAPINGGISQYKVFLEE
FT                   ANRDKFDKNDLKLLMSSFDELVHALSKCLVLQSELSGTGSTNKSGHNLLVELFEENFAE
FT                   EIKRNRIDISTMSVDSIMKDSNKPVHNKSVVHKWHINSHWDRPNFGKSQRVKSDTNDNG
FT                   VPFGTSMLGRYLSSTRSQSRNASERNTAASSPMPYAIPDF"
FT   gene            <445793..>446146
FT                   /locus_tag="CAGL0J04664g"
FT                   /old_locus_tag="CAGL-IPF7041"
FT                   /old_locus_tag="CAGL-CDS5221.1"
FT   CDS_pept        445793..446146
FT                   /locus_tag="CAGL0J04664g"
FT                   /old_locus_tag="CAGL-IPF7041"
FT                   /old_locus_tag="CAGL-CDS5221.1"
FT                   /note="similar to uniprot|P32463 Saccharomyces cerevisiae
FT                   YKL192c ACP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60858"
FT                   /db_xref="GOA:Q6FPD5"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD5"
FT                   /inference="similar to AA sequence:UniProtKB:P32463"
FT                   /protein_id="CAG60858.1"
FT                   /translation="MFSRLVPRLATRALIPSTVIARPMLVTPMLMRQYSVKSKDEISQK
FT                   LIEVVKNFVKGESSQNVTADSKFHKDLGLDSLDTVELIVSIEEEFDTEIPDDVADRLTS
FT                   IRETIDYLASQKN"
FT   gene            complement(<446347..>447576)
FT                   /locus_tag="CAGL0J04686g"
FT                   /old_locus_tag="CAGL-IPF7040"
FT                   /old_locus_tag="CAGL-CDS2708.1"
FT   CDS_pept        complement(446347..447576)
FT                   /locus_tag="CAGL0J04686g"
FT                   /old_locus_tag="CAGL-IPF7040"
FT                   /old_locus_tag="CAGL-CDS2708.1"
FT                   /note="similar to uniprot|Q06410 Saccharomyces cerevisiae
FT                   YLR423c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60859"
FT                   /db_xref="GOA:Q6FPD4"
FT                   /db_xref="InterPro:IPR007240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPD4"
FT                   /inference="similar to AA sequence:UniProtKB:Q06410"
FT                   /protein_id="CAG60859.1"
FT                   /translation="MPESLAERARSTLLKAQVLCREVESRIAEVKDRLSQWEKNRHTLR
FT                   FLVSCLEHQLGFLEQCALRQGIGRALIETEWSQVVLVDLVNEMKLWYDKIQLRLERLDQ
FT                   VENILVADNKHLSHYISQEQALVLKKRLDEVPIIRPQIENIQTQYDTMCKRVRQKLINK
FT                   RLTEIKTIFDSQFGDELTETAELTEVKPRDLDSIELELVDYINSLTDHFDKCQALEKGL
FT                   FNDSNEYDELLKIVSADDSQLDDIMKHLLNTIDSTNHQIDKVYEILDIKTKQKTILHGK
FT                   INELIANCTKYSEYLAIFKGIATSIEKFKEGCMQDIQLTKELYKFYDEFENSYNKLLQE
FT                   VQRRRALSQKMLGIIKNCENELKTLHDEDQKLRTHFLSENGAFLPETIWPGEIDDLSPL
FT                   YALDYHIKEI"
FT   gene            <447836..>449728
FT                   /locus_tag="CAGL0J04708g"
FT                   /old_locus_tag="CAGL-IPF7039"
FT                   /old_locus_tag="CAGL-CDS1350.1"
FT   CDS_pept        447836..449728
FT                   /locus_tag="CAGL0J04708g"
FT                   /old_locus_tag="CAGL-IPF7039"
FT                   /old_locus_tag="CAGL-CDS1350.1"
FT                   /note="similar to uniprot|Q06411 Saccharomyces cerevisiae
FT                   YLR424w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60860"
FT                   /db_xref="GOA:Q6FPD3"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD3"
FT                   /inference="similar to AA sequence:UniProtKB:Q06411"
FT                   /protein_id="CAG60860.1"
FT                   /translation="MGLEEQYGFGARLLKKLGYVEGQGLGSDGRGRASPIEVNAEQHGT
FT                   HAGLGMLSKRATAEDIDMHITSSSDEGREVNENARARPLQFKKTDATKPSSDIIYQIEA
FT                   LGLPVDANVLARHPNASTIVEELVTKQRTLDAIVRKVEVVKQELDDVETQLNTLRNLQH
FT                   SEMSLLDKISEVLKLNNETIIDELAAKILKDELQKYNNLSLKDDRITNTLEPVVELLQY
FT                   ALESDPGALNKNQTQLYQWLCPRIEAAITEIDFKNSDSVDSIIYILVEYELILKYIMMY
FT                   DKLIDKFLMPRLLGLIKEWAPERNGIDHHFYDFYILLNQEQRKKLQDALKVIFSDYCSG
FT                   WYHKDAFHFDCHYFKLIFGETVFYSITEKKLLPIMVKQLYEEHFTLVDDLEDWSDINHD
FT                   REGPAYCFKKVKEFANFLTNTQITTIMKGMFNDIRKLVFQWYLFSEPNDWQNCQNLIHD
FT                   FFNIVYAEESKISDFEITELREILRMGTEVGKLSTVCYDREFDILKELHLKKREFIDLE
FT                   RDENDHPNVIQIDDSDEDMRDSDGYTVQDIPIRRVDATFKEILQRYCEENGYEMIRDTT
FT                   NYTQLPYGINGTSLVPIITIRKGTKARKVAIKDDILWIEGLSGYRPEFLYNLTL"
FT   gene            complement(<449942..>450015)
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CAGL0J04730r"
FT   tRNA            complement(449942..450015)
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CAGL0J04730r"
FT                   /product="transfer RNA-Asn"
FT   gene            <450562..>454479
FT                   /locus_tag="CAGL0J04752g"
FT                   /old_locus_tag="CAGL-IPF7038"
FT                   /old_locus_tag="CAGL-CDS0189.1"
FT   CDS_pept        450562..454479
FT                   /locus_tag="CAGL0J04752g"
FT                   /old_locus_tag="CAGL-IPF7038"
FT                   /old_locus_tag="CAGL-CDS0189.1"
FT                   /note="similar to uniprot|Q06412 Saccharomyces cerevisiae
FT                   YLR425w TUS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60861"
FT                   /db_xref="GOA:Q6FPD2"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD2"
FT                   /inference="similar to AA sequence:UniProtKB:Q06412"
FT                   /protein_id="CAG60861.1"
FT                   /translation="MYRYNTPNTPERSKGGNTRSRDSPGVQGDVILPKLPPLNTRSSFL
FT                   ESDMMQSDVSIGWTPLTENTISTSGQFADEHIGYGNSPQLRSPKSPANRRNSLIYENFN
FT                   GDSPMSVKSVGNGKSRRRPPPPSLQHSISQLDSYQSSPGSPATPFITKRRTNDFITPTK
FT                   TKPYKSPFVGEQDIEDSMLQQSTHFAGKVYKSPFVGDLDSDIIISPSNANETTKTRKES
FT                   SRVQSKTISNTELNFYSKPQIPLTSSRNITGISRFSDQVESFYSDSNYTFNNSSARNSS
FT                   FNSFLGAKPLQYAPSVTAPTQAFSIDLIDEHKLYQCYSIYRLSDIYEWLLKVYFEWFNE
FT                   YIFEKLDLFQIVQLLLEFQSPKTYEQEVIDSNVDRIMSSLINQGAIKFEVDNEQEIAVI
FT                   VAGLTISSIFTDLLPCYSFIDSTFNEFDHSTICYSTTCCNRLSNESRQEIKVSEIINKS
FT                   VGLWTDYWQLSAEELSEINPKEIQRQSFIFDLIILEERSLSMANAAVEIYGKRFDPDLL
FT                   PDETNFASLAFDIFLPIIEIHKEFILKPLFWKIKTRGKFIDGIGKIYLKWCHEVRDAYL
FT                   NYANAMATVHEVISWEKTHHTKFAEWLLETDNLPEITRSKMYHDVIFFGGYFKSLQNMP
FT                   VTLSSILKNTSPSSEDYGALQLVIKEVTQLSADVDKVHGMAIDRRKLIRFSKQLVYSSG
FT                   NKGSTTGYINIGNPEKMVKGDKLSLGLADPKRVMINCDTVLKKSDHWLEPYPVFLALLD
FT                   NFLLITELVSKGLEKKYKLIDRPIPIEYLNLEIKRAPEEFNKDLPLGDSRPTSQIVSDL
FT                   DNKSSLNSRSSVVGDLNYGHTGISNNLPSSTEFAFKVRNTATNDSYTFYVPNSIEWNNW
FT                   MNAFKCCFKNRNNDDNRHPINLSIITAEFSYQDRNAPVNLPVAPEGSEIDSALKTYKRY
FT                   LKDEFENIATTVFCSTEFDNEDTKFNLIATNSGVFLRRKNDYTTKFVKVLQNISVSRLQ
FT                   AVPKLGLLFVLDGQKLCYFSISSILAVYYNPERFLNANFVVGIVLKDKVSFFKFADDFG
FT                   NSKQLFYERKGKIVVSTPEFHSIMNNFNCFKIYKKYYLPSSSKMLASHSISDIVIFKKS
FT                   FMVFTKKNVFLFNDAFNELGASLPGFYNDKEMIAYIKHPHLNSGRFSSSSSKLDANLSM
FT                   VTDVKKDIASGKTKPITAFRLQSGDGFLMVYDEAIVKINSSGMIPNWKNDILILDFYCT
FT                   GASYHNGYLFLIGENLILVYQLSYEGTPISELTPVQIINSKKIELLNSGGMDYPTVTSS
FT                   HPKIPNRQLLFSCIPANYQVK"
FT   gene            <454697..>455792
FT                   /locus_tag="CAGL0J04774g"
FT                   /old_locus_tag="CAGL-IPF7037"
FT                   /old_locus_tag="CAGL-CDS3420.1"
FT   CDS_pept        join(454697..454782,454862..455792)
FT                   /locus_tag="CAGL0J04774g"
FT                   /old_locus_tag="CAGL-IPF7037"
FT                   /old_locus_tag="CAGL-CDS3420.1"
FT                   /note="similar to uniprot|Q06417 Saccharomyces cerevisiae
FT                   YLR426w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60862"
FT                   /db_xref="GOA:Q6FPD1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD1"
FT                   /inference="similar to AA sequence:UniProtKB:Q06417"
FT                   /protein_id="CAG60862.1"
FT                   /translation="MGFDIDFILSYVVFPLLRFPVPIAFACSKLYAIVVFSIWTLIING
FT                   FYWLELWFRSRGEQTWKSLNELHDPIVLITGGSNGLGRCIIHKLLRSYNNIKVINLDLD
FT                   VQYWSEEARVINIECDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPI
FT                   DEMQRIMNINTWSTARILQAIIPRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITA
FT                   LHNSMTNDFLVRGIGNIRTLLVLPGQIDTQMFDGFPPPRKFWAPIVCPAALAEAIIDHC
FT                   ENGLRGTLRTPLYSYFPEFLMGIPYLLQRFARNFSKMDNCLPIETISSKRSLASVDL"
FT   gene            <456300..>458099
FT                   /locus_tag="CAGL0J04796g"
FT                   /old_locus_tag="CAGL-IPF7036"
FT                   /old_locus_tag="CAGL-CDS1511.1"
FT   CDS_pept        456300..458099
FT                   /locus_tag="CAGL0J04796g"
FT                   /old_locus_tag="CAGL-IPF7036"
FT                   /old_locus_tag="CAGL-CDS1511.1"
FT                   /note="similar to uniprot|Q06436 Saccharomyces cerevisiae
FT                   YLR427w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60863"
FT                   /db_xref="GOA:Q6FPD0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR039739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD0"
FT                   /inference="similar to AA sequence:UniProtKB:Q06436"
FT                   /protein_id="CAG60863.1"
FT                   /translation="MSSSTNSNSSTRKSRNQGNGKTDTGRPRRRQNNGGSKFTKYDLDK
FT                   QERFDASIEQELNQGNFKMRGRKTKVSIDHLLDFQLPEVQRENHTHRKVNKRRIDSHTY
FT                   LHGESFINVNYRLLVSDRYDYKDQENDPNKFVDKEKIVRVIVPRGQNCPICLNEIPVAP
FT                   RMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLCGSIVKPNNVKEVLFEE
FT                   DYSFNKQAFQEGSDHRPEPGHEASLVLMCKPHGSILALPISLDIDPKKVGDIPPANIEE
FT                   ISEYSHIMKCGDDYALKYYQLDMDAIENQYEIDKALYSDSGKYVKVALDKIRQNISTIL
FT                   SKDDFNSSINHITEDFMNKLHFDGNQSYDDTSAYFFYQTNFQSPIKYYLSPLDIKILLT
FT                   IFGHYSKFPELLEVKIENIHYGNIVTEALIKRYKYLGHLPYGTEIALLDLDWRSVPFIE
FT                   KDVYNRFASELKQRRRKLIIRKQREDQEKKKYEERLEQEQREFYQRENSNFTGWEPQIN
FT                   KKDIQLTSLPAPVKPPQNTEAKLSKYNEKTIWGTSIEITEDEKTTKENKEFEDMLLQKM
FT                   RQEKSNKKKKGKIMLFSNTQQHL"
FT   gene            <458449..>460413
FT                   /locus_tag="CAGL0J04818g"
FT                   /old_locus_tag="CAGL-IPF7035"
FT                   /old_locus_tag="CAGL-CDS1254.1"
FT   CDS_pept        458449..460413
FT                   /locus_tag="CAGL0J04818g"
FT                   /old_locus_tag="CAGL-IPF7035"
FT                   /old_locus_tag="CAGL-CDS1254.1"
FT                   /note="highly similar to uniprot|Q06440 Saccharomyces
FT                   cerevisiae YLR429w CRN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60864"
FT                   /db_xref="GOA:Q6FPC9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC9"
FT                   /protein_id="CAG60864.1"
FT                   /translation="MSGKFVRASKYRHVFGQAAKKELQYENVRVTNNAWDSNLIKSNGK
FT                   YLSVNWNSSGGGAFAIVPVSEPGKLPDQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDG
FT                   KIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLASSSLDYT
FT                   VRIWNVETGEDIYKLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAH
FT                   AGAKNQRVVWLGNSERLATTGFSKLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPF
FT                   YDDGNKILYLAGKGDGNIRYYEFQNDELFELSEFQSIEAQRGFAVTPKRLVNIRENEVM
FT                   KCYKTVGDQRIEPVSFYVPRRSEEFQEDIYPDAPSNKPALSADEWFSGKTTEGPILVSM
FT                   KSLYDGAEPELHQSHKAEATVKVVPEPAIKIEKKKPAEKPVEKEPTPEPEKPKTVGNAN
FT                   EVLKSDNSIDKLLQKSSDLDMTNNVEDPSKDTSGWDEEDDKPISVNVDSTASSTVDKVD
FT                   VNIQKEQEPKKSEESSKVPTPVKSSTPEPVKTEMPVSKITPTKENKTMEPVRESTPVTE
FT                   KASTEKESVSTPRSTSSKDEAATPGKSAKSLGLKQSVEKLSELVLKLQQTVDDLRESNL
FT                   QKDDRLKALEEKIDSLLKK"
FT   gene            complement(<460655..>461893)
FT                   /locus_tag="CAGL0J04840g"
FT                   /old_locus_tag="CAGL-IPF7033"
FT                   /old_locus_tag="CAGL-CDS2686.1"
FT   CDS_pept        complement(460655..461893)
FT                   /locus_tag="CAGL0J04840g"
FT                   /old_locus_tag="CAGL-IPF7033"
FT                   /old_locus_tag="CAGL-CDS2686.1"
FT                   /note="similar to uniprot|P47051 Saccharomyces cerevisiae
FT                   YJL046w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60865"
FT                   /db_xref="GOA:Q6FPC8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC8"
FT                   /inference="similar to AA sequence:UniProtKB:P47051"
FT                   /protein_id="CAG60865.1"
FT                   /translation="MLKLGTRLLPALPARRTSMVRYMATNTPFDLDESDPKYKELNTMY
FT                   EEMFSGETVPYMSNDATDEVSEVDLLNEEIDSLYNVGMNNPRHIKINTSTELNKLIKGE
FT                   GPFVLRSISHNPYFNLALEDYLFRNTPIDKNSKSFDSHRLVFYINNKCAVIGKNQNIWE
FT                   ELHLQKLKEKGYEVLRRLSGGGAVLHDLGNVNYSYICSRDEFDTKYFNGRIVSWLKQYN
FT                   HALPVSLNQRGDILSNGFKISGSAYKVALGKAYHHGTMLIKSNLSDFKGLLKPDIIEGI
FT                   NWETNSVVSVRSPIENLPLPSPDTFIDLCTSQFNKMFHLNNNSYVCNESVMENNDDIKE
FT                   TMQKLQSNDWKYHSGPKFKVHIRDSKTGKEHSIAVEKGFIVDSTLKGVEAQDFNNFLHN
FT                   VDKYITVNKANIL"
FT   gene            <462163..>464562
FT                   /locus_tag="CAGL0J04862g"
FT                   /old_locus_tag="CAGL-IPF7032"
FT                   /old_locus_tag="CAGL-CDS0815.1"
FT   CDS_pept        462163..464562
FT                   /locus_tag="CAGL0J04862g"
FT                   /old_locus_tag="CAGL-IPF7032"
FT                   /old_locus_tag="CAGL-CDS0815.1"
FT                   /note="weakly similar to uniprot|P47050 Saccharomyces
FT                   cerevisiae YJL047c RTT101"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60866"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC7"
FT                   /protein_id="CAG60866.1"
FT                   /translation="MNVEASLRELGELFDTAGSIAQSNIHLVSIPDKDRDFLVWRANML
FT                   RFQCQYLTQRRDFDINELDNGDSHSSGRKRLKTDSSARLYTAISEFWKFISSRIETLAD
FT                   QYALMVVDHYNLNQDLDWYAEQHNGVFRYFNVSMEMLLDTFERFISLLAPITEYSFLNY
FT                   TKIMRDLCCFHSAFDFAFVSLIKKLKLYMGSNFKLILKDSFEVLKDKNYQQEGKVQYSL
FT                   ISLFHYYKIEVDENVTVSEFVNELINHDISELTSRDISDDYFERISSGATAEMLLIKCC
FT                   GFPEQTESRYVSLVLDKQVFFKILACQLDKLDKILKSGNCNIKLRKNDVQYSLCAYYTR
FT                   HGKKDDYYRLVSVFFNDRFKNCPLERNISEVIFIECTKLMLLFYFDNQILQILMSSLCE
FT                   KFGGVLKMYENYEKLLEYKIRKYNRSHELWNKNNSDIEKPYRLSDDIKKHQYYERFLIM
FT                   LPSRLKFDSSFLRLHQQKLFRRAVLQGPSIYESISDFSYLEMNILFSLISEYETSDEFH
FT                   YLYDLYTSLRKSYVFYQQYSKDHGDQVVPLVIDKKSVPTAFQKEENENVILPEILQRQW
FT                   GKLVEYYNSTLKTSASRTLVPAYALQHCDVETEFLVEGTRDKYVTFNISVYQTCVLNLF
FT                   NDHDKLDIAKIMQLTGLSERMSKAVITSYLSAGIFKEDKGTYTIDSSFKADPRKLKDGK
FT                   LRIPMAPGPPSRLRRDTSSSSSTASATVSTSASHNEGYSSLWIQEVIKAAIVRTLKANG
FT                   KPMNFDTLFEQIKTGINGVSVGECKESINRLVSEKIISQTAEGYTY"
FT   gene            <465532..>466518
FT                   /locus_tag="CAGL0J04884g"
FT                   /old_locus_tag="CAGL-IPF7030"
FT                   /old_locus_tag="CAGL-CDS3338.1"
FT   CDS_pept        465532..466518
FT                   /locus_tag="CAGL0J04884g"
FT                   /old_locus_tag="CAGL-IPF7030"
FT                   /old_locus_tag="CAGL-CDS3338.1"
FT                   /note="weakly similar to uniprot|P38349 Saccharomyces
FT                   cerevisiae YBR273c or uniprot|P47049 Saccharomyces
FT                   cerevisiae YJL048c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60867"
FT                   /db_xref="GOA:Q6FPC6"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC6"
FT                   /protein_id="CAG60867.1"
FT                   /translation="MDVESLLWLSIRDSRRIIVTVTDEPMGELADECQIVRLSRDSGSF
FT                   QRFVSVFNSSKTALYYYIEGPTVVEARSLDELKARFPNKNSTRPYESERQRIIDLINAD
FT                   KLERNSRSRQLSGYTALSSEVVLKDNIKNNKSDICTLKIRMTNGDYVQYDFDSNTSLGS
FT                   VRRWLKDYRTDGDFPYLFHQNISRKSIRITEEYKTLAELDLTPRSILMLKQYDLRPRTR
FT                   VPKPRKRSWYWQFLTVRIKRQLLEGLSEILASHRTTSNIMRSSSMSYLQADDSNMTKIT
FT                   NSLPPNDDNSEDIVKIKQKYNQNTGSIMNTPLEIARPDSPSVLQINT"
FT   gene            complement(<466782..>468128)
FT                   /locus_tag="CAGL0J04906g"
FT                   /old_locus_tag="CAGL-IPF7029"
FT                   /old_locus_tag="CAGL-CDS2417.1"
FT   CDS_pept        complement(466782..468128)
FT                   /locus_tag="CAGL0J04906g"
FT                   /old_locus_tag="CAGL-IPF7029"
FT                   /old_locus_tag="CAGL-CDS2417.1"
FT                   /note="similar to uniprot|P47048 Saccharomyces cerevisiae
FT                   YJL049w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60868"
FT                   /db_xref="GOA:Q6FPC5"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC5"
FT                   /inference="similar to AA sequence:UniProtKB:P47048"
FT                   /protein_id="CAG60868.1"
FT                   /translation="MDKLVSQSRLNSLYKDFRPLKELNFDGYVANVNDWQNYLLKKYFP
FT                   KQDKICVTIGTRFLQDISDKKYGAPASIDVVIDNLIQENILIKLDEFKNSATKRDEKTI
FT                   TRIFSWIHASSIGKLNRYQSRKNDNATNYLKQDTFVIRPLLEEKFTKIYDIIRNNILAK
FT                   ATTVCDLIFPLEDFIDFSGISYTLPSDSLIEWEVMLNYLEYHKNTITRKENIVKIIDPL
FT                   VESIYKQFGVEITETDQSIAEIKQCFTNIENAIEKYEIEVYEYKMKLKGDDFKKLTKIA
FT                   QTEYKRGYFLAQKMLLKLFKFRNNLVEVKYQLDMSVSNLVLYKTLQSSNKIITTINGKI
FT                   GPAEKVHDLLEEIRERSTDNEEITKVLSMEISKFDDDELDEELKEMEKELAGQEISKTQ
FT                   SEKNKEDDESKILEQLENLNIKDEQSLNVVNNNSNKKHNEKFMLREEAA"
FT   gene            complement(<468765..>471962)
FT                   /locus_tag="CAGL0J04928g"
FT                   /old_locus_tag="CAGL-IPF7028"
FT                   /old_locus_tag="CAGL-CDS0361.1"
FT   CDS_pept        complement(468765..471962)
FT                   /locus_tag="CAGL0J04928g"
FT                   /old_locus_tag="CAGL-IPF7028"
FT                   /old_locus_tag="CAGL-CDS0361.1"
FT                   /note="highly similar to uniprot|P47047 Saccharomyces
FT                   cerevisiae YJL050w MTR4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60869"
FT                   /db_xref="GOA:Q6FPC4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC4"
FT                   /protein_id="CAG60869.1"
FT                   /translation="MDSNDLFDVFSAVPEEVPDVSDEEIENDSAKVPKSNEKHTLTSDE
FT                   EDGESNKKVKPNKTSGSKKETSKIIPIVADDFEQEASREVDASAGLSTQATTEVEEDGK
FT                   VKLSHQVRHQVALPPFYDYKPIGQHKRTNEARTYPFTLDPFQDTAISCIDRGESVLVSA
FT                   HTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINP
FT                   DAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRY
FT                   VFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTF
FT                   REENFQKAMTSIGNQAGDDPNSTESRGKKGQTFKGGAAKGDAKGDIYKIVKMIWKKKYN
FT                   PVIVFSFSKRDCEELALKMSKLDFNSDDEKDALTKIFNNAIALLPENDRELPQIKHILP
FT                   LLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWD
FT                   GQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFH
FT                   LGYNMILNLMRVEGISPEFMLENSFFQFQNVIAVPVMEKKLIEYQQQYDNIHIEDESGI
FT                   KEYYEVKQTLKGYYEDVRKVMTHPAHLLSFLQPGRLIEVVVDGNQRYGWGAVVDFAKRV
FT                   NKRNPTAVYSDYDSYIVNVVVSSMYVDSPINLIKPFNPAFPEGIRPAQEGEKSLCAIIP
FT                   ITISSITNVGNLRLFMPKDVKASGQVDIVGKSLKEVGRRFPDGIPLIDPVKHMKITDDD
FT                   FMKLQKKIQVLEEKLKTNPLHGSVKLNELYEAYNSKHELSDAMKKLRAKITDSQAVIQL
FT                   DDLRKRKRVLRRLEFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFTELKPEQAAA
FT                   LLSCFAFQERCKEAPKLKPELSEPLKDLRELAAKIAKIMKDSKIEVVEKDYVESFRHEL
FT                   MEVVYEWCRGASFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNQALREKMEA
FT                   VLKLIHRDIVSAGSLYL"
FT   gene            complement(<472406..>474844)
FT                   /locus_tag="CAGL0J04950g"
FT                   /old_locus_tag="CAGL-IPF7027"
FT                   /old_locus_tag="CAGL-CDS0780.1"
FT   CDS_pept        complement(472406..474844)
FT                   /locus_tag="CAGL0J04950g"
FT                   /old_locus_tag="CAGL-IPF7027"
FT                   /old_locus_tag="CAGL-CDS0780.1"
FT                   /note="weakly similar to uniprot|P47046 Saccharomyces
FT                   cerevisiae YJL051w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60870"
FT                   /db_xref="GOA:Q6FPC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC3"
FT                   /protein_id="CAG60870.1"
FT                   /translation="MQGSRMLLMLASAVSFACGSMVIALLAQIRSITGALTVIVCATYL
FT                   YGIAAFLSAVCGAKLAALNGSGLLVSFSLEMITLWASVYVFHRTNQASFMAAINHSSQR
FT                   VLTSFQSLLVLKLLVSGLSIGAQINKQQPPIGDQENLPLEDSTKLVSDPEKFIPMKNSA
FT                   QTLTPGMEITTNVPTRDANQNLDGRNALNSVTVVTDPNVTRTRYDSSALSGGSVIRHPL
FT                   VNIANLNNTSETQMTKRRRKRLLRQFKTLHVRFKGRKTVPKALPLQVENDSQTDLHTTN
FT                   KRGTILSDISGLSKGLIPFVGNNSDKESKHENSSYSLILDLAHNRNEQLSIQNSPQMEV
FT                   ERSAIGRFDNMLLPPYLRINPSAPKTPEVNSDHVNLLDIPHPQEEMLMKTSSNHSNVLD
FT                   EFDLHTIEGPNDNVFAHDDYPTTEHVNYPSHISLEMWEKNKEDYLNTSRTKSKSLLLPI
FT                   FTQDSFMDSSNINLKKLETLQESENNSQLVGLGINTSSGFSFPSKDTVESEDKLYMAPI
FT                   SGSNEESIVETPISPNKVSNEFYNNDDAISALDEYLKEEEHQENIDDSIMEESLNQNLS
FT                   SSFILDSYGNNEVLARHSPTKSVISIMSGNTSLNHKRSYSKIASFLGHSRGNSLVTQTR
FT                   LPNNSIHSSPTKSERRQRLSQKLSFSNLSDFGSPTKWENKNSNQKYNNSIGHKLNKSID
FT                   FSYIHSLQGNDGNSPTKNNIRRHSTIWDQMTQDQRRHSVATDVMYDFPSNQNSKSSFQV
FT                   HNINTTRFEVNIPNPELREVSGGTIETSLSDETERYPEQAMSEYDKEKWNTLNEPVPNI
FT                   "
FT   gene            <475587..>476606
FT                   /locus_tag="CAGL0J04972g"
FT                   /old_locus_tag="CAGL-IPF7023"
FT                   /old_locus_tag="CAGL-CDS3253.1"
FT   CDS_pept        475587..476606
FT                   /locus_tag="CAGL0J04972g"
FT                   /old_locus_tag="CAGL-IPF7023"
FT                   /old_locus_tag="CAGL-CDS3253.1"
FT                   /note="some similarities with uniprot|Q12100 Saccharomyces
FT                   cerevisiae YDL025c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60871"
FT                   /db_xref="GOA:Q6FPC2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC2"
FT                   /protein_id="CAG60871.1"
FT                   /translation="MVIAVADQRPRGFRSAFSGIFSKTDKRATGKKLAADALSLNSKAI
FT                   KFAKGTTCDVVVSLDKKTGQTVAKKVYNTDRDPSKDYRDYMVTVLRNEYDILVTLRKSK
FT                   YVVNVYDLDISKRTIKMEFLPFSLSRVLSMDLSPSLQEKKCYFLQICEAVQYLHSRGIV
FT                   HRDLKLENIMLCADACQIKLIDFGVAVNRQDPQSLTTACKGMCGTEALMAPEVLGSISY
FT                   VGEYADCWSVGIIMFQIFNISNDSVRWKPRYPWESARFSNSIYKIYSEEADTSVVLTNL
FT                   EDDEDLKELILLFLHIDSLKRLTMKKALESKFLASIKGVKHSHDRTLRVCNKVFQLKH"
FT   gene            complement(<476763..>477782)
FT                   /locus_tag="CAGL0J04994g"
FT                   /old_locus_tag="CAGL-IPF7022"
FT                   /old_locus_tag="CAGL-CDS3252.1"
FT   CDS_pept        complement(476763..477782)
FT                   /locus_tag="CAGL0J04994g"
FT                   /old_locus_tag="CAGL-IPF7022"
FT                   /old_locus_tag="CAGL-CDS3252.1"
FT                   /note="highly similar to uniprot|P40335 Saccharomyces
FT                   cerevisiae YJL053w PEP8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60872"
FT                   /db_xref="GOA:Q6FPC1"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR028934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC1"
FT                   /protein_id="CAG60872.1"
FT                   /translation="MFFKSPVDIEIQLDGEETRKHVDVTNTSNSKTLKESYPLFEDGES
FT                   ISGNITMRVRDGRRVEHLGVKVSVIGSIDMVNGVGSGKSNSQSSFGTSTDVNKKCVDQF
FT                   LTLSYDLCPPGELQHTKTFPFLFKDINKQYESYTGKNVDVTYAVKVTVIRKSADVSKMK
FT                   RLWVYLYNDLSKPIIENTNLINTDTSEGENSDKNKVEAFKKPVKLDIGIENCLHIEFEY
FT                   SKAEFSLKDVIVGRIYFLLTRLKIKHMEISLITRESAGIHTGNTLTDTTAVRYEIMDGS
FT                   PVKGETIPIRLFLGGYSLTPTMSNNQFNVKNYLSLVIIDEDGRRYFKQSEIILYRTRQ"
FT   gene            complement(<478312..>479670)
FT                   /locus_tag="CAGL0J05016g"
FT                   /old_locus_tag="CAGL-IPF7020"
FT                   /old_locus_tag="CAGL-CDS2377.1"
FT   CDS_pept        complement(478312..479670)
FT                   /locus_tag="CAGL0J05016g"
FT                   /old_locus_tag="CAGL-IPF7020"
FT                   /old_locus_tag="CAGL-CDS2377.1"
FT                   /note="similar to uniprot|P47045 Saccharomyces cerevisiae
FT                   YJL054w TIM54"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60873"
FT                   /db_xref="GOA:Q6FPC0"
FT                   /db_xref="InterPro:IPR021056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPC0"
FT                   /inference="similar to AA sequence:UniProtKB:P47045"
FT                   /protein_id="CAG60873.1"
FT                   /translation="MNPALKALGLGNFKLPSRNWTIFWTVLAGSLGGVGYDKYQQRQII
FT                   SRYCDEVKPLSLQHCDVNKSPRKITVFIAPPPNDYLETSLKIWRRYIKPVLYYAGLDYE
FT                   VIEEDRQGIIRSEVASRIRQLRRELLEADNEQQGNSGDSLLSIFKKPHAKDPEEEQKFD
FT                   PEQARQFKADFDFRNVMGIYTKVPKLDTIVQTDSLVADPVLAGGVVCVGRGAYKEYITG
FT                   LHEGLLGPLDPPEETTQEVEMGSKLKSMNDGDNVETTVETAVETMVETTLESADKVEVE
FT                   GKDTENEEGKDEPDEEKSRVLKPYLLRTAFHDTPIPPEVEPVLEKDALLKDPKTNVPSL
FT                   LHQPVLVIPVPNLIGFLTIPERIYRFYQRRFFVDEVCREASNLVKQEHIVKYEPDKHIN
FT                   LALEEESDWPKQWVKTGIEKNSEWTQELVQDQRVVSKMHVFELPKHTTKDTKE"
FT   gene            complement(<479913..>480581)
FT                   /locus_tag="CAGL0J05038g"
FT                   /old_locus_tag="CAGL-IPF7016"
FT                   /old_locus_tag="CAGL-CDS4237.1"
FT   CDS_pept        complement(479913..480581)
FT                   /locus_tag="CAGL0J05038g"
FT                   /old_locus_tag="CAGL-IPF7016"
FT                   /old_locus_tag="CAGL-CDS4237.1"
FT                   /note="similar to uniprot|P47044 Saccharomyces cerevisiae
FT                   YJL055w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60874"
FT                   /db_xref="GOA:Q6FPB9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB9"
FT                   /inference="similar to AA sequence:UniProtKB:P47044"
FT                   /protein_id="CAG60874.1"
FT                   /translation="MKSVCVYCGSASGDKSFVAAAEELGALIHARRWSLVYGGGTTGLM
FT                   GGVARGAMGPSKDGSVHGIIPDALVAKERSDGGGAGQEQEQEQEEYSEPVNGTTVVSSD
FT                   YGETTVVPDMHTRKRLMASMSDAFVALPGGFGTLEELLECVTWSQLGIHNKPVVVLNTN
FT                   GYFDALLRFFRDAIAAGFISEANGSILQVASTPQEAIDLIVNYKVPEGRFNLKWSDEGL
FT                   "
FT   gene            <481253..>483394
FT                   /locus_tag="CAGL0J05060g"
FT                   /old_locus_tag="CAGL-IPF7013"
FT                   /old_locus_tag="CAGL-CDS1048.1"
FT   CDS_pept        481253..483394
FT                   /locus_tag="CAGL0J05060g"
FT                   /old_locus_tag="CAGL-IPF7013"
FT                   /old_locus_tag="CAGL-CDS1048.1"
FT                   /note="similar to uniprot|P47043 Saccharomyces cerevisiae
FT                   YJL056c ZAP1 metalloregulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60875"
FT                   /db_xref="GOA:Q6FPB8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040792"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB8"
FT                   /inference="similar to AA sequence:UniProtKB:P47043"
FT                   /protein_id="CAG60875.1"
FT                   /translation="MVEGVVHGHIHNSERYTYVHGHVHHDSEECEGFEDCRVPGMNMLN
FT                   LNMGMNMGMNMSTNMDLQAMQVQANPHAHPHAHAQAQMFHEYNSASSSGASSPVQCCNP
FT                   NILEICCDLDHPVSNQIGATGGSAGSAGSTGSTGSTGSAGSAGSAGHSGPGSASMTNNA
FT                   MSLNTASSVFTNDFSKDMMIFTDNALTQLANTGTATATNTTTTASTSPIGTRNDTAAGN
FT                   EDEDMKILQDLCNISQLYELPMAKHINHHHHNHGNVVNLLEDTHLCGGGDANQNANSGD
FT                   GHACDGSHQTDAPCTGNCTSGKPHHHHRIQVHPHDMKEYKPHRKRRKLVESPMFGSRKL
FT                   VMSPQPLTSHDRHIPADFNDLNTNTINFNWNFRDDDDIHCQWDDCGETYTTLFDLQRHM
FT                   LKDHITNEDKHNIFNGESEHLSHCQWKDCEFKGGDICSLVNHINDEHGIHFEINVLEND
FT                   TSVSNSSAPSCASSIKSSLHFDSPHPDIRSMSSPVMIKAEQENDLNNSNSTRTRARQRV
FT                   SRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNK
FT                   TFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHICHKRFA
FT                   ISNSLKIHIRTHTGEKPLKCKVCGRCFNESSNLSKHMKTHMKKYFCSQCSRSFDTLEKY
FT                   KAHELRSHPKTIKDQQIAT"
FT   gene            <483782..>485743
FT                   /locus_tag="CAGL0J05082g"
FT                   /old_locus_tag="CAGL-IPF7011"
FT                   /old_locus_tag="CAGL-CDS1259.1"
FT   CDS_pept        483782..485743
FT                   /locus_tag="CAGL0J05082g"
FT                   /old_locus_tag="CAGL-IPF7011"
FT                   /old_locus_tag="CAGL-CDS1259.1"
FT                   /note="similar to uniprot|P47042 Saccharomyces cerevisiae
FT                   YJL057c IKS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60876"
FT                   /db_xref="GOA:Q6FPB7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB7"
FT                   /inference="similar to AA sequence:UniProtKB:P47042"
FT                   /protein_id="CAG60876.1"
FT                   /translation="MSLVPYKEGSIILNDPSSRSLAIVDPKIGSVAIYKQINARVEHLR
FT                   SDRRSSVESIASYMCPHCGTEVHLSNDEGYGSSARKARKENTNRRNVSPDFDPDDLSNY
FT                   NMLSTTTGSSAYFRLLQRNHQFYAIQDGEQTENSHIPDDMFIPGYFHKFFDILEPLGNG
FT                   ARGSVYKVVHKLGSTPLGTYALKKIPIGNDDEWFKKCIREVKILSSLKHTSENLITYNH
FT                   VWMEMDASVGHVQSLDGSSTGMVGDVPCMFILQQYCAGGNLEDCINNVVFEKNPELISI
FT                   EERKKRFRERHGQKSSGSAKAGLSTLQILSILHDIASGLKELHNSGLIHRDLKPSNCLL
FT                   LSPYKHNDEERVFPTVVIGDFGESQMKGEYRTATGCTGTMEFTAPELIIENCDSNSNSQ
FT                   YHEFSFQSDMYSLGMIGYFVIFGELPFGSELDIPEIKNCIKALNIDKTYMVKKHREMRL
FT                   KDIDYRIFDVLQLLLSSKESIRPSAIEVESIFEKLIGLNIKHDDNEKLAYDYSSKDKLE
FT                   KSDVLYEQPDGINIGKLEEFQSSDKGSASTNEAYFQIASLPATPRLALPNLIDRQQVSD
FT                   STKINLTNITLRGLIFVFAALAYYRYALTVNAINPQVMHSFFWSSTFMALSFVDNQRFL
FT                   FCIFIIQFIISLRAMFLY"
FT   gene            complement(<485863..>487098)
FT                   /locus_tag="CAGL0J05104g"
FT                   /old_locus_tag="CAGL-IPF7010"
FT                   /old_locus_tag="CAGL-CDS2694.1"
FT   CDS_pept        complement(485863..487098)
FT                   /locus_tag="CAGL0J05104g"
FT                   /old_locus_tag="CAGL-IPF7010"
FT                   /old_locus_tag="CAGL-CDS2694.1"
FT                   /note="similar to uniprot|P47040 Saccharomyces cerevisiae
FT                   YJL059w YHC3 may function as a chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60877"
FT                   /db_xref="GOA:Q6FPB6"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB6"
FT                   /inference="similar to AA sequence:UniProtKB:P47040"
FT                   /protein_id="CAG60877.1"
FT                   /translation="MNSKQRVYAFFWIFGLVNNVLYVVILSAAVDIVGPKVPKTLVLLM
FT                   DITPSLLIKVTAPFFIKSIPYTMRIYALIALSCIGMIFVSGKSLLLCMIGIAMASVSSG
FT                   FGEVSFLQLSHFFEENALNGWSSGTGGAGIVGSSVYMLLTSIFKLPIRLSLLSFTILPF
FT                   AFLLYFKLDTTQIEYDSISSSGEETLIRNSNSNALQTDTFNESIRLSKTEEQNIFVSSI
FT                   DHFKSTCVNLKALVVPYMLPLSSVYLFEYLINQAVSPTLLFPLDSRGLPPFFNKYRDMY
FT                   VTYGTLYQLGVFISRSLAHKFRMHNLYFLSALQGLNLVLTILQAWIYIVHTPWPIMILI
FT                   FYEGLLGGSSYVNTFLNVLEEVDMDKREFSLGAVSIADSLGVFIAALVGLGLEPTICNH
FT                   QVSTGRPWCRME"
FT   gene            complement(<487452..>488753)
FT                   /locus_tag="CAGL0J05126g"
FT                   /old_locus_tag="CAGL-IPF7008"
FT                   /old_locus_tag="CAGL-CDS2531.1"
FT   CDS_pept        complement(487452..488753)
FT                   /locus_tag="CAGL0J05126g"
FT                   /old_locus_tag="CAGL-IPF7008"
FT                   /old_locus_tag="CAGL-CDS2531.1"
FT                   /note="highly similar to uniprot|P47039 Saccharomyces
FT                   cerevisiae YJL060w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60878"
FT                   /db_xref="GOA:Q6FPB5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB5"
FT                   /protein_id="CAG60878.1"
FT                   /translation="MKRTLNRMTKITPNKYFQKNTSKDVWTLTNEFAASAVGKSEGREL
FT                   INLGQGFFSYSPPQFAINAAKSALDVPLVNQYSPTRGRPSLIKSLVELYKPVFGDFIDN
FT                   QNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEM
FT                   KTRNTTGDEWQIDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTV
FT                   VISDEVYEHLYFTESFPRIANINEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLN
FT                   YVSKAHTRICFASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKLGLNY
FT                   TQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEFYIKE
FT                   HEKDAETLLRFAVCKEDEYLAKAAERFQLLKDYL"
FT   gene            complement(<489747..>494336)
FT                   /locus_tag="CAGL0J05159g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.532.m"
FT   CDS_pept        complement(489747..494336)
FT                   /locus_tag="CAGL0J05159g"
FT                   /old_locus_tag="Cagl0J.mRNA.at.532.m"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05159g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58044"
FT                   /db_xref="GOA:B4UN28"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN28"
FT                   /protein_id="CAR58044.1"
FT                   /translation="MLLNWTITLLWTLLLSRVTAQLVVTTTIPIPQAVTFPTPVAVGTG
FT                   GDVTFEGSGPYTFNDKVYIMKNGKLTIHNPQSGSLLNISITGDTINNGQVSVLNDGTTN
FT                   ARIKITGDSILNTGTLLLQNNDAAAIVNHDLSIVLSPKDSILNTGTLTLYQAGGVDITT
FT                   GDITNNGVLNVYGTALRIHQPIVGNGNINLFSGFLILGFDQTESNILQNITIGFGSLML
FT                   FDTRGNTTPRLVTINLASFDPNNFLGFTDPNFTYTYDGNVLNLVSNQVTVKVYIGPGYD
FT                   INSFIKLDSTQQEYLGTNYIISAIYYGAQPPTTRTFQPLPSPYNTTIYTLDVTEEFTVS
FT                   YIATSDKGGFPTTIRTSIPWSTPISSPYTTFTIHDSTTESYVVSYFSTVNAKGGPLISS
FT                   TTYPVLHAPYTTTITEKGVTHEVYYSFTDILKGNSHSTSTFISTIIPPFPKPTTFTSFS
FT                   GNYEYIGVVTYYSTVNAQGGTYTASSTKTISTITLTQYKVPPVTTVTISNSQYSEVDVI
FT                   SYYLTQDSNRKVFTASTTISSSRAYITPPPLTSKTVDSNGVTIWAIISYYTSAKDGQII
FT                   FTSGSSVYSPPPLKTITVLGDHYVEEDVYSYFITVNGQGQIITDSTEISSSVSHDPAPS
FT                   GSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDV
FT                   YSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVDENG
FT                   KFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVDSEGNIITDSKLISSSVSHDP
FT                   APSGSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEE
FT                   EDVYSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVD
FT                   ENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVDSEGNIITDSRVISSSII
FT                   DDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKD
FT                   GVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTT
FT                   DSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYP
FT                   SPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTT
FT                   DKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHI
FT                   TTTDSNGNPTTVATTLALPSSGNNSGNNSGNNSGNNSVNNSGDNNGNSAGNNAGESDHT
FT                   TVITSNGTPTSVFVSHITTTDSNGNPSTIATTLALPSSGNNSGNNSGNNSGNNSGNNNG
FT                   NSAGNNAGESDHTTVITSNGTPTSVFVSHITTTDGNGSPTTIRTLIPSSSEFLSQNIIS
FT                   NTPINSQANISSPTNKSSRTTLQGTHTVPTVSPSSVSSATFTGAGEKLNVSKLYAAVVL
FT                   SGIVLCIIV"
FT   gene            complement(<501919..>504069)
FT                   /locus_tag="CAGL0J05214g"
FT                   /old_locus_tag="CAGL-IPF7906"
FT                   /old_locus_tag="CAGL-CDS1041.1"
FT   CDS_pept        complement(501919..504069)
FT                   /locus_tag="CAGL0J05214g"
FT                   /old_locus_tag="CAGL-IPF7906"
FT                   /old_locus_tag="CAGL-CDS1041.1"
FT                   /note="similar to uniprot|P40368 Saccharomyces cerevisiae
FT                   YJL061w NUP82 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60882"
FT                   /db_xref="GOA:Q6FPB3"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB3"
FT                   /inference="similar to AA sequence:UniProtKB:P40368"
FT                   /protein_id="CAG60882.1"
FT                   /translation="MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS
FT                   TSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCH
FT                   IYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSA
FT                   LGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSL
FT                   LLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSM
FT                   TPYPNELYDFMATDINIIQITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNS
FT                   LALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKL
FT                   LANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKL
FT                   IDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSA
FT                   PLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKF
FT                   WDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFA
FT                   EIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDL
FT                   KIISEFEKKCDTAVNGINQLKI"
FT   gene            complement(<504544..>507072)
FT                   /locus_tag="CAGL0J05236g"
FT                   /old_locus_tag="CAGL-IPF7908"
FT                   /old_locus_tag="CAGL-CDS0705.1"
FT   CDS_pept        complement(504544..507072)
FT                   /locus_tag="CAGL0J05236g"
FT                   /old_locus_tag="CAGL-IPF7908"
FT                   /old_locus_tag="CAGL-CDS0705.1"
FT                   /note="similar to uniprot|P40367 Saccharomyces cerevisiae
FT                   YJL062w LAS21"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60883"
FT                   /db_xref="GOA:Q6FPB2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB2"
FT                   /inference="similar to AA sequence:UniProtKB:P40367"
FT                   /protein_id="CAG60883.1"
FT                   /translation="MLFLLVVAHAIAVLIFGCGFFPQKKVLDGHAALDGTHARDPVFDK
FT                   LVVVVVDAMRSDFLFDASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGST
FT                   PNFLDAILNVAEDDTSSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQ
FT                   TMFDEYEGTNSFFVSDFTQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYS
FT                   RFMGPKHEEMDSIIRKLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSD
FT                   KLAAYKPSKEQSSAKEFPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNN
FT                   VGVIIPEFLQLFKDVSLQKAIVKENWNQLSGLTKGKTQIMEETKNFVIEDVIKNMKDVQ
FT                   ENLAKTATDYNYPLLFIGCFLSIVITGTIYYRYARHVAININTSILIAIAALMGISVFG
FT                   SSFIEEEHQFWWWIITGLVLLSMVNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNV
FT                   IANLLKGNIDALWWLNLITVTVVGLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYK
FT                   VNWSIVNGERVPDLFYKWVLETASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLV
FT                   SRLMIQKFFQVSDISKSLAVVSRYVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERY
FT                   QSDYLLAVIFGIILQFFTFFQSGGTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFA
FT                   PTIYWSFYNWRITYANANSSRWQTLVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSV
FT                   FSPKLCYYMVWTIFVGIIVHWIPEILLLLT"
FT   gene            <507849..>508583
FT                   /locus_tag="CAGL0J05258g"
FT                   /old_locus_tag="CAGL-IPF7913"
FT                   /old_locus_tag="CAGL-CDS4056.1"
FT   CDS_pept        507849..508583
FT                   /locus_tag="CAGL0J05258g"
FT                   /old_locus_tag="CAGL-IPF7913"
FT                   /old_locus_tag="CAGL-CDS4056.1"
FT                   /note="similar to uniprot|P22353 Saccharomyces cerevisiae
FT                   YJL063c MRPL8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60884"
FT                   /db_xref="GOA:Q6FPB1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="InterPro:IPR040894"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB1"
FT                   /inference="similar to AA sequence:UniProtKB:P22353"
FT                   /protein_id="CAG60884.1"
FT                   /translation="MTAGIARRLSRDKPHREMMLRNLVTSLLEHGSVVSTHEKCMEASR
FT                   LADRVIHWSKSAGHSSKYVSLIQSKLFLSGNNSGLLRKLCGEIAPRYVERPGGYTRVMK
FT                   LEPRLGDRARQSVLELVDTPVVTAGDVAHPQPSIQRGNMKLWLLARATLTDESLARAHN
FT                   PQTLLNLKKMLKFRDAGDVARDLLVVRSLLREDMGLEPVDKEQDHAAVTTLIQAAQAAT
FT                   PVSKKKVRNDYKFETARPNGPQ"
FT   gene            <508860..>509747
FT                   /locus_tag="CAGL0J05280g"
FT                   /old_locus_tag="CAGL-IPF7918"
FT                   /old_locus_tag="CAGL-CDS3648.1"
FT   CDS_pept        508860..509747
FT                   /locus_tag="CAGL0J05280g"
FT                   /old_locus_tag="CAGL-IPF7918"
FT                   /old_locus_tag="CAGL-CDS3648.1"
FT                   /note="some similarities with uniprot|P40366 Saccharomyces
FT                   cerevisiae YJL065c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60885"
FT                   /db_xref="GOA:Q6FPB0"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB0"
FT                   /protein_id="CAG60885.1"
FT                   /translation="MEQPADKPVEMETRNEGAEAVEPAVEAVEAVEVEAAEAAEAAEQK
FT                   DAEAMNETVDGDTDQGDESRSNAQVIEIEDSDSSPEGDTEMDIDEDQEMKHDDRDETRP
FT                   TTQSSAKEESRSSSRVVKSEMDESIAQSRREMEELESELGEEARKEKQRVVDELKKQYK
FT                   LINREYIRRCSRFPISKMRMIAKNDPEYLECTKDALIATAFATELFVQTLTYETLIVNG
FT                   SVPYGDGNFQQEPKPEPSTPINSDELLLDYKSLSESIALVDHFQFLADIVPRTKNLREL
FT                   VKENKVRYTATQKN"
FT   gene            <510020..>510943
FT                   /locus_tag="CAGL0J05302g"
FT                   /old_locus_tag="CAGL-IPF7919"
FT                   /old_locus_tag="CAGL-CDS3549.1"
FT   CDS_pept        510020..510943
FT                   /locus_tag="CAGL0J05302g"
FT                   /old_locus_tag="CAGL-IPF7919"
FT                   /old_locus_tag="CAGL-CDS3549.1"
FT                   /note="weakly similar to uniprot|P40364 Saccharomyces
FT                   cerevisiae YJL066c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60886"
FT                   /db_xref="GOA:Q6FPA9"
FT                   /db_xref="InterPro:IPR035187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA9"
FT                   /protein_id="CAG60886.1"
FT                   /translation="MGLFNGDDEKLKELCDSGVKDELNRESLFDDGLIPHGLKDSALEL
FT                   YDKAGLKDIFESGYGSLWDTLKEIGNYNTNLGSLVSRPQGNDVIQQGITGLYHYGTPNM
FT                   SQYKECADVDGLSVWDTQGWWRCLFPQGVIRDKLKVDDLSSKEQDSVMSKILTKEAVVN
FT                   DKDNKYGVFFPEWSLYMKWRVHMNHLIQQRKEEEITKRKNNDLKDWAYGFYDSDDKTPE
FT                   DIMMKKSLQDFDHKDGPEIIGKSEYVTIQSTNDGKEEVKQLKTFYNNGTTSIESIKKVY
FT                   PKDGGKPRIERTVRTVPSSRDKGNGF"
FT   gene            <511210..>512100
FT                   /locus_tag="CAGL0J05324g"
FT                   /old_locus_tag="CAGL-IPF7920"
FT                   /old_locus_tag="CAGL-CDS3637.1"
FT   CDS_pept        511210..512100
FT                   /locus_tag="CAGL0J05324g"
FT                   /old_locus_tag="CAGL-IPF7920"
FT                   /old_locus_tag="CAGL-CDS3637.1"
FT                   /note="highly similar to uniprot|P40363 Saccharomyces
FT                   cerevisiae YJL068c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60887"
FT                   /db_xref="GOA:Q6FPA8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA8"
FT                   /protein_id="CAG60887.1"
FT                   /translation="MKQVKSIAVCGGKLLQLKHASEVLHCEMDVNVYLPKQYNTNSQGK
FT                   KIPTIYYLSGLTCTPQNASEKAFWQAQADKYGFAMVYPDTSPRGDDVAGDPEGSWDFGK
FT                   GAGFYINATKEPFQKHYHMFDYVHKELPSELAKFFEEQGQSKIDFLDNVSITGHSMGGF
FT                   GALSGYLLHYSDNKYKSCSAFAPIVNPSVVPWGQKAFKGYFNDPKEGEHYDPCNLVKQV
FT                   KNTNNSSILIHVGTNDPFLKEQLQPHLLKEAATGTTWENKIDINLVDGFDHSYYFISTF
FT                   VPEHAAFHAKHLGLA"
FT   gene            complement(<513918..>515351)
FT                   /locus_tag="CAGL0J05346g"
FT                   /old_locus_tag="CAGL-IPF7921"
FT                   /old_locus_tag="CAGL-CDS2216.1"
FT   CDS_pept        complement(513918..515351)
FT                   /locus_tag="CAGL0J05346g"
FT                   /old_locus_tag="CAGL-IPF7921"
FT                   /old_locus_tag="CAGL-CDS2216.1"
FT                   /note="similar to uniprot|P21827 Saccharomyces cerevisiae
FT                   YGL097w SRM1 GDP/GTP exchange factor for GSP1P/GSP2P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60888"
FT                   /db_xref="GOA:Q6FPA7"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA7"
FT                   /inference="similar to AA sequence:UniProtKB:P21827"
FT                   /protein_id="CAG60888.1"
FT                   /translation="MVKRSASDEAPTAKRVSTKKVLNQLDDYTHRYISVRPLDVFVWGT
FT                   GSMCELGLGPLAKNKEVKRPRLNPFLPQDKVGIVSIAVGGMHTLALDKDNNIWSWGCND
FT                   YGALGRDTSGAKEKLKDANDSSDDEDGDLNELESTPTKLPFKFEGTSEKDAKIVQLVAT
FT                   DNLSSVLLSDGTIYAWGTFRCNEGILGFYQDEIEVQREPWVVPKFAKGKIVQMAGGKDH
FT                   ILFLDEAGIVYAWGNGQQYQLGRKILDRFRLKTLYPLPFGLKKVKYIASGENHCFALTE
FT                   TGKVVSWGLNQFGQCGIGESIEDGGIVAVPSQVMNLPLDNDSIRTISAGEHHSLFLMES
FT                   GALYTCGRIDMNEIGLLKKELPTYAYKDEHERVRAVPLPTKVVKTLEELDPEDDEDDRE
FT                   YKEMKFKNIAAGSHHSIAISQDGKLYTWGFGETYAVGQGPAGDDIEVPVKITNTATKEV
FT                   DMVLAGSGGQFSVSAGYKQ"
FT   gene            complement(<515847..>516515)
FT                   /locus_tag="CAGL0J05368g"
FT                   /old_locus_tag="CAGL-IPF7922"
FT                   /old_locus_tag="CAGL-CDS4239.1"
FT   CDS_pept        complement(515847..516515)
FT                   /locus_tag="CAGL0J05368g"
FT                   /old_locus_tag="CAGL-IPF7922"
FT                   /old_locus_tag="CAGL-CDS4239.1"
FT                   /note="similar to uniprot|P53146 Saccharomyces cerevisiae
FT                   YGL098w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60889"
FT                   /db_xref="GOA:Q6FPA6"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA6"
FT                   /inference="similar to AA sequence:UniProtKB:P53146"
FT                   /protein_id="CAG60889.1"
FT                   /translation="MSSTLIDFLVTSKEACNNKCRREAAIRDGTVEQYEQQYSKTSFEY
FT                   DSKCYSLLKDMEKEYNKYESSIKHRRYSEDFDGTHGDEDDSKELKINTEDESVAELRKR
FT                   LLGRLSDKAEQDAGQSVETQIQNHEDMQQNLYEDMSKLVGSLKQGAVAFQNALEEDQKV
FT                   LGAAEIGIQVASRGIVDISGKLKTYDKAKLGYLFYILTFLFMFIGLCVTFIIIKIFPAM
FT                   "
FT   gene            complement(<516870..>517202)
FT                   /locus_tag="CAGL0J05390g"
FT                   /old_locus_tag="CAGL-IPF7923"
FT                   /old_locus_tag="CAGL-CDS5342.1"
FT   CDS_pept        complement(516870..517202)
FT                   /locus_tag="CAGL0J05390g"
FT                   /old_locus_tag="CAGL-IPF7923"
FT                   /old_locus_tag="CAGL-CDS5342.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60890"
FT                   /db_xref="GOA:Q6FPA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA5"
FT                   /protein_id="CAG60890.1"
FT                   /translation="MKNYIKSRINCSLFYNHLLLCVFGDFVLNIEISMGSYTHFEVLNP
FT                   MLSVTPSVQVIYFQKFRFLLVFLFLFEVMRMLGTASVLLVERLLENLPMDLMDGGALNP
FT                   HAPYMK"
FT   gene            complement(<517428..>519347)
FT                   /locus_tag="CAGL0J05412g"
FT                   /old_locus_tag="CAGL-IPF7924"
FT                   /old_locus_tag="CAGL-CDS1317.1"
FT   CDS_pept        complement(517428..519347)
FT                   /locus_tag="CAGL0J05412g"
FT                   /old_locus_tag="CAGL-IPF7924"
FT                   /old_locus_tag="CAGL-CDS1317.1"
FT                   /note="highly similar to uniprot|P53145 Saccharomyces
FT                   cerevisiae YGL099w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60891"
FT                   /db_xref="GOA:Q6FPA4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA4"
FT                   /protein_id="CAG60891.1"
FT                   /translation="MPPKTEPKKWKPPKGPKPIQRKNKNPIGLGRAIMHQRSKENTIEY
FT                   LPDGEMRFTTDKHEANWVKLRSVTQESALDEFLNTAALADKDFTADRHSNVKIIRIDNG
FT                   DGSATSQGFSLTNEQKSTIDAKQRALANDLIVPRRPYWDESMTKYQLERQENDAFLEWR
FT                   RKLAHLQENNEDLLLTPFERNIEVWKQLWRVVERSDLVVQIVDARDPLLFRSVDLERYV
FT                   TEVDDRKQNLLLINKADLLTRNQRITWAKYFAKKNNSYAFYSALRANQLLEKQKELGDD
FT                   YSEEHIEEESDDSEETLEESVREGIKILTIDQLEELFLSRAPSEPLTEPLPGQESLLQI
FT                   GLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTIKLSDHVMLCDCPGLVFANFAY
FT                   NKGELVCNGVLPIDQLRDYVGPCALVAERIPKYYLEAVYGIHIQTRSREESGDIEPENP
FT                   TAQELLVAYARARGYMTQGFGSADESRASRYILKDYVNGKLLYVNPPPHLEDDTPYTRE
FT                   ECKEFNKELYVFDKLPETRQEQLREAAKAKGIEVLDLARDLSKLTFSAHTAAEANKKAS
FT                   SVTHGGKQAALYNAADDLDREFFNMNKVEGKLTTPFHKQQSQSGSKKHNKKNKKGKVRN
FT                   LNFE"
FT   gene            <520083..>520682
FT                   /locus_tag="CAGL0J05434g"
FT                   /old_locus_tag="CAGL-IPF7926"
FT                   /old_locus_tag="CAGL-CDS4454.1"
FT   CDS_pept        520083..520682
FT                   /locus_tag="CAGL0J05434g"
FT                   /old_locus_tag="CAGL-IPF7926"
FT                   /old_locus_tag="CAGL-CDS4454.1"
FT                   /note="highly similar to uniprot|P17536 Saccharomyces
FT                   cerevisiae YNL079c TPM1 tropomyosin or uniprot|P40414
FT                   Saccharomyces cerevisiae YIL138c TPM2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60892"
FT                   /db_xref="GOA:Q6FPA3"
FT                   /db_xref="InterPro:IPR000533"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA3"
FT                   /protein_id="CAG60892.1"
FT                   /translation="MDKVREKLNNLKLEAESWQEKYEELKEKNKELEQEKTDLENQAKA
FT                   LTVKNQSLEEEVEKLESGADQSRGLEQEKTDLENQVKALTVKNQTLEEEVEKLESELSE
FT                   LKQTSEESTTLRSNNENFTKKNQQLEEELEESDAKLKETTEKLRESDLKVDQLERRVTA
FT                   LEEERDEAEKKNEELTAKYEEAKKELDEIAASLENL"
FT   gene            <521362..>522477
FT                   /locus_tag="CAGL0J05456g"
FT                   /old_locus_tag="CAGL-IPF7928"
FT                   /old_locus_tag="CAGL-CDS2980.1"
FT   CDS_pept        521362..522477
FT                   /locus_tag="CAGL0J05456g"
FT                   /old_locus_tag="CAGL-IPF7928"
FT                   /old_locus_tag="CAGL-CDS2980.1"
FT                   /note="similar to uniprot|P53938 Saccharomyces cerevisiae
FT                   YNL080c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60893"
FT                   /db_xref="GOA:Q6FPA2"
FT                   /db_xref="InterPro:IPR021100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA2"
FT                   /inference="similar to AA sequence:UniProtKB:P53938"
FT                   /protein_id="CAG60893.1"
FT                   /translation="MATEAGTGQMTKESLRDAYRSIKKMSLNHLSAKQHLLMALCRDVS
FT                   MLPPVYYTFMSLKKAWQISIQTTIKLYEPQSLRESLIAFWQTYMVANISDSVQFSNLRT
FT                   MENVTQHNVNNTSAENWESVLFTALTKARASEHLFCALWCLVSLYLTYAILDSLMVRWI
FT                   VKYSTLAAILRMFSMSMIIITFELMLLASLSPEKNYFLHTWITISCILTAVYIWQSYLT
FT                   SDLNYVRNKKLDINDIDVDDEIEGINGQFSYSTTIEATPDNNSEYEVISNEDSPSQINQ
FT                   RRLNTIGSQQSRSSTPTSATSQRRSQKRNTVKSIDFTTKRYIDLYNITVFCVVPVGIAS
FT                   FITMVGLLRNLFIQRLDVEQLGRMLHESYNP"
FT   gene            <523169..>523549
FT                   /locus_tag="CAGL0J05478g"
FT                   /old_locus_tag="CAGL-IPF7929"
FT                   /old_locus_tag="CAGL-CDS5101.1"
FT   CDS_pept        523169..523549
FT                   /locus_tag="CAGL0J05478g"
FT                   /old_locus_tag="CAGL-IPF7929"
FT                   /old_locus_tag="CAGL-CDS5101.1"
FT                   /note="highly similar to uniprot|P53937 Saccharomyces
FT                   cerevisiae YNL081c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60894"
FT                   /db_xref="GOA:Q6FPA1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA1"
FT                   /protein_id="CAG60894.1"
FT                   /translation="MVVHILGKAFKGKEVIRIALASKFYGVGKSTAERLCSKLGFYPWM
FT                   RMHQLSEPQILNITSELSNMTIEGDARAIVRENIALKKKIGSYEGMRHALGLPVRGQRT
FT                   RNNAKTARKINRIGVRAFHTAQ"
FT   gene            complement(<523770..>526493)
FT                   /locus_tag="CAGL0J05500g"
FT                   /old_locus_tag="CAGL-IPF7930"
FT                   /old_locus_tag="CAGL-CDS0592.1"
FT   CDS_pept        complement(523770..526493)
FT                   /locus_tag="CAGL0J05500g"
FT                   /old_locus_tag="CAGL-IPF7930"
FT                   /old_locus_tag="CAGL-CDS0592.1"
FT                   /note="similar to uniprot|P14242 Saccharomyces cerevisiae
FT                   YNL082w PMS1 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60895"
FT                   /db_xref="GOA:Q6FPA0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA0"
FT                   /inference="similar to AA sequence:UniProtKB:P14242"
FT                   /protein_id="CAG60895.1"
FT                   /translation="MPISQISEQDVHRITSGQVIIDLASAVKELVENSLDAQATQIDIT
FT                   FRKYGIDGLEVSDNGTGISKDDYESLALKHHTSKIKNFDDVLTNINTLGFRGEALSSLC
FT                   GIARMAVITTTQPPRADRLEYDMAGHLSSKSTTTRNKGTTVIISDLFHNLPVRQKDFER
FT                   TAKRHFTKCITLLQSYAIINESVRITVTNITSTGKKNNILSTAANQNLNKRIISIFGST
FT                   SLRGLSPISLTLDMNPFKKNIKSRYVDDPDFDNMDYKVKVTGLFSQNSFGCGRTSKDRQ
FT                   FIFMNKRPIDYPAVVKCCNEVYRTYNNVQYPMFILNFELTPDLIDVNITPDKRTVVLHN
FT                   EQSVIDVLYENLSDYFDTQDMALPKEEPQDHISKRRRLLDHPSDSADDGSSSQLEISST
FT                   NESSFVTPIEMDITELVETNSFEYDGKESLPASEPDFRNDIEDDNMQCNSSPSKEPHSP
FT                   DDNYNEIHKEQELSEVYAPQRNLRRPKVVNIEEFANPIHEPESYIAKNGSPKKSQESLI
FT                   LQIDDKVYKQTVTVNNNSDIVSIENITPSKEYDSQHSTARENDSKTESQETDSCESCKD
FT                   DSNIPGLRSNDELLEYDDDKDEDLASFHPTDYNIRSPIKSVTSRTSKRDTFRSMTDNVL
FT                   SKNNIQLLSQHLVVHNIDDIVNISNLKEIITNNTYMNERQGTSKIIRNSALNDLDKGAQ
FT                   YLSLSVKKSDFKDMKVVGQFNLGFILVTRNMGSNYDLFIVDQHASDEKFNFENLQQTTR
FT                   FKSQKLISPETIELSVIDELIVMDNLSVFERNGFKIEIDEDAMAGHKVKLISIPVSKRT
FT                   IFGVADFQELVYLIKEDGGTNKSNIKCSKIRAMFAMRACRSSIMVGKPLNMRTMTRVVQ
FT                   NLSTLDKPWNCPHGRPTMRHLMELQNWKSFSEDYKL"
FT   gene            complement(<527054..>528613)
FT                   /locus_tag="CAGL0J05522g"
FT                   /old_locus_tag="CAGL-IPF7931"
FT                   /old_locus_tag="CAGL-CDS1961.1"
FT   CDS_pept        complement(527054..528613)
FT                   /locus_tag="CAGL0J05522g"
FT                   /old_locus_tag="CAGL-IPF7931"
FT                   /old_locus_tag="CAGL-CDS1961.1"
FT                   /note="highly similar to uniprot|P48233 Saccharomyces
FT                   cerevisiae YNL083w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60896"
FT                   /db_xref="GOA:Q6FP99"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP99"
FT                   /protein_id="CAG60896.1"
FT                   /translation="MAGSNADDSRYERLFKDLDVDGNGRIDLRALKRAFKEKDHPLSKS
FT                   DDALHLLFNAMDSNHDSVIDIEDFKKYARKAEEQIELGFQRIDADNDGKIKTSELTEYL
FT                   HSLSTSADNGVRPEDKQVMKPRFNSFIKWAFLRRKAKSSSDPEYITYDQWRDFLLMMPR
FT                   EQGSRLHTAYSYFYLFNEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCTAPFD
FT                   RLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGN
FT                   GLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYP
FT                   IDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLG
FT                   TFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQ
FT                   GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLMKL
FT                   QS"
FT   gene            <528997..>530043
FT                   /locus_tag="CAGL0J05544g"
FT                   /old_locus_tag="CAGL-IPF7933"
FT                   /old_locus_tag="CAGL-CDS3177.1"
FT   CDS_pept        528997..530043
FT                   /locus_tag="CAGL0J05544g"
FT                   /old_locus_tag="CAGL-IPF7933"
FT                   /old_locus_tag="CAGL-CDS3177.1"
FT                   /note="similar to uniprot|P39013 Saccharomyces cerevisiae
FT                   YNL084c END3 required for endocytosis and cytoskeletal
FT                   organization"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60897"
FT                   /db_xref="GOA:Q6FP98"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP98"
FT                   /inference="similar to AA sequence:UniProtKB:P39013"
FT                   /protein_id="CAG60897.1"
FT                   /translation="MPKLEQFEIKKYWQIFSGLKPVENKVSHDQVLPILYNSKLDSSIL
FT                   NKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIDSVPDELPEWLVPGSKAKLIKERQ
FT                   KAKQQENAEIPRQEVPDVDWYISPEDKTYYEKILSTCGPMADGTVTFAELSLALKSKFF
FT                   NIGVSDMERTWKLINPRDLPSIDRDPAMYFIHCLRQRNDIGTSIPSELPPALAEVCNKQ
FT                   RVEYDLSSKQADLKRLDTKEPTKNDVTKLGDELDRLEHSLENLTTGSTSSTLQGTIKMS
FT                   KESLNQFKGLLAFMENDLNHPNPDSNANVKYVTDDLDNIDQQVQMLETYLQQKRQELGS
FT                   LKAEVGST"
FT   gene            complement(<530428..>532869)
FT                   /locus_tag="CAGL0J05566g"
FT                   /old_locus_tag="CAGL-IPF7934"
FT                   /old_locus_tag="CAGL-CDS0778.1"
FT   CDS_pept        complement(530428..532869)
FT                   /locus_tag="CAGL0J05566g"
FT                   /old_locus_tag="CAGL-IPF7934"
FT                   /old_locus_tag="CAGL-CDS0778.1"
FT                   /note="highly similar to uniprot|P40850 Saccharomyces
FT                   cerevisiae YNL085w MKT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60898"
FT                   /db_xref="GOA:Q6FP97"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR022039"
FT                   /db_xref="InterPro:IPR022040"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037314"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP97"
FT                   /protein_id="CAG60898.1"
FT                   /translation="MPIKSLESYLFERSLVGSYSIESLANCTLGIDVNHYVSRLLTSKR
FT                   EQYLDAIGGFPTSLKLYLESDLKVYNEYNITPIFIFNGSLTHDQLENEGYFSAASKESA
FT                   KAASNGATTSGPNAATNPTMRSNKETVLAQRHRAWTQWNNLVTSNQESYIDQPIQPQEP
FT                   FRYTTTIDPKAYQADLISYFIEHDIMYQVAPYTSWIQLAYLFENEFIDAIYGPTDCLML
FT                   PKVDKFILGMEFPNKEFRFIEKSRVLKEFGITHEELVDISMAVGNDLQPVTLPPLQIYP
FT                   VPQLFDIALEMVLNAGTNFYTYELTNPIKSEKDQYLIKYQKGYAALKFMPVLKANGRVE
FT                   LLSENENSDEAQKENSATHTSPGESDNEKKKSIPSASFDDPDAIPADVHDFIAQRLPHE
FT                   YYFYRSIGLVTGKLFDAITTGVYPEEPPLDGGSSNSYRKLVEKSVDAFKNQEVNLLTQP
FT                   INRYYQIKQIKHVKWFAPEESVQLTNRMTPSAFEKINRIIVKTDSEAPFSLLSFLQLLS
FT                   TSDNLGDKFISNEVIFPASVNHEKKLHSAFDLLATCFLRTLVVLGFFDCNISKKELTPT
FT                   KWGEVLMKLPELQVSKDYIEPIFILMVFLKLDVLELGKDTVPSTTSALSEATLRSYPDA
FT                   SQHILIIARILTLFQIKQKPSNYHGPIDKKTLVFRDHLAFVKENLNELFEAITVSSLTS
FT                   GEFDRLNLDNFNWKKSVVRSMPFKLDTPNTIMAMMWEFFLQKYLHNGNAKADALSLVAT
FT                   DFSTYKSTPDLDEKFQESLEFLQQVKAVAKELANNNLIKASDASLLSAATDFAISAYSS
FT                   S"
FT   gene            complement(<533614..>533919)
FT                   /locus_tag="CAGL0J05588g"
FT                   /old_locus_tag="CAGL-IPF7935"
FT                   /old_locus_tag="CAGL-CDS5565.1"
FT   CDS_pept        complement(533614..533919)
FT                   /locus_tag="CAGL0J05588g"
FT                   /old_locus_tag="CAGL-IPF7935"
FT                   /old_locus_tag="CAGL-CDS5565.1"
FT                   /note="similar to uniprot|P48232 Saccharomyces cerevisiae
FT                   YNL086w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60899"
FT                   /db_xref="GOA:Q6FP96"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP96"
FT                   /inference="similar to AA sequence:UniProtKB:P48232"
FT                   /protein_id="CAG60899.1"
FT                   /translation="MSDNSEVQGIHPVELSVYSLVSSDLDNLYQAINELRESQALLILK
FT                   LRTVRDSLRLENELLFDSNEYKAQFKEVNNLQKRLQKITLRLKDLERRSSQLTTSS"
FT   gene            complement(<534283..>538503)
FT                   /locus_tag="CAGL0J05610g"
FT                   /old_locus_tag="CAGL-IPF7937"
FT                   /old_locus_tag="CAGL-CDS0143.1"
FT   CDS_pept        complement(534283..538503)
FT                   /locus_tag="CAGL0J05610g"
FT                   /old_locus_tag="CAGL-IPF7937"
FT                   /old_locus_tag="CAGL-CDS0143.1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60900"
FT                   /db_xref="GOA:O93794"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93794"
FT                   /protein_id="CAG60900.1"
FT                   /translation="MSEPKTASERYQKISQLEHILKRPDTYIGSVEIQEQEQWIYDEET
FT                   DCMIDKTVNIVPGLFKIFDEILVNAADNKVRDPSMKRIDVTINPEENFIEVRNDGKGIP
FT                   IEIHEKEKIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTLETADPK
FT                   NGRKYVQTWENNMNVCHPPKITSYKKGPSYTKVAFKPDLSRFGMESLDSDILGVMRRRV
FT                   YDINGSVRDVNVYLNGKPLKIRNFKNYVELYLKSLEKMRKMDNGESDTTPSNIPTILYE
FT                   RVSDRWEIAFAVSDISFKQVSFVNSIATTTGGTHVNYIADQIVRKVSDILKKKKKNIKP
FT                   YQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCDISSDYINKIMKTDLATKIF
FT                   EIADENANNALKKSDGSRKSRITDYPKLEDANKAGTKDGYKCTLILTEGDSALSLAVAG
FT                   LAVVGRDYYGCYPLRGKMLNVREATADQILKNAEIQAIKKIMGLQHRKKYEDTKSLRYG
FT                   HLMIMTDQDHDGSHIKGLIINFIETSFPGLLDIPGFLIEFITPIVKVTITKPIKKVISF
FT                   FNLPDYEKWREEESHKYSWKQKYYKGLGTSTSPEIIEYFSNLDTHLKKFHALQGDDKDL
FT                   IDLAFSKKKADDRKEWLRQYEPGTVLDPTLNEIPISDFINKELILFSLADNVRSIPSVL
FT                   DGFKPGQRKVLYTCFKKNLTTEKKVANLAPAVSDYTAYHHGEQALVQTIIGMAQNFVGT
FT                   NNIYFLKPNGAFGTRATGGKDAAAARYIYTELNKIARKVFHPADDPLFRYVQEDEKTVE
FT                   PEWYLPVVPMVLINGAEGIGTGWSTSIPPFNPLDVVNNIRHLLNDEEMDDMHPWFRGWT
FT                   GTMEKIESQRYRMYGRIEQVGPNTLEITELPARTWTSTIKEHLLLGLGGSEKVKPWIKD
FT                   MEEQHAETIKFIIKLTDEEMTKTRKLGFYERFKLISPISLQNMVAFDYRGKIKKYDHVH
FT                   EILKDFYEVRLEYYQKRKDYMTGRLQWEAEKLSFQVKFIKMIIDKSLIVTNKPKKQLIS
FT                   ELEELGFPRINKEGKPHFGKIDEEVEAIISEDEDEDLEESEEATRKKDKDDESTVNGPE
FT                   ELFGTYEYLLGLKIWSLTKERYEKLLKQKQEKETELENLLKLSAKDLWNNDLDDFLTAY
FT                   EDFQKMDLFLRNSAVPKTKGGKRKRKGGDDDDYDPSGKKKPARRIKKIKKEDDFDRILI
FT                   KPQAKIKAKRPVKVKVEPPSSAASTPSVKEELGVSDVTSNASTPSTTIFDQKVKQENSD
FT                   ESGISAFSSKFNKIASAFDEDAPLDQITSEDTSVKESSAPAAKKKAPPKRKAKVVESSE
FT                   DELSDANLSEQDDEEVVPVRRQRSSRQTAKKSYAEPIEISDEEDFIDDDEDEEVDSDES
FT                   FNDE"
FT   gene            complement(<539466..>540032)
FT                   /locus_tag="CAGL0J05632g"
FT                   /old_locus_tag="CAGL-IPF7938"
FT                   /old_locus_tag="CAGL-CDS4538.1"
FT   CDS_pept        complement(539466..540032)
FT                   /locus_tag="CAGL0J05632g"
FT                   /old_locus_tag="CAGL-IPF7938"
FT                   /old_locus_tag="CAGL-CDS4538.1"
FT                   /note="highly similar to uniprot|P06781 Saccharomyces
FT                   cerevisiae YNL090w RHO2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60901"
FT                   /db_xref="GOA:Q6FP94"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP94"
FT                   /protein_id="CAG60901.1"
FT                   /translation="MSEKAIRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYV
FT                   TDCRVDGIKVSLALWDTAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEE
FT                   AFRYCPDAPVILVGLKEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVD
FT                   DVFELATRSSLLMHKEPDHFCCSIS"
FT   gene            <540710..>545416
FT                   /locus_tag="CAGL0J05654g"
FT                   /old_locus_tag="CAGL-IPF7940"
FT                   /old_locus_tag="CAGL-CDS0090.1"
FT   CDS_pept        540710..545416
FT                   /locus_tag="CAGL0J05654g"
FT                   /old_locus_tag="CAGL-IPF7940"
FT                   /old_locus_tag="CAGL-CDS0090.1"
FT                   /note="similar to uniprot|P53552 Saccharomyces cerevisiae
FT                   YNL139c RLR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60902"
FT                   /db_xref="GOA:Q6FP93"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP93"
FT                   /inference="similar to AA sequence:UniProtKB:P53552"
FT                   /protein_id="CAG60902.1"
FT                   /translation="MTNVLGRLKRLSGQVNDNYFTTRTILTDEFASSWNSKREELIDNY
FT                   KKLDNDSERKEWLRSFFMDVIRLLKLSEDNNSLQIDTLSELIKLVYNATPSFKQTIGEV
FT                   FAAVVNTYCPKSVIDKVLRLITLTPILRTEVYKYSWLSTKLMTNDQKILTKHLLKKNRY
FT                   EIKKYNLIYENPIGFTQITSLLNVLVLDPYAHQKIPYFVSQLYQIMGKYSLDPLRTLDV
FT                   MITFFAEHVTLHYKLILDFLKCTNYWPRDTQLANPDNIMSLNHGGNKTAAKLITVRLNS
FT                   FFQSAVEGKSISSFEDNYLNLSCLLIKEGFVNFSNIWSNLSPLSEEFKSTLDDYMKKLE
FT                   LESTKGLDNPLAMASALTNEDDEADNKELDNKDSDTTMTGTEEEDKELEEAQKRNFEAA
FT                   VLNHGKLKLLIKLLAHGTYAPTLWAISEFPEISHLDTDIPILFSKLFEIQIENLYESMS
FT                   FRWRNTPAIISGLKKLENGLLSSKPRLYETIYSDDTNECVELNTKRKFYYQDWSSGLPR
FT                   IADINELVDVCHQYFKYFDVSLGCNSSLIIKLCRIVSAKLRGTEVDGTDQSQTLELAIN
FT                   YTRKFLLPIVGVMSENSTLGSEIFNLLKEFPLEKRYFMYNEMLTKTSQDNLLVKIGFNK
FT                   AEREAKSILKSLSTDNIETGSRKFARLLSSNPLATLLPTIKQIENYDKVSELIIFTTKF
FT                   LNQFGYDVLQYILLLRLTYSRPIMQDDGINQSMWVQRLAVFIAGLVKSCPQMDISELIT
FT                   YIIKQLHVGSSIAITIMKELISTVAGIRDLNHVSRERLILINSSRPLQKYGHKLIFDVR
FT                   NENKSLGMKLMTLFQNQDAVSEIIVLLYNLNLNINQQDLHYKILSSKCDEMNTLLWSYI
FT                   ELVKYSNTHDNFPKYVYPFERLINEFHISTPWAFHIWRDYFKEEDEISGDLSNFSSYEK
FT                   IDFPELSASNFDRSFFLTFWRLSLLHVQFDKNLYNTRKKEIESEIVPGLTNRQKNQKVG
FT                   EKKEIMSSCITHEHIFIKTKKYLCENSSSWGNSLDLDNQHIFIKFCIVPRILFSPSDAL
FT                   FTSRFLIETFGNELLFSLMDTFIKSRMMHALIFCSTISEAANLGIFFADLFEYLEKARI
FT                   SGKLTDDLTATLYNWHDVLVEESIILLKERNYMSIRNGIEFLRNVSDIFPVVDIHIKLC
FT                   CQALRDILEAETREDIKLPTNALLGHLNSKLKSSIRKSEYCQLTEDEKLLEEKYNEELN
FT                   EIKDYETSLENEKKQAELRAKIEENKQKRLEAEKQKAELQKQQQVESSRETRVSEAKLK
FT                   QKGQSHTWRLTKLFRVMDDVCYFISRNELNRAINLVEDDSEVWNIKHAIKNKGSLGSFR
FT                   NNIFEIFGRYFKSLILYPQNSDFQVRMDELKAATKYLDRKSNDVEPEKSSRYGGSVKVP
FT                   PGASAKSEDLRGRSTTPSGPASDKNKQSSNQFRQAPGRNTYNNDRQHSGHSYKTGKDDK
FT                   EKTPQQRSQLQFPDRPTQGRNDHQIAGQKRGYQSQQKDSHDDHASKRFRKEDSSRMSYT
FT                   DRNNRSFNQNLASRFGGPTNKNSNASSDHKPTALPQGPKGSSGSRYQR"
FT   gene            <545919..>547193
FT                   /locus_tag="CAGL0J05676g"
FT                   /old_locus_tag="CAGL-IPF7942"
FT                   /old_locus_tag="CAGL-CDS2614.1"
FT   CDS_pept        545919..547193
FT                   /locus_tag="CAGL0J05676g"
FT                   /old_locus_tag="CAGL-IPF7942"
FT                   /old_locus_tag="CAGL-CDS2614.1"
FT                   /note="similar to uniprot|P53901 Saccharomyces cerevisiae
FT                   YNL152w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60903"
FT                   /db_xref="GOA:Q6FP92"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP92"
FT                   /inference="similar to AA sequence:UniProtKB:P53901"
FT                   /protein_id="CAG60903.1"
FT                   /translation="MSEEVWDGNQGTLSVYVSKAKDLPNLDKLDKQDVLLRLRIAHMTR
FT                   ESDTIIRAGQTPIFKYYEKFEITPELRPLMYVEIYSDRRKKAPILIGRCEVDLLNGIRA
FT                   DPKEGYCTWYELKKPNNDFAGTVFIELTFKPTYPTFRRDGESYNSRNQDKSMAARPIPP
FT                   LPDDMSQFENEPESFRPNHYNSHFSSSSSSRTQSRFGGSESDYLHASAVRQVTPAIVDD
FT                   NHHRVAQRFATSDNYGNENGPANFMSSVGTSSTVTTQDSSTTTITNNSDTKFHFANLRK
FT                   LKEKINIFKNPNNSEEPETKNSNVDIEALQKAIGINNDAQSDDVSSTESFHERYQASRD
FT                   ISKSSSRGHNDALFKYSGGQNNEPPLPPLPKSPSRSPTRDRSPHRTPHSHHYHQHQEMV
FT                   SPKLPPLPTSRNNSTSPTRRRPPPI"
FT   gene            complement(<547495..>548199)
FT                   /locus_tag="CAGL0J05698g"
FT                   /old_locus_tag="CAGL-IPF7943"
FT                   /old_locus_tag="CAGL-CDS4128.1"
FT   CDS_pept        complement(547495..548199)
FT                   /locus_tag="CAGL0J05698g"
FT                   /old_locus_tag="CAGL-IPF7943"
FT                   /old_locus_tag="CAGL-CDS4128.1"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151c RPC31 DNA-directed RNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60904"
FT                   /db_xref="GOA:Q6FP91"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP91"
FT                   /inference="similar to AA sequence:UniProtKB:P17890"
FT                   /protein_id="CAG60904.1"
FT                   /translation="MSGRRGAGSGGGARSLPFGLGYQDIGPNNIAEFPSLSLPVNGNVS
FT                   SRDRSIALKYINFNAALRESPFFTGTLEAAEEGDNKNKKKGKRELVNNEGPSDGIARYS
FT                   DKYLKKRKLGVSIDEHPFHLELFPKDLYAVMGINKKKLMTLSKFNNEDDIFTGSEQDEA
FT                   LGLSMLEKYKELAEEVDEEDENKKEEDGTEEPVDDEFDDEDDDDDYNAEKYFSGGDDDD
FT                   IGEDDYGDEPAF"
FT   gene            complement(<548712..>549125)
FT                   /locus_tag="CAGL0J05720g"
FT                   /old_locus_tag="CAGL-IPF7944"
FT                   /old_locus_tag="CAGL-CDS4964.1"
FT   CDS_pept        complement(548712..549125)
FT                   /locus_tag="CAGL0J05720g"
FT                   /old_locus_tag="CAGL-IPF7944"
FT                   /old_locus_tag="CAGL-CDS4964.1"
FT                   /note="similar to uniprot|P53903 Saccharomyces cerevisiae
FT                   YNL149c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60905"
FT                   /db_xref="GOA:Q6FP90"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP90"
FT                   /inference="similar to AA sequence:UniProtKB:P53903"
FT                   /protein_id="CAG60905.1"
FT                   /translation="MERISKIFENSIDNILSIEPRKALRIVIIVGAYMLFRNLVTRDQN
FT                   RRQLARQVRQEEERKKEEREKTLLERPEDFEVETIAKSSTTEYGWGKKTRQRVKRQQEV
FT                   LERAVDDLKRHEQLKLSGTGYDSDEEIEELLED"
FT   gene            complement(<549568..>550329)
FT                   /locus_tag="CAGL0J05742g"
FT                   /old_locus_tag="CAGL-IPF7945"
FT                   /old_locus_tag="CAGL-CDS3977.1"
FT   CDS_pept        complement(549568..550329)
FT                   /locus_tag="CAGL0J05742g"
FT                   /old_locus_tag="CAGL-IPF7945"
FT                   /old_locus_tag="CAGL-CDS3977.1"
FT                   /note="weakly similar to uniprot|P53904 Saccharomyces
FT                   cerevisiae YNL148c ALF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60906"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP89"
FT                   /protein_id="CAG60906.1"
FT                   /translation="MTSDKKIPVTVRLFNGQEPTKMYSDSITVSELREQIYAFSGVDPQ
FT                   DMKLYVAFNRTPMGRASSDERQWDLEVTKETNGDQRILEGHSSCYIIVQDTNKDSLIYQ
FT                   LMKQDEQDEGPLFEYSQKDYENRDNTVLRWKQQEQLGRFDSEYNANMAKDLEQQELKAS
FT                   QLQLGERCTVKGVSERRGWLRYVGPVEGLTGLWCGVEFDKAEGKNNGVFKEHTYFGPVS
FT                   DNHGGFVRPQQVETGTQYAPFETSGSDSDEI"
FT   gene            <550672..>551192
FT                   /locus_tag="CAGL0J05764g"
FT                   /old_locus_tag="CAGL-IPF7946"
FT                   /old_locus_tag="CAGL-CDS5746.1"
FT   CDS_pept        join(550672..550683,550851..551192)
FT                   /locus_tag="CAGL0J05764g"
FT                   /old_locus_tag="CAGL-IPF7946"
FT                   /old_locus_tag="CAGL-CDS5746.1"
FT                   /note="highly similar to uniprot|P53905 Saccharomyces
FT                   cerevisiae YNL147w LSM7 Sm-like"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60907"
FT                   /db_xref="GOA:Q6FP88"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP88"
FT                   /protein_id="CAG60907.1"
FT                   /translation="MSEQNTQQAEQNNNNRGQQKKKFEAPKREAIVDLGKYKDSKVSVK
FT                   LMGGRIVTGILKGYDQLMNLVLEETEETLKPEVETGATQQVTRQLGLTVIRGTILISLS
FT                   PLDGSEVLYIQTN"
FT   gene            complement(<551562..>553406)
FT                   /locus_tag="CAGL0J05786g"
FT                   /old_locus_tag="CAGL-IPF7947"
FT                   /old_locus_tag="CAGL-CDS1428.1"
FT   CDS_pept        complement(551562..553406)
FT                   /locus_tag="CAGL0J05786g"
FT                   /old_locus_tag="CAGL-IPF7947"
FT                   /old_locus_tag="CAGL-CDS1428.1"
FT                   /note="highly similar to KLLA0E23034g Kluyveromyces lactis
FT                   and YALI0E27720g Yarrowia lipolytica"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60908"
FT                   /db_xref="GOA:Q6FP87"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP87"
FT                   /protein_id="CAG60908.1"
FT                   /translation="MGTANKRSLKEILDSEYVENSDDEVQHGDSDHDVSDNEEAPLDPS
FT                   ICEECRDMKFEIICKDCQENFCVICYEMIHRGGKRRKHEFTKVSIDNPGEATETTLQQL
FT                   PADSSEQKELQDTINNYDGSEIPAQKQESVEDTNSIDNKLMSILFETSHYIPMRLTYEE
FT                   RHLLRLLEAALQVSEYTDRVDILSNKSKSRRIVEQLKEICSVLSGLVVASNMKLGQKLL
FT                   DMKNFSDNAKWFQDIFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQICEHMEFHLYK
FT                   PILTVQSFLTTKTEDNGKAMGIFKDKLILAATSHISPVGRTRNQINRSIKQKETAIETL
FT                   ASKYSSKHYSKEDIRQALYSIGDYNAYVNMNRKPVLRMLSRLEIFRQPEVAAKYNIGIQ
FT                   YGRNGARLTHDHERQWHYVQQSLTLWSIIQREMVKLWYIADLDLFDGSNYRLASTGHGL
FT                   NRIKPCPRIYKEMHRIIGECRSKTEAWVGSSVVHLGDDAVPNALFFLDKYTQVPSILIP
FT                   FDQTLIQINDLVKNDEYLLDYIKKEYGSVEDLKMTILQDAFAHMFDGSGADNFYMSGSC
FT                   IDGRLTSAWNHCNEISKKKYYNIFLLTSFTGFNGSEGF"
FT   gene            <553745..>554044
FT                   /locus_tag="CAGL0J05808g"
FT                   /old_locus_tag="CAGL-IPF7948"
FT                   /old_locus_tag="CAGL-CDS5595.1"
FT   CDS_pept        553745..554044
FT                   /locus_tag="CAGL0J05808g"
FT                   /old_locus_tag="CAGL-IPF7948"
FT                   /old_locus_tag="CAGL-CDS5595.1"
FT                   /note="weakly similar to uniprot|P53906 Saccharomyces
FT                   cerevisiae YNL146w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60909"
FT                   /db_xref="GOA:Q6FP86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP86"
FT                   /protein_id="CAG60909.1"
FT                   /translation="MKTTKSSNGSYYHDLRRALRIGVLFILISLLFTSRLRNIVQQFLN
FT                   MFGRVRSGYSIEDVNHVPIFSEPDFDGVDVHTVDIKRLIMFLVVFFSLAIPFVF"
FT   gene            complement(<554231..>556054)
FT                   /locus_tag="CAGL0J05830g"
FT                   /old_locus_tag="CAGL-IPF7952"
FT                   /old_locus_tag="CAGL-CDS1467.1"
FT   CDS_pept        complement(554231..556054)
FT                   /locus_tag="CAGL0J05830g"
FT                   /old_locus_tag="CAGL-IPF7952"
FT                   /old_locus_tag="CAGL-CDS1467.1"
FT                   /note="some similarities with uniprot|P53907 Saccharomyces
FT                   cerevisiae YNL144c or uniprot|P38835 Saccharomyces
FT                   cerevisiae YHR131c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60910"
FT                   /db_xref="GOA:Q6FP85"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP85"
FT                   /protein_id="CAG60910.1"
FT                   /translation="MDTEMDMGIELPAYSVHSVDSVHSVHSVDSADSLECAEELPGYSP
FT                   AVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSYVS
FT                   AKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKRSNQ
FT                   YDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEENVYK
FT                   DAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVPRRRR
FT                   RRHSGHSRRRFSSRRRHSSGRTPVRNTEGPSSSTRRRANSFLKHFTGAKSASEPLQIDF
FT                   KNPFTSEQQPDAALVRQKSHHEPPERTPASDQSRSESSAHGDITPNNSISRSTTTSLHD
FT                   NESDVMDGLNNLTRSPSECLSLYETLTANSSFCEYDLDKPHAKLARINYNFDYWSPLQF
FT                   GSSLSSTSSLGLSNSMDCSFDSNESTYPDGMIPELIELEEEIEEDDEDDIDIEDYGLEE
FT                   FEIFEEGEELETDDMNDCDTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVK
FT                   AGLRNKMYNPSLLKDIKPYLMETKIVGAMST"
FT   gene            complement(<556527..>557558)
FT                   /locus_tag="CAGL0J05852g"
FT                   /old_locus_tag="CAGL-IPF7953"
FT                   /old_locus_tag="CAGL-CDS3219.1"
FT   CDS_pept        complement(556527..557558)
FT                   /locus_tag="CAGL0J05852g"
FT                   /old_locus_tag="CAGL-IPF7953"
FT                   /old_locus_tag="CAGL-CDS3219.1"
FT                   /note="weakly similar to uniprot|P40580 Saccharomyces
FT                   cerevisiae YIR036c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60911"
FT                   /db_xref="GOA:Q6FP84"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP84"
FT                   /protein_id="CAG60911.1"
FT                   /translation="MPAPTQPAPSYSKCYALKEIIYGFWATKVTYTPDKYPDLTGKTAV
FT                   VTGCNTGVGKEAAKLLYQKNCNVIGVCRTESKGLEAAESIKQEIGNSKGSISVVSGCDF
FT                   LDFTTVPQAGKRIQEILAGKPLNIIIHNAGLMSSSNAGTSKQGLEAMFQTNVMGPQLLQ
FT                   HYLDPVFLKEDDTSLKRIVWVSSGAHLLGPSQYGIFWENPGFDGVAIEKRPAATTLYGA
FT                   TKAANILQAKAWATRNKEMVDKIGCVSVSCYPGNLRTDLQRDWHPWTRATVGRLFYPAE
FT                   YGAYTELYSVLSPSLTTSDQGKYICPFDQVHEPREDVKEGLQNGTDLALWDWIESEIKE
FT                   YIS"
FT   gene            complement(<558678..>559628)
FT                   /locus_tag="CAGL0J05874g"
FT                   /old_locus_tag="CAGL-IPF7954"
FT                   /old_locus_tag="CAGL-CDS3450.1"
FT   CDS_pept        complement(558678..559628)
FT                   /locus_tag="CAGL0J05874g"
FT                   /old_locus_tag="CAGL-IPF7954"
FT                   /old_locus_tag="CAGL-CDS3450.1"
FT                   /note="similar to uniprot|P53895 Saccharomyces cerevisiae
FT                   YNL159c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60912"
FT                   /db_xref="GOA:Q6FP83"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP83"
FT                   /inference="similar to AA sequence:UniProtKB:P53895"
FT                   /protein_id="CAG60912.1"
FT                   /translation="MNDQEGDSDSELYEQYLEDRRRLQSREDAHEIQTSEEVLQRNLDE
FT                   TLSRVLRNWSQEIDNHHVRIRITGRRHENTNSNSHTNNSYNNGAATENRNNNYGNMLGI
FT                   NLPSHNSIGSNSNGVNQRTPFAQRPSFFRTLVRNLLVLNYLVLSLLFPFSLYNVLRSGF
FT                   STMTFSERDFTREILTYWYAIDTVDVISLIKPSTPETSDSGPGLGLLGKFHNIIVYYSL
FT                   PIGEALLRRILNIDRSYTDTEEYPVSVGIYRMILGFFFRWYKKSIKIVTILVYLLYGIG
FT                   GTTYLMIAGFFFSLCVGLTIVRRYKSTQQILSGLF"
FT   gene            <559944..>560519
FT                   /locus_tag="CAGL0J05896g"
FT                   /old_locus_tag="CAGL-IPF2275"
FT                   /old_locus_tag="CAGL-CDS4511.1"
FT   CDS_pept        559944..560519
FT                   /locus_tag="CAGL0J05896g"
FT                   /old_locus_tag="CAGL-IPF2275"
FT                   /old_locus_tag="CAGL-CDS4511.1"
FT                   /note="weakly similar to uniprot|P53896 Saccharomyces
FT                   cerevisiae YNL158w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60913"
FT                   /db_xref="GOA:Q6FP82"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP82"
FT                   /protein_id="CAG60913.1"
FT                   /translation="MLLYYTVLPVLWLCAIVSANTETLRIRIPRQFKTSELTRQVHDSY
FT                   SILKNLEDTAIVSGNINSTSPFHVIEVRSNWSGTTLDVRVSWTAADGYSINDLGYLLIT
FT                   KEHEVVTPWSNETFEGLHEKLYVYFKVVPDSYPLLEDGQVFNVAINIKETFLGLTSDLY
FT                   VMIAYLIVLASISRLVVVHGWKLLSPLL"
FT   gene            complement(<560739..>561710)
FT                   /locus_tag="CAGL0J05918g"
FT                   /old_locus_tag="CAGL-IPF2276"
FT                   /old_locus_tag="CAGL-CDS3376.1"
FT   CDS_pept        complement(560739..561710)
FT                   /locus_tag="CAGL0J05918g"
FT                   /old_locus_tag="CAGL-IPF2276"
FT                   /old_locus_tag="CAGL-CDS3376.1"
FT                   /note="similar to uniprot|P53898 Saccharomyces cerevisiae
FT                   YNL156c or uniprot|P38837 Saccharomyces cerevisiae YHR133c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60914"
FT                   /db_xref="GOA:Q6FP81"
FT                   /db_xref="InterPro:IPR025929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP81"
FT                   /inference="similar to AA sequence:UniProtKB:P53898"
FT                   /protein_id="CAG60914.1"
FT                   /translation="MVKGRKKKAVKTVESSESISSLTTPQLYSIYDQDIVKSEDAEIYE
FT                   ELKRSRSKSSSLDTPLYAIDEIIHLKKDNDKVNESPLIDVSEGSHIRPLSQHKKLINET
FT                   LLTPSMSAGGNLGLDATMANTMSFHVTPFQRFTNFVFAIVVLSISGVAYHQLSRNLHDN
FT                   HLLHEDFASRPLLWGVTIQQKLSCGILPDWFGYALEGIIFGSIIPLMDHITKVKLRPTS
FT                   YSLSSVIRSINAMLGVTFGIRKIQWASSGQAAGAWGLLNVILWLFFDGTLSMFSNCSVL
FT                   GLLCCASCFHEITDVSQFLYFMDFYFLGSLMFGKIGRYLYHL"
FT   gene            <562687..>564147
FT                   /locus_tag="CAGL0J05940g"
FT                   /old_locus_tag="CAGL-IPF2277"
FT                   /old_locus_tag="CAGL-CDS2145.1"
FT   CDS_pept        562687..564147
FT                   /locus_tag="CAGL0J05940g"
FT                   /old_locus_tag="CAGL-IPF2277"
FT                   /old_locus_tag="CAGL-CDS2145.1"
FT                   /note="similar to uniprot|P23291 Saccharomyces cerevisiae
FT                   YHR135c YCK1 or uniprot|P23292 Saccharomyces cerevisiae
FT                   YNL154c YCK2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60915"
FT                   /db_xref="GOA:Q6FP80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP80"
FT                   /inference="similar to AA sequence:UniProtKB:P23291"
FT                   /protein_id="CAG60915.1"
FT                   /translation="MPHSLTGTPSPGMITSNSSTQGSMSSSKDNGNGGTIAGLHYQIGK
FT                   KIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGTPGVPQAYYFG
FT                   QEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAHDLIYRDIKP
FT                   DNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR
FT                   EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDLANGYPVQ
FT                   FARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWDLTINKK
FT                   PNLHGYGHPNPPGDKSHRNRNAAKGGNHANDANHGGLDPTSYEAYQQQTQQKMLQQQQK
FT                   QSQRNQNTAVDQQNYRLNNNPINNTSQPNNYKGNGGKDTNMMNGNGNGNRYNFQEQPTT
FT                   THGQTKNTQQDMHSSSSEKGFFSKLGCC"
FT   gene            complement(<564491..>565372)
FT                   /locus_tag="CAGL0J05962g"
FT                   /old_locus_tag="CAGL-IPF2278"
FT                   /old_locus_tag="CAGL-CDS3666.1"
FT   CDS_pept        complement(564491..565372)
FT                   /locus_tag="CAGL0J05962g"
FT                   /old_locus_tag="CAGL-IPF2278"
FT                   /old_locus_tag="CAGL-CDS3666.1"
FT                   /note="similar to uniprot|P53899 Saccharomyces cerevisiae
FT                   YNL155w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60916"
FT                   /db_xref="GOA:Q6FP79"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP79"
FT                   /inference="similar to AA sequence:UniProtKB:P53899"
FT                   /protein_id="CAG60916.1"
FT                   /translation="MFAKRAPQSVVNDMNNKEKETGMLDVGTHCQYCRQLDFLPFHCKL
FT                   CDGDFCSEHRSKESHHCKWLLDHPEELENNGARSPPSSSKSNGGKFFQSLLPEKAHIRV
FT                   KSPSPSSTTSQSPVKLGSSGVTTKNKPSETTKIRSTLNPAALNKLLNFFKRTKSDPKTK
FT                   KKVSTSSNRLVELSTLKKTAKGDSKIPVQNRIYIYCQVILGEDETSDTLGLTKVPLYIN
FT                   KIWPVGRALDYLSQQLHVTNVNGNVDTTKGEKLFLYKYDEKLNEYVGIETSGRVNVLVK
FT                   DLDTLYLVRGQI"
FT   gene            complement(<565921..>566964)
FT                   /locus_tag="CAGL0J05984g"
FT                   /old_locus_tag="CAGL-IPF2279"
FT                   /old_locus_tag="CAGL-CDS3180.1"
FT   CDS_pept        complement(565921..566964)
FT                   /locus_tag="CAGL0J05984g"
FT                   /old_locus_tag="CAGL-IPF2279"
FT                   /old_locus_tag="CAGL-CDS3180.1"
FT                   /note="highly similar to uniprot|P53909 Saccharomyces
FT                   cerevisiae YNL141w AAH1 Adenosine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60917"
FT                   /db_xref="GOA:Q6FP78"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP78"
FT                   /protein_id="CAG60917.1"
FT                   /translation="MVPESFLLELPKCEHHLHLEGTLEPDLLFPLAKRNNIQLPDHFPQ
FT                   TPEELAVRYTQFKDLQDFLDYYYIGTNVLLKEEDFFDLAWAYFTKVSKQGLVHAELFYD
FT                   PQSHTTRGVSLETVTRGFERACKKAHEELGITSKLIMCLLRHLPPQDCLQTIEEAEQLI
FT                   KSGVIHGLGLDSAEKPFPPSLFVECYERAAKINPELRLTAHAGEEGTHQFVSDALDLLN
FT                   VTRIDHGVNSKQSEELMARLAEQQTLLTVCPLSNVKLQVVQSVKEIPLQLFLDKNIAFS
FT                   LNSDDPAYFGGYILDNYYQVNKDFPDWDFKVWERIAKNGINGSWCEQKRKEELLAKVDA
FT                   VVAKYTN"
FT   gene            <567376..>567765
FT                   /locus_tag="CAGL0J06006g"
FT                   /old_locus_tag="CAGL-IPF2280"
FT                   /old_locus_tag="CAGL-CDS5058.1"
FT   CDS_pept        567376..567765
FT                   /locus_tag="CAGL0J06006g"
FT                   /old_locus_tag="CAGL-IPF2280"
FT                   /old_locus_tag="CAGL-CDS5058.1"
FT                   /note="highly similar to uniprot|P53900 Saccharomyces
FT                   cerevisiae YNL153c GIM3 Gim complex component"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60918"
FT                   /db_xref="GOA:Q6FP77"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP77"
FT                   /protein_id="CAG60918.1"
FT                   /translation="MELLPEGKKNNIEVTFADQQKINEFSKLIMRKDALEAELKKERQE
FT                   KEYLEDVSLEIELIDEDEEVQYKMGEVFVFLKQSKVVEQLEKDTEIIDEKISQLESKQD
FT                   DLEDRIKELKTSLYAKFGDNINLER"
FT   gene            complement(<568124..>569638)
FT                   /locus_tag="CAGL0J06028g"
FT                   /old_locus_tag="CAGL-IPF2281"
FT                   /old_locus_tag="CAGL-CDS2052.1"
FT   CDS_pept        complement(568124..569638)
FT                   /locus_tag="CAGL0J06028g"
FT                   /old_locus_tag="CAGL-IPF2281"
FT                   /old_locus_tag="CAGL-CDS2052.1"
FT                   /note="highly similar to uniprot|P41948 Saccharomyces
FT                   cerevisiae YNL142w MEP2 high affinity low capacity ammonia
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60919"
FT                   /db_xref="GOA:Q6FP76"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP76"
FT                   /protein_id="CAG60919.1"
FT                   /translation="MSYNFTGTPTGHGTGGDSLTTDLNTQFDLVNMTWLGVCTSGVWLM
FT                   VPGIGLLYSGLSRKKHALSLLWASLMAACLVIFQWFFWGYSLSFSHETRGNGFLGTLEF
FT                   FGFRNVLGAPSVVTSVPDIVFAIFQGMFAAVTGALMLGGACERARLMPMMIFLFLWMTI
FT                   VYCPIACWTWNAEGWLAKLGALDYAGSGPVHTASGHGALVYALILGKRNDPVAKKGMPK
FT                   YKPHSVTSVVLGTVFLWFGWQFFNPGSAGNASIRAWYSAMNTNLAAASGGLTWLFIDYF
FT                   RTGGKWTTVGMCSGIISGLVGITPGAGFVPIWSSFIIGVLSAAGCNLAVDLKNVLHIDD
FT                   GLDVYALHGVGGCIGSVLTGIFAADYVNATAGSYIAPIAGGWLNHHWKQVGYQLAAICA
FT                   TIAWTVTITAILLLAMDQIPFLRLRLRPEEEEQGTDEAEIGEFTYQEEQEYIPEPVRSR
FT                   SPGMQPKMSSIDDKITGPQQVIDSKLSESESGSNEAGSNMGEKQTV"
FT   gene            complement(<571225..>572331)
FT                   /locus_tag="CAGL0J06050g"
FT                   /old_locus_tag="CAGL-IPF2282"
FT                   /old_locus_tag="CAGL-CDS2998.1"
FT   CDS_pept        complement(571225..572331)
FT                   /locus_tag="CAGL0J06050g"
FT                   /old_locus_tag="CAGL-IPF2282"
FT                   /old_locus_tag="CAGL-CDS2998.1"
FT                   /note="similar to uniprot|P38616 Saccharomyces cerevisiae
FT                   YNL160w YGP1 secreted glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60920"
FT                   /db_xref="GOA:Q6FP75"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP75"
FT                   /inference="similar to AA sequence:UniProtKB:P38616"
FT                   /protein_id="CAG60920.1"
FT                   /translation="MKFQVALTSLLAAAAVASPVEDLFKHKAKKSSTSSVHPSSTTKGK
FT                   PTSSAHAKALPSSLASLLANTTGNASNMTNSTVAPQKQQLQVIYTGGQVAIPSTNATNT
FT                   TAFSTNSTALFNTTSALNITELYSVAATINQTLADNSTKGAVVVANAKSLESLGFLTSI
FT                   VLDSKKPIVISADEKMALAVANETAAWNRGPLVVSKEGLVYAGIFTPSSANAVGLPVAV
FT                   IDDAKKVQWFFSPAPPALINSNSTIRVNYTNFTNTDIEFAATPLVPIVYDGGYSSSLIS
FT                   SLASTVQGLVVVSSGSSNSTTSTIESAQIPVVYANSGAPLTPVSSKDVPQNALSAGYLT
FT                   PVKAQLLLSIAAINGVNSDEALMSIFPN"
FT   gene            complement(<574501..>576822)
FT                   /locus_tag="CAGL0J06072g"
FT                   /old_locus_tag="CAGL-IPF2286"
FT                   /old_locus_tag="CAGL-CDS0877.1"
FT   CDS_pept        complement(574501..576822)
FT                   /locus_tag="CAGL0J06072g"
FT                   /old_locus_tag="CAGL-IPF2286"
FT                   /old_locus_tag="CAGL-CDS0877.1"
FT                   /note="similar to uniprot|P53894 Saccharomyces cerevisiae
FT                   YNL161w CBK1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60921"
FT                   /db_xref="GOA:Q6FP74"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP74"
FT                   /inference="similar to AA sequence:UniProtKB:P53894"
FT                   /protein_id="CAG60921.1"
FT                   /translation="MFGGEYDHAYDANNGQRFQPPVLDAMEFEKPGSPSVGDHFLRQQI
FT                   SNQSLHDQYSSHMEQQQQQQQQQHNAAYGAGFTDIPQLHPSTPPHGLVQKISNGNFHPA
FT                   MNQGGNIPSTSNMNNMFNTPPPTMGNNPLYSHDNNSTNLLQDNLNQARSQFSPDRYSVD
FT                   SDFNNGAGNHVMANGNYNINGSQSSSPYHQPQTFYTNSNLSSGQLSAHRSSPQRQPAQP
FT                   LQQTTFTQLPQPSLPPQQQQQQQQQQQQQQQQQPKFQSMVPPQQTQLQQQQQQELQNAG
FT                   SYMYFERRPDLLSKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELGSHNWSE
FT                   ERNARQLASLGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMK
FT                   TLLKSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTM
FT                   LIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTG
FT                   FHKTHDSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQTWRK
FT                   SRRLMAYSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYR
FT                   KIMNFEQTLQFPEDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTI
FT                   RQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKNGVNPNQNQVKED
FT                   LPFIGYTYSRFDYLTRKNAL"
FT   gene            complement(<577278..>577484)
FT                   /locus_tag="CAGL0J06088g"
FT                   /old_locus_tag="CAGL-IPF13655"
FT   CDS_pept        complement(577278..577484)
FT                   /locus_tag="CAGL0J06088g"
FT                   /old_locus_tag="CAGL-IPF13655"
FT                   /note="similar to uniprot|Q3E7A8 Saccharomyces cerevisiae
FT                   YNL162wa"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58045"
FT                   /db_xref="GOA:B4UN29"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN29"
FT                   /inference="similar to AA sequence:UniProtKB:Q3E7A8"
FT                   /protein_id="CAR58045.1"
FT                   /translation="MDARVCPQCGELLHRFMIRMKHAVVMCANDKCMYPFNTPGGIESN
FT                   LVYVEGSELLEASTKIEKPPSRH"
FT   gene            <577719..>581045
FT                   /locus_tag="CAGL0J06094g"
FT                   /old_locus_tag="CAGL-IPF2290"
FT                   /old_locus_tag="CAGL-CDS0314.1"
FT   CDS_pept        577719..581045
FT                   /locus_tag="CAGL0J06094g"
FT                   /old_locus_tag="CAGL-IPF2290"
FT                   /old_locus_tag="CAGL-CDS0314.1"
FT                   /note="highly similar to uniprot|P53893 Saccharomyces
FT                   cerevisiae YNL163c translation elongation factor eEF4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60922"
FT                   /db_xref="GOA:Q6FP73"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP73"
FT                   /protein_id="CAG60922.1"
FT                   /translation="MVRVLPETFKRLQSDPTCVRNICIVAHVDHGKTSLADSLLASNGI
FT                   ISQRLAGRVRYLDARPDEQLRGITMESSAISLYFRVLHKQEGKDEPLVNEHLINLIDSP
FT                   GHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPVLVLNKIDRLIT
FT                   ELQLTPMEAYIHLNKTIEQVNSVIGSFFAGERQLDDLSWRERLETNANAEFIEKDDSEI
FT                   YFTPTDNRVIFASAADGWGFNIGQLAKFYEKKMGAKRENLQKVLWGDFYMEPKTKKIIT
FT                   NKNLKGRNLKPLFVSLILDNIWKIYENVIMEKDLDMVEKFTKILDVTLTARDLRTKDDK
FT                   QLLRQIMGQWLPVSTAVLLTVIEKLPSPLESQSERLDVIIGKEYEKEDVDEDLIKDMKE
FT                   CNRNGQLCAYVSKMLSIPRDELPLEDNKNMTADQIIERNRRAREVAMNAAKRAEMLEKS
FT                   KDNSTEEDLYARAKETIITPELDSGTENKTKNDTFQIVTAPAAPLDLGFEYEEDPEAVS
FT                   DDDSDTNGDAIPEFVPGEIDPNDPLSSMFEYEEEDPFSTGATLAETHFEPVSLEELKDD
FT                   DIFDEKDEVLIGFARIYSGTLEVGQEISVIGPKYDPKNPTEHIHTTTITKLYLFMGKEL
FT                   VSLNSCPSGNIVGIGGLAGKIIKNGTIVGNSAKGLNLAGVNLHSTPIVRVAIEPSNPME
FT                   INKLVRGLKLLDLADPCVNIEVEDSGEHILCTAGELHLERCLKDLKERFAGIDITHSEP
FT                   AIPYRETFLNVSGMNPPKNPELGRSVIELKLGKYRMSFRSIPLSDEITNFLTHHERTIA
FT                   RIVSSKSANENIEEQILDEDTFWKKLGSLFEESEGTEELVSYMDKIAAFGPKRIGANIL
FT                   VSNNGILGNVKQHEAPQFEYSDSIINGFLLSVNEGPLANEQVQGMCVVLEDIHEMTENE
FT                   ISEIDDPHYQVDEPNLSGRLITTTRDCIHKSFLDWSPRIMWAMYTCDIQTSVDVLGKVY
FT                   AVVQQRHGKIISEEMKEGTPFFQIIARIPVVEAFGLSEDIRKKTSGAAQPQLVFDGYES
FT                   IDLDPFWVPTTEEELEELGETADKENIARAHMNNIRRRKGLFIEEKVIQNAEKQRTLKR
FT                   N"
FT   gene            <581464..>582420
FT                   /locus_tag="CAGL0J06116g"
FT                   /old_locus_tag="CAGL-IPF2291"
FT                   /old_locus_tag="CAGL-CDS3427.1"
FT   CDS_pept        581464..582420
FT                   /locus_tag="CAGL0J06116g"
FT                   /old_locus_tag="CAGL-IPF2291"
FT                   /old_locus_tag="CAGL-CDS3427.1"
FT                   /note="similar to uniprot|P53892 Saccharomyces cerevisiae
FT                   YNL164c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60923"
FT                   /db_xref="GOA:Q6FP72"
FT                   /db_xref="InterPro:IPR026231"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP72"
FT                   /inference="similar to AA sequence:UniProtKB:P53892"
FT                   /protein_id="CAG60923.1"
FT                   /translation="MSSNNQNTNNTSIELISENGPISLNLMMEEGVKALTRILSNQLND
FT                   TPGTQPMHFIIKKNDKDNKAIDINGDDEEVVELGNESNYHMSDGVQNEAEIILNDQLND
FT                   ILKNHESQLRLDGEEAEIIFDYETQGTVDGSDSIGEKITQMIESVLPNGLGPNTTGKLQ
FT                   AVLNGKELNITEEIHKSDRIEEEEHIEGGLTTAEGNFEVEFETEPLPEDHKHTEENIDG
FT                   HENYNDCCPHHHNNQDNRRRAPKYKNYNYHDYEYTVQHPKTEPNFSALINQKKPVCLFC
FT                   EYYMVFGEPPKNMIKWYNMHYGYNHLPQRNDRHHRNR"
FT   gene            complement(<582568..>583785)
FT                   /locus_tag="CAGL0J06138g"
FT                   /old_locus_tag="CAGL-IPF2292"
FT                   /old_locus_tag="CAGL-CDS2733.1"
FT   CDS_pept        complement(582568..583785)
FT                   /locus_tag="CAGL0J06138g"
FT                   /old_locus_tag="CAGL-IPF2292"
FT                   /old_locus_tag="CAGL-CDS2733.1"
FT                   /note="similar to uniprot|P53891 Saccharomyces cerevisiae
FT                   YNL165w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60924"
FT                   /db_xref="GOA:Q6FP71"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP71"
FT                   /inference="similar to AA sequence:UniProtKB:P53891"
FT                   /protein_id="CAG60924.1"
FT                   /translation="MDRVRSLLNSRRVVRVPEDEGERVLLPPQNSVSVESTAEHLYRPH
FT                   VGGDDDDQMTMIDGDRDDMTMHTLLSESSTIGDFQRLGFVNRCPNFDNERVVPFVSVLL
FT                   SRGFYAFASEESYKAYLGNKRKIEKFDVQSELGIPLFHALPSNVVKSMFGSRSTPVMRI
FT                   FKFIVVRTCDANDNEGSTRADVLDFAPQGSELVSELQGTPYSVYKYQFCTIFKAVDTKT
FT                   GKVEHKFAFSKLTSDVKDTVITENVNMTNYMQSRNADTNYAGLNLRWYGSTGFASPFGS
FT                   NNIKLLVLDDSMPSYMTQDTLNDYEQARRAERLRPLGYLPVWARYSDDKVSVIPKKRTL
FT                   RVATLDIKEQNRELSSDNPNTAFGLPWDTQVLTCMCMLLHEYESRKDKRHNATLRSQLV
FT                   GPGMLM"
FT   gene            <584111..>585373
FT                   /locus_tag="CAGL0J06160g"
FT                   /old_locus_tag="CAGL-IPF2294"
FT                   /old_locus_tag="CAGL-CDS2633.1"
FT   CDS_pept        584111..585373
FT                   /locus_tag="CAGL0J06160g"
FT                   /old_locus_tag="CAGL-IPF2294"
FT                   /old_locus_tag="CAGL-CDS2633.1"
FT                   /note="similar to uniprot|P53890 Saccharomyces cerevisiae
FT                   YNL166c BNI5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60925"
FT                   /db_xref="GOA:Q6FP70"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP70"
FT                   /inference="similar to AA sequence:UniProtKB:P53890"
FT                   /protein_id="CAG60925.1"
FT                   /translation="MLDQEDVKKRMSQIELDINQMNKMIDENLQLGENDGHDSGTEGVE
FT                   GAVGEGVDGQAGPVEPVVTTAAEETSETKDIEHEQVTNEGMAKEVEDASESSVQATEQA
FT                   QDQQAGTNEETNTFKTESMPEPETQAPEVNDLEMKEPEMKEPEMKEPETVEPETVEPEM
FT                   KEPETVEPEMKEPVIKETDALEPEMKHAEIPPQATTEEQPTRHDEWEDVEEEEFNEIDT
FT                   STESNNVIGDTKQVEGSSVLAAGDLRGNVADNGNLTPVTDIDDAESTIFIPKKQNQNSE
FT                   LTEQMKETLRNTRRTTNPFRVISVSSSNSSTNSSRKSSGHDMGLEQTPSEQLKRYEQRH
FT                   YYLTTKCGKIQKEIDYLNKMNSQGTLSIDDSRKLTRAIAKLQEYLDKKNKERYEVGVLL
FT                   SRQLRRDINRGENGEFWIGTK"
FT   gene            <586031..>587572
FT                   /locus_tag="CAGL0J06182g"
FT                   /old_locus_tag="CAGL-IPF2297"
FT                   /old_locus_tag="CAGL-CDS1991.1"
FT   CDS_pept        586031..587572
FT                   /locus_tag="CAGL0J06182g"
FT                   /old_locus_tag="CAGL-IPF2297"
FT                   /old_locus_tag="CAGL-CDS1991.1"
FT                   /note="similar to uniprot|Q02100 Saccharomyces cerevisiae
FT                   YNL167c SKO1 cre-binding bzip protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60926"
FT                   /db_xref="GOA:Q6FP69"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP69"
FT                   /inference="similar to AA sequence:UniProtKB:Q02100"
FT                   /protein_id="CAG60926.1"
FT                   /translation="MQNTSSRPSGSLGTVSSFDLEPNPFEQSFASTKKTESGGDGGNIG
FT                   NTNDSAANGDGLDNAKGMASLSYLDSQNNGSSGSLNIDPQIAGDQKRAASLIYGNQRGP
FT                   MQSPPLLTPGGSKKLPPLLMSPSYLQGQSQSGQNGSSHNGSATGGQTPLGGSQGVANGS
FT                   ETDGQLPGFLMNLFKSGLTPNESNLRANFTPGILGSQFNQGSLPSLMNNNVSISRANSN
FT                   SVVPTNGDKDESGSGRKMNGQIDIPNKALTALGGLPAGQLTPGLSSLLASSAKQLNLDN
FT                   NTRESTPNISVSQPVVQGVTKSNSVPTNSYFPLADTTIEKDSGADGADNQSGTQKKRGR
FT                   KKSVSTKATEPKRKRASTSSASKKSEGNTGTATVTNPEANNAVNTGNDDLDEQERRRQE
FT                   FLERNRVAASRFRRKKKEYIKKIETDLGILQTEYNDMSKIIGHLAGITPEGSDDRVSAS
FT                   ILLMLEQSLMNNDIKAALQIIESTKQILTSSNFVKRNGANPVAKNTSHDSSDSGK"
FT   gene            <588083..>588868
FT                   /locus_tag="CAGL0J06204g"
FT                   /old_locus_tag="CAGL-IPF2298"
FT                   /old_locus_tag="CAGL-CDS3906.1"
FT   CDS_pept        588083..588868
FT                   /locus_tag="CAGL0J06204g"
FT                   /old_locus_tag="CAGL-IPF2298"
FT                   /old_locus_tag="CAGL-CDS3906.1"
FT                   /note="highly similar to uniprot|P53889 Saccharomyces
FT                   cerevisiae YNL168c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60927"
FT                   /db_xref="GOA:Q6FP68"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP68"
FT                   /protein_id="CAG60927.1"
FT                   /translation="MSYTYLKDAKKIICIGRNYAAHIKELNNATPKQPFFFLKPMSSVV
FT                   TPVDEKHAIKELPKQASYHGLNDDGTNPGTIQIPKGTVVHHEIEVALVMDKYISNANES
FT                   EFTAADVYDSIRGVALALDLTARNVQDEAKKKGLPWSIGKGFDTFLPMSHMIPKTKFEA
FT                   NKENLQEAFRVTCDVNGTRRQDGNTNLMLYPLHKIIQHISTMMTLEPGDIILTGTPAGV
FT                   GPIAAGDNISGQLYYTDDLLIDFNFDCVVRPGPYEYKET"
FT   gene            <589288..>590814
FT                   /locus_tag="CAGL0J06226g"
FT                   /old_locus_tag="CAGL-IPF2300"
FT                   /old_locus_tag="CAGL-CDS2023.1"
FT   CDS_pept        589288..590814
FT                   /locus_tag="CAGL0J06226g"
FT                   /old_locus_tag="CAGL-IPF2300"
FT                   /old_locus_tag="CAGL-CDS2023.1"
FT                   /note="highly similar to uniprot|P39006 Saccharomyces
FT                   cerevisiae YNL169c PSD1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60928"
FT                   /db_xref="GOA:Q6FP67"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP67"
FT                   /protein_id="CAG60928.1"
FT                   /translation="MIPVKTVLLKSKTLLSGRMPVRLSNGMQLRNRTAILKRGITNRLS
FT                   NPQRKSNEIVRKARSYASVTTKQKEKYIVSVNMKWAVLTGVTIVLGTLLLTSRRIEEDE
FT                   DSKKDSEGQGKRYKKIRILDNNWLFFCYSTLPLNAISRLWGQVNSYTLPIWLRPSGFKF
FT                   YSYLFGVNLDEMENPNLEDYANLSDFFYRNIRPETRPVAPGDEVIVCPSDGKVLQIGII
FT                   NSETGEVEQVKGLTYSIKEFLGTHSHPLLCKSESTLDLSGHEERHQEFARANKFKVSYS
FT                   SPDLNATKDEEATDVIKFENEGDKTVDEYNTPSISKTMKLLTEVSPNFPSYTSSMTGPE
FT                   ETNLYFAVIYLAPGDYHHFHSPINWVCRLRRHFPGDLFSVAPYFQRNFPNLFVLNERVA
FT                   LLGYWRHGFFSMTPVGATNVGSIKLNFDEELKTNAKRRKIKPHTCYEAVYEKASKVLGG
FT                   LPLTKGEEMGGFMLGSTVVLCFEAPKDFQFHIKTGEKVKMGQKLGSIQKD"
FT   gene            complement(<591163..>596457)
FT                   /locus_tag="CAGL0J06248g"
FT                   /old_locus_tag="CAGL-IPF2302"
FT   CDS_pept        complement(591163..596457)
FT                   /locus_tag="CAGL0J06248g"
FT                   /old_locus_tag="CAGL-IPF2302"
FT                   /note="similar to uniprot|P53886 Saccharomyces cerevisiae
FT                   YNL172w APC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60929"
FT                   /db_xref="GOA:Q6FP66"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP66"
FT                   /inference="similar to AA sequence:UniProtKB:P53886"
FT                   /protein_id="CAG60929.1"
FT                   /translation="MNFKEDFSLFKKCFECSDDDLGDLWVSPDRRTVEWLVGKGTECRR
FT                   RFTFNSSAVVRAGFTKFENLQTKCLIIVLRELAYVYYIANESSESAKSDSSTICFPFPI
FT                   KDAFMYQNGIILERDDMLSLEPGSGGKSIFSEENSGRTSIEQQFISLSDPLAPFGTLVF
FT                   INEDDTILTSSGKRRNTREIDTVDGNILFKKKRRTCSPNEYTKELENSEQTCLASSRVR
FT                   HPLKMMTFPKNSGLSITVLYDSEELNLQFYYTRILGDNARTENTLSDYKNSNSAGQNSH
FT                   LQISKPRTISKLEASQQLENRHQYSNDLRKLSLMNRKVTPNAGLPVDVQLKSPADFFQE
FT                   VNVSHQQLSSSTLKRNDSSTMDRLGINGNESLLKNHPNSSVRVSSSTMATTDTMSSETS
FT                   IKDVVLTKISTVKLPESLRNGEGGINIKCLPLKYENMEGVLIFDTEKGYYKLWFIDMIP
FT                   EVINSNSFLLYGTFPQLMIQLKNLPKVDFGNILDFQPTNSSEYRLDGCVFAITEEKTYI
FT                   MNPYLDIYYEENIMAIRRMEMVSKEQLIVHQFPSTFVRYFTLYDRCPKRLLLREIFLSF
FT                   RYICDSKFYQLLVFFWFQISLEYVNSKENLDVFDCEWECFKVLISSLMSPDSLTSLPSL
FT                   RNSRILNSLERMDVGVTFPKMVMGLHLLREETILNIYRRRDTDDMGSLIGAITTILEWP
FT                   SQWDDYYQDYKGLKAIPCCLNLSSNIVNGYVKPLDAPTSILGSLSSLSDKDVNTIVPFI
FT                   EFSRLVEMDNKVNELITPRTFKVTRLFESLNNISPKSHFLKVLTKFKMNREDLQSYPPG
FT                   LFKPMVEALQLFENNFAEIEEDVDVGLISRADLARYSSILKEKMTWKGSNESALKTDIK
FT                   ASPLLNAKSTKSILSVLSDIVLSSESQLSKDILLDQNASEDIDDGVNLKKNSSLIFSED
FT                   RRFNDAMTLLSFSKVQKVPFFSTDSEYSKILSKKKKIAEIIALRSCAQGIGWAMVVFAT
FT                   EKPLSTQKWVLRPINFSVSFPDETVINVDKDLIPSDIIEWGEFHAGVSSGLKISRKTKG
FT                   VNGSWIVFNKPKDVSASHAGFLLGLGLNGHLKELEEWHIYNYLSLKNTHVGVGLLLGMT
FT                   ASMRGTMDLTLTKILSIHIASLLPKGANDLNIDIRVQTAGLVSLGLLFLKSQHKKMTNI
FT                   LVDQLESLVLINEEYVANEGYRMAAGIAIGMINLGAADNFTKSCGTEEHKKSRSNLVED
FT                   DLDSSYNLPEIQDSAYFTSLTDGLLNKLKFHSEAEKSELPQNSYIGRLLAIMLIYLKSE
FT                   NADVADQVKPKIIFGFERSSCRPEFYMFSEFAYRMIMWDSIHDSVEFLMEELGVDILDS
FT                   CLKSDHMQIYYILSGRILSLGLKFASTGNLRIKEFLLSLFDQLLPFYQYPGRDSVDFKL
FT                   VVTSINVLLNVIMVSLSMVMSARGDLDVFKRIRYVHEVVFGSSSDIYHRKESKSQNNWD
FT                   HSDANTINNQAVGSSRRSSLNGFEEVVEGGSAGEDTVPPNFDQPDTDNHYAKYIATSLS
FT                   IGFLFLGSGQYALKNTDKESVAYLILSTLPLFLPPYYLQELRHFWSLAVESRCLLVKDA
FT                   TTDKMVSGVDIRVLTKSANSQKLNEQILRTPCLLPEINAIKAISLISNDYYPLHIDFSK
FT                   NISASKLFKNGTILYVQSKKESSYPNGASDYRTRNNTDVVDLSLSKKIEKRLRFDKIMV
FT                   QPASSILSLLHIKGKDLQDPLNEFEDSSICSRNSKFDLELIQNNRRVSSISNDDLAIWW
FT                   KLYEEAQH"
FT   gene            complement(<597098..>599275)
FT                   /locus_tag="CAGL0J06270g"
FT                   /old_locus_tag="CAGL-IPF2303"
FT                   /old_locus_tag="CAGL-CDS1005.1"
FT   CDS_pept        complement(597098..599275)
FT                   /locus_tag="CAGL0J06270g"
FT                   /old_locus_tag="CAGL-IPF2303"
FT                   /old_locus_tag="CAGL-CDS1005.1"
FT                   /note="weakly similar to uniprot|Q12027 Saccharomyces
FT                   cerevisiae YDL176w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60930"
FT                   /db_xref="GOA:Q6FP65"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP65"
FT                   /protein_id="CAG60930.1"
FT                   /translation="MSRTITLAVSTPSNKKGNTSTYCILDNKDGKFTRIRRSSNFGDES
FT                   VDSSVLAFCYLVPKDRSLYGNQKPSQRAEKTNNPVEGDCTSNINSEVEENETNFPNFDL
FT                   KDDSDYMLICRSNGIIEVVKDYRQKIYQNSSLCPQFLWKCFPDDIDPTGDFDFSIANLS
FT                   YFKGLLYCCTTSGKVYIFILNLPEDYIQVENLISNSDSNKIKDMKNDGNGGTTAARNIS
FT                   PDEDEFFKLTQYRYCGKTDDICYFLIPIDEDTRNSILGQQKYTASYSGAIMYKSSGYNR
FT                   LDQGIANFQINPLDRLSFIVSAQRSPLMIRKVVMTRIFVIFLRTYLKKKLECQSNQYLQ
FT                   SSSLIFNLDNDIANMPQIDHRLWNSIIQLSGTAPLQSIIVWKQKFGGRKDEIDKLLHNI
FT                   ADNQNVELAENLSISTRPLSRGNLMVNRSQDSLFRRINYMSRQLTEKKVDTLLKSLKKN
FT                   TFPIDFCAVQLRQESQQHIFNGSYTFNDEPPSDVEDDVIVSFLTDKYRNLDIYSIEKFL
FT                   KFHVFRPRLMNEPLVEINVYPNHQYSEFSNTKDSRERFDEILSQVCSFKKLFVLTEKII
FT                   LIIGSGGVLLLDRSLLKYMNHLSDNPIESICIIKIDLGLLNDAILLVDRFETCKDCSGV
FT                   LLNFQLITTNLSGEINSYNCMMRPHSRIGSYECTDSIQLTKVGKFVDKLIFITDFKEQV
FT                   SSRKRSQSDIEMGQSRKKQRSLSDNFVISSI"
FT   gene            <599887..>600336
FT                   /locus_tag="CAGL0J06292g"
FT                   /old_locus_tag="CAGL-IPF2304"
FT                   /old_locus_tag="CAGL-CDS4835.1"
FT   CDS_pept        599887..600336
FT                   /locus_tag="CAGL0J06292g"
FT                   /old_locus_tag="CAGL-IPF2304"
FT                   /old_locus_tag="CAGL-CDS4835.1"
FT                   /note="similar to uniprot|Q12257 Saccharomyces cerevisiae
FT                   YDL177c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60931"
FT                   /db_xref="GOA:Q6FP64"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP64"
FT                   /inference="similar to AA sequence:UniProtKB:Q12257"
FT                   /protein_id="CAG60931.1"
FT                   /translation="MDWNVSDVVTDKKSKFQARCCFLRDQKDIPDILQGMIQSDKHIAK
FT                   ASHMHMYAWRTGTEELKGNEKQTKKKNNKKQDEVVQLKNVQQGSSDCGEAGAGQRLLTL
FT                   LERSNAFNVIVIVTRWYGGTPLGPARFRHICSAALQSLRIGGFVP"
FT   gene            complement(<600516..>602147)
FT                   /locus_tag="CAGL0J06314g"
FT                   /old_locus_tag="CAGL-IPF2305"
FT                   /old_locus_tag="CAGL-CDS1808.1"
FT   CDS_pept        complement(600516..602147)
FT                   /locus_tag="CAGL0J06314g"
FT                   /old_locus_tag="CAGL-IPF2305"
FT                   /old_locus_tag="CAGL-CDS1808.1"
FT                   /note="highly similar to uniprot|P46681 Saccharomyces
FT                   cerevisiae YDL178w AIP2 actin interacting protein or
FT                   uniprot|P39976 Saccharomyces cerevisiae YEL071w DLD3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60932"
FT                   /db_xref="GOA:Q6FP63"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP63"
FT                   /protein_id="CAG60932.1"
FT                   /translation="MMLKCGRQYRIVSKNASRVLNSTAVSGRNRLGLYMQPLLTMAAYT
FT                   RTYSSKLPPRLTAETYPEVKRDGRFKSLAKDDIDYFKSILSETELLEGNDSNDSLAAYN
FT                   EDWMRKYKGQSKLLLKPKTVEQVSKIIKYCNDNRLAVVPQGGNTGLVGGSIPVFDEIIL
FT                   SLANLNKIREFDPVSGIFKCDAGVILEAANEYLEKNGYIFPLDLGAKGSCHVGGVVATN
FT                   AGGLRLLRYGSLHGSVLGLEVVLPNGKIVNSMHSLRKDNTGYDIKQLFIGSEGTIGIIT
FT                   GVSILAPPKPKFTNVCFLSLEDYESVQKVFVKARQELSEIISAYEFMDNKSLSLTKDHL
FT                   EGVPFPLEDEHPFYVLIETSGSNKEHDDAKLEAFLELAMEEGLVTDGVVAQDETELANL
FT                   WQWREMIPESSQSNGGVYKYDVSLPLKSMYSLVEAVNDRLTQHGLLGEAPKPVVSAIGY
FT                   GHIGDGNLHLNVAVREYTKEVEKCLEPFVYEFIQRHHGSVSAEHGLGFQKKNYIQYSKT
FT                   PEEIEMIKSIKNQYDPNSILNPYKYI"
FT   gene            complement(<602954..>603898)
FT                   /locus_tag="CAGL0J06336g"
FT                   /old_locus_tag="CAGL-IPF2307"
FT                   /old_locus_tag="CAGL-CDS3472.1"
FT   CDS_pept        complement(602954..603898)
FT                   /locus_tag="CAGL0J06336g"
FT                   /old_locus_tag="CAGL-IPF2307"
FT                   /old_locus_tag="CAGL-CDS3472.1"
FT                   /note="similar to uniprot|Q12477 Saccharomyces cerevisiae
FT                   YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
FT                   YDL127w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60933"
FT                   /db_xref="GOA:Q6FP62"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP62"
FT                   /inference="similar to AA sequence:UniProtKB:Q12477"
FT                   /protein_id="CAG60933.1"
FT                   /translation="MFETPPYCGLNPVEYEILVRFLKRNVTYEMLTFLISKTNSMIKIK
FT                   KTNSPKPVELSLFVEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMFLG
FT                   CLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDINIQIEELYNTLE
FT                   PILKPIREEMVTRRYTLYLPTPSSSPGKIDGRIKLSSHPVLQKQIAEEISTYLDDASPV
FT                   SSISTFYDSESPTSMQSGHNGRLYLCDNCSTPALGNSTVSSEYVLDSSNQRKRGHSSDL
FT                   KSTKSEEEESNLEYLFKRDKKLVRWNNRWSMVF"
FT   gene            complement(<605140..>606867)
FT                   /locus_tag="CAGL0J06358g"
FT                   /old_locus_tag="CAGL-IPF2311"
FT                   /old_locus_tag="CAGL-CDS1634.1"
FT   CDS_pept        complement(605140..606867)
FT                   /locus_tag="CAGL0J06358g"
FT                   /old_locus_tag="CAGL-IPF2311"
FT                   /old_locus_tag="CAGL-CDS1634.1"
FT                   /note="similar to uniprot|Q12301 Saccharomyces cerevisiae
FT                   YDL180w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60934"
FT                   /db_xref="GOA:Q6FP61"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP61"
FT                   /inference="similar to AA sequence:UniProtKB:Q12301"
FT                   /protein_id="CAG60934.1"
FT                   /translation="MVRISSAASYFMPLLCSKKPSVVVSAVFVVTLIYSLAYLSSTILP
FT                   NAYDDPNMFAPNSQDYFRTFLLGFFSPCLLYLTRSFLLSVNPNQRFINLILDFPINDSF
FT                   LLLIIIGLAYPQIQDGHGIHTKNDGDDASAVQWHIIPKQSYIFGISWSLSEFIICAISN
FT                   LFEFQEVSIAGQLNSKEDSEIDVLNRKNSLNRENITLSKCIGVRRKSSTISNNVYTNDA
FT                   DPEVSTSKYGTLTYMDYTSWDKFRKSNFNSDEYGREANKNITTDKTGRDPLIIINPKDN
FT                   SLRITSLNREGNHLEFEESEPIFKDKRGFTWVRWKEDNYLENQGNMLDSDTTSIRHANV
FT                   IERLTSNGGQKSYFTLKGYGHLGKNFFIMSVVIFSNIWMTIGQSLLMSIYFIYVRGHEK
FT                   LFSDTVIFFGSKDITYFLLVVFIPFVSMNFLINTYIYLQDTLVEWFIDPYFNMNGGIGA
FT                   SLNNQYPYYPIVENSLLFPNKKRVSTANSKPTRQDLTSSYDSALLMESAMLYGSHNNAD
FT                   DYDANDPKPLKLAKRMIIKWKEISASDQFVLSAMFIWGLSVFVCGLFATIPSFNIPSR"
FT   gene            complement(<607459..>608292)
FT                   /locus_tag="CAGL0J06374g"
FT                   /old_locus_tag="CAGL-IPF13664"
FT   CDS_pept        complement(join(607459..607665,608179..608292))
FT                   /locus_tag="CAGL0J06374g"
FT                   /old_locus_tag="CAGL-IPF13664"
FT                   /note="highly similar to uniprot|P10622 Saccharomyces
FT                   cerevisiae YDL130w RPP1B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58046"
FT                   /db_xref="GOA:B4UN30"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN30"
FT                   /protein_id="CAR58046.1"
FT                   /translation="MSDAAISYAAFILADAGLEITSENLQTLTKAAGANVDNVWADVYA
FT                   KALEGKDLKEILSGFHTAGPAVGGAAAAGGAAAASGEAAAEEKAEEEAEESDDDMGFGL
FT                   FD"
FT   gene            complement(<609450..>609731)
FT                   /locus_tag="CAGL0J06380g"
FT                   /old_locus_tag="CAGL-IPF2314"
FT                   /old_locus_tag="CAGL-CDS5626.1"
FT   CDS_pept        complement(609450..609731)
FT                   /locus_tag="CAGL0J06380g"
FT                   /old_locus_tag="CAGL-IPF2314"
FT                   /old_locus_tag="CAGL-CDS5626.1"
FT                   /note="weakly similar to uniprot|P01098 Saccharomyces
FT                   cerevisiae YDL130wa STF1 or uniprot|P01097 Saccharomyces
FT                   cerevisiae YDL181w INH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60935"
FT                   /db_xref="GOA:Q6FP60"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP60"
FT                   /protein_id="CAG60935.1"
FT                   /translation="MLRLNAINTLKQSKSVTPACQTAMRRYSNIPPPVGGFSSTGQSDT
FT                   FNKREKAAEDYFIKQHEKEQLKNLREQLKHHKEQLQDLEEKIEKITKN"
FT   gene            complement(<610975..>612270)
FT                   /locus_tag="CAGL0J06402g"
FT                   /old_locus_tag="CAGL-IPF2315"
FT                   /old_locus_tag="CAGL-CDS2549.1"
FT   CDS_pept        complement(610975..612270)
FT                   /locus_tag="CAGL0J06402g"
FT                   /old_locus_tag="CAGL-IPF2315"
FT                   /old_locus_tag="CAGL-CDS2549.1"
FT                   /note="highly similar to uniprot|Q12122 Saccharomyces
FT                   cerevisiae YDL131w LYS21 or uniprot|P48570 Saccharomyces
FT                   cerevisiae YDL182w LYS20"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60936"
FT                   /db_xref="GOA:Q6FP59"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP59"
FT                   /protein_id="CAG60936.1"
FT                   /translation="MTANNNPYAPSPTDYLSNVNSFQLIDSTLREGEQFANAFFDTEKK
FT                   IEIAKALDDFGVDYIELTSPVASEQSYKDCKAICNLGLKAKILTHIRCHMDDAKVAVET
FT                   GVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEIRFSSEDSFRSDLVD
FT                   LLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSCDIECHFHNDTGCAIAN
FT                   AYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLV
FT                   AEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLT
FT                   GWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAEITTPQLR
FT                   SINGQARTSAIDLQSLDTVEENEPAQKKARVD"
FT   gene            complement(<614059..>616977)
FT                   /locus_tag="CAGL0J06424g"
FT                   /old_locus_tag="CAGL-IPF2317"
FT                   /old_locus_tag="CAGL-CDS0481.1"
FT   CDS_pept        complement(614059..616977)
FT                   /locus_tag="CAGL0J06424g"
FT                   /old_locus_tag="CAGL-IPF2317"
FT                   /old_locus_tag="CAGL-CDS0481.1"
FT                   /note="highly similar to uniprot|P53091 Saccharomyces
FT                   cerevisiae YGL201c MCM6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60937"
FT                   /db_xref="GOA:Q6FP58"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041024"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP58"
FT                   /protein_id="CAG60937.1"
FT                   /translation="MSSPFPHDEETRGGPSSQPASSLGGFGSSSGFDESQVGSRLQFPS
FT                   SSQPHVPDSVGSNIPGIRDSSARDSSQFSSQRPYENEPEHEENEDMPMQGWRKRTFNHI
FT                   KKVEDVTGEKVREAFEQFLDEFTIQSSDTGELQKVYRAQIEFMKLYDLSTLYIDYQHLS
FT                   MRENGALAMAISEQYYRFSPFLIKGLKRVVRKYAPELLLTSDSVKMQNEDDDLSTIDPS
FT                   SMPRDSENSQQATKSTTTNSPEQTERLFQISFFNLPTVHRIREIRSDKIGSLMCISGTV
FT                   TRTSEVRPELYKASFTCDMCRAMVDNVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKF
FT                   LDWQKVRIQENTNEIPNGSMPRTLDVILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLML
FT                   PGVKPSSSLDTRGIARSSEGLNSGVTGLKSLGVRDLTYKITFLGSHVVSVGSNMNPNEN
FT                   SSAETNLQFISKLQNNDIYSDREKDQEIFLSSLSPDEINELQDMVKDDHVYDKLVRSIA
FT                   PSVFGHEAIKKGILLQMLGGVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCRFAP
FT                   RSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAI
FT                   HEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYNRKTSLRANLNMTAPIMSRFDL
FT                   FFVVLDDCNEKIDTELASHIIDLHMKQDEAITSPYSAEQLQRYIKYAKTFKPVINKEAR
FT                   KFLVEKYKALRKDDAQGYSRSSYRITVRQLESMVRLSEAIARANCSDEITPEFVAEAYD
FT                   LLKQSIIRVDVDDIEIDEDPEEPEEIATDVQAAIVQENTDQQKSDKQKVVVTYEKYVTM
FT                   MNMIVRKISEVEKNEGAEMTATDIIDWYCVQRENDISSEEEYYAERKLAYKVLKRLVKD
FT                   RILMEIHGTKDNLDDDEDHDGNGKIVYVIHPNCEMFDTAQDA"
FT   gene            complement(<617289..>617360)
FT                   /gene="tRNA-Gly (TCC)"
FT                   /locus_tag="CAGL0J06446r"
FT   tRNA            complement(617289..617360)
FT                   /gene="tRNA-Gly (TCC)"
FT                   /locus_tag="CAGL0J06446r"
FT                   /product="transfer RNA-Gly"
FT   gene            complement(<617932..>621129)
FT                   /locus_tag="CAGL0J06468g"
FT                   /old_locus_tag="CAGL-IPF2318"
FT                   /old_locus_tag="CAGL-CDS0360.1"
FT   CDS_pept        complement(617932..621129)
FT                   /locus_tag="CAGL0J06468g"
FT                   /old_locus_tag="CAGL-IPF2318"
FT                   /old_locus_tag="CAGL-CDS0360.1"
FT                   /note="similar to uniprot|P38426 Saccharomyces cerevisiae
FT                   YMR261c TPS3 or uniprot|P38427 Saccharomyces cerevisiae
FT                   YML100w TSL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60938"
FT                   /db_xref="GOA:Q6FP57"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP57"
FT                   /inference="similar to AA sequence:UniProtKB:P38426"
FT                   /protein_id="CAG60938.1"
FT                   /translation="MTIIVASLFLPFQPQFEVNADQEQTAELVDSKLVKISGEQEAHAN
FT                   KNLPDVRVQETDAYATAATQPFLNSRTPLALSSAASQLNVKQGPLSSEQFLENLTANAT
FT                   TAGTPVNPNLGVHGHASAEDFFTTNNSTAINNNASSPPFSVSSIAPEINANVDGTDTMD
FT                   VTADLLDNVNKSLLLHSVLNSGQGVSSPNAVEGHTATHLTNPNTTVITPKSRAVPESNP
FT                   GVVNFDNYKERRDSQSNSAFPSMKRVASGSHGPSHLKYSQNAIDAALESDVIDDADDRQ
FT                   NSEAESDYETDRKVHYNVPGFGGYSSTSKRLKNSLEIFSRVPWKIVPSRKGNGALKNAI
FT                   NTSILEKDIKDGVKWVGTLGIPTDEIPVETTKKIVKDLNENYQSSAVIADDVTFKGAYK
FT                   NFCKQILWPTLHYQIPDNPNSKAFEDHSWNYFQRLNQYFAEKIVSIYEDGDIVWVHDYH
FT                   LMLVPGMVRQKLPNAKIGFFLHVSFPSSEVFRCFAQRENMLEGILGANFVGFQTAEYAR
FT                   HFLTTANLLLTADVSGDHLRYKGKVVSVKSTPIGIDAFDLANQLLTDPVTKWRQLIRQR
FT                   WAGKKLIVCRDQFDKIRGLHKKLLAYERFLRENPDYIEKVVLIQICIGKSSDPELERKV
FT                   MVVVDRINSLSISISVSQPVVFLHQDLDFAQYLALSSEADLFLINTFREGMNLTCHEFI
FT                   VCSREKNSPLLISEFTGSAELLKDGAILINPWDTRHLAKCIKMGLEMPLDERKRRWKIM
FT                   MKSLINNDSTNWIMSNLQAIEHCWEFSKESSTLFSLSSEELASEYQSASNKLFILKISE
FT                   PPSPRMLAILRELSSRCTVYIMNTFSKTTLENLYGRVGNLGLIAEGGAYVRLNGTWYSI
FT                   VDHVDWLEEVTKILDTKIERLPGSYYKLADSMVRFHTENAEDQDRVASVIGEAMTHINT
FT                   LFADRGIHAYVHKNILFVQQKELSLETTKFILKFHNSGKVYNTGHSTPSKHNNEMSAMF
FT                   SGQSDTIDFICVAGSTSPTIEPIFKLVKDATLAGNLRYGHTIVYGDAPSTYAREHTSGW
FT                   NELFNIFQDLAKSNERQ"
FT   gene            <621951..>622415
FT                   /locus_tag="CAGL0J06490g"
FT                   /old_locus_tag="CAGL-IPF2319"
FT                   /old_locus_tag="CAGL-CDS4783.1"
FT   CDS_pept        621951..622415
FT                   /locus_tag="CAGL0J06490g"
FT                   /old_locus_tag="CAGL-IPF2319"
FT                   /old_locus_tag="CAGL-CDS4783.1"
FT                   /note="some similarities with uniprot|P38428 Saccharomyces
FT                   cerevisiae YMR264w CUE1 or uniprot|Q04201 Saccharomyces
FT                   cerevisiae YML101c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60939"
FT                   /db_xref="GOA:Q6FP56"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP56"
FT                   /protein_id="CAG60939.1"
FT                   /translation="MDLSTKVFLGLLVAFILVVKRYLNQPTHKNINKTVDISNDGEEID
FT                   KDVLVSGKDQKTVKRRRKRRVTEGMIEIVSTLAPHLDVEQIKYDLEKTGSVELTVERLL
FT                   KGEEFEFPPKEDESSTANNSKSNEEPQNEEDYYEDYHTETDSSDSEDDDD"
FT   gene            complement(<622640..>624277)
FT                   /locus_tag="CAGL0J06512g"
FT                   /old_locus_tag="CAGL-IPF2320"
FT                   /old_locus_tag="CAGL-CDS1799.1"
FT   CDS_pept        complement(622640..624277)
FT                   /locus_tag="CAGL0J06512g"
FT                   /old_locus_tag="CAGL-IPF2320"
FT                   /old_locus_tag="CAGL-CDS1799.1"
FT                   /note="similar to uniprot|Q04199 Saccharomyces cerevisiae
FT                   YML102w CAC2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60940"
FT                   /db_xref="GOA:Q6FP55"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP55"
FT                   /inference="similar to AA sequence:UniProtKB:Q04199"
FT                   /protein_id="CAG60940.1"
FT                   /translation="MEATNLQIYWHESQPVYSITFRGSQADDDNDDENFNEKGELFTAG
FT                   GDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASAGDDGQV
FT                   LLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLRGTANDLDNMPGGGASEIYDLSWSPD
FT                   DKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE
FT                   IELRDSKDITSSTTSTELIKRLKLKNRIFKSELPFIDEDASSRKIDYSVQKSSYLYHNE
FT                   TLPSFFRRLVMSPCGSLLVVPTGLIKNHPTSTSIGTKDDGEESSQSNSINTSASSDFNN
FT                   AVFIYTRAAIKQNLGKPSICLPFFKKPAVAVAFSPIFYERTSNKPYVDLPYKLVFAIAT
FT                   INQVIFYDTENIEPISIVSNLHYTPLTDLTWSPRGDMVMVSSTDGFCSAISINTAVFGR
FT                   RTKKPSFTNTIVKEEISLNREDASEVKQPKRSHDIINILPVRKKSKVDTNKSTTDSAST
FT                   PDATGNDKENKDDAKTLEIIKNTETENS"
FT   gene            <625604..>630616
FT                   /locus_tag="CAGL0J06534g"
FT                   /old_locus_tag="CAGL-IPF2323"
FT                   /old_locus_tag="CAGL-CDS0067.1"
FT   CDS_pept        625604..630616
FT                   /locus_tag="CAGL0J06534g"
FT                   /old_locus_tag="CAGL-IPF2323"
FT                   /old_locus_tag="CAGL-CDS0067.1"
FT                   /note="similar to uniprot|P52593 Saccharomyces cerevisiae
FT                   YML103c NUP188 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60941"
FT                   /db_xref="GOA:Q6FP54"
FT                   /db_xref="InterPro:IPR018864"
FT                   /db_xref="InterPro:IPR041634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP54"
FT                   /inference="similar to AA sequence:UniProtKB:P52593"
FT                   /protein_id="CAG60941.1"
FT                   /translation="MMAMTMEYRDVAGFLNSIEDDAINKEHINAVSAFLEKNKRQLLEL
FT                   QLGSNESTKHNDNNDTKRIIARKILGYDYDFEGSNEYNLNEFLEKELLERNSMVDIMVD
FT                   LNTRRHICDRYIPDLNVNNAKNEDSLTGRISTVIDVLLNTLTATNSVDECVLQCMDHLE
FT                   ELHLDNEDTIQDIIDLIINYNILYCFKLLKLLTLYIINRNVAVSLTQKWFSNFSEIVNQ
FT                   VTLISSTHSNRRFLDNTERSMVDTLFIAKLESTISIVSIVFLGLSSAREDSNLNMDTDF
FT                   LHDVATFELVHSVLLDEMHKKRMPIVLYMWSFILCAKSIIAEDDSDEITSINELDFIRK
FT                   CFPQDSIHSMSILFAKNAEDIGLLAKFLETSNCIRNDNIFTTLFASFMTLSVNFIPFTA
FT                   STTKIIKSVLNDLPRGVIENFISNNAFITKFDTIKAKLPLIDEGLLPFINLTSINEELA
FT                   EFNWEAFGSYAVKMPLGSIDYDVADRSNSNDSSTLEQIQLSSEVLVKPPFEQDDDVLMP
FT                   LPKSTKAFIVADVPAITSGKEHTKDSIVKYNSEDGSSNFTTNNVTNETLLVFDYQYNGW
FT                   SLLGRILQNLSILYTVKGNDINYEQKEFMIAAISLLSNIMSSTIPVDHSIKILESLSSQ
FT                   LSKPRDDDIISVVFKIFERALHKRNYELLCICASFTNVLVRRFPHFVWAYLSTSDLLDH
FT                   YGKSGLVNIILGSIELTNGEYDFTISIAKMTVGLIDDAVTTSLYSDSGVPLKTKKSILS
FT                   NLIVHLLNVYESFQFWKYSKSIEQRFELSLELTKAFSKILYFVHGIDSETPPENKITNV
FT                   LSKAADTITNAFLVPDSYDPPVVISLINTITSPKNKTIYIFGNGLFDELYDHVVQKAYD
FT                   LANLLVSIRGVSKLNASSLERMLFCQSPKLIDIYLTKPTLKISIVKLLNSLVGVPWSSE
FT                   YPFLYSYLGHTYSEKFLSSIIKDLTTTLQDYQLAKTLYVFFGTLIRSKQDGLSILFLTG
FT                   RAPDKAISSSLKNTSKDNQISILNVLKNNAKKMDQYPETTCCYLLEAISYAFNTWSNAR
FT                   NLDEDNDFIVSLLNKLENLMDATVGTNSSDDSQVTHDKELKRRYKLIARIVEIFALYIF
FT                   TSKNPNSDLMSLLESDKIVPHLQKFFLIEGYQSDLQTNLEKNISEIWNKAELSMFALSP
FT                   IAKTFINFDDNIFDISILDQCLGNDSSWTGTDSIRNQIIDASSNLQSTVAQVAAAKSWG
FT                   ALITAFIKRKNSIVPECYMSLLSDLLQYNIEYGVEAPIFTDVYMERLELVFFFLYNIHN
FT                   NGQQLPDKNIQKLLAQLLEILKSPEVNFLTNIPENTGSLLYRPILRSILLLLSMVKDGP
FT                   QFVELNADLLIQTNEESFCKGLYLLFSNILSEINSMKATSGQYSIANIDEKIQDISLLL
FT                   NIVVKTQELNPSSEFNSIFASSLYEVGTLQVMLNLYSSSHLYLVNDEPILGQLSLSIIA
FT                   ELCMIREVAEKLITNGLFTVLVESPLSVALQRNAIKTSSQPRIHYIWSNGLLSITLILL
FT                   SNFGSKILPETYLFISYFSNQIGNVLSSWFDSNMSVSTALVNETKQIILLQKMLEAINK
FT                   VNSVSTSRNNSTVQNPDNVKQIPGLVSEQDYKQLNSALKKLLTHPKYLNSRIVASTTDE
FT                   QHMLEEISRRNELSTIISNQIKEIQDLLFETL"
FT   gene            <630978..>634214
FT                   /locus_tag="CAGL0J06556g"
FT                   /old_locus_tag="CAGL-IPF2325"
FT                   /old_locus_tag="CAGL-CDS0343.1"
FT   CDS_pept        630978..634214
FT                   /locus_tag="CAGL0J06556g"
FT                   /old_locus_tag="CAGL-IPF2325"
FT                   /old_locus_tag="CAGL-CDS0343.1"
FT                   /note="weakly similar to uniprot|Q01846 Saccharomyces
FT                   cerevisiae YML104c MDM1 intermediate filament protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60942"
FT                   /db_xref="GOA:Q6FP53"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP53"
FT                   /protein_id="CAG60942.1"
FT                   /translation="MQKLPSVFGFAILLFVPSLFRNGLLILCILSLAIIFLLCSIIKLQ
FT                   NFITGSHFKSKRINEIVSCHKNILPNNVATYKSKFITIDKYPRTASEIREIIEFIVTDF
FT                   IQSWLLRIEKDNDQSLPNLIQSLLENTTDKIATIQADKNIVDIISTKCIPKITKHINIY
FT                   KRCVTTEANLKRQTTLHKNSLHLAVEFNKYQKFHRNVSLRNHILDDSVKNYCLDKAQLI
FT                   QKRILNENEASSTIVSSLVKEILAGSVLYPLINKLINPYDINLQIISMSERILKETKQV
FT                   SRIRQLLNEETDTSGTTEELINNAKVWWLFKELPINNKQYELSLRYITTCGQIVPLHNI
FT                   GYVLLLCFGILDDNIDKKASKQRLLLMLNLVEMRLKTFNSKLIYGPSLSSKVLNSKNSW
FT                   RESTQFVKNFISTITFADIVQQNELILFFEEFLANENNINLKPLLSFICESNLILTPLD
FT                   DSYEEDQSIVEPLAFYRQLKQFITETMIHALRNINAERTDNIMNFMSQNEPDMNIYFID
FT                   CLKSIRFLNNLVENILKQYFEQFKSSASFLNMITSSKFFQTNVYIKGILEFSLRQKSED
FT                   YSQENATNMGTKNSRIDQKLESIIFENGILANDLPKRNVEDSTLANALLDNYDKDKSID
FT                   DIQLSVPQESKELLFRPGLKSFKDIKEAIADLTLKINQTEKEDEILDHLLLKAELINDK
FT                   EQLRILSKSKRAMKKDIERMDVARQLLLIQESSNALYGTTEVSISSFYEDVDEGGKKLI
FT                   TFYLVNVKRQNGDKSTSWEVSRRFNEFAVLYKYLHANYSKKLKKLDLSFPSKIPITENY
FT                   NIAKVDICNERRIKFELFLNQLLQIQEICEDDLFRTFLTNPLSFSINRNPEELPLINNS
FT                   QSYECIPELSLMDEGLRSTDDLVYDNKYLTSHYAKVPTSNETKSTVKIISEFFIAIFSS
FT                   RTNSRWLRGRAIVTLLQQLMGSTIDKYMKEQGDKWSSDSHVSDLLASLKFLLWGPNGTF
FT                   RRPKVDKKEISSNEKRKVEIKAFQMMQTLFIEQFGTFIGYQRSKEASKSLHEMLQNQYL
FT                   NCNLVFELFDDIIDEFLLRKEELETNKITM"
FT   gene            <634596..>635390
FT                   /locus_tag="CAGL0J06578g"
FT                   /old_locus_tag="CAGL-IPF2326"
FT                   /old_locus_tag="CAGL-CDS3880.1"
FT   CDS_pept        634596..635390
FT                   /locus_tag="CAGL0J06578g"
FT                   /old_locus_tag="CAGL-IPF2326"
FT                   /old_locus_tag="CAGL-CDS3880.1"
FT                   /note="highly similar to uniprot|P29478 Saccharomyces
FT                   cerevisiae YML105c SEC65"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60943"
FT                   /db_xref="GOA:Q6FP52"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP52"
FT                   /protein_id="CAG60943.1"
FT                   /translation="MPKLEEIEDYDDIDNMDMDLAELDPTLNTPIAPKITPTVVRSQDI
FT                   EEEERKKQYAGSNKEMISFINPQTGKVEESAPITKQELDEVKKFQVLYPCYFDKNRSHK
FT                   EGRRVPIEMAVENPLAKTISDAVREYGLLSIFEGDKCHPQDFGNPGRIRVLLKEEGKLV
FT                   PSASKFSGGKRQLMKLVAEYLQKHPTTVESLRELPYGPDFDNIEFKKIPKVKGFKMNDI
FT                   VPLHSPYLWGHPMTKSIYEAPKIEAPEKQFKAPKNKFKVVRR"
FT   gene            complement(<636175..>636846)
FT                   /locus_tag="CAGL0J06600g"
FT                   /old_locus_tag="CAGL-IPF2327"
FT                   /old_locus_tag="CAGL-CDS4222.1"
FT   CDS_pept        complement(636175..636846)
FT                   /locus_tag="CAGL0J06600g"
FT                   /old_locus_tag="CAGL-IPF2327"
FT                   /old_locus_tag="CAGL-CDS4222.1"
FT                   /note="highly similar to uniprot|P13298 Saccharomyces
FT                   cerevisiae YML106w URA5 orotate phosphoribosyltransferase1
FT                   or uniprot|P30402 Saccharomyces cerevisiae YMR271c URA10"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60944"
FT                   /db_xref="GOA:Q6FP51"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP51"
FT                   /protein_id="CAG60944.1"
FT                   /translation="MPLEDYQKNFLELAIESQALKFGSFTLKSGRQSPYFFNLGLFNTG
FT                   KLLSNLATAYAIAIIQSDLKFDIIFGPAYKGIPLAAIVCVKLAEIGGSKFQNVQYAFNR
FT                   KEAKDHGEGGNIVGAALEGKKILIIDDVMTAGTAINEAFEIIAANQGQVVGSIIALDRQ
FT                   EVVGSPDSTDSMSATQAVSKRYNIPVLSIVSLSHVINFLDGRITAEEKQKIEDYLQKYG
FT                   A"
FT   gene            <637316..>638311
FT                   /locus_tag="CAGL0J06622g"
FT                   /old_locus_tag="CAGL-IPF2328"
FT                   /old_locus_tag="CAGL-CDS3314.1"
FT   CDS_pept        637316..638311
FT                   /locus_tag="CAGL0J06622g"
FT                   /old_locus_tag="CAGL-IPF2328"
FT                   /old_locus_tag="CAGL-CDS3314.1"
FT                   /note="weakly similar to uniprot|Q03760 Saccharomyces
FT                   cerevisiae YML107c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60945"
FT                   /db_xref="GOA:Q6FP50"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP50"
FT                   /protein_id="CAG60945.1"
FT                   /translation="MQANKLMDLEARLLRLSRELDSYHGHLVHRNEAVPRTAERIVKRR
FT                   KYRSCGPLKSNRFLSSKNMKFRKLYENLVETEKEKTHLQYTLAEILEKYQHLLDGTKYL
FT                   DIEWSKLTNPLTLVANGWSMHRIVDRKAPDAGETHNSLICTCSNCHQLISFNCDKTSMD
FT                   LSDKLALRGWLTDSHLKDCSWRHYQFPLERDYYLNKHNLLAEFLCLQKLNLRATIEVDI
FT                   FYRNSIDQIRYCFNIKDENNLKLFLRGFWSSNPSHTIKDFVTCQYCCCRSALTSLSKND
FT                   HVGHYPWCRYQDQDQLYHLIEDAIHDSSYIVKELPIVARLNKLEKTLEKL"
FT   gene            complement(<638437..>638508)
FT                   /gene="tRNA-Gln (CTG)"
FT                   /locus_tag="CAGL0J06644r"
FT   tRNA            complement(638437..638508)
FT                   /gene="tRNA-Gln (CTG)"
FT                   /locus_tag="CAGL0J06644r"
FT                   /product="transfer RNA-Gln"
FT   gene            complement(<639077..>639415)
FT                   /locus_tag="CAGL0J06666g"
FT                   /old_locus_tag="CAGL-IPF2329"
FT                   /old_locus_tag="CAGL-CDS5297.1"
FT   CDS_pept        complement(639077..639415)
FT                   /locus_tag="CAGL0J06666g"
FT                   /old_locus_tag="CAGL-IPF2329"
FT                   /old_locus_tag="CAGL-CDS5297.1"
FT                   /note="similar to uniprot|Q03759 Saccharomyces cerevisiae
FT                   YML108w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60946"
FT                   /db_xref="GOA:Q6FP49"
FT                   /db_xref="InterPro:IPR015080"
FT                   /db_xref="InterPro:IPR035946"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP49"
FT                   /inference="similar to AA sequence:UniProtKB:Q03759"
FT                   /protein_id="CAG60946.1"
FT                   /translation="MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQID
FT                   EIDLLNKWFDKFDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV
FT                   EDEDEEDA"
FT   gene            complement(<640041..>642527)
FT                   /locus_tag="CAGL0J06688g"
FT                   /old_locus_tag="CAGL-IPF2330"
FT                   /old_locus_tag="CAGL-CDS0741.1"
FT   CDS_pept        complement(640041..642527)
FT                   /locus_tag="CAGL0J06688g"
FT                   /old_locus_tag="CAGL-IPF2330"
FT                   /old_locus_tag="CAGL-CDS0741.1"
FT                   /note="similar to uniprot|P54786 Saccharomyces cerevisiae
FT                   YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
FT                   YMR273c ZDS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60947"
FT                   /db_xref="GOA:Q6FP48"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="InterPro:IPR040206"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP48"
FT                   /inference="similar to AA sequence:UniProtKB:P54786"
FT                   /protein_id="CAG60947.1"
FT                   /translation="MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSI
FT                   GSIDLITDPELNVTVTGTEREDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASIDRT
FT                   RVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKP
FT                   KNEEQSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEEEVSN
FT                   KENINENGRLRGSIVRRPSKLRKSYTEFSSEDLELLDKALSNNRIISTRNTTNSKRLSL
FT                   KEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADD
FT                   DTFATAVVGNSHSLASNTSSLRRSKFNTYRVKAGQQRGISRSNYIDSTNRTDNLIARHT
FT                   WETPLKDSYDEHSTSYHNKQHSILDSNIPVVTTVSDDNHDISGSSFSQDSSMVSSDSTS
FT                   NSILNRPEHSYSYVSEKLDREIEKTDQFSNLGSSENKIDEPTVDTKRPSLEHRITGATE
FT                   IKDKNLEQSAISNHQTIQKNTFIEKKERLDKKISNLFKRKKGKKTDNVLEADVPLEKDN
FT                   CYDIISSESQEEIGNVIPRTTSPESIRGGSLISFTNSADDIDVKSYQSDNQQRRLSDEV
FT                   VEYVQELEEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSINQSYSLHTDEPNKVG
FT                   KPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSH
FT                   LKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSSPDNKVVELEGSNYN
FT                   TAHNQSDGTILIPELQ"
FT   gene            <644531..>645397
FT                   /locus_tag="CAGL0J06710g"
FT                   /old_locus_tag="CAGL-IPF2331"
FT                   /old_locus_tag="CAGL-CDS3697.1"
FT   CDS_pept        644531..645397
FT                   /locus_tag="CAGL0J06710g"
FT                   /old_locus_tag="CAGL-IPF2331"
FT                   /old_locus_tag="CAGL-CDS3697.1"
FT                   /note="highly similar to uniprot|P49017 Saccharomyces
FT                   cerevisiae YML110c DBI56 ubiquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60948"
FT                   /db_xref="GOA:Q6FP47"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP47"
FT                   /protein_id="CAG60948.1"
FT                   /translation="MFLTRRSAIAARRLTSNIKLCAWNSTQSNNTTHFGSKTVPVEEKE
FT                   KLVGDVFSSVASKYDLMNDVMSLGIHRCWKDHFIHKLDAGKRPNSTEPLNFIDVAGGSG
FT                   DIAFGLLDYAEEKFHDTESTMDVVDINPDMLKEGEKRAMENKKYYNDPRVNFMVQNGEV
FT                   LDKIPSDSKDVYTISFGIRNFTNIQAGLNAAYRVLKPGGIFYCLEFSKIENPVMDLAYQ
FT                   QWAKLLPVMGSIVANDYNSYEYLVESIERFPDQETFKSMIEKAGFKSVGYESLTFGVCA
FT                   IHWGVKV"
FT   gene            complement(<645658..>648627)
FT                   /locus_tag="CAGL0J06732g"
FT                   /old_locus_tag="CAGL-IPF2333"
FT                   /old_locus_tag="CAGL-CDS0460.1"
FT   CDS_pept        complement(645658..648627)
FT                   /locus_tag="CAGL0J06732g"
FT                   /old_locus_tag="CAGL-IPF2333"
FT                   /old_locus_tag="CAGL-CDS0460.1"
FT                   /note="similar to uniprot|Q03758 Saccharomyces cerevisiae
FT                   YML111w BUL2 or uniprot|P48524 Saccharomyces cerevisiae
FT                   YMR275c BUL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60949"
FT                   /db_xref="GOA:Q6FP46"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="InterPro:IPR039634"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP46"
FT                   /inference="similar to AA sequence:UniProtKB:Q03758"
FT                   /protein_id="CAG60949.1"
FT                   /translation="MQSPEKPGRRRRPPLFTLSTDSSINTSNRSNRAENESSNHVKFPL
FT                   SPPRAHHHETELGNARLSEEQERRRASTTNIANMRRKHIKEINVYNTPNPNDLDALCVA
FT                   KSSTELNQMNTDSKDPNMIIDVLPSFEFYNVLHKHIPQGNVDPDIHDFPPTYQEVQTQR
FT                   LPALQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPY
FT                   STRHYSLNPNQNNPLHPTVSGSTAVNDNTNIEDDVNDADNIAIDKLYSLPKFSTPLEID
FT                   IRITKHVPKPHEKPEEESVLKEFTSGDIIHGYCVIENRSTQPLKFEMFYVTLEAYISIV
FT                   DKQKGKRTIKRFLRMVDMSASWSYSSMQVSSGIEYVPGDVDFDDSILGLSNSRTFLPKT
FT                   KYKKYFMFKIPDQLLDVTCRQEIFPHCSLPPSLGIDKWKDNGKYSIIKVNNVLGCGHLG
FT                   TKGSPILTNDITDENLSINYTIDAKIVGKEKKTSKLNIMREREYNLRVVPFGFNTPSPV
FT                   QSNLRSKSQLKELKRLLNERIAALERVFERLKKNEPIQNADIYGTDISGTIDSETDLDV
FT                   REHLERKLNQLHVRNRIEESDSWSGLKRMSQPDNLVESELRYQIKSRKLNSGTNIANSL
FT                   FSGFKSSSSMSSLKSSSSSSNSETGKILDGSSSHLKKHLKHSDKTGLITLSTTIPTKAV
FT                   KYWSPSLFRKTNTFESKNKHDQENWVRLIDLLSEEEKTPLENVNVKLKCFVSNNGPIHQ
FT                   PPGIQIITTSLICITASSDNSIPIQLSSKLLYNEENVTTLKKTFTDYNKKITEYKALFE
FT                   ENEEKLNILYHGNSMLSQTNRGLKFTDFIPTNLHNDVESLMELHVDVTELHQVFRKQSF
FT                   FTKSTSSNDSYFNFSLSSSETIGNNASSPSEIIDANNSPKPTKSETSASGWRSTGKFTF
FT                   ERDVNVHLSLDPHMKETLPPNFESCLCTRFYVVRVCIKFDHHIGTATLDIPVSVKRITT
FT                   "
FT   gene            complement(<649591..>650640)
FT                   /locus_tag="CAGL0J06754g"
FT                   /old_locus_tag="CAGL-IPF2336"
FT                   /old_locus_tag="CAGL-CDS3163.1"
FT   CDS_pept        complement(649591..650640)
FT                   /locus_tag="CAGL0J06754g"
FT                   /old_locus_tag="CAGL-IPF2336"
FT                   /old_locus_tag="CAGL-CDS3163.1"
FT                   /note="similar to uniprot|P46963 Saccharomyces cerevisiae
FT                   YML112w CTK3 carboxy-terminal domain kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60950"
FT                   /db_xref="GOA:Q6FP45"
FT                   /db_xref="InterPro:IPR024637"
FT                   /db_xref="InterPro:IPR042326"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP45"
FT                   /inference="similar to AA sequence:UniProtKB:P46963"
FT                   /protein_id="CAG60950.1"
FT                   /translation="MDSFEARLQFIQVIKNLQKSLNVSKEDTDGTLGIGLGSGQSSGAN
FT                   SVSHSGSYSNIQELDDTTIGTQVSKSMSDPLQFYLKHYAHHYEDFHQCLFDTGLKMDPL
FT                   HRLNIVIFYYQIILALVAEMKKRKLDTSSLQATVVYEHLIPSMPRIFEICLPKDDWKAL
FT                   SNLKSCTDIYYNLLRLLKTLPGYQLEMSPEEMTLSEYTMDSEEVIQAMTQPTSELDWKT
FT                   IANDDKPQNVSQSILWTRELLNDRMIKKYVVFKTFVTNGVCNLKNSHNSSTSNNNVSNI
FT                   LHRMENDRERHKRQKENNWVVERVSQSMLDENEFKAAWNSITSLPSLSRSDQKDIRQLH
FT                   TIARGSYLI"
FT   gene            <651309..>654392
FT                   /locus_tag="CAGL0J06776g"
FT                   /old_locus_tag="CAGL-IPF2337"
FT                   /old_locus_tag="CAGL-CDS0407.1"
FT   CDS_pept        651309..654392
FT                   /locus_tag="CAGL0J06776g"
FT                   /old_locus_tag="CAGL-IPF2337"
FT                   /old_locus_tag="CAGL-CDS0407.1"
FT                   /note="highly similar to uniprot|Q02932 Saccharomyces
FT                   cerevisiae YPL125w KAP120 nuclear transport factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60951"
FT                   /db_xref="GOA:Q6FP44"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP44"
FT                   /protein_id="CAG60951.1"
FT                   /translation="MSGIMLTELNLVEVLQQASDMQHMGTERQRMAESQLKAWETQPGF
FT                   HFLLQSIYLDLSNGLHVRWLAVIQFKNGVEKYWRATRINSIGKDEKASIRKRLFDVVDE
FT                   QNNQLCIQNAQATARISRIDFPVEWPNLFESIEQLLNINHRKEIQTHNILMHLNQIIKI
FT                   LGSARIGRCRPAMQSKIPLIFSLVVRIYLESFDEWTHSNVADGDILSKLQISYLALKVL
FT                   RRMVSDGYEYPQRDETVCEFMKLSITHFDVLIANHENFKKFDLYEKFIKCFGKLYFNLV
FT                   TASPANFILIPSSSQILISYTSFLLNKAQFVYQENPDVTGDFWEQVAIRGIMIIKRVIN
FT                   FVSKKGAVTIKARSDKPNIDAAITKINNEYLNENLIKKMVDTLMEWYLKLRATELDNWF
FT                   MDPEEWINEQMASSYEYQIRPCAENFFQDLINTFPELLASYLLNKIETSASTLSDSLED
FT                   FLRKDAIYAAFQLSASAVSEMVDFDRLLPTVFLPEAAGSNTPGERLKIIRRRVALIINE
FT                   WSIVKCSEESKNLCYKFFAEMLATEEDKVVLLTVVQSLRTMLDDWNFNKDNFEPYLNSV
FT                   ASLLLRKILPSVSLTETRLYVLNTMSDLIIQTKSLIGQDMLIEILQIVPNLWNVATNET
FT                   TESILCNSLLRLLRHLATSLGAFSYMTWEISIPIVMTSCNPSSKDYQLLNEDGFELWSV
FT                   LLQNYSPEKQQLDTRFTEFLPYVSSAVECHTEILPTLLEIIKSYALLLEPSQFFAHPSV
FT                   AEVFRKLSQYLLKLREDSFQLVLEIWEILTLCNESNNESLLIENFYSNGIFIALFDAVL
FT                   LEEALSSYQCLQVLQVISRITYVNPSAVMNFLTSYHSNLPLMEQNMQLPVTERKLVSSD
FT                   MSYDDVVRKFISVWVVCFKDVYDPKQKKVHILGLSSLLRTGLVSVIGEFPAIASIWIEM
FT                   LEEIKETNDGDCEKYHLNDIVTEQSLEFYPISCEQLRYHQLVKNNDPTHNISLRDFISQ
FT                   TMQFLETQMGSQEYQAFLNSNNPTLLENLQLFLSIQQQ"
FT   gene            <654817..>655521
FT                   /locus_tag="CAGL0J06798g"
FT                   /old_locus_tag="CAGL-IPF2338"
FT                   /old_locus_tag="CAGL-CDS4122.1"
FT   CDS_pept        654817..655521
FT                   /locus_tag="CAGL0J06798g"
FT                   /old_locus_tag="CAGL-IPF2338"
FT                   /old_locus_tag="CAGL-CDS4122.1"
FT                   /note="some similarities with uniprot|P33419 Saccharomyces
FT                   cerevisiae YPL124w NIP29 nuclear import protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60952"
FT                   /db_xref="GOA:Q6FP43"
FT                   /db_xref="InterPro:IPR031392"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP43"
FT                   /protein_id="CAG60952.1"
FT                   /translation="MVVGPISNLRDDALKDDTLNHIRKEYLESKKQISNLLSQETNTNE
FT                   FSRKPYPNSSPIRKFDHFANERPTTIDAKLREQLRTGASDVAIEQSLRTNSDESRNQMI
FT                   YDDMKVMKRIIDGQQESIRELRRALEQERYMNSELQRKYNEMERRFDRLEWFINSHDKF
FT                   QAYQDIRSNTTKKDFSDPIFNNGLKRRWDEYPIRSFEPDTNINRNNRIFSNYDDSTTRL
FT                   MQITDPHYRSVG"
FT   gene            complement(<655589..>656890)
FT                   /locus_tag="CAGL0J06820g"
FT                   /old_locus_tag="CAGL-IPF2339"
FT                   /old_locus_tag="CAGL-CDS2524.1"
FT   CDS_pept        complement(655589..656890)
FT                   /locus_tag="CAGL0J06820g"
FT                   /old_locus_tag="CAGL-IPF2339"
FT                   /old_locus_tag="CAGL-CDS2524.1"
FT                   /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
FT                   YPL123c RNY1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60953"
FT                   /db_xref="GOA:Q6FP42"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR033697"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP42"
FT                   /inference="similar to AA sequence:UniProtKB:Q02933"
FT                   /protein_id="CAG60953.1"
FT                   /translation="MILASVLKAFQGLQTGLQHSYQDGSPSCPINLPLSCGNETAISDL
FT                   CCFEYPGGILLMTQFWNYAPSKPNLNRTELEEELGPVDSFTIHGLWPDDCMGGYPQFCK
FT                   RDLFIDDVDYLLKSDAFNNDDTLPIQGEELLNNLNKYWKSNNGNHESLWIHEYNKHGTC
FT                   LSTLQPQCYSRWNPTTSQKGPKYYKKKAVYDYFRISYDLFQKLNTYEMLAKHNITPSND
FT                   TSYTKSEILSALSSEFQGTQAHINCNSQNALTEVWYYHQLNGSILNEDFIPLDPLRSMS
FT                   RCKDQGIKYYPKGYQRRDNRGPNKKPISRGTIRISQYGGFLIKTGRWMKRGTPANFELI
FT                   ESKYGNYLLKSRMGYCTVHNDKSQLDCSSRSPDYATQFDYNEEKGILGYSGSFEWGAES
FT                   APKNGRTSRSVVFAVSNEKNSNLKYKFQLKFNRK"
FT   gene            complement(<657226..>658740)
FT                   /locus_tag="CAGL0J06842g"
FT                   /old_locus_tag="CAGL-IPF2340"
FT                   /old_locus_tag="CAGL-CDS2053.1"
FT   CDS_pept        complement(657226..658740)
FT                   /locus_tag="CAGL0J06842g"
FT                   /old_locus_tag="CAGL-IPF2340"
FT                   /old_locus_tag="CAGL-CDS2053.1"
FT                   /note="highly similar to uniprot|Q02939 Saccharomyces
FT                   cerevisiae YPL122c TFB2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60954"
FT                   /db_xref="GOA:Q6FP41"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="InterPro:IPR040662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP41"
FT                   /protein_id="CAG60954.1"
FT                   /translation="MSFSGLKHSITQYLEEIPSQVQTRLYKSPATCLAIYRLLPTLAKF
FT                   FIMTVIFNDKDISLRDLDRWVKSNGKLQFQEAIKSMKSLHLLIPTRVNGQLLINLNPTF
FT                   RESFRNALTGGEVNNSFGIVVDEDRLDTVVNLAVLDEYAATKWETILHFMVGTPMAKMP
FT                   SENVLNLLKHSKLMEEVPDSSEFMITNEGFQFLLQEVNSQIWSLLLQYLKLAESLHMDP
FT                   VHVLNFIFMLGALETGKAYSTENLSETQLKMLLDMRDYGLVFQKTSNPNIFYPTRLAQM
FT                   LTSDTKSMRTASGAMESVLNKPDDAAKSTDDKYDSLEGKAEDIQDGALIIETNFKLYSY
FT                   CNSPLQIAILSLFVHLKSRFANMVAGQITRESIRRALINGITADQVIAYLESHAHPQMR
FT                   RLAEEKLQKKLELDPNCKDPLQVLPPTVVDQIKLWQLELDRVLTYEGSLYIDFDTAQDF
FT                   NMLCKYAQDIGALLWKDDRKRKLFVSREGNAQVLEYAKRKIKKKEE"
FT   gene            complement(<659025..>659657)
FT                   /locus_tag="CAGL0J06864g"
FT                   /old_locus_tag="CAGL-IPF2341"
FT                   /old_locus_tag="CAGL-CDS4353.1"
FT   CDS_pept        complement(659025..659657)
FT                   /locus_tag="CAGL0J06864g"
FT                   /old_locus_tag="CAGL-IPF2341"
FT                   /old_locus_tag="CAGL-CDS4353.1"
FT                   /note="weakly similar to uniprot|P32489 Saccharomyces
FT                   cerevisiae YPL121c MEI5 meiotic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60955"
FT                   /db_xref="GOA:Q6FP40"
FT                   /db_xref="InterPro:IPR018468"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP40"
FT                   /protein_id="CAG60955.1"
FT                   /translation="MEDTFIGDDTTLLESASQPGEKPSVKTVNNGKVLKPRNENIKRHR
FT                   LILSEYRRKIRDEEKDIRELKQAIKIIEEKKLEHLMSLIEKWREVSQKTLSYMQYSTVL
FT                   KIDKMGGFKKYMERELENKLLEIEDEYTRFEEEMGSFLESDEFERLSEEQQEEYKDQIN
FT                   SRRYDLEKLKLQKAKEIEKEYENVDDVFTLQELTKLLKIDYKLIFPH"
FT   gene            <660284..>661822
FT                   /locus_tag="CAGL0J06886g"
FT                   /old_locus_tag="CAGL-IPF2344"
FT                   /old_locus_tag="CAGL-CDS1999.1"
FT   CDS_pept        660284..661822
FT                   /locus_tag="CAGL0J06886g"
FT                   /old_locus_tag="CAGL-IPF2344"
FT                   /old_locus_tag="CAGL-CDS1999.1"
FT                   /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
FT                   YPL120w VPS30 involved in vacuolare protein sorting and
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60956"
FT                   /db_xref="GOA:Q6FP39"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="InterPro:IPR041691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP39"
FT                   /inference="similar to AA sequence:UniProtKB:Q02948"
FT                   /protein_id="CAG60956.1"
FT                   /translation="MNDLQFDSLKVFKCQNCHLPLQVDPTMLHLSKSQRELLLPREDRR
FT                   PGVEEFNLRQESQDMLKKVKTGKEAKQLLKEDFQSSDFLFLRDIDDSIAEKDLKKGLEG
FT                   DNDDRKSNEDSMVSELDVEDTAKTLSTQIERLSKLFEIMSTSESNIDYPICQECCNIMM
FT                   KRLKTDYEKAVKERDLYFQFVKRIEKQQLDESDSSQLSLRQKEYTDQTKKINQERERLL
FT                   LELTKKEQVEEELDAEIAELTRQISEKKANERATRKIDNAKQWDKMKLLNDISSLQYQY
FT                   ETELNKLDQLRKTNIYNESFRISHQGPFATICGLKLGSYEDHKVSYSEINAALGQLVLL
FT                   LMTISSSLNIKISGYRLQPIGSTSKVSKFLADKEDWETYELYFSSNFSLEKIFKRETDF
FT                   DKGMESLLDIVKQISLSFSTVVSSDTDINIQDERTRSNDSMLNGGANRNANLRADRLFT
FT                   ESELPYMIDGDRINGISVKLYGAEPNLEWTTAMKFLLTDAKWLLVFCSSKLSLQ"
FT   gene            complement(<662041..>663855)
FT                   /locus_tag="CAGL0J06908g"
FT                   /old_locus_tag="CAGL-IPF2345"
FT                   /old_locus_tag="CAGL-CDS1482.1"
FT   CDS_pept        complement(662041..663855)
FT                   /locus_tag="CAGL0J06908g"
FT                   /old_locus_tag="CAGL-IPF2345"
FT                   /old_locus_tag="CAGL-CDS1482.1"
FT                   /note="similar to uniprot|P24784 Saccharomyces cerevisiae
FT                   YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
FT                   YOR204w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60957"
FT                   /db_xref="GOA:Q6FP38"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP38"
FT                   /inference="similar to AA sequence:UniProtKB:P24784"
FT                   /protein_id="CAG60957.1"
FT                   /translation="MSDGSGRYVPPHIRRGGGNSHESAAADGLSGSRYSGNGFFSSPNR
FT                   GNHKSSGGFFGSRPFNDRRTGQGSRASGSGGFGGSGGRYGWVNGKHVPYPKNPRLEMEL
FT                   FGNATDHVTSGINFDNYDDIPVEASGDNVPEAITEFKSPPLDELLLENVELANFSKPTP
FT                   VQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSELFLNGPAPLPEHTRHSYMRKCYP
FT                   SALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGAPIGQQMRDMDRGCNLLVATPGR
FT                   LNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPSVNDRQTLMFSATF
FT                   PREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNSALLDILINEIDGLTL
FT                   VFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVAARG
FT                   LDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFNSNSMNIAKELMDLLTEA
FT                   NQEVPQFLVNMVQDSMRFGRGGRNSRTGSNRGRGSNTRDYRHSNKDDWGSLGSSRRGFR
FT                   SNDNRGFGNNWGSSSGDGFTNKAANSWW"
FT   gene            <664270..>665289
FT                   /locus_tag="CAGL0J06930g"
FT                   /old_locus_tag="CAGL-IPF2346"
FT                   /old_locus_tag="CAGL-CDS3241.1"
FT   CDS_pept        664270..665289
FT                   /locus_tag="CAGL0J06930g"
FT                   /old_locus_tag="CAGL-IPF2346"
FT                   /old_locus_tag="CAGL-CDS3241.1"
FT                   /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
FT                   YPL118w MRP51"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60958"
FT                   /db_xref="GOA:Q6FP37"
FT                   /db_xref="InterPro:IPR016712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP37"
FT                   /inference="similar to AA sequence:UniProtKB:Q02950"
FT                   /protein_id="CAG60958.1"
FT                   /translation="MSLSNMLRASRLAQVYKSSKPLSTGLKIAPTHQVIETKPALLKFH
FT                   EWGLKSAIPSKVKTQYLMYKELDTLERLTDFEPRGGANWNRIRVQEFGLSPRYNANTKN
FT                   PLFNKEHYDFSSLNEVFTKFFFEKQQHGSMKYGSLSESRKLFIKNVRQEFKEWLVAKYP
FT                   EAILNQSFTKPDNMLTYGKEFLQSYNNRSSSKLNSPDTMIGTGGLTYALKGRLRNSPNG
FT                   VIQKHIVPGRFVAPTNDNKIAAIGGFVANAASSVISAQPQKWVSNRDKIYPFEVSNLSV
FT                   NNGQITLDAKGTMLNKPEQKRLRRNHYPKPLYGNRYSTGERKSDVAESLKAILEFNKS"
FT   gene            complement(<665599..>666426)
FT                   /locus_tag="CAGL0J06952g"
FT                   /old_locus_tag="CAGL-IPF2347"
FT                   /old_locus_tag="CAGL-CDS3790.1"
FT   CDS_pept        complement(665599..666426)
FT                   /locus_tag="CAGL0J06952g"
FT                   /old_locus_tag="CAGL-IPF2347"
FT                   /old_locus_tag="CAGL-CDS3790.1"
FT                   /note="highly similar to uniprot|P15496 Saccharomyces
FT                   cerevisiae YPL117c IDI1 isopentenyl-diphosphate
FT                   delta-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60959"
FT                   /db_xref="GOA:Q6FP36"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP36"
FT                   /protein_id="CAG60959.1"
FT                   /translation="MSEYRKLVEGLDEAAILENFPEIIPLQSRPNTHSSEDASRGKDDV
FT                   FAGHDQEQIRLMNENCIVLDWEDNAIGAGTKKVCHLMDNINRGLLHRAFSVFIFNTEGK
FT                   LLLQQRATEKITFPDLWTNTCCSHPLCVDDELGENGSLPAKVLGAKTAASRKLEHELGI
FT                   PEAETATRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKIDEGKQLTVQPNLNEVRDFR
FT                   WVSADELKAMFNDPQYKFTPWFKIICDSYLFQWWEQLQDLSKVENDSQIHRML"
FT   gene            <667811..>669847
FT                   /locus_tag="CAGL0J06974g"
FT                   /old_locus_tag="CAGL-IPF2350"
FT                   /old_locus_tag="CAGL-CDS1158.1"
FT   CDS_pept        667811..669847
FT                   /locus_tag="CAGL0J06974g"
FT                   /old_locus_tag="CAGL-IPF2350"
FT                   /old_locus_tag="CAGL-CDS1158.1"
FT                   /note="highly similar to uniprot|Q02959 Saccharomyces
FT                   cerevisiae YPL116w HOS3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60960"
FT                   /db_xref="GOA:Q6FP35"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP35"
FT                   /protein_id="CAG60960.1"
FT                   /translation="MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSPY
FT                   SLSHEFSRDWVAKSYKKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLLSP
FT                   HVLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVE
FT                   TGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKYGVTH
FT                   AVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSF
FT                   PTESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEF
FT                   FKNSKNEMNELGKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQ
FT                   MHCQGKVLSLLEGGYSDKAITSGVFSHLIGLQNQDWINEWGSEQVVKEIVRGCKPSWKP
FT                   YKTKKARDVIRIWAEEVIRLGRAMIPEFEDILFKEGLQSNPGLGDVPTSTIAQRLRKTH
FT                   VKEEPTKTKELTEPPKTSTNTRKSRNDDTKKDVPFIQQELSSEDEGEDEDYVYDEELNK
FT                   TFNRTVEDITIDDISRHLETLELEQIDENEPQELFIKKDENKQQRHLQSNGMYKIPSSK
FT                   TQRFKNSQQPQSNSPPTYDDSDISMISHVSVARKHNTRSGRKW"
FT   gene            complement(<670212..>673529)
FT                   /locus_tag="CAGL0J06996g"
FT                   /old_locus_tag="CAGL-IPF2351"
FT                   /old_locus_tag="CAGL-CDS0317.1"
FT   CDS_pept        complement(670212..673529)
FT                   /locus_tag="CAGL0J06996g"
FT                   /old_locus_tag="CAGL-IPF2351"
FT                   /old_locus_tag="CAGL-CDS0317.1"
FT                   /note="similar to uniprot|P32873 Saccharomyces cerevisiae
FT                   YPL115c BEM3 GTPase-activating protein for CDC42P and
FT                   RHO1P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60961"
FT                   /db_xref="GOA:Q6FP34"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP34"
FT                   /inference="similar to AA sequence:UniProtKB:P32873"
FT                   /protein_id="CAG60961.1"
FT                   /translation="MAGNFGAGSSALQLLEQYNDQRLEKDKKLEHIERNKPTEQKNYLD
FT                   PDKRASWRRGSLDGGNNDWKSLYDDMFQDNLRMNKQLQDKDKEIALLEKVVVYLRDNIG
FT                   VVNAKYNVNKNSTLEDLKKVVTEIDNAKHEHQFALPPRSTERTNNQRTTDPLDDFENEM
FT                   KLKKVSENTPRPTPSATGSFQSNSTKTQSSEEPTLPSSYANKLNISPIRITEAPQNFTS
FT                   PATSVTYTTSRITISSPRSVRHEPKQDTTAQVPESPSRRIVSQTIRKQQNGPLESCSNS
FT                   QSGRNTPTKHLEKDQSVDRSFAPMSPPRTDFQKPKGQDFSPSSKEKIDNFAELLEASFG
FT                   EEEVSKHDTQNGHQDLKKSNAIKSQGLPNVTINASITSTPVSAQQLGSPIIVNKKKDVL
FT                   VNHDSQMSTPGTSSIVSSIVPGSLPNETPLGRADNLRHEREYLPSNEQRQETPSHISPQ
FT                   KPPANSQQGLRVDLTSVNRDNSLRSNPSLKPVTSDIPLFVQPEDLGTIQIQILSTLYKD
FT                   PEINFQGEENSVLFSVIDRSSSQEMFKFSKSLKKLRELDVYLKSHIPSVSIPDLPSEQL
FT                   YKSLLPVRVDQRREMLNGYFSSLVSIPNFPVNVGLKIAEFISTDTVMTPLTLGDTLYEG
FT                   RLLMRKPKALGGGNTWKLRYGALNSKTLQLLENDQIMEQVKVRQVSLEILPNLPDDKFG
FT                   TKNGFLLTEHKKSGLSGSNKYYLCTETAKEREGWISALHGLLDPNSSNLAPSTSSIRSG
FT                   SNHTDNISFGRPDSSKPDPHYVTDLSNHRNSYNIETASNYSGISSPSGISEQNEGADDE
FT                   RESRRMKMRSIFPFKKIAGGVFPHDEDRDTENDSLNKSVETFVTSNNDNYSQRLVESTP
FT                   LPVSLNTVFGAPLQKSMQLSSKTYQRQYHLPSIVYRCLEYLYKNHGIQEEGIFRLSGSS
FT                   TLIKQLQEKFDREYDVDLSNFNNKLEGAGNEDDSNGGQFISVNTVSGLLKLYLRQLPHL
FT                   ICGDDEYGYFKGVVDMNHDNPAKIALGFRDIIASGKIPHQNLSLMYALFELLLRINENS
FT                   RYNKMNLRNLCIVFSPTLNIPIGVLQPFIVDFACIFKGADPIPDSSREQIDIHIPNV"
FT   gene            <674365..>676644
FT                   /locus_tag="CAGL0J07018g"
FT                   /old_locus_tag="CAGL-IPF2352"
FT                   /old_locus_tag="CAGL-CDS1470.1"
FT                   /old_locus_tag="Cagl0J.mRNA.at.515.p"
FT   CDS_pept        join(674365..676154,676461..676644)
FT                   /locus_tag="CAGL0J07018g"
FT                   /old_locus_tag="CAGL-IPF2352"
FT                   /old_locus_tag="CAGL-CDS1470.1"
FT                   /old_locus_tag="Cagl0J.mRNA.at.515.p"
FT                   /note="similar to uniprot|Q02981 Saccharomyces cerevisiae
FT                   YPL109c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60962"
FT                   /db_xref="GOA:Q6FP33"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP33"
FT                   /inference="similar to AA sequence:UniProtKB:Q02981"
FT                   /protein_id="CAG60962.2"
FT                   /translation="MLLNLIKSRAKVTTALAKVRVVGRQRRFLISPLTTASIATGAISL
FT                   SIYHNRREHLLNETLEPDPTGDTFEMGLYIASEKERETLAASGKLDVIRKSRSLLVRSI
FT                   LKLWVVLDDNIIEPVLTVCRFLELMGLFLPVFSLYPICWLGRRIKLNDDITDTRGSIIW
FT                   CKLIRIALELAGPSFIKLGQWAGSRTDIFSETLCYELGKLHSKVRPHSIEYSKKMITSS
FT                   FEVDDFDEIFDSFGEKPLGVGAIAQVHVGKLNDAFYNKYSNKTPENNKWCAIKIIHPRV
FT                   RNQIYRDLKIMKFFACVIDGIPTMEWLSLPNEVEQFSILMKLQLDLRIEALNLKRFNEN
FT                   FKDATQVKFATPYLELSNRDVLFEEYLHGFPMEDFLKVKRHIKDDDLCRRVSDPFVEAF
FT                   LQMLIRDDFVHADLHPGNVMIRFVKTNKYGTQIISSEESSYNISHTLREKWRNKDSDLI
FT                   PYLKSALTTYTPQICYIDTGLVTELNDRNRVNFIALFNALAQFDGYRAGELMIERSRTP
FT                   ETAIDKDLFALKVEKLVDKVKQRTFTLGNVSIGDLLDQMLRMVRSHHVRMEGDFVSVVV
FT                   AILLLEGIGRQLDPDLDLFESSIPLLRDFNFMKETNNKFLTEIGTYKILKLLVGLEIRK
FT                   LMTVSVRELYNLVKTDQLCPNY"
FT   gene            <677513..>681250
FT                   /locus_tag="CAGL0J07040g"
FT                   /old_locus_tag="CAGL-IPF2354"
FT                   /old_locus_tag="CAGL-CDS0214.1"
FT   CDS_pept        677513..681250
FT                   /locus_tag="CAGL0J07040g"
FT                   /old_locus_tag="CAGL-IPF2354"
FT                   /old_locus_tag="CAGL-CDS0214.1"
FT                   /note="similar to uniprot|Q02979 Saccharomyces cerevisiae
FT                   YPL110c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60963"
FT                   /db_xref="GOA:Q6FP32"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR033506"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP32"
FT                   /inference="similar to AA sequence:UniProtKB:Q02979"
FT                   /protein_id="CAG60963.1"
FT                   /translation="MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQENS
FT                   ANGEGDKPLWKKEEDGMTSDRKTFAENKKIQQLIISFFFNLDRDIEKVDSFYNSQFSEY
FT                   EKRLQKLLQSSQFQDVTYLIENREGEKELTPVGNGSIPPRYATPHHIDDVNEVYNILSE
FT                   LKTQFRNLKNYSELNKRAFVKILKKFDKITGLSRKDIFLQNRIYPLPFANETQISKDLG
FT                   TINEIWSKLSSRVGVIGALNPSVDELLQSTENLIPQIKLNDSPSVKGQVTSINDITPFI
FT                   DEDNGKGIIAQLIQLYGTITAVPTRSLINILNKSALKKSYNCVDSILEVIPSFNDVTDI
FT                   NNRNFFHHFIISLSKKLPSNDQQEEIPFVLKSQPSFAKPTEDVILSSNLEVIYNTYMNR
FT                   GTTGTVLEKQKLDENYLDPFRHIIQKLPVRLRPCILQVDNYSRTPLHYAAKFGFTGIAA
FT                   EIIEMLKAWGYWKDDISLDDKDFWGDSEGLSPVHLAVLGRNTDTLKMLLDSMNNNLLLT
FT                   SPTLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVAANLFEATACLLING
FT                   ASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAVLRGHLEV
FT                   AKIVEVKDWPEVCHPVYNSTKNQDSQSRDNSEIIKGNSNSSEQMNDTKVKRIKSFGHSY
FT                   LKEEEAIMLITLGGTDTRITTPAISLNLKKLLQSADIDTALSLVISCDDDVSSVPVVLD
FT                   LPLDASMANINFKVPFKDNGVYTVFFDIVYTYGSYSPDNGNSLVRPNLDRNASVDSVIL
FT                   SSASDRDQNDSPPPVEYLKDRLVARAVALLNKTNSAAGTNRRLLNDNVTIPIQSKYGMD
FT                   LVGTISFEYSIVTPFSHPKMGVYATDTYWKSLVSTRVIGHRGLGKNYQSSKSLQLGENT
FT                   VESFIAAASLGASYVEFDVQLTKDNIPVVYHDFSVAETGVDIPMHELTLEQFLDLNNYG
FT                   GSRELLKSRRKSMDDSDFKNLKKDWDLGEPDDGRKSPYYQSRSKLMEERMKLTKAYKSN
FT                   NYKGNSRGHSIASSFVTLKELFKKIPQNVGFNIECKYPMLDEAEAEELGQIALEMNHWV
FT                   DTVLQVVYDNFNGRDLIFSSFHPDICVMLSLKQPNFPILYLTESGTTKMADYRAISLQN
FT                   AIKFAKSWNLLGIVSAAYPIVKAPRLAKVVKSNGLVCVTYGVENNDPNNAAIEIDAGVD
FT                   AVIVDSVLAIRRGLTKIQTK"
FT   gene            complement(<681641..>682606)
FT                   /locus_tag="CAGL0J07062g"
FT                   /old_locus_tag="CAGL-IPF2356"
FT                   /old_locus_tag="CAGL-CDS3400.1"
FT   CDS_pept        complement(681641..682606)
FT                   /locus_tag="CAGL0J07062g"
FT                   /old_locus_tag="CAGL-IPF2356"
FT                   /old_locus_tag="CAGL-CDS3400.1"
FT                   /note="highly similar to uniprot|P00812 Saccharomyces
FT                   cerevisiae YPL111w CAR1 arginase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60964"
FT                   /db_xref="GOA:Q6FP31"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP31"
FT                   /protein_id="CAG60964.1"
FT                   /translation="MTDYKYYKDRQLSLVLAPFSGGQGKLGVEKGPKYMLKHGLQKDLE
FT                   ELGWGTEIQSPLDEEEYVKKVKENTQDQFGIIKRPQLVGEATELIYKSVTDVLSRDRFP
FT                   VTLGGDHSIAIGTVSAALDKHPNAGLLWIDAHADINTLESSPSGNLHGCPVSFLLGLNK
FT                   GKHESLKSLDWVPGKLKPNKIAYIGLRDVDSGERKILKELGIKAFSMYHIDRYGINTVI
FT                   EMALEAIKDPESENTPIICSYDVDSIDPLFVPATGTPVRGGLTLREGLFLAERLAETGN
FT                   LISLDVVECNPDLAIQDIHVSNTISAGCAIARCALGETLL"
FT   gene            <684122..>685252
FT                   /locus_tag="CAGL0J07084g"
FT                   /old_locus_tag="CAGL-IPF2359"
FT                   /old_locus_tag="CAGL-CDS2926.1"
FT   CDS_pept        684122..685252
FT                   /locus_tag="CAGL0J07084g"
FT                   /old_locus_tag="CAGL-IPF2359"
FT                   /old_locus_tag="CAGL-CDS2926.1"
FT                   /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
FT                   YPL113c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60965"
FT                   /db_xref="GOA:Q6FP30"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP30"
FT                   /inference="similar to AA sequence:UniProtKB:Q02961"
FT                   /protein_id="CAG60965.1"
FT                   /translation="MRPKVLIPYQQTWEVASHIPEWEKLKDKLDFIEYKMTNADDFREY
FT                   LHSNDIAALWVTEEFFRVLGGPTPYIEDYPSSLRVIAVPWVGCDFIDGKMLLEKYNIYL
FT                   CNIGPHAVDNVTDLAIHLVVSCFRLTSFWEYCFRFSEPGSIDECKKYVGGTSKDQITKD
FT                   GALYPQKLDDDQSRFLNLAKDFNVAGKKVDSPTKKTALILGFGSIGQNIGSKLKFSFDM
FT                   KIKYYKRSGEVPREQLGYDAIYCSDLQSADTWQDVDVIVLALPGSPSTDDIINDSSLGM
FT                   CKDGVRIVNVGRGSCIDEDALISALDSGKVNSCGLDVYKNEETLINEKFLKRWDVTLLP
FT                   HIGSAVADMMVRQTIITLDNIEDILLKNGEGIYRAN"
FT   gene            complement(<685582..>686331)
FT                   /locus_tag="CAGL0J07106g"
FT                   /old_locus_tag="CAGL-IPF2360"
FT                   /old_locus_tag="CAGL-CDS4005.1"
FT   CDS_pept        complement(685582..686331)
FT                   /locus_tag="CAGL0J07106g"
FT                   /old_locus_tag="CAGL-IPF2360"
FT                   /old_locus_tag="CAGL-CDS4005.1"
FT                   /note="similar to uniprot|P32773 Saccharomyces cerevisiae
FT                   YOR194c TOA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60966"
FT                   /db_xref="GOA:Q6FP29"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP29"
FT                   /inference="similar to AA sequence:UniProtKB:P32773"
FT                   /protein_id="CAG60966.1"
FT                   /translation="MSNLEASKVYELIVSNVINEVREDFESAGIDEQTLQDLKRVWQEK
FT                   LTETKVTHFSWDPVTDAVPATNETNQQETSTTETNGLQLPGGAVISAPSTGNDMSPQDE
FT                   NTNNADDGDATAGMLAGGDDDLNNNENNVSDNNVQVKQEGDVKFEMTIENADTSDLESK
FT                   NKDHKEAKRSALLDADEVGSELDDSDDNYLISEGEDEGPDENIILCLYDKVTRTKARWK
FT                   CTLKDGIATVNRKDYSFQKAQVEAEWV"
FT   gene            <687628..>688371
FT                   /locus_tag="CAGL0J07128g"
FT                   /old_locus_tag="CAGL-IPF2361"
FT                   /old_locus_tag="CAGL-CDS4026.1"
FT   CDS_pept        687628..688371
FT                   /locus_tag="CAGL0J07128g"
FT                   /old_locus_tag="CAGL-IPF2361"
FT                   /old_locus_tag="CAGL-CDS4026.1"
FT                   /note="similar to uniprot|P39721 Saccharomyces cerevisiae
FT                   YAL049c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60967"
FT                   /db_xref="GOA:Q6FP28"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP28"
FT                   /inference="similar to AA sequence:UniProtKB:P39721"
FT                   /protein_id="CAG60967.1"
FT                   /translation="MASNPPGKCCFEGFYHEGQAKGTHKDVCGVDTYVTGAENSSDRVI
FT                   VILTDIYGNRLNNVLLTADQMATDCYQVYIPDILFNDPVVALDGSTDFNAWLAAHPAEK
FT                   VQELVTKYLTDLRAQLKPKFLAVVGYCYGAKFAIQQIGANPLADCCAIAHPSFVSIEEV
FT                   DAISKPVLISAAEEDPIFPEELRHQTEAKLKENKARYQLDLFSGVSHGFAARGDTSNPV
FT                   VKYAKEKVLVDQLYWFNYFSGCCQK"
FT   gene            complement(<688858..>691926)
FT                   /locus_tag="CAGL0J07150g"
FT                   /old_locus_tag="CAGL-IPF2362"
FT                   /old_locus_tag="CAGL-CDS0414.1"
FT   CDS_pept        complement(688858..691926)
FT                   /locus_tag="CAGL0J07150g"
FT                   /old_locus_tag="CAGL-IPF2362"
FT                   /old_locus_tag="CAGL-CDS0414.1"
FT                   /note="similar to uniprot|P39720 Saccharomyces cerevisiae
FT                   YAL051w OAF1 peroxisome proliferating transcription factor
FT                   or uniprot|P52960 Saccharomyces cerevisiae YOR363c PIP2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60968"
FT                   /db_xref="GOA:Q6FP27"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP27"
FT                   /inference="similar to AA sequence:UniProtKB:P39720"
FT                   /protein_id="CAG60968.1"
FT                   /translation="MKYVDEGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLK
FT                   HGIRCVYDLTSQKAPKNPNKDAMIARLEKELSYWKKKTLKLTKTLPPVSRHLISTNEPA
FT                   MDIELSSLRANCTNVEVNLFKVHPRLIVSGVIKREVNPLSENYLIIQDKFTTTAIASVF
FT                   LNYQGSALLSALASDMSITKTSTNVQNNISIIKENLLKQCRNDLQGKRIKLFVNKLAQN
FT                   IEPPPDLFQKGEEAKNFLTSLDNSFVEDYCPKGAPYSELLQSLIDSIESLLPPYDIIIA
FT                   YKKWYYDNVYYIAPFVHKSIFEDDLAQILVRDDKDPQKVKVVFGNSKLRSKLETMSMLL
FT                   LVMKLAYTSIILTDDDIRKYSSVLTMDIVRKYPISSEVAHVVQNCLSAENWCATPNENI
FT                   ISCLLLLWAFFVFSPDEGDFFYEQPTGVLASIAMMLGVSIGLHKDPSDYPVFSNDTLGD
FT                   KRVCNQRRLLWIAMICVLTFETNTKGSTVDKHDDLFDIFIDLRDPSSVYELMDRVKKDC
FT                   DHNDEGSIEVMNVIENLFRRTQTSYALYDLNALLLSPDGRFTLSEYEILSSKVHIMSKE
FT                   YIDLVSSYSPKHGPSGDKAKLPLFYMLNCCDVLSGIIFQLMNLRISIALFLHFEERLVT
FT                   EENVKNHYIYFFTKLCLDLIALGNTMEKFFDGTFDAVIAKASDFIIKKAIQVAINTVLF
FT                   GLLAVIMRFDLAASILFNELQSLQTQGVYKEQIYSEMNSKIQLLNDMKVIFETQLKNIY
FT                   HVCSTSLRFEYFTIFKMLTLFDALLDRIEKNELWIGILRMAHLDNVDPKIAKVLAITLR
FT                   IQLIRKTGLVEDMQLRSHLAHFELEKITKLHKSMTNYKSRLNLINTYNVDLESTPESSL
FT                   EPLIPMKEEPLVVIKEETVTPNFSNRTVSPNLPRIKSEEPVEIMATPATGLTQLSNAAL
FT                   LSSQPLSIPVLPIQSQQPASQSNSDNQGPVNENIPTAFPILGSTNQQNQMINNNGVANV
FT                   NLNNTEEPLADFFGISATLGVLDFEFLLGNQFQ"
FT   gene            <695093..>695707
FT                   /locus_tag="CAGL0J07172g"
FT                   /old_locus_tag="CAGL-IPF2363"
FT                   /old_locus_tag="CAGL-CDS4415.1"
FT   CDS_pept        695093..695707
FT                   /locus_tag="CAGL0J07172g"
FT                   /old_locus_tag="CAGL-IPF2363"
FT                   /old_locus_tag="CAGL-CDS4415.1"
FT                   /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
FT                   YOR367w SCP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60969"
FT                   /db_xref="GOA:Q6FP26"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP26"
FT                   /inference="similar to AA sequence:UniProtKB:Q08873"
FT                   /protein_id="CAG60969.1"
FT                   /translation="MEKVYGVKPDVTTLDDDLKQLRSGKFSKEAVDEIKNWIFSSILKE
FT                   RPENSDSSLLELLKDGSVLCKVANKLGELEHGFSPIKWKVSNMPFVQMEQISLFLAFSR
FT                   QYGVPEDELFQTVDLFEEKDPASVYQALKSLSRYANKKHPDKFPVLGPQLTEKKPRPPV
FT                   KAKPKHLQTESPGWSTYEYGYMKGASQKTENIVFGQKRDIA"
FT   gene            complement(<695807..>696331)
FT                   /locus_tag="CAGL0J07194g"
FT                   /old_locus_tag="CAGL-IPF2364"
FT                   /old_locus_tag="CAGL-CDS4641.1"
FT   CDS_pept        complement(695807..696331)
FT                   /locus_tag="CAGL0J07194g"
FT                   /old_locus_tag="CAGL-IPF2364"
FT                   /old_locus_tag="CAGL-CDS4641.1"
FT                   /note="weakly similar to uniprot|P39718 Saccharomyces
FT                   cerevisiae YAL055w PEX22 peroxisomal matrix protein import"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60970"
FT                   /db_xref="GOA:Q6FP25"
FT                   /db_xref="InterPro:IPR024359"
FT                   /db_xref="InterPro:IPR038613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP25"
FT                   /protein_id="CAG60970.1"
FT                   /translation="MSKRRKNQGYLAIIAAVSIGAAAYLWWRNHSEDDSVSKFNQQDDG
FT                   TAQDNQIKEKPAIKLGKKRLHRSLCVIISNKLSNLVELDWDEILQEDIVFLILPSVNDF
FT                   QNSNDIKTDTHKIINCDTELGLWACVRTLKKNELLVCADDIKVPDDIGRYCDKISQIKS
FT                   SQQLMNYLDET"
FT   gene            <696814..>697986
FT                   /locus_tag="CAGL0J07216g"
FT                   /old_locus_tag="CAGL-IPF2365"
FT                   /old_locus_tag="CAGL-CDS2828.1"
FT   CDS_pept        696814..697986
FT                   /locus_tag="CAGL0J07216g"
FT                   /old_locus_tag="CAGL-IPF2365"
FT                   /old_locus_tag="CAGL-CDS2828.1"
FT                   /note="similar to uniprot|P48581 Saccharomyces cerevisiae
FT                   YOR368w RAD17 DNA damage checkpoint control protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60971"
FT                   /db_xref="GOA:Q6FP24"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="InterPro:IPR016587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP24"
FT                   /inference="similar to AA sequence:UniProtKB:P48581"
FT                   /protein_id="CAG60971.1"
FT                   /translation="MVKSRFSATTVHLEHITTALNCLTPFGSKDDILIYIDHDGLSFVK
FT                   DNNGVIRISLLLAKELFSSYHFATTESNQTDNDGDDLDYMKLCVKINHILDSVSVVNKN
FT                   LDDVVECILSYDGRGSPFSLTFEDSMISERVDYSTYLIKEMDTSALELDRQKIILECIL
FT                   KGEVMHSALKDLKEINCKDIYLYANVTSNGDSTLAFISRSQLGLSKIKFPSNKNVIEKL
FT                   EIYDNNSTTMCYDKPVIGYFNYTSFNKIILSTKIASKILLRMDVHGILSINILSHTDNV
FT                   MMSEDKFTKQSSSTSSKRYNSMQLPKDYPGIVIDVCMIEKEPLDMYAQEEIHQFMGSGA
FT                   ITGVPNSKDSAADVPQHNLLSHPVTEYESNSNTKDTSSSSNMNEDLPIFF"
FT   gene            complement(<698356..>698784)
FT                   /locus_tag="CAGL0J07238g"
FT                   /old_locus_tag="CAGL-IPF2366"
FT                   /old_locus_tag="CAGL-CDS4911.1"
FT   CDS_pept        complement(698356..698784)
FT                   /locus_tag="CAGL0J07238g"
FT                   /old_locus_tag="CAGL-IPF2366"
FT                   /old_locus_tag="CAGL-CDS4911.1"
FT                   /note="highly similar to uniprot|P48589 Saccharomyces
FT                   cerevisiae YOR369c RS12"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60972"
FT                   /db_xref="GOA:Q6FP23"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP23"
FT                   /protein_id="CAG60972.1"
FT                   /translation="MSDVEEVVEVQEEVVEQTAEVSIEDALKVVLRTALVHDGLARGLR
FT                   ESTKALTRHEAQLVVLVSSVTEDNIIKLVEGLANDPNNKVPLIKVADAKQLGEWAGLGK
FT                   IDRDGNARKVVGASVVVVKKWGAETDERNMILEHFSQQ"
FT   gene            complement(<700532..>702448)
FT                   /locus_tag="CAGL0J07260g"
FT                   /old_locus_tag="CAGL-IPF2369"
FT                   /old_locus_tag="CAGL-CDS1319.1"
FT   CDS_pept        complement(700532..702448)
FT                   /locus_tag="CAGL0J07260g"
FT                   /old_locus_tag="CAGL-IPF2369"
FT                   /old_locus_tag="CAGL-CDS1319.1"
FT                   /note="highly similar to uniprot|P32864 Saccharomyces
FT                   cerevisiae YOR370c MSI4 geranylgeranyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60973"
FT                   /db_xref="GOA:Q6FP22"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP22"
FT                   /protein_id="CAG60973.1"
FT                   /translation="MLSPERRPSMAERRPSILVPHIDHNRDGSSVVHTLMVPHLAGIED
FT                   PLPEATPEEVDVVIIGTGMVESVLAAALSWQGSSVLHIDKNDYYGDTSATLTVDQIKKW
FT                   VNGINSGEVKGYTNAKLYVSTLIGPNRYASRDFGIDLSPKVLFAKSDLLSILVKSRVYQ
FT                   YLEFQSLSNFHTYENDSFEKLTNSKQEIFTDQKLPLMTKRNLMRFIKFVFNWEQQPEIW
FT                   QPYQDRTLEEFLTEKFKLEKAQISELIFSIGLCYNMNAKMPAVFQRIRRYLSSFDVYGP
FT                   FPVLYSKYGGPGEVSQGFCRSAAVGGATYKLNEQLVSYNPSTKVATFSDGSNVKVTEKV
FT                   IASPTQAPPDSQNIPQQKYEVHRLTCIVDKPCLEWFNEGESAAVVVFPPGSLKSNNTEV
FT                   VQALILGPGSETCPAGTCIWYLSTSQQGSKAELDLDAALEAMEISILRESSSDLENNDD
FT                   IVQFSVNGQTIINSVKLGQSFREYIPREKLQFLFKLYYTQFTSTPPFDVVNPALFATNT
FT                   SSKELMIPGASDNGIIYSPMPSVEISYDEVITAAKVLYEKIVGSDDDFFDVDFEDEDEM
FT                   REIAANAASNDMTNNKVGSQQTNAGIANPMIYENAIVDEDDDSQDVEMDRNDDSEFVGE
FT                   MEI"
FT   gene            complement(<703034..>705907)
FT                   /locus_tag="CAGL0J07282g"
FT                   /old_locus_tag="CAGL-IPF2370"
FT                   /old_locus_tag="CAGL-CDS0500.1"
FT   CDS_pept        complement(703034..705907)
FT                   /locus_tag="CAGL0J07282g"
FT                   /old_locus_tag="CAGL-IPF2370"
FT                   /old_locus_tag="CAGL-CDS0500.1"
FT                   /note="similar to uniprot|Q08886 Saccharomyces cerevisiae
FT                   YOR371c GPE1 or uniprot|P39717 Saccharomyces cerevisiae
FT                   YAL056w GPE2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60974"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP21"
FT                   /inference="similar to AA sequence:UniProtKB:Q08886"
FT                   /protein_id="CAG60974.1"
FT                   /translation="MEGIVNDGSVNINSNHEKPTLISVPGSISKFMKSDSPSRYETFEP
FT                   LSFATNYVSIFAEPLEKNNNDKICLENEKLLKCYYEYRSAFSNIMNHTVNSATNSYTNL
FT                   SSMNDIQFNPDQHRHGSITSSIETSILQNERQSIYKVLNDFLIHKEHKLNPSILQKIMK
FT                   MDRSQFYRDSPFRPHFDNNDNKSDKNMENLNNEAGDNNDTYFNSTKPYLLYYKKPLSVK
FT                   FRDSEVIHRHNLWMPVVKRKYHYILKPEKLQQTLDYREPSEEAAAIYRDYFTSKACPLF
FT                   IKGLDFVPKNYDTYSGTSIVPSIFADYKMPGLVYHCSVHLNNNIYIIGGLTACYRFDEE
FT                   APDLSDFYVDPIKNLPPPLLSKLINNPSLISNPFLYVYSTLQSRFGKPDFSGNAPPPLI
FT                   CAKGSIINDRYIFYYGGFEIKTETKKDENGKYYLKKRAFVNNLGYILDTETLKFSKVEV
FT                   INPGQGSERNNKFYPRFGHIQLSANIDLTNNSVTSSSENVSVLSSRRTSSHQLYYGSHH
FT                   HYKTNHGNGQNNIRQPEELSSIAKKMPHSLGSDSKVTNDSETKIHNKTNLSPYKSIHSI
FT                   FVFGGYTQTEDDQYKALDDMWRIDLPVEIRGKRGFIKFASKAELINLPKKEVWPSARAF
FT                   SAFTISEVFPPIKESLESNLLKRLEEQYSIDTKNLTGNTSNLFGTTVGVKSDLGEAYHD
FT                   LGPSIHSQFSSHISLNSLNKPSQQGSAVNLGAPTEHSNVISNSMTAFETRMQILYNSKG
FT                   INIIMHGGSDHDEIYGDLWMFDIKNEVWSRSNLFAKEIKDKPRHECQGDISLAAPDEPR
FT                   TIVEEVPVDLKLTGHDMAYEGHMLVLLGGITQTDLPSMYHDGPIDADSEPRPLLGQNTV
FT                   NIFDMETSTLQGYKIRKNAQGHYEYIYEQDKPKKSHSVMTTAGATVHINGSLFVVGGIL
FT                   ALRSNLKDLKLRATVLQFVIPPISLSY"
FT   gene            complement(<706716..>708167)
FT                   /locus_tag="CAGL0J07304g"
FT                   /old_locus_tag="CAGL-IPF2371"
FT                   /old_locus_tag="CAGL-CDS2172.1"
FT   CDS_pept        complement(706716..708167)
FT                   /locus_tag="CAGL0J07304g"
FT                   /old_locus_tag="CAGL-IPF2371"
FT                   /old_locus_tag="CAGL-CDS2172.1"
FT                   /note="similar to uniprot|P53867 Saccharomyces cerevisiae
FT                   YNL223w AUT2 essential for autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60975"
FT                   /db_xref="GOA:Q6FP20"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP20"
FT                   /inference="similar to AA sequence:UniProtKB:P53867"
FT                   /protein_id="CAG60975.1"
FT                   /translation="METIHNISNRLQEVLATNKSVNVDTDNDSLSSNQEDNEVEKVRHL
FT                   VVILGEKYSYAVDRNTGINALMQWFTTNSEIPEEILNAIRSKLNFTYRTNFEPIERAPD
FT                   GPSPINPLIMLRINPIDAIENVFNNRECFFTDVGWGCMIRTGQSLLGNALQRVKSTVKD
FT                   QPYIYEMDDTKEITDLFKDNTKSAFSLQNFVKCGRIYNKIAPGEWFGPATTATCIRYLI
FT                   QENPCYGIEACYISVSSGDIFKENIQGMIDRYPNGNILILLGIKLGLDSVHERYWGEIK
FT                   TMLESPFSVGIAGGRPSSSLYFFGYFDDTLLFFDPHNSQTALIDDFDESCHTENFGKLN
FT                   FSDLDPSMLLGFLLPCSKWDEFQEFTSLLTIVNVLDGMDQYRDPDLNSNDIGNVELSPQ
FT                   LKLSQTPDAITDDDYVDIGALIQGNSMNINDRDNGYQEVQCKNQQIVIMDSLNETKPLE
FT                   IEKVLVGQGTNLVNATTPCREAFPK"
FT   gene            <708554..>710980
FT                   /locus_tag="CAGL0J07326g"
FT                   /old_locus_tag="CAGL-IPF2372"
FT                   /old_locus_tag="CAGL-CDS0787.1"
FT   CDS_pept        708554..710980
FT                   /locus_tag="CAGL0J07326g"
FT                   /old_locus_tag="CAGL-IPF2372"
FT                   /old_locus_tag="CAGL-CDS0787.1"
FT                   /note="similar to uniprot|P53866 Saccharomyces cerevisiae
FT                   YNL224c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60976"
FT                   /db_xref="GOA:Q6FP19"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR034082"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP19"
FT                   /inference="similar to AA sequence:UniProtKB:P53866"
FT                   /protein_id="CAG60976.1"
FT                   /translation="MAKRHKHFESRGGFRKKRGGGRGSQRGRGSKRGRGGRFRGFEETE
FT                   RSASEPGAWLNSSVPLGDGDLSNPDMMVDNYRPRKHISQDTITDHYFGRKSSLKLNSMR
FT                   MAGLRHNDWRDPNNGNSASFRKRPIEFIKANCTYDPSRDLILQLANRSKNQESKEPEED
FT                   ANKCSEYAEHSEKDMEIDTAATENDANISYDESDTDQEIGNFNHSIENSKHNNNISECD
FT                   ITAVTDQELFFVDEEGMDISQKPTKVVHITEHEKKMGSNVEFHNVLTVGKVEISLNQDE
FT                   NDEVYVDRKPTAKYHPFHNYISNVIERMQEEENIDSDDFEDEDDIYLDNSGNDMPETEL
FT                   DQDEIIDLQRHDDKDHAVQTCAIPTNTLSNDLDTLHITESNDDRITINNHNMDSTVETD
FT                   KEKDPEFGFLEEDYAVNTSEVIVDNIRLGLNDNSYFLKCYRFFGDYSFHWIDQEAFVSF
FT                   LTEDLELPMNRVGAYLAYVKNSLVPDETPPSPTYSDIPFSDTSNESDEDNALPNVDAVS
FT                   SCSNDDEDEELGDDVDDLVSYSLKYANSRNIDYETRALEFTGKGKKKKLLVNEQLDLDN
FT                   ETMETLQAKLSKRMENKAKKRRLKEDFIDKENMNSDDLFLKYPYGFHVQNIRDEFELFL
FT                   TRNKDRMSFPPLDPHGNKVITKFATCYNIKSSKVGKGNHTHIMVEKVKKTKWSRPNYNM
FT                   VLQLTRQRPVFMRIDVRRPKEDAIKENSGRRGPTAKFHVKEGEVVGENAPEIGQDNIGR
FT                   RMLEKLGWSSGEGLGAHGNKGISIPVMARVKKSKSGLRHSKEDEDTGRSSSFRKK"
FT   gene            <711496..>713091
FT                   /locus_tag="CAGL0J07348g"
FT                   /old_locus_tag="CAGL-IPF2374"
FT                   /old_locus_tag="CAGL-CDS1892.1"
FT   CDS_pept        711496..713091
FT                   /locus_tag="CAGL0J07348g"
FT                   /old_locus_tag="CAGL-IPF2374"
FT                   /old_locus_tag="CAGL-CDS1892.1"
FT                   /note="weakly similar to uniprot|P53865 Saccharomyces
FT                   cerevisiae YNL225c CNM67 involved in cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60977"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP18"
FT                   /protein_id="CAG60977.1"
FT                   /translation="MSLSVEDQRAEHMRKEAALVALQYAYDEEDKENHPLRETNGHFLN
FT                   HPKTTIPHSTPLVKIDDFNSKYEKEIETLKDQLFSIKNLLGIEDPDSEHSDYELIETSI
FT                   KKMKGQIENALKENRMLKDQAVENASVTSSRISELETKMNELTAQNQTQNELIQSLKKD
FT                   NQLKEEELQQSSKAAEQLTLELDTSKEEIKNLTNERMSNREYIKTFILFGRPIGEIITD
FT                   CLDSSINVLDDSIKKTHADIVSFKTNQDINYTSIQSKAVERLDEIKAILSQLPQQIKDN
FT                   ENLNSEKLNELVSKYNEQNLETIEKVNKTNKISTGINNETLNLITQVNELKSEIQQLHS
FT                   EVEQINNQQFNLQEILQEKEQLQKTVFELQLQLNTERESKMELQQLNDSKDNKLLSITG
FT                   NTNNMLSFEKLKQLDNSFCKEEYVSLKISEIEDISLVQLQNMAKMICMYFRTPFDKLDI
FT                   KLPLAAIQIIHERKILIHFANILNEYFMSKPLSMKKCTDSAYCEWQLSHNIFRIEHPLK
FT                   FKLEELYTTILRST"
FT   gene            <713487..>715358
FT                   /locus_tag="CAGL0J07370g"
FT                   /old_locus_tag="CAGL-IPF2375"
FT                   /old_locus_tag="CAGL-CDS1378.1"
FT   CDS_pept        713487..715358
FT                   /locus_tag="CAGL0J07370g"
FT                   /old_locus_tag="CAGL-IPF2375"
FT                   /old_locus_tag="CAGL-CDS1378.1"
FT                   /note="similar to uniprot|P53863 Saccharomyces cerevisiae
FT                   YNL227c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60978"
FT                   /db_xref="GOA:Q6FP17"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP17"
FT                   /inference="similar to AA sequence:UniProtKB:P53863"
FT                   /protein_id="CAG60978.1"
FT                   /translation="MKTCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATT
FT                   IFAEIRAAYEVLSDPQERAWYDSHKEQILSDTPLNPNDEDDDYVVDSTVTGVTTEELMM
FT                   FFNSSLYTSIDNSPAGFYQIAGKVFAKIAKDEVSWGLRLGLDGYKNYKDMEFEEHINSR
FT                   GYILACDSSKANLSNLLFPIFGYSSTSYEELKLFYTKWSSFNTLKSFTWKDEYMYSRNY
FT                   DRRTKREINKRNEKARAKAKEEYIKTVKRYVNFIKKLDQRMKEGAKKAAEKRLADERLR
FT                   KENEMKLRKERLNNEQGAQFHLQSWQTIDQENWKELEKQYEKEFEKRNVDKDDELIGHE
FT                   FTKNQFQTNNNSQHEDVDEIIIYDCFICKKSFKSEKQLENHIKTKLHKRNLDRVQKEMK
FT                   KDSMALGLDELSDYNDFDSAESETEKLYSGMDLNDIDAELKKIEEQLAQSSVTDSEDFT
FT                   DDNNDTEDQNSLVDKLSNTNYDIEIDDEINDDTNEEVQISGADNSETQNAEQDHDSNGD
FT                   SEEEKEDELTRILRELEESKTSRSNFSDSDEEWSNKKKTKAKKKKNKANTPDKQPVTAN
FT                   KNDAKEVCGECRAEFESRNQLFSHIQTEGHVSPLSKVKKGKRSKKNK"
FT   gene            <716085..>717152
FT                   /locus_tag="CAGL0J07392g"
FT                   /old_locus_tag="CAGL-IPF2376"
FT                   /old_locus_tag="CAGL-CDS3115.1"
FT   CDS_pept        716085..717152
FT                   /locus_tag="CAGL0J07392g"
FT                   /old_locus_tag="CAGL-IPF2376"
FT                   /old_locus_tag="CAGL-CDS3115.1"
FT                   /note="highly similar to uniprot|P23202 Saccharomyces
FT                   cerevisiae YNL229c URE2 nitrogen catabolite repression
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60979"
FT                   /db_xref="GOA:Q8NJR5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NJR5"
FT                   /protein_id="CAG60979.1"
FT                   /translation="MGDSRNTGTISNLSSALRQVNIGSGQDQKNINYEFSNGLNNNVND
FT                   NGNHNLVNTNEDNVNKDGSINTNMMSRQVPIQHTHGSQLLQQERMNEQQFNPMEYSRIS
FT                   KFFQNQPMEGYTLFSHRSAPNGFKVSIVLSELGLQYNTIFLDFNLGEHRAPEFVSVNPN
FT                   ARVPALIDHGLENLAIWESGAILLHLVNKFYKETGNPLLWSDDLADQAQINAWLFFQTS
FT                   GHAPMIGQALHFRYFHTQKIESAVERYTEEVRRVYGVIEMALAERREALIMELDTDNAA
FT                   AYSAGTTPLSQSRFFDYPVWLVGDKLTIADLSFVPWNNVVDRIGINIKVEFPEVYKWTK
FT                   HMMRRPAVIKALRGE"
FT   gene            <717856..>718944
FT                   /locus_tag="CAGL0J07414g"
FT                   /old_locus_tag="CAGL-IPF2377"
FT                   /old_locus_tag="CAGL-CDS3047.1"
FT   CDS_pept        717856..718944
FT                   /locus_tag="CAGL0J07414g"
FT                   /old_locus_tag="CAGL-IPF2377"
FT                   /old_locus_tag="CAGL-CDS3047.1"
FT                   /note="similar to uniprot|P53861 Saccharomyces cerevisiae
FT                   YNL230c ELA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60980"
FT                   /db_xref="GOA:Q6FP15"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP15"
FT                   /inference="similar to AA sequence:UniProtKB:P53861"
FT                   /protein_id="CAG60980.1"
FT                   /translation="MKSLSEICQIHLMRHCNRIEGVNNVPYRLISGILEKLKLDQLRKL
FT                   ESTNVLLLLEDEELWLKLLTNNFPTNVHEIYISKKDKIINYYISYFEEHDPLLVHDNEE
FT                   LLRNWIQQCIKKNPDNGKYRLPYRMLYDKYESDMIEKQEESARRLRQQMRQIEEQRQKK
FT                   QTELIEGKSLAFGTSRRSGSNNERSELFRKSLKDHKDRLQHFKSGGFDVTRRLDDSKRK
FT                   VYNNRVAFGGGSGSINTNRSSIKVSAGNKDERIDTSNQAKPALSPGKETPKENKPIVKK
FT                   RRSEREEPSIFLKNKRPNMIRRVFDTRPSRPEHSNRNTEINTSPVRHRNDTANTSPVRH
FT                   VNVSTETPKIGKRKKSSFFNLK"
FT   gene            <719991..>721025
FT                   /locus_tag="CAGL0J07436g"
FT                   /old_locus_tag="CAGL-IPF2378"
FT                   /old_locus_tag="CAGL-CDS3202.1"
FT   CDS_pept        719991..721025
FT                   /locus_tag="CAGL0J07436g"
FT                   /old_locus_tag="CAGL-IPF2378"
FT                   /old_locus_tag="CAGL-CDS3202.1"
FT                   /note="highly similar to uniprot|P53860 Saccharomyces
FT                   cerevisiae YNL231c PDR16 protein involved in lipid
FT                   biosynthesis and multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60981"
FT                   /db_xref="GOA:Q6FP14"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP14"
FT                   /protein_id="CAG60981.1"
FT                   /translation="MFKKLTGKKEVKKVDESKLISIDKPIKSLPEEIKRPEEEKLTAEQ
FT                   QAKYDEVYKYLTNAELKVGNKEKNPTESSGLIDEERAWLTRECIIRYLKATKWHVKDAI
FT                   DRILGSLAWRREFGINHLGEENGDEVTSDLVAVENESGKQVVLGYENNARPILYLKPGR
FT                   QNTKTSHRQVQHLVFMLERVIDFMPIGQGSLALLIDFKEYSDVPKVPANSKIPPIGVGK
FT                   EVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPMTREKLVFDEPFTKYVPMDQ
FT                   LDAIYGGHLNFKYKHEVYWPALIEYSKEKREHYMKRFQKFGSKIGLSEYDLRGTHETPL
FT                   YPVN"
FT   gene            complement(<721367..>722224)
FT                   /locus_tag="CAGL0J07458g"
FT                   /old_locus_tag="CAGL-IPF2379"
FT                   /old_locus_tag="CAGL-CDS3714.1"
FT   CDS_pept        complement(721367..722224)
FT                   /locus_tag="CAGL0J07458g"
FT                   /old_locus_tag="CAGL-IPF2379"
FT                   /old_locus_tag="CAGL-CDS3714.1"
FT                   /note="similar to uniprot|P53859 Saccharomyces cerevisiae
FT                   YNL232w CSL4 3 -5 exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60982"
FT                   /db_xref="GOA:Q6FP13"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP13"
FT                   /inference="similar to AA sequence:UniProtKB:P53859"
FT                   /protein_id="CAG60982.1"
FT                   /translation="MSEHLPIDQTVFPGDLICPEIGSEKQEDKLIIYKYTPGRGCSLQK
FT                   YKYNQHSLDAIVSTVVGVVETQEIEPETTETKENNTVTTEGDTDRTVKYVEVRVVPIPK
FT                   DLEVEYKSNKDNNFANNLPKEGDVVLARVTRISAQKVNVEILAVENEPIPLDSGVGSNG
FT                   AGKVAPGGGSGASTFSVSQASSDLGETFRGMIRSQDIRATERDRVKVIESYKPGDIIRA
FT                   QILSLGDGNNYYLTTARNDLGVVFARSDNGAGGLMYAVDWQTMVSPFTGVQERRKCAKP
FT                   FEYE"
FT   gene            complement(<722608..>725538)
FT                   /locus_tag="CAGL0J07480g"
FT                   /old_locus_tag="CAGL-IPF2381"
FT                   /old_locus_tag="CAGL-CDS0476.1"
FT   CDS_pept        complement(722608..725538)
FT                   /locus_tag="CAGL0J07480g"
FT                   /old_locus_tag="CAGL-IPF2381"
FT                   /old_locus_tag="CAGL-CDS0476.1"
FT                   /note="similar to uniprot|P53858 Saccharomyces cerevisiae
FT                   YNL233w BNI4 bud neck involved"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60983"
FT                   /db_xref="GOA:Q6FP12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP12"
FT                   /inference="similar to AA sequence:UniProtKB:P53858"
FT                   /protein_id="CAG60983.1"
FT                   /translation="MSQGQMRSKNDLLNSTFYSSTSINTMDHAKTFRNSLILNVLSDNS
FT                   IANSTDKDEGNYSTIADDGGDVTYVEDNESDIAVKRDEDSNSSTLSNNESQPNRSNLLK
FT                   KNEIQTINMTTSPSLSALANILQEKSKNADKKMRNSGLLNISEDNEVVENNYTNITNSK
FT                   TVGNSLQQKPQIDLINSPNLIDIDGSQTVNYTQINSNDYDQPDFLTTPKIQPDLGNKPT
FT                   YASNLDCIQESPVQETSNLKQFEHVEIQSMPKQSRSASLPKLEPVSAEQSTITNLKIVE
FT                   AQPQIHVQPISESEVKQESQNDGGHLLEKHRDNHNGDDSNTNFANNGNKYPLTENRNFS
FT                   TTSLPYTTIHSAGQPIKRSVTNEQIKNNLLRKGPRVDPKTRATRTVSTGPVLEQISDYK
FT                   EKKGFFSFLKRKNKSSSASGDKRKNNNKTVHQQENKRAFSNSNNSVVSSPNDVNSGRKK
FT                   EPIKSQSSNTLFSNFRKKKSERNQISNDFDNNELNISKTRIVHAETESQSLLKDGSHFT
FT                   GTESEVNIRKPTPLNIDLQIKNDPELIESTTRQNDEKNDNISEYRESPAFSLPRPDAGE
FT                   ALFPKFLNSFEVDSIVSLERTRSMKSNKRSSITSHRRSLTDTLSINAQNEGMFIKEVGP
FT                   MVISTPDLTKSPASSILRNGMFEPPTISSTIESSPQPAGVVELDHSHDDYGRTQYEYEE
FT                   EQYDTNAFNVENMEAQFNQLISTDDTITNREPIPNLTKKEDLIYEEDEQLITDIMDFAN
FT                   IIDFGDELDVGLGINYNSQELLPNNNKLVESMYDQGTEKETTQQIETRAAEQKSSLTEE
FT                   NEDVFKYKIPQDRIETSLPSPPASTPGNYQVLDNKVIDPNEFENEDFNEIDDSQLEYEQ
FT                   NLHQIDENWATKLRKYEGLGLQEPALNLLQIPETGSHGIPQLKVCFSSEILLFETYGEE
FT                   EYDRRPDIATCNQLTPQLAQMIKAELNEIKDEMEIHEESKCYTHYY"
FT   gene            complement(<726663..>727961)
FT                   /locus_tag="CAGL0J07502g"
FT                   /old_locus_tag="CAGL-IPF2382"
FT                   /old_locus_tag="CAGL-CDS2538.1"
FT   CDS_pept        complement(726663..727961)
FT                   /locus_tag="CAGL0J07502g"
FT                   /old_locus_tag="CAGL-IPF2382"
FT                   /old_locus_tag="CAGL-CDS2538.1"
FT                   /note="similar to uniprot|P53857 Saccharomyces cerevisiae
FT                   YNL234w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60984"
FT                   /db_xref="GOA:Q6FP11"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP11"
FT                   /inference="similar to AA sequence:UniProtKB:P53857"
FT                   /protein_id="CAG60984.1"
FT                   /translation="MMSSETSISFMKENSSNMSDSEKNKVLEDIIGESQSLVKGSSKKS
FT                   TTSSSLMDPRMLKLELHLTEREIELIRDSWFIMLNDDLSPQTMAAFYGKLRQNKKISLT
FT                   ANLITNEKFNVMNQQYEENRKRLIKDKSIPYQISNTSTIEGSLFCAQFYENLIAMDQNV
FT                   ERMFPSIRHQAVSFSGVLNTAVDNLENIHVLDSYLRGIGKRHSRILGIKPAYFETMGKA
FT                   FIRTFQDRFGIFFTIELEDIWSRLYSYLANGMIAFGVDPVLPQSIKSTRANSLDTLRTT
FT                   SSGDASLRNSSFSKAQESDTSDFKTYMAQFNCDIVEEDDLDFPIPEILTTETSINENDN
FT                   DVDDVKDMIKNFGFNMNKAEMTHKDSIQVKKTPLDSVNPKSSASSSKDNMSTASSISEK
FT                   TRKKAVLQNKMKKKISAPIETPYKMSKRDCIIM"
FT   gene            complement(<730066..>732987)
FT                   /locus_tag="CAGL0J07524g"
FT                   /old_locus_tag="CAGL-IPF2383"
FT                   /old_locus_tag="CAGL-CDS0480.1"
FT   CDS_pept        complement(730066..732987)
FT                   /locus_tag="CAGL0J07524g"
FT                   /old_locus_tag="CAGL-IPF2383"
FT                   /old_locus_tag="CAGL-CDS0480.1"
FT                   /note="similar to uniprot|P32259 Saccharomyces cerevisiae
FT                   YNL236w SIN4 global regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60985"
FT                   /db_xref="GOA:Q6FP10"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP10"
FT                   /inference="similar to AA sequence:UniProtKB:P32259"
FT                   /protein_id="CAG60985.1"
FT                   /translation="MCELNNKRVSWSKTGLIAYADEQSTYGNLCISFLETINGVNCRFH
FT                   PPQRYVIHPQLHEVPLKTETGNGINGASGSSTAQSNIHGTTSVPGSAGKHQHQFFYDIS
FT                   SIHWNNWFSLPGDMLAVCDELGNMTMLIAGQSPDGPTTLDKLTMLFQDNVYKIHNHVMQ
FT                   LEPERENTDSKLERKKTKKEYNTTILDFHWLSSSKPVIVSQFCAFDSSINMYRNKAQQL
FT                   SPHGIFHPPFMKYAGLAIRRNGQLDFWYQFSNSKDHKKITLQLFNPHNERSKGLDFLQY
FT                   AKITSVNNDNSILITTYSRLTGKLSFYKLFVDWNVNTAKPVVLNDPSLKIKHILDATVD
FT                   QTDDEGRILDFTHVHVLAKVVAEKDAAPEVLLAYDVVGTPESLIKRFKLGQVRLPLDYL
FT                   GILKPELNTSNENHNQALRSNRSNLRFLGVLNLHHKVASISSEVLDGFVSFYYRNGEIE
FT                   IYNQNDWKLETERLLNQGPQGKFSNIITSILSAGFKYPTIKNLGTVEWIRVSPAMAGIL
FT                   YKYRHDDLPQFQPMNIDDVSDKSKDEINAATMAFGYVTSAHRQLSGEDIALACKQHILK
FT                   IAKIDEKRAKDFTTTLMFNLYNFFNFSPGAPKELMDKIISSRPLQKVMLLQLELGSIFT
FT                   DENTCEMARVILYLKNVSFAFNGVARNLQFAIEQMTNSTNSSNPPLSGDKFFQTAFSKQ
FT                   DLVHSLIPVTKWFVKFITYLIQQILILTNDPENPDNRLVLGVFGAKIPRTLILTILKEI
FT                   KNVTAIITKFPETNYPILNESSTYLKMLLIESPINFEKFETFLMDVNNKLSAFSEQQPS
FT                   IMREPTLLVRSSVPNELNKITEFLLQYSSNTVISHADASAIYFSDTSGLRISCDEFFEP
FT                   GVHRLLQPIEDGIVIDEKNMPATFRDSKTFTKLTYDGITYDRFSKEELSDNKLKRCNRC
FT                   GAVTKAGYPIPTNKTIVPTSISTRRWPTMYTRMCICLGMLYEL"
FT   gene            complement(<733686..>736055)
FT                   /locus_tag="CAGL0J07546g"
FT                   /old_locus_tag="CAGL-IPF2385"
FT                   /old_locus_tag="CAGL-CDS0838.1"
FT   CDS_pept        complement(733686..736055)
FT                   /locus_tag="CAGL0J07546g"
FT                   /old_locus_tag="CAGL-IPF2385"
FT                   /old_locus_tag="CAGL-CDS0838.1"
FT                   /note="similar to uniprot|P13134 Saccharomyces cerevisiae
FT                   YNL238w KEX2 endoproteinase of late golgi compartment"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60986"
FT                   /db_xref="GOA:Q6FP09"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP09"
FT                   /inference="similar to AA sequence:UniProtKB:P13134"
FT                   /protein_id="CAG60986.1"
FT                   /translation="MKWWNKGCIYLAYIALISKNSNAELIPAKNFTSRDYFAVESHLSA
FT                   AELSKLHPDWTFEHLVRGLDNHYVFSVAKSENEDDIDSGNSLRKRAIENEDHILSSEFL
FT                   TPSNKLQKRMPVPAPPLDSSMLPIQEIKDKIGINDPLFPKQWHLINPAFPGNDINVKDV
FT                   WLQNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDNHGTRCA
FT                   GEIAAIRNNNYCGVGVAYDAKVSGIRILSGPLTAEDEAASLVHALDVNDIYSCSWGPTD
FT                   DGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSITV
FT                   GAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAAPIAAGIY
FT                   ALVLEANPNITWRDMQYLSILSSETIENNLEDGDWQTTKLEKKYSHKYGYGKLNAHNIV
FT                   ALAKDWENVNPQVEFATDIKEVNEETDKEDKPIESTIEITASDLEKAKFRSVEHVTINV
FT                   DISTENRGTTTIDLISPFGVVSHLGVVRRKDDSNEGFRDWTFMSVAHWGELGSGEWKLI
FT                   VKTTSDDDKVEFHSWSITLFGLSEYSEQKLKEGDIPSENDDDNRKEDGPETDNNNVTEE
FT                   TGSDQQPETENPENDGDNGTDKNTGHHMTPTIPTGVHLIVSIFIIGCVFLLLHFMFFVR
FT                   TRRRIKRVRASNYDYDVIDTDAEYDSTNESSSTPLPDTFRLSDIDDNEFDISDEENTQY
FT                   NHLFNNDESLDQRLLDSDNPEQNPTGEQAQTHSSDT"
FT   gene            complement(<736677..>738077)
FT                   /locus_tag="CAGL0J07568g"
FT                   /old_locus_tag="CAGL-IPF2386"
FT                   /old_locus_tag="CAGL-CDS2276.1"
FT   CDS_pept        complement(736677..738077)
FT                   /locus_tag="CAGL0J07568g"
FT                   /old_locus_tag="CAGL-IPF2386"
FT                   /old_locus_tag="CAGL-CDS2276.1"
FT                   /note="highly similar to uniprot|Q01532 Saccharomyces
FT                   cerevisiae YNL239w LAP3 member of the GAL regulon"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60987"
FT                   /db_xref="GOA:Q6FP08"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP08"
FT                   /protein_id="CAG60987.1"
FT                   /translation="MYRLRSLIRPIRKYSMSRSLAIDEIASWDKELSKDLHHQLATTVL
FT                   KNINADDALLNKTRLQEQDVRVFNTKLSVDCTPVTNQRASGRCWLFAATNHLRVNVVKE
FT                   LQLKDFELSQAYLFFYDKLEKANYFLDQITQSHEEPVDSRLVQYLLTDPTQDGGQYSMF
FT                   LNIVKKYGLIPKDLYNDAAYSTTASRKWNSILTSKLREFAETIRETLKTKDVESKEFKE
FT                   LRTSMQKEIFRLMTLFMDLPPVKPDEKFTWTYQDKDKKVHTIESTPLEFASKYAKLDAA
FT                   KPVSLINDPRNPYGKLIKIDRLGNVIGGEETLYLNVDNKTLTDLIVKRLKNDKPVFFGS
FT                   HTPKYMDKKTGVMDIDLWNYHAIKYDLKQSKASRIEYHESLMTHAMLITAAHVDDDGNP
FT                   VRFCVENSWGKDSGKDGMYVMTPEYFEEYCYQIVVDIDELPTDLAEKFDDKEPIVLPIW
FT                   DPMGALAE"
FT   gene            <738538..>740193
FT                   /locus_tag="CAGL0J07590g"
FT                   /old_locus_tag="CAGL-IPF2389"
FT                   /old_locus_tag="CAGL-CDS1755.1"
FT   CDS_pept        738538..740193
FT                   /locus_tag="CAGL0J07590g"
FT                   /old_locus_tag="CAGL-IPF2389"
FT                   /old_locus_tag="CAGL-CDS1755.1"
FT                   /note="similar to uniprot|P23503 Saccharomyces cerevisiae
FT                   YNL240c NAR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60988"
FT                   /db_xref="GOA:Q6FP07"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP07"
FT                   /inference="similar to AA sequence:UniProtKB:P23503"
FT                   /protein_id="CAG60988.1"
FT                   /translation="MSALLSEDYLNDYISPALACTKPTEIKKEKFVTEDGEFQVGVEPQ
FT                   ELEKVTISLSDCLACSGCITSSEEIMLSQQSHSVFLDAWRELGFDKCGSAGDAQCTNKL
FT                   VVSISPHCRASMARYYGVDVDAADYAILRVFKEVFHATSVIGDGAGRLLSVKRVVEELM
FT                   ERRKASQGTALSSICPGFLIYTEKTKPKLVPMLLNVKSAQQVTGALFKEIALEEGYDVD
FT                   TSLKDGKRTNVQYHLTIVPCFDKKLEASRPDGEGEVNCVITPREVLAMLGEMGVSFRKY
FT                   LGDWASLDKQLQQSQLGMLRAEMSPAGWDPLLHWSIPANGDGYSDGYAYQYACTVRDAH
FT                   VASGCAAQVVSVPGKNADVLEYRVVEPSSEGGKVIARACVLSGFRNIQNLCRKLDPSGH
FT                   KKRSVRRVAALRSRGRKDSSSEDSTGTPSAISNALGGTANPAECDYVEVSACPSGSING
FT                   GGLLMELAPEREEMGETPLPSSTIGGNARRRQQQLQELQAMYKAQIRITDETPTSLPPA
FT                   ALPPLPPQYTMQYTFYIQEEDPAKPDIVTVGNTW"
FT   gene            <740949..>742451
FT                   /locus_tag="CAGL0J07612g"
FT                   /old_locus_tag="CAGL-IPF2392"
FT                   /old_locus_tag="CAGL-CDS2076.1"
FT   CDS_pept        740949..742451
FT                   /locus_tag="CAGL0J07612g"
FT                   /old_locus_tag="CAGL-IPF2392"
FT                   /old_locus_tag="CAGL-CDS2076.1"
FT                   /note="highly similar to uniprot|P11412 Saccharomyces
FT                   cerevisiae YNL241c ZWF1 glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60989"
FT                   /db_xref="GOA:Q6FP06"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP06"
FT                   /protein_id="CAG60989.1"
FT                   /translation="MSEPVKFEKNTVVVVFGASGDLAKKKTFPALFGLFREGYLHESTK
FT                   IIGYARSSLTVEELTERIKPHLKTPRGKEDEAKIPQFFKLLTYVSGPYDQDDGFIRLRE
FT                   QIETFEGAKCSTVPHRLFYFALPPSVFLPVATNIKRLVYAENGVTRLIVEKPFGRDLET
FT                   ARKLQADLSPLFKEEEIYRIDHYLGKELVKNLLVMRFGNQFLNSAWNRDNIQSIQISFK
FT                   EPFGTEGRGGYFDNIGIIRDVMQNHLLQVLTLLTMERPVSFDPEAIRDEKVKVLKAMAP
FT                   FDPKDILIGQYGKSEDGSKPAYLDDETVKPGSKCVTFAAIAFQIENERWEGVPIVMRAG
FT                   KALNEGKVEIRLQYKAVASGVFKNIPHNELVIRIQPNEAVYMKFNAKTPGLSNATQVTD
FT                   LDLTYSSRYKDFWIPEAYEALIRDALLGDHSNFVRDDELDVSWSLFTPLLNYLEGPDAP
FT                   QPEIYPYGSRGPSGLRDYLKKHNYMIEEKHPYTWPVTTPDED"
FT   gene            complement(<743067..>747830)
FT                   /locus_tag="CAGL0J07634g"
FT                   /old_locus_tag="CAGL-IPF2395"
FT                   /old_locus_tag="CAGL-CDS0086.1"
FT   CDS_pept        complement(743067..747830)
FT                   /locus_tag="CAGL0J07634g"
FT                   /old_locus_tag="CAGL-IPF2395"
FT                   /old_locus_tag="CAGL-CDS0086.1"
FT                   /note="similar to uniprot|P53855 Saccharomyces cerevisiae
FT                   YNL242w SPO72 required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60990"
FT                   /db_xref="GOA:Q6FP05"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR026849"
FT                   /db_xref="InterPro:IPR026885"
FT                   /db_xref="InterPro:IPR026886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP05"
FT                   /inference="similar to AA sequence:UniProtKB:P53855"
FT                   /protein_id="CAG60990.1"
FT                   /translation="MAFWLPQNIQRRLILYVLQQITLFSNVDITKLDVSLGSHSKFTFQ
FT                   DVDLNISEMNISGCEVNSGMLGKLMLGLTVSGDVHISGDNIDFMITMINEDDFNDMNSF
FT                   SLAKSFYDLTSSIMQFKPDAHLKNEISGSGSDSPRIPDDYTNPSSAGGNPTTNTYDIIV
FT                   DDTASSTTESDDSSPIDSIPTSRFNIMQQKVIATALAKLKITLQSVRIRINLGKRKDCN
FT                   CLDVVVKRIDMSTSEGHVRNFDANGISIAYINNEPSVVPPNNMDMAESLYFSQADASSI
FT                   YMSALSDANTDIKSLDASVFNSERYELLSINGMSFSFVGISSIDDFAISRIKINLGTLQ
FT                   VNIPFLLKVREDIILTMIFKLISPRHTDKVDVKNSPAYKRFQNELHSNDTNLFSNLAIE
FT                   EILIGLSSNQKIILRAVDLESNEINGINLSVGDIDLVGLDMDWISETRPCFNASFGKSN
FT                   TIIELANTIIRVSEHDLILFLKIYYEIMDFIDFVLSKWKILGVKQVSQLRNDEKFSLNV
FT                   GSLVIEIPLDNSILEINIPNIEHDSLNQDLKLYEVNMTHIVESIKISSLKLKEVSIDLS
FT                   SARKKMKCYNEHFSQYFVFTHYKVQITGIDSQINLKSLWIIGAVIEQFYIASPVQEYPE
FT                   ATNKNSVRFHDNNKRLLSTSLMINKRAILAKYIIELDDIKVCISGFDADQIRHCKFSLQ
FT                   RLLFLNQIDKGLLFNIFQPHVEIKFFSGSLNDIIRSTNIGVSGQPHLILCIFADKKIKV
FT                   SIKDIMIFYQAKWLDSVQRNASLDQEKGQNVEYSELPEFSISIRDSAINFLPFRINPSL
FT                   VILFESIIVTKSGNDALINMHSKVGRFYLTDNYDHLKTTQVMNKTICDSLIKSGYSQIG
FT                   KFEGLSMTLNKKHKIVNCNGCLEKVILSVCSDSFHTLVQLCMDLKVPVTFPDDKKYQPV
FT                   PSVAVDLFETIEENEFNLSNLDNKDIDKSIGSDSDSLHIVNSFLDEVEDFQFHEDYNSG
FT                   TVWSHTTSDTHSSSDILPISLKEEYLDSRRTEVQKHSQSNDRNIISEIDFDIKNADIRL
FT                   YDGYDWRYTRKNVSSAISELEEGLLSGIQRQEQTESELSRTTVFDSICIATKQKDLGNL
FT                   KQIISEQVQGKHDHLNSDKVYLYPSKHYKSLIKANELIFKIKIYDSNSPRNEEFNNHAA
FT                   KLFQITASISTYEVLDNLPTSTWNKFVTLLKKEAWPKSEPMLYFDFMLFKPINSLEATE
FT                   ATINIRSAPLRIHADQYMVDFLLRFFQFNDKRFELIDEYPEILFLQKFKSNTIKLRIDY
FT                   KPNKTSSGMYSGKISDLINLFVLDESKVTLKGVVLHGINGFNELSEQLVKIWGNDVTSK
FT                   QIFNILQGFAPVKSFIALGAGAQTFITVLLAEYKRDRSISRSVKKSGNIFIKTTTGDFI
FT                   KLGAKLAVGTQALLENTEGILSGNATQNRTLADVSQTNKVLDLDSLLQQDQVLIGRNPK
FT                   IRNKSPSAIIIDAADLEESGRPKVVSLYSEQPLDLHKGLEEAYHALEKHIQIAYNTIWQ
FT                   TNQELRGEESRSAKAAAVTIAKAAPVAVIRPMIGATEAIAKTLQGIYNQLDKSNIEEIN
FT                   DKYKKEDN"
FT   gene            complement(<748336..>751194)
FT                   /locus_tag="CAGL0J07656g"
FT                   /old_locus_tag="CAGL-IPF2396"
FT                   /old_locus_tag="CAGL-CDS0506.1"
FT   CDS_pept        complement(748336..751194)
FT                   /locus_tag="CAGL0J07656g"
FT                   /old_locus_tag="CAGL-IPF2396"
FT                   /old_locus_tag="CAGL-CDS0506.1"
FT                   /note="highly similar to uniprot|P33338 Saccharomyces
FT                   cerevisiae YNL243w SLA2 cytoskeleton assembly control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60991"
FT                   /db_xref="GOA:Q6FP04"
FT                   /db_xref="InterPro:IPR002558"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR030224"
FT                   /db_xref="InterPro:IPR035964"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP04"
FT                   /protein_id="CAG60991.1"
FT                   /translation="MSRKSSEADLQKILKKACSIDESAPKRKHVRACIVFTWDHASARA
FT                   VFSALKSMPFTDHEIQLFKLLIVLHKVIQEGHPSALAQAIKDREWIRSLGRINIGHSPY
FT                   TKLVKEYVRFLMLKLDFHATHKGFKNGTFEYEEYVSLINVSDLDEGYETVLDLMTLQDQ
FT                   LEDYSQIIFASIHSERDSSELRIAALIPLVAESYGIYKFITSMLRGLHAQLNDAEGDAA
FT                   LQPLIEKYDLQHARLFEFYADCSSIKFLTTMVTIPKLPTKAPDVLVDNSNDIETTRKTP
FT                   TPQPKKTPTPEVRKPSPGPREQLKPTRTASTANTLSPMFTANVMIPTVTGAVQQAFPQQ
FT                   QQQIQPDFWVNQQAQLAQEQQRLAQERQQQLALQQQQQEEFQRQLQQTQQEMMNMQMQQ
FT                   QSQHQNDLIALTNQYEKDQALLQQYDQRVQQLEEEISNIDKNANEQIDNKNEQIGSLQD
FT                   QLEMWEKKYESLAKLYSQLRQEHLQLLPRFKKLQIKVGSIQEAVANKEVLEQKLKKKDL
FT                   QLIDAIKERDRLRLDNERLISNKSEDLNSDGVEKFADDRVLPMLDAVLLSGINTIQESV
FT                   FNMDNSLSWSGPLAPASFLLALADNTSERATEFATNFNNLIVDGLVNGDQTAVIHSVSD
FT                   FSVSIATLVTYVNAYTTSLLGENDSESIASMAKKCAREAEFFFEDLLSENLMPYDDEGK
FT                   TDVVINSNVNFQEKLQHLTTTIEKVLQSAPQNKNKEQDPHSQLIATADAIVKSSQPLRI
FT                   TPNVPKPLLTLALAIIDAVVALVQAAVQCQNEIATTTNTPLSQFYKKNSRWTEGLISAA
FT                   KAVGGATDILISTAGELVTDDKEGSPERFAVAAKEVAASTIQLVAASRVKSGVHSKAQE
FT                   KLEECSRAVTEACKELGHTVLVKYNSEAQDDQPMEFTSEHQLKTVEMEQQVEILRLEQS
FT                   LNIARKKLGEIRKHAYFTEQDE"
FT   gene            <752132..>752458
FT                   /locus_tag="CAGL0J07678g"
FT                   /old_locus_tag="CAGL-IPF2397"
FT                   /old_locus_tag="CAGL-CDS5381.1"
FT   CDS_pept        752132..752458
FT                   /locus_tag="CAGL0J07678g"
FT                   /old_locus_tag="CAGL-IPF2397"
FT                   /old_locus_tag="CAGL-CDS5381.1"
FT                   /note="highly similar to uniprot|P32911 Saccharomyces
FT                   cerevisiae YNL244c SUI1 translation initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60992"
FT                   /db_xref="GOA:Q6FP03"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005874"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP03"
FT                   /protein_id="CAG60992.1"
FT                   /translation="MSIENLKSFDPFADTGDDETAASNYIHIRIQQRNGRKTLTTVQGV
FT                   PAEYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIK
FT                   IHGF"
FT   gene            <753062..>753592
FT                   /locus_tag="CAGL0J07700g"
FT                   /old_locus_tag="CAGL-IPF2398"
FT                   /old_locus_tag="CAGL-CDS4624.1"
FT   CDS_pept        753062..753592
FT                   /locus_tag="CAGL0J07700g"
FT                   /old_locus_tag="CAGL-IPF2398"
FT                   /old_locus_tag="CAGL-CDS4624.1"
FT                   /note="similar to uniprot|P53854 Saccharomyces cerevisiae
FT                   YNL245c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60993"
FT                   /db_xref="GOA:Q6FP02"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP02"
FT                   /inference="similar to AA sequence:UniProtKB:P53854"
FT                   /protein_id="CAG60993.1"
FT                   /translation="MGTGDLNLLKSWNPKLVKNRKKVWEKEQRLLEEDEKIRKRQLEIA
FT                   KEKEEEELLAGRDSTKGRKTGLEWMYQDDPTAKEDYLLGKKKLDTTVIKKAEVMEENQT
FT                   PLTKINKTTVIPDAIYSKEDPMARFGTKVKRNKVVKKEPVKPLRGKTTNEPRTDNIKPK
FT                   SDYKKRLQEELDY"
FT   gene            complement(<753637..>754425)
FT                   /locus_tag="CAGL0J07722g"
FT                   /old_locus_tag="CAGL-IPF2399"
FT                   /old_locus_tag="CAGL-CDS3901.1"
FT   CDS_pept        complement(753637..754425)
FT                   /locus_tag="CAGL0J07722g"
FT                   /old_locus_tag="CAGL-IPF2399"
FT                   /old_locus_tag="CAGL-CDS3901.1"
FT                   /note="similar to uniprot|P53853 Saccharomyces cerevisiae
FT                   YNL246w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60994"
FT                   /db_xref="GOA:Q6FP01"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP01"
FT                   /inference="similar to AA sequence:UniProtKB:P53853"
FT                   /protein_id="CAG60994.1"
FT                   /translation="MSDKEIVGKAFLDLAKYEEDVAKVEDDIEHYRLKMMQPMVERRDN
FT                   IIKNIPEFWKIVLSQHTSFADFIRASDFKYIDLIDKVKVDWLIIEDPKQYSVGDFRITL
FT                   HFNSIDDDFNEQTVSKVFKLIKGDINEGDTDDETEEERLVSEPVDIQWPKSYDSINPSL
FT                   IEDKHSKEGKKSYRQGMKSFFGWFKWTGKKPGKEFPHGDSLATLFSEDIYPYCVKYYTE
FT                   AQRDLEDEEEDDSEDNSSEEPLDLEVESESEESDKKRRKI"
FT   gene            complement(<754822..>757188)
FT                   /locus_tag="CAGL0J07744g"
FT                   /old_locus_tag="CAGL-IPF2401"
FT                   /old_locus_tag="CAGL-CDS0840.1"
FT   CDS_pept        complement(754822..757188)
FT                   /locus_tag="CAGL0J07744g"
FT                   /old_locus_tag="CAGL-IPF2401"
FT                   /old_locus_tag="CAGL-CDS0840.1"
FT                   /note="highly similar to uniprot|P53852 Saccharomyces
FT                   cerevisiae YNL247w cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60995"
FT                   /db_xref="GOA:Q6FP00"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP00"
FT                   /protein_id="CAG60995.1"
FT                   /translation="MVNWSVLKRTVMSAANSKVVQPKWINPAQCSERTQAPVLKLYNSL
FT                   TRSKEVFAPSSGTKTVSWYSCGPTVYDASHMGHARNYVSIDINRRLIQNYFGYDIQFVQ
FT                   NVTDIDDKIIIRARHNYLFEEFVKQNDSETPLNESDEIVKKANDATISYINKNLADVLG
FT                   SSQESVNTFLVAAEKVNHEEAKLKDPKFPMHMTSVQNAISALSNVSKLPRRKFFDGVKD
FT                   VLVPVLDKELGSTINDPEIFRKLPAYWEKQYDSDMAALNVIPPNVTTRVSEYVPEIVSF
FT                   VEDIINNGYAYATNDGSVYFDTVRFDQNEKHDYAKCQPWNKGKLDLINDGEGSLSNFDN
FT                   NGKKSANDFALWKGSKPGEPAWDSPWGKGRPGWHIECSVMASDILGSNIDIHSGGIDLA
FT                   FPHHDNELAQSEAKFDNKQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALQKYTPRQL
FT                   RLAFASVPWNNQLDFKESLIHEVKSFETSMNNFFANVRAHYNDYKSSLEDDSIIVSKKL
FT                   TNLEKDLLEEFKKSQEKVHAAFCDNLSTGQALKTLSDLVTTTNTYITNSGKDLKIEPVI
FT                   SICKYITKILDIVGFPGRPDGLGWVAQASSVSSGSESANQISGSIEEIAMPYVKCLSTF
FT                   RDSVRSMAIAKAQPQEFLKLTDTVRDNDLLNLNVSLDDRNGQSALVKFLTQHEKDEIIK
FT                   LNAEKKQREEEKLKKKLEQQKIKEAKEKERQEKAKVSPLEMFKDTTLYSAWDEQGLPTK
FT                   DKDGNDITKSMTKKLKKQWEQQKKLYEEFNGPLSS"
FT   gene            <757665..>758888
FT                   /locus_tag="CAGL0J07766g"
FT                   /old_locus_tag="CAGL-IPF2402"
FT                   /old_locus_tag="CAGL-CDS2718.1"
FT   CDS_pept        757665..758888
FT                   /locus_tag="CAGL0J07766g"
FT                   /old_locus_tag="CAGL-IPF2402"
FT                   /old_locus_tag="CAGL-CDS2718.1"
FT                   /note="highly similar to uniprot|Q01080 Saccharomyces
FT                   cerevisiae YNL248c RPA49"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60996"
FT                   /db_xref="GOA:Q6FNZ9"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="PDB:3NFF"
FT                   /db_xref="PDB:3NFG"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ9"
FT                   /protein_id="CAG60996.1"
FT                   /translation="MGEKRSIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQ
FT                   FVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSKFSKNLK
FT                   GPEIKSKGDTRYGAMRNALGEAFGTKKAKKAIADLERNRVDSDKLTDVAIDIVDSVKTA
FT                   SKDLPTRAELQENVSASNRPTPVANLDATDVEQIYPVENIIPKKELQFIRVGPILKEKD
FT                   QEKKLELFPYTSSKYVAKKLETLTQASQMEKLQLLYYLSLLLGVYENRRVSNKDKLLER
FT                   LNSPPELLIDGILDRFTIARGGHFGKSKNRSYFIDPQNEDKLLCFILTIVMHLDNFLVE
FT                   ISPLAQELGIKPSRIVNLFRILGAIVKGATVSQAEAFGIPKSAAATYKIASLKVPFKLP
FT                   ELTRRGRR"
FT   gene            complement(<759175..>763092)
FT                   /locus_tag="CAGL0J07788g"
FT                   /old_locus_tag="CAGL-IPF2403"
FT                   /old_locus_tag="CAGL-CDS0188.1"
FT   CDS_pept        complement(759175..763092)
FT                   /locus_tag="CAGL0J07788g"
FT                   /old_locus_tag="CAGL-IPF2403"
FT                   /old_locus_tag="CAGL-CDS0188.1"
FT                   /note="similar to uniprot|P12753 Saccharomyces cerevisiae
FT                   YNL250w RAD50 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60997"
FT                   /db_xref="GOA:Q6FNZ8"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ8"
FT                   /inference="similar to AA sequence:UniProtKB:P12753"
FT                   /protein_id="CAG60997.1"
FT                   /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIE
FT                   CLKYATTGDLPPNSKGGVFVHDPKITGEKDVRAQVKLAFTSTNGLSMIVTRNIQLLAKK
FT                   TTTTFKTLEGQLVAINKSGERTTLSTRSVDLDSHVPLYLGVPKAILEYVIFCHQEDSLW
FT                   PLSEPSNLKKKFDEIFQAMKFTKAIDNLKAIKKEMAVNIKLLTQSVEHLRIDRDRSRAT
FT                   KMKVKQLNEKINDYQSQVDDVEQELESINGSLDSLFKSNQNFQSVLSRIETLNASISAA
FT                   STQIERLSNSIEKLDMPKVDLENLLKNFSESIEQKELDVKRLESKIASDRQKLENCQKQ
FT                   SNRLMLQQGELTAKKLQNENTLKSFQDTIRQIKDEHKLDLNAEEPPQRNVDHILKKKAD
FT                   MESSVNEAISKLEETKMNLKEKSDSIRNSINLEEQKLSYYESDIKQLATKLDQKQKQIS
FT                   SIPADIEEQLKAKKAVWSKLSKELQEFEKENNITDINNQIKSNNEELSKSELLAQQIET
FT                   DLQNYSKKSELSTKLSVLIENMDEKQNEINKITTALLNDTMIKEWGLDDVKQLSFEFKT
FT                   HYIALQKNIATNLKAFNEISKSQTELEYELNTCKGKVNNLQHKKEKLILNINSVLPEDC
FT                   SIEDYDDVLLETEVSYKTALENLKMHQTTLEFNRKALEVAINNDCCYLCSRSFENTEFR
FT                   SKILKELKEKTDTKFEESLKTTLEDEKEYLNNLRLAEKDIYNLNSISSESKALQDRISQ
FT                   LSKELDNKKSEVAEANTTIEKLKEKRDHCDNYIKPKMDKIDYLQKEIYNHEEEKNSLND
FT                   VIRSSAENGDSVTMEQLQDNQKSTRELIWKIRSEIESLQEQRENISSKNNTLINQIRQA
FT                   NDDVAEIEKQFDMKVTIQEQIANDKKHIEELTNSKESIKLHINDLSKSVEMLNKENSEK
FT                   ISTLDKDAKRKKGEFQSFNELVLQVNQLHHQLMQYNTSDEQHLQECERSIKELEKEMNI
FT                   LKNGLEADNHVLNEQSQKLYDSTGEKRNLLQNIELIDLKEQLLSMNNELSSLNAQNAEA
FT                   ERDKYQQESARLRTQYERLSAQNAGKLGEIRQIQNQIDSLTQQLRSDYKDIDDKYQKEW
FT                   VELQTRSFANDDIDTYSKALDSAIMKYHSLKMEDINRIIDELWKRTYTGTDIDTIKICS
FT                   DEVGSTTKGKSYNYRVVMYKQDAELDMRGRCSAGQKVLASIIIRLALSETFGINCGVIA
FT                   LDEPTTNLDEENIESLAKSLHNIIEFRKHQKNFQLIVITHDEKFLNHMNAASFTDHFFR
FT                   VKRDDRLKSLIEWVDINKVTE"
FT   gene            <764042..>765856
FT                   /locus_tag="CAGL0J07810g"
FT                   /old_locus_tag="CAGL-IPF2404"
FT                   /old_locus_tag="CAGL-CDS1483.1"
FT   CDS_pept        764042..765856
FT                   /locus_tag="CAGL0J07810g"
FT                   /old_locus_tag="CAGL-IPF2404"
FT                   /old_locus_tag="CAGL-CDS1483.1"
FT                   /note="similar to uniprot|P53617 Saccharomyces cerevisiae
FT                   YNL251c NRD1 involved in regulation of nuclear pre-mRNA
FT                   abundance"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60998"
FT                   /db_xref="GOA:Q6FNZ7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ7"
FT                   /inference="similar to AA sequence:UniProtKB:P53617"
FT                   /protein_id="CAG60998.1"
FT                   /translation="MSGDSEHQEFVETLESFHDLKTGISGSRIKKLTTYALEHVASEEQ
FT                   LISLIINYSRTCESSHKLGSLYIIDSIGRAYLDEARSGTVDTPAPAGTAAHAVATLGEV
FT                   IQELLSDALEKSNQDHKEKIKLLMDIWDRSALFQKECINSVRNKFFPTPTSSANKSIDD
FT                   DMVQLPNDPSERADKILETLKPIDIVPAVSLPSGLFSDVEHDQKRALVQLLVSIQKQYE
FT                   EDPRLSKQDSAAQPVPQSRRDENRQSRHVITEYGSRREREREREKNNRRNRSRSPKRDT
FT                   MNYGGDSAPSRYQNMPPVNNSNYNLGAPNMNFGVNNHHLYPDEVNVPANPHYRNKTVTF
FT                   EPSIPPDHIKVYSRTLFLGGVPMNMKEWDIANVLRPYSEVQSVILNNARKHAFVKVYSR
FT                   QEAENALLNFNKDGSLPLRTRWGVGFGPRDCCDYQHGFSIIPLHRLTDADKKWSVSAQW
FT                   GGTGGQPLTSGIAFEEPDIVVGEGVSSKAISQKMPTDSGRNGPRSNKAKNMAPQYGPPQ
FT                   AAVISPSQGYAGMQQGYPQQQQQQQMGMYGQPMMQQPINAYASPAQQQPIMQAPPPPAP
FT                   PSQQQQSSNYDPTAQLNSLMNILNQQQQ"
FT   gene            <766589..>767386
FT                   /locus_tag="CAGL0J07832g"
FT                   /old_locus_tag="CAGL-IPF2406"
FT                   /old_locus_tag="CAGL-CDS3871.1"
FT   CDS_pept        766589..767386
FT                   /locus_tag="CAGL0J07832g"
FT                   /old_locus_tag="CAGL-IPF2406"
FT                   /old_locus_tag="CAGL-CDS3871.1"
FT                   /note="similar to uniprot|P36528 Saccharomyces cerevisiae
FT                   YNL252c MRPL17"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG60999"
FT                   /db_xref="GOA:Q6FNZ6"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="InterPro:IPR040008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ6"
FT                   /inference="similar to AA sequence:UniProtKB:P36528"
FT                   /protein_id="CAG60999.1"
FT                   /translation="MLSVRGLATAAKATGSPAVKVGLILSRVPLVSPEKSELESSYYKY
FT                   MSELERRLMWTFPAYFYFKKGTLSEHRFYAAQKGPISKQEGVWFPKGVPDIKHGRERSQ
FT                   KQTINLPKSKQQEGQASDDISRPIIANSIVTEADKNNDLTSLERSLRRTLYLLIKDKKG
FT                   IWKFPNFDIGEEKSLHRAAEKGIREIGGENMNTWTVSRTPAAVLKDDPKSSQFLIKSHI
FT                   LMGRFDIQDKRILSDFAWLSKDEIKGKVEKNYYEKISFLLSDI"
FT   gene            complement(<767587..>768885)
FT                   /locus_tag="CAGL0J07854g"
FT                   /old_locus_tag="CAGL-IPF2408"
FT                   /old_locus_tag="CAGL-CDS2539.1"
FT   CDS_pept        complement(767587..768885)
FT                   /locus_tag="CAGL0J07854g"
FT                   /old_locus_tag="CAGL-IPF2408"
FT                   /old_locus_tag="CAGL-CDS2539.1"
FT                   /note="similar to uniprot|P53851 Saccharomyces cerevisiae
FT                   YNL253w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61000"
FT                   /db_xref="GOA:Q6FNZ5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ5"
FT                   /inference="similar to AA sequence:UniProtKB:P53851"
FT                   /protein_id="CAG61000.1"
FT                   /translation="MPATAIDSFNNISSKSHEYVNVVENVAVKFLQSAFENEHINAIED
FT                   DRYNHVITRIQSRFKNSLTPNEILAFEFHPAGHSLAYSRIDGSITIWPSIQATFIPGKM
FT                   IHIKDACGTDKLVTSISWNPNEITQLITSCNSDELDIWEYDELNLKASKVRSISVDHKT
FT                   KLNNALFDPTGEYILAITKSDSIYLFSAKDDYRLLHTIKLKSIMSSDTLYSVTWDSSGS
FT                   NIFLGTKNGSIIAMSINKENNEMFKVLEVTAHRFSVTCLKIDPLGRYLFSGSKDGSCSI
FT                   WELRTLICIKEISGLESNILSMDICHLGKMLGLCLEDERVCFCDVTTGKIIYESSLSGS
FT                   NSEPLLRFFPDKTMFILSGKNDTLEKHFYGSGKLSLLSVLSTESRKNGDSKGHSKGISK
FT                   KSSKKSNTDREKSQGPRSTRPNRKSRFLASKRR"
FT   gene            <769398..>770417
FT                   /locus_tag="CAGL0J07876g"
FT                   /old_locus_tag="CAGL-IPF6757"
FT                   /old_locus_tag="CAGL-CDS3250.1"
FT   CDS_pept        769398..770417
FT                   /locus_tag="CAGL0J07876g"
FT                   /old_locus_tag="CAGL-IPF6757"
FT                   /old_locus_tag="CAGL-CDS3250.1"
FT                   /note="similar to uniprot|P53850 Saccharomyces cerevisiae
FT                   YNL254c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61001"
FT                   /db_xref="GOA:Q6FNZ4"
FT                   /db_xref="InterPro:IPR028094"
FT                   /db_xref="InterPro:IPR039024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNZ4"
FT                   /inference="similar to AA sequence:UniProtKB:P53850"
FT                   /protein_id="CAG61001.1"
FT                   /translation="MEDSIDLQRESLNKLIPESGSDDTSSSDEVNGLPTSSDGADDVSL
FT                   INSEDLNSSLLKSDPGGTNKSDQTKNDETDSNDDQRIVLSGGVELEEVQETVKVYNNVK
FT                   QALLEVETTDESQLILDKIKRDSQYSSDTECESRDADSELEDIQLEFRSKYPQLQIPYS
FT                   DELCVKIIPYLDIVYDILSGVVTSMYYTRAKRAAMDSKKAFLSAEDFRNLDINLFTAGY
FT                   FGLRRQLKVGNIIYEKFRDELARSKSPKIQWWGPIDFANYVLAPEVLVSFVLDTCQNKR
FT                   SVQLTSRQDVYELFDNTTYYGNTVTDNEPLESWELSRKKRKYGPTNNQKTHKTRKKKS"
FT   gene            <770997..>771464
FT                   /locus_tag="CAGL0J07898g"
FT                   /old_locus_tag="CAGL-IPF6755"
FT                   /old_locus_tag="CAGL-CDS4780.1"
FT   CDS_pept        770997..771464
FT                   /locus_tag="CAGL0J07898g"
FT                   /old_locus_tag="CAGL-IPF6755"
FT                   /old_locus_tag="CAGL-CDS4780.1"
FT                   /note="highly similar to uniprot|P53849 Saccharomyces
FT                   cerevisiae YNL255c GIS2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61002"
FT                   /db_xref="GOA:Q6FNZ3"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ3"
FT                   /protein_id="CAG61002.1"
FT                   /translation="MSQKACYVCGKIGHLADDCDSERLCYNCNQPGHVQSECTMPRTVE
FT                   HKQCYNCGETGHVKSECSIQRCFNCNQTGHVSRECPEPRKGRFGAASKNVSCYKCGGPN
FT                   HVARDCMQTDTKCYSCGRFGHVSRDCPNGPNEKVCYNCNETGHISRDCPVL"
FT   gene            complement(<771900..>774323)
FT                   /locus_tag="CAGL0J07920g"
FT                   /old_locus_tag="CAGL-IPF6753"
FT                   /old_locus_tag="CAGL-CDS0793.1"
FT   CDS_pept        complement(771900..774323)
FT                   /locus_tag="CAGL0J07920g"
FT                   /old_locus_tag="CAGL-IPF6753"
FT                   /old_locus_tag="CAGL-CDS0793.1"
FT                   /note="similar to uniprot|P53848 Saccharomyces cerevisiae
FT                   YNL256w FOL1 Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61003"
FT                   /db_xref="GOA:Q6FNZ2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ2"
FT                   /inference="similar to AA sequence:UniProtKB:P53848"
FT                   /protein_id="CAG61003.1"
FT                   /translation="MSTLVVDKHASDRDHVHVIKLEASAHMGPDMWGQPTEQRCNITMN
FT                   MGTDFSKSSETDDLKYSLNYAVICKDMLKYIGLKNNRWGSVGAMTRDVAQFAMDSWLGI
FT                   NNLNLEVNVPSVHIRSKDIACEVNRSRAAVTEDLQDFIKIQNLRLLTLIGVFTFERKEK
FT                   QFVDLDIKIPWPRNREHHISIKKIVDKIVQHVENSNFKTVEALAENICGIIGHDSYFGH
FT                   NLKDLPISVKVIKLNAITDTEGVGVSCVRKPSELPHYDQKPFSNRSDPKSLDDSFNLPV
FT                   GTNVPLIEGAWNTAFLAFGSNIEPRRQQVERAINLLRENPNVKVKGFSSYFESEPMYFK
FT                   DQSPFLNGCIGIETTLSPHELLELCKDIEYTKLGRVKKFNNGPRTIDLDIIFYLSESGE
FT                   HVLVNDTDLTVPHPRMLERTFVLEPLCELLHPEFTHPVSAEPVFNHLENIYDNENPEDI
FT                   LWKLIPLPSKDGESEKFLKFKNVKVYDEILGISRWRTQSSALAMGVVNTTPDSFSDGSE
FT                   SYLDVNEKVEKVKKMINDGLRLSEQLIVDIGGCSTRPGSTQVSEEEEIERTIPLIKAIK
FT                   ACSDIPFDKVLLSIDTYRSKVAQSAIECGIDIVNDISAGSFDPTMFDVIANNPQIAYVL
FT                   SHIRGDIATMSTKTTYGEPDGTHYVNGRKNTSESTVLIRNIGKEMADRYCLAMKKGVQR
FT                   SQLILDPGIGFAKNAKQNLQIIKQTSLLKNYSYVQDNLSVNFRNIPVLVGPSRKKFLGT
FT                   ITKEDDPSKRDSATSSIAATCVGFDADIIRVHNVRECIQSIKLANELYRSATLT"
FT   gene            <774882..>778616
FT                   /locus_tag="CAGL0J07942g"
FT                   /old_locus_tag="CAGL-IPF6752"
FT                   /old_locus_tag="CAGL-CDS0215.1"
FT   CDS_pept        774882..778616
FT                   /locus_tag="CAGL0J07942g"
FT                   /old_locus_tag="CAGL-IPF6752"
FT                   /old_locus_tag="CAGL-CDS0215.1"
FT                   /note="similar to uniprot|P38717 Saccharomyces cerevisiae
FT                   YNL257c SIP3 SNF1P or uniprot|P38851 Saccharomyces
FT                   cerevisiae YHR155w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61004"
FT                   /db_xref="GOA:Q6FNZ1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR039463"
FT                   /db_xref="InterPro:IPR042067"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ1"
FT                   /inference="similar to AA sequence:UniProtKB:P38717"
FT                   /protein_id="CAG61004.1"
FT                   /translation="MAPLEEHHNQRQLRLISVAFKEASIDSPSFRATVNFFHTRVDIFE
FT                   EWIDKSMAFYEKKYTHSYDDFKRTQNSLLSQLLPSPSMLSSGLVSNQGYTPSLVSNFLF
FT                   DFTEYSERIIKALKGNDILNSTPLSELISVAIDPYKACRKSFDYYQTKYDSMLSTFQAA
FT                   NIREVSIDPETTKNDTIHIFTLQKSYIQASLDLIEAIYTLRLQIDKFLLDTMNNMKSDS
FT                   IYSPKDGSRPLDLMPSMNEYMKDYTMWVQNAIDGARALERDIENAKKQAYEYTLSHITP
FT                   SEDINDYDIRTISTNTFVDQNIHINKTPEKSGWLFMKTYVGTPSREIWVNRWCFLQNGV
FT                   FGTLLLSPSKTYVEETDKFGIFLTNIRYKPEEYRKFCFEMKIFNGNNSASQDKRKMIEL
FT                   VFQASSLKELKSWINAFETTRKVVSQLDKNSLNYEIAYKRFSPKYIEFASSTTTKIDQQ
FT                   ITTFDDTTESLFQKYKCAFSEYEVLSVGSEKIFNFQTIITPISTKMTNLAFLADNSVYG
FT                   SYCTNAVVANIWGTTYWSDYSLILSTVPMNEERTTSKPTTRLVSPHDKIIYPKFYPNAM
FT                   KFYDLQFKNLFFSIDQRLSKITEEFLLFKFDAFWCPNKKQKFASTCYLTQYNLYSFINS
FT                   VGFICLTKVNLDDLVSIEKDKATRTLIRIYDSSGLQLRVNVLFTDPEAVALKLQYLLEK
FT                   KASGTNDSIMEIFARFSEIDKEMEEKRNLERANSDSSESVYDSQLVGSKHDHELTFWNI
FT                   TKESAELLNKRKMLQKESSVYFSHNYDIPCKGLMHLLFGDESQAFPKSLFLARKNGTQH
FT                   VNWYWKQKRTNKTGDVILSRKIEFVVDMTDNFLTTSKYSDNNVEELSLEQNIVKAIDNK
FT                   YYEIDQTPVRIKLPFARIMKITTKYIISEAYDPEKSTSENKSKSPRNGSCFQLFFNIDF
FT                   LDCKSGNPVKDLHFLERVYLDWAIHFAGTEFFLFRKVIRFYLEKMGKHGKVIKAMRLCG
FT                   LIGVSDEATNETEKHEVITEKDIGTNKDVNVDPIVDRKQYDARYTLNIISKVLLKRLVY
FT                   RVSNLFFFLFRVIISLFLGSSTVVQSLNRYLLFGLLLSIIVNLYLSGRSTLNFWSVHNA
FT                   EKKFNNFMSDSGKFTMQRSIKIDDLDLLTEYLAIDENNRAYNKFQEYLHDIDHDFKYKT
FT                   TRKDLAVKRNELLVELRILQNMERELVQGEYKRFLLEEVDRCEQALREVPDLFTNDENI
FT                   KSYCENCNDELTRVSRLLL"
FT   gene            <779482..>781719
FT                   /locus_tag="CAGL0J07964g"
FT                   /old_locus_tag="CAGL-IPF6750"
FT                   /old_locus_tag="CAGL-CDS0954.1"
FT   CDS_pept        779482..781719
FT                   /locus_tag="CAGL0J07964g"
FT                   /old_locus_tag="CAGL-IPF6750"
FT                   /old_locus_tag="CAGL-CDS0954.1"
FT                   /note="similar to uniprot|P53847 Saccharomyces cerevisiae
FT                   YNL258c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61005"
FT                   /db_xref="GOA:Q6FNZ0"
FT                   /db_xref="InterPro:IPR021875"
FT                   /db_xref="InterPro:IPR021876"
FT                   /db_xref="InterPro:IPR038442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ0"
FT                   /inference="similar to AA sequence:UniProtKB:P53847"
FT                   /protein_id="CAG61005.1"
FT                   /translation="MTYADKDHVITELLKDPVYLSRHNSLATHPKDENDLYALETKLEE
FT                   ELHDLKDLKIVSSLVKETQVNLDLMELENCYYSLYNLSKKLKSSRSFLKQSLHFQRSVA
FT                   VHVDELRIKLLSTIYDILATKFWSISESSFEFHPDIKWKEEEFMMKYEEFKSFVSKSFF
FT                   PDNAINNSHWLITDIIHSEEQERMRNKLKDIYINYIDFASLTKAVKDALFSDEYEFEWS
FT                   DNNYTKLLITKRGALCIQKRIESFNNLLSFLEKGISNSDKFKLLTNLGKAIGIEFLRFV
FT                   KSNATGIIDKNANSIKQQTLLLNDRLKTISEQSGAWNFDSDQISKLLNDEILYKSLLLD
FT                   GVLGRAISDVRKLIANESWKSKTKITLKNSEMLNDSKEKEISQDNVGDEWEWNEEEMDD
FT                   DVHNSTSKVPNSKSEDLNDDEDGWADEIDVDLEDEINTKETEPEDDAWNDEWDVEEDIK
FT                   STHSNKNSKSKHFINTTEEVTITELPKKFLNIMEKLLEDARAIDVNLPLTEDFKYKANL
FT                   LQTVFFSISSTKYGNEWWQFYNDMKFTFDQNNDMKRLQELIYNYMETNLQNTKKISKRI
FT                   LSSQLQQFQRNENNPSWNDTLDNFLPFLEEELANITTHITQEDSFRYITRLFSFIFEDV
FT                   IIQNILSWDIISEKNSENISELLKLIITSTQIDSLNTYPKYRELYERVNIVAKLLPLHL
FT                   KEIMEMFYNGDFYLFATEEIITWIKLLFAETPLRKDAIDDIYEIRNTPTED"
FT   gene            <782059..>782283
FT                   /locus_tag="CAGL0J07980g"
FT                   /old_locus_tag="CAGL-IPF13715"
FT   CDS_pept        782059..782283
FT                   /locus_tag="CAGL0J07980g"
FT                   /old_locus_tag="CAGL-IPF13715"
FT                   /note="similar to uniprot|P38636 Saccharomyces cerevisiae
FT                   YNL259c ATX1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58047"
FT                   /db_xref="GOA:B4UN31"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN31"
FT                   /inference="similar to AA sequence:UniProtKB:P38636"
FT                   /protein_id="CAR58047.1"
FT                   /translation="MSENQNHYQFDVVMTCSGCSSAVERVLKKLEPDVSHIDISLPQQT
FT                   VDVYTTLPYETILEKIKKTGKEVKSGTTL"
FT   gene            <782640..>783128
FT                   /locus_tag="CAGL0J07986g"
FT                   /old_locus_tag="CAGL-IPF6748"
FT                   /old_locus_tag="CAGL-CDS4717.1"
FT   CDS_pept        782640..783128
FT                   /locus_tag="CAGL0J07986g"
FT                   /old_locus_tag="CAGL-IPF6748"
FT                   /old_locus_tag="CAGL-CDS4717.1"
FT                   /note="similar to uniprot|P53846 Saccharomyces cerevisiae
FT                   YNL260c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61006"
FT                   /db_xref="GOA:Q6FNY9"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY9"
FT                   /inference="similar to AA sequence:UniProtKB:P53846"
FT                   /protein_id="CAG61006.1"
FT                   /translation="MNTDELLFLEEQFYQEGYEEGRNENLKNNLIEGKEFGLQVGFQRF
FT                   VLLGQMVGMCDVLDSLQLKNNSLFKNIANVRELISSIELNNKEENVESLEKTLVKLKNK
FT                   FRLILLSFQREFKHNDRKPINFDNFEDLSRAIAGEIKGFVEDEDATDAKTTQDQAQAW"
FT   gene            complement(<783310..>784728)
FT                   /locus_tag="CAGL0J08008g"
FT                   /old_locus_tag="CAGL-IPF6747"
FT                   /old_locus_tag="CAGL-CDS2238.1"
FT   CDS_pept        complement(783310..784728)
FT                   /locus_tag="CAGL0J08008g"
FT                   /old_locus_tag="CAGL-IPF6747"
FT                   /old_locus_tag="CAGL-CDS2238.1"
FT                   /note="similar to uniprot|P50874 Saccharomyces cerevisiae
FT                   YNL261w ORC5 origin recognition complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61007"
FT                   /db_xref="GOA:Q6FNY8"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY8"
FT                   /inference="similar to AA sequence:UniProtKB:P50874"
FT                   /protein_id="CAG61007.1"
FT                   /translation="MSKSNLVVLFRDYQLELLDSLIDVDSTLTTPNLILQGYSGTGKTL
FT                   TLRKVFELKPDIINVWLDPIEVVSWKPLFQAIARSTQQRLMQKYPGLQDKEYDPMAVEE
FT                   PSFLVKYLIKLFSHYKELPEKIPLYIVYDGFDSLQDLDSQILYKLLKLHELLPNDNAIV
FT                   MKSIYTVRDLNFVNRYSSNAIPMVVFPRYNLDEIIKILILTRAQELVGSSFLVMQLELL
FT                   DECEYTNESLEKVAVNFIQLIVQAFHSYTGNDIYALNDLIDFKWPLYLKNLDKNNILDP
FT                   LALYRANVRLFITTDDSLKNDFNDTYEDYSDTAMTQTYELSNISKYLLIAAYFCSYIET
FT                   KFDIGIFSKRGSKAANSKRKKKEQNPRYLQPSFFYIERLLAIFQSIYPLEIEVPKGSLA
FT                   ALKVDDLMKSNVEVFQNLAELFSLKLITCSSSKNLDVLGNKIKWRVNIPWEIISEIASS
FT                   VSFDISEYFSGVHD"
FT   gene            complement(<785064..>791717)
FT                   /locus_tag="CAGL0J08030g"
FT                   /old_locus_tag="CAGL-IPF6745"
FT                   /old_locus_tag="CAGL-CDS0021.1"
FT   CDS_pept        complement(785064..791717)
FT                   /locus_tag="CAGL0J08030g"
FT                   /old_locus_tag="CAGL-IPF6745"
FT                   /old_locus_tag="CAGL-CDS0021.1"
FT                   /note="highly similar to uniprot|P21951 Saccharomyces
FT                   cerevisiae YNL262w POL2 DNA-directed DNA polymerase epsilon
FT                   catalytic subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61008"
FT                   /db_xref="GOA:Q6FNY7"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="InterPro:IPR029703"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNY7"
FT                   /protein_id="CAG61008.1"
FT                   /translation="MSTARFKRGNGQAGSLSNGYAVTAQQLLQAAKVDDIDAMMGFERY
FT                   VPPQYNGRVDPDRLDQVPGRTGWLVNMHPTLISEEIASGGGSDYNPSAAGIAGVDFYFL
FT                   DEEGGSFKSSITYDPYFFVTVTDDARLNDVEEFLKKYLETCLKDISTLKKEDLKLDNHL
FT                   LGLQKSLIKLSFVNSNQLFEARKLLRPILAENESNKQQRNVFKHSNISNGNGMLSSNVN
FT                   RFASSSVQDKKDAKQYIEDIREYDVPYHVRVSIDKDIRVGKWYKVTHEGFFVWPDKVAF
FT                   ADPVVLAFDIETTKAPLKFPEASVDQVMMISYMIDGDGFLITNREIISEDIEDFEYTPK
FT                   PELQGHVTIFNEVDELAVLQRFFEHIRDVRPTVISTFNGDFFDWPFIEKRASVRGLDMF
FT                   EEIGFAPDSEGEYKSSYCVHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPEL
FT                   MTPYAYERPQQLSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTLCE
FT                   MLLMVQAYQGNILLPNKHTDPLERFYDGHLLESETYVGGHVESLEAGVFRSDLATEFKI
FT                   DTSAIDELIEDLPHALKFAVEVENKAKMEDVTNFEEIKEQIKEQLLELKENNKRHEKPL
FT                   IYHVDVASMYPNIMTTNRLQPDSIKTEKDCASCDFNRPGKSCARRLKWAWRGEFYPAKS
FT                   DEYNMIKRALQNETFPNKNKFSKKPYLTFDELSYSEQVAHIKKRLTEYSKKVYHRIKVS
FT                   EIVEREAIVCQRENPFYVNTVKSFRDRRYEFKGLAKKWKGKMSSIDRNDKHGKDEANKM
FT                   VVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARALVERVGRP
FT                   LELDTDGIWCILPKSFPENFFLKLENGKKLFVSYPCSMLNYRVHQKFTNHQYQELVDPV
FT                   KHKYETHSENTIFFEVDGPYKAMILPTSKEEGKGIKKRYAVFNEDGSLAELKGFELKRR
FT                   GELQLIKNFQSDIFKVFLDGKTLEECYASVAAVSNRWLDILDNKGSMLEDEDLVSLICE
FT                   NRSMSKSLKEYEGQKSTSITTAKRLGEFLGEDMVKDKGLQCKYIISSKPHGAPVTERAI
FT                   PVAIFSSDINVKRSFLRRWTMDHSLDNFDIRTILDWGYYRERLASVIQKIITIPAALQN
FT                   VPNPVPRVEHPDWLKRRIAVKEDKFKQSKLERFLSKSSQEPQNRRIKDIEELFHEDDDI
FT                   KRIKLAKVTSRNKNKRNRDVQKNDEESLVLPATMPSMEEDYVSWLSYQKIKWKIQRRDR
FT                   IRRTQLFGKSGETNSRSVLGSMIRKQAEMFANGSWEVLQYRDNYEAGAVDAYVIINGKV
FT                   QVLKIYVPRTLYINFKTDSVPLKKIKNCEVERSNAILPNDARINNDSASPLFKLTLSEQ
FT                   VYLDELEDSGSVLNDESVLGIYESHISPAQKALMDLGTTISFKSKKVGSLGKSLQDGFH
FT                   LKDLTSVGNDRYLSHFDLNVCYLLHIDTNIDYEFFVIFRSWENKLSIFVKKPSNNAQEL
FT                   LESTIIGIFKEQYHKRKDRITKFNKYINLSDNVDMNSNHYTDKKKLFKAINQEFAMIKE
FT                   QKGQQVLLLMQSPFPSLIKKNIRYSTQIPIIELSMNILALPQLNWQNVMINKLCSYIIS
FT                   TSYWVSHLVSLSQHSNVPICNINLEKMDFVIDVIYARRLKLDNIILWWNEQSPLPDHGG
FT                   MENDFDQNTSWIMNDLDFPNINVPDVYDNVVLEVSIENLVVNTILCSTLINEAEGSDLV
FT                   DMNTVDVSDKPVGNNQGIVQDSFSHDALAVLKSLLKEWWDRALEKNITADLLVNSLVSW
FT                   VYSTDSKLFDGSLRYHIHNLTKKSLFQLMNEFNELGSFIVSADRNRLLIKTNKISPETC
FT                   YAYSHYMIKSIRSNPMFTYLDLNIERYWDLLIWMDKYNFSGLSCSQIEEREKQDYTAYS
FT                   NWQIKYYLPRIYQSEFEDWAMIILDSMVKTKRAFLESSYGTQRATQIVTGLTPQSDTED
FT                   ISPLSSFSKEIGKPLLQRVNKLFRNQREFILDPGFSEDYAFPILPGSHIKMDDPLLEFI
FT                   KSLFQILLLSKSTTLEVRQLRKEVLKFLEIREFAKEAEFQNPSDSLVINGILCEYCSYV
FT                   SDLDLCRDGLDGKFQCPRCDKSINDSLLQEHMIQNLAIEYQTYITQDLRCEKCHTVKRD
FT                   LMSTNCNCSGNWVCTTKPEKLSNIVKIYKQVAEFYNYSLVKNALESLY"
FT   gene            <792654..>793583
FT                   /locus_tag="CAGL0J08052g"
FT                   /old_locus_tag="CAGL-IPF6744"
FT                   /old_locus_tag="CAGL-CDS3530.1"
FT   CDS_pept        792654..793583
FT                   /locus_tag="CAGL0J08052g"
FT                   /old_locus_tag="CAGL-IPF6744"
FT                   /old_locus_tag="CAGL-CDS3530.1"
FT                   /note="similar to uniprot|P53845 Saccharomyces cerevisiae
FT                   YNL263c YIF1 SLH1P Interacting Factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61009"
FT                   /db_xref="GOA:Q6FNY6"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY6"
FT                   /inference="similar to AA sequence:UniProtKB:P53845"
FT                   /protein_id="CAG61009.1"
FT                   /translation="MSYNPYSFQGEATANDRFRHGSQPSMEQGQPLFGAQQASQQQMPP
FT                   QQQQQQQQPGFNFQNPTQSMAFQLGQSAFSNFIGEQNFSQFQETVSKATSANGSLSLYF
FT                   QVTTNYVINKLRVILIPFTNKNWQRIPEAQQGSNGALSFMPPKDDINSPDMYIPIMGLV
FT                   TYILIWNTQQGLKGSFNPENLYYKLSSTVAFVLLDLVILKLGLYLLVSTNSRTTNIVEL
FT                   ICFVGYKFVPLILALFLPSSPIYLKMIVQVYLFIAFGVFLLRSVKFNLFTNTNSDMVTF
FT                   NKATVRKCNYFLFVYGFIWQSILMWLMG"
FT   gene            <794667..>795710
FT                   /locus_tag="CAGL0J08074g"
FT                   /old_locus_tag="CAGL-IPF6743"
FT                   /old_locus_tag="CAGL-CDS3182.1"
FT   CDS_pept        794667..795710
FT                   /locus_tag="CAGL0J08074g"
FT                   /old_locus_tag="CAGL-IPF6743"
FT                   /old_locus_tag="CAGL-CDS3182.1"
FT                   /note="similar to uniprot|P53844 Saccharomyces cerevisiae
FT                   YNL264c PDR17 involved in regulating phosphatidylserine
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61010"
FT                   /db_xref="GOA:Q6FNY5"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY5"
FT                   /inference="similar to AA sequence:UniProtKB:P53844"
FT                   /protein_id="CAG61010.1"
FT                   /translation="MGIFSRKKKEATPVNRGDLIPCETMIEAPPKGSPPPKKPADLDAE
FT                   QTKKLAQMLEHFNKPDLVLPVSSTDDTGKTRPISSWEKFFLTRDCFLRYLRAQKWDVPK
FT                   AIKMLTETLVWRREVGITHGEEDEHPLKPEDIAVENETGKEILLGFDYDRRPLFYMKNG
FT                   RQNTESSFRQVQQMLFMMECATTLTPQGVEKMCVLVDFKHYKEPGIITDKAPPISIAKM
FT                   CLHIMQNHYPERLGKCILINIPWFIWAFLKMMYNFLDPATKEKVIFDEPFTNHIDPSQL
FT                   EATYDGRLDFKYNHAVYWPDMNAKIEAIRNKQYERFQKFGAVMGLSEWDLKGDHDELVY
FT                   PVDSIKA"
FT   gene            complement(<796151..>797149)
FT                   /locus_tag="CAGL0J08096g"
FT                   /old_locus_tag="CAGL-IPF6742"
FT                   /old_locus_tag="CAGL-CDS3309.1"
FT   CDS_pept        complement(796151..797149)
FT                   /locus_tag="CAGL0J08096g"
FT                   /old_locus_tag="CAGL-IPF6742"
FT                   /old_locus_tag="CAGL-CDS3309.1"
FT                   /note="highly similar to uniprot|P53044 Saccharomyces
FT                   cerevisiae YGR048w UFD1 ubiquitin fusion degradation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61011"
FT                   /db_xref="GOA:Q6FNY4"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="InterPro:IPR042299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY4"
FT                   /protein_id="CAG61011.1"
FT                   /translation="MFSGFGFGNTGSVPIPQEFEDFFRCYPIAMMNDRIRKDDANFGGK
FT                   IFLPPSALNRLSMLNIRYPMLFRLTSNESGKVTHGGVLEFIAEEGRVYLPQWMMETLNA
FT                   QPGSLMKINSTDVPLGQFVKIEPQSTDFLDITDPKAVLENVLRNFSTLTIDDIIEISYN
FT                   NKTYRIKVLEVKPESAAKSICVIETDLVTDFAPPVGYVEPDYKALKAEQDAKRKSAAID
FT                   PVKHSQGSMATRINYSNILNSTDSETIRFAGEGQKISGKPNKTSKGKQDISEIKISLDS
FT                   EPARLDLPEGQLFFGFPLVLPKDENADEEENDKKVFIGEGQSLRKSKKSKK"
FT   gene            <797953..>798978
FT                   /locus_tag="CAGL0J08118g"
FT                   /old_locus_tag="CAGL-IPF6741"
FT                   /old_locus_tag="CAGL-CDS3739.1"
FT   CDS_pept        join(797953..797985,798106..798978)
FT                   /locus_tag="CAGL0J08118g"
FT                   /old_locus_tag="CAGL-IPF6741"
FT                   /old_locus_tag="CAGL-CDS3739.1"
FT                   /note="similar to uniprot|P53843 Saccharomyces cerevisiae
FT                   YNL265c IST1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61012"
FT                   /db_xref="GOA:Q6FNY3"
FT                   /db_xref="InterPro:IPR005061"
FT                   /db_xref="InterPro:IPR042277"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY3"
FT                   /inference="similar to AA sequence:UniProtKB:P53843"
FT                   /protein_id="CAG61012.1"
FT                   /translation="MSKAMQQAPYNIRLKTCLKMCIQRLRYAQDKQQALAKQGRREVAQ
FT                   LLGNSKEQKARYRAESLIHDDLHIELLELLELYCELLHARVNILSNIENEVSLIESHTD
FT                   DGINEAVRALVYCTLAAPEVRELTQLRDLLILKFGHEFAKVIIDEKVGVPPKVLKKCDI
FT                   NLPNQDLVDLYLKEIARTYDVPFSLLTDSEDSSSGSDSENESDGGNFKVEEENKKGETD
FT                   KDGKPILAVNNGEEFTGDSEHPIKIRKPRKNSDTLKSELKIPKDVKKSVEVKHSKPKSI
FT                   AKKKDDELEALKKRFDALRR"
FT   gene            complement(<799207..>802329)
FT                   /locus_tag="CAGL0J08140g"
FT                   /old_locus_tag="CAGL-IPF6740"
FT                   /old_locus_tag="CAGL-CDS0387.1"
FT   CDS_pept        complement(799207..802329)
FT                   /locus_tag="CAGL0J08140g"
FT                   /old_locus_tag="CAGL-IPF6740"
FT                   /old_locus_tag="CAGL-CDS0387.1"
FT                   /note="highly similar to uniprot|P39104 Saccharomyces
FT                   cerevisiae YNL267w PIK1 phosphatidylinositol 4-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61013"
FT                   /db_xref="GOA:Q6FNY2"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY2"
FT                   /protein_id="CAG61013.1"
FT                   /translation="MNIIENRPKNQNQASEEVIEAVNSPTFNVHRCIELLCKNANNIGI
FT                   HFFLCQRLENFPHSELQFYIPQLVQILLTIETESMALEDLLLKLRTENPHFALLTFWQL
FT                   QALLTDLSTDPESYGFQVARRVLNSLQANLFSTDVSEIEKKTKMHENVAPALVMSSMVF
FT                   SCMALPQLAESIEPLVRSQGRRQKSYVFKLAKNLMKDFTRNMTLKNTLHNKSHKKKTKH
FT                   ITQAAPVDIINPTTTKEDVMFRKSKSTEINLDFDMVDNVGQKVFEERISTSIRMPKRKT
FT                   RPTDGMQRTSTDTSIRTLGTSKPQRLRGFDAVSSPEESPRVSQTNTGQNSDESDEETDS
FT                   ESRIPMKTDRFISSMPDLIGNKPRNSGSSYTSLAKSSGGLSRSHSQSVKHDATRNYTNT
FT                   DSRFKELDPSKIPTTVKIKMLKANYFRCETQFAIALETISRSLAQVPTEARLSALRAEL
FT                   SLLNRDLPACVDIPTLLPPNKKGKLHKLVLITANEAQVLNSAEKVPYLLLIEYLRDEFD
FT                   FDPTTPENEEIIKKGNNHSNLIFDLNYITKNRKKFDEDTIFSSTDAIPSKNSRHASSTP
FT                   GEDTSKSNSSVNLLKEEDLGDMSMIRVKNLSDAEAYRSSLVLKRASNVPVLPTDSHDRT
FT                   PELNFSSTMQEFINQGNNLSDSFKSQTDDLADQMRVSAVMLAQLDQSPQQLSETTNQIR
FT                   AQIIASMKEVQDRFGYKDVENLHGKAGERKLENDLITAGISSSYLGEDWATKKERIRKT
FT                   SEYGHLENWDLCSVIAKTGDDLRQEAFACQLIQAMAQIWTSERVDVWVKRMKILITSAN
FT                   TGLVETITNAMSVHSIKKALSKKMIEDGELDANGGIATLKDHYLRMFGDPEGFKFKRAQ
FT                   DNFASSLAAYSIICYLLQIKDRHNGNIMIDNEGHVSHIDFGFMLSNSPGSVNFEAAPFK
FT                   LTYEYVELLGGLDGAPYKKFVQLTKDSFKALRKYADQIVSMCEIMQKDNMQPCFNAGQQ
FT                   TSIQLKQRFHLELTEEETDAFVDNFLIGRSLGNIYTRLYDQFQLLTQGIYS"
FT   gene            complement(<803679..>805472)
FT                   /locus_tag="CAGL0J08162g"
FT                   /old_locus_tag="CAGL-IPF6738"
FT                   /old_locus_tag="CAGL-CDS1525.1"
FT   CDS_pept        complement(803679..805472)
FT                   /locus_tag="CAGL0J08162g"
FT                   /old_locus_tag="CAGL-IPF6738"
FT                   /old_locus_tag="CAGL-CDS1525.1"
FT                   /note="highly similar to uniprot|P32487 Saccharomyces
FT                   cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
FT                   cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
FT                   cerevisiae YNL270c ALP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61014"
FT                   /db_xref="GOA:Q6FNY1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY1"
FT                   /protein_id="CAG61014.1"
FT                   /translation="MKFRNILKNEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATE
FT                   ATHKKKTGSTGFDDTISLTHTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIA
FT                   LGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVF
FT                   SKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLM
FT                   NFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRYWRNPGAMGAGII
FT                   SSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVLFYI
FT                   MSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTVISAANS
FT                   NVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVNHNANTAFNW
FT                   LINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVII
FT                   FIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDIDSDRREID
FT                   AIVWEDDEPQNLWEKFWAAVA"
FT   gene            <806631..>808349
FT                   /locus_tag="CAGL0J08184g"
FT                   /old_locus_tag="CAGL-IPF6732"
FT                   /old_locus_tag="CAGL-CDS1653.1"
FT   CDS_pept        806631..808349
FT                   /locus_tag="CAGL0J08184g"
FT                   /old_locus_tag="CAGL-IPF6732"
FT                   /old_locus_tag="CAGL-CDS1653.1"
FT                   /note="similar to uniprot|P04817 Saccharomyces cerevisiae
FT                   YEL063c CAN1 or uniprot|P38971 Saccharomyces cerevisiae
FT                   YNL270c ALP1 or uniprot|P32487 Saccharomyces cerevisiae
FT                   YNL268w LYP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61015"
FT                   /db_xref="GOA:Q6FNY0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY0"
FT                   /inference="similar to AA sequence:UniProtKB:P04817"
FT                   /protein_id="CAG61015.1"
FT                   /translation="MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSV
FT                   SSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGA
FT                   LVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTF
FT                   ALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMG
FT                   FLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQG
FT                   TELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS
FT                   SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT
FT                   TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQ
FT                   ALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVG
FT                   LFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA"
FT   gene            <809506..>815202
FT                   /locus_tag="CAGL0J08206g"
FT                   /old_locus_tag="CAGL-IPF6730"
FT                   /old_locus_tag="CAGL-CDS0042.1"
FT   CDS_pept        809506..815202
FT                   /locus_tag="CAGL0J08206g"
FT                   /old_locus_tag="CAGL-IPF6730"
FT                   /old_locus_tag="CAGL-CDS0042.1"
FT                   /note="similar to uniprot|P41832 Saccharomyces cerevisiae
FT                   YNL271c BNI1 regulator of budding"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61016"
FT                   /db_xref="GOA:Q6FNX9"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR042201"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX9"
FT                   /inference="similar to AA sequence:UniProtKB:P41832"
FT                   /protein_id="CAG61016.1"
FT                   /translation="MLKGSNSKSSDGSGSGSNSGLFQNLRRLTTKDRDNRNKSPKRTSL
FT                   DNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGS
FT                   NHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNL
FT                   SRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVK
FT                   QDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPS
FT                   TYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSK
FT                   DEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFF
FT                   KCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES
FT                   VLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGS
FT                   LVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNK
FT                   IKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENE
FT                   KTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRL
FT                   YDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRI
FT                   LAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKIGSIEA
FT                   SEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTN
FT                   FAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDER
FT                   VNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQDKL
FT                   DEITKISEELLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVS
FT                   DLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM
FT                   RGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLLATSAVSPTTSAPPPPPPPMPAG
FT                   LFGANNDNNTGDSDAISVSGTPAPPPPPPPPPFLKDSSPIPPPPMPTMLTPSESTTSLS
FT                   SIPPAPPMMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQ
FT                   KAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMY
FT                   SNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIE
FT                   DAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDK
FT                   AVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYV
FT                   EKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSS
FT                   KFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQ
FT                   KFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDE
FT                   EEESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGG
FT                   DSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKT
FT                   LLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDEKSPDEEQEEVS
FT                   SSSISTTGIVTAQESPVQIDENED"
FT   gene            <815653..>817911
FT                   /locus_tag="CAGL0J08228g"
FT                   /old_locus_tag="CAGL-IPF6727"
FT                   /old_locus_tag="CAGL-CDS0932.1"
FT   CDS_pept        815653..817911
FT                   /locus_tag="CAGL0J08228g"
FT                   /old_locus_tag="CAGL-IPF6727"
FT                   /old_locus_tag="CAGL-CDS0932.1"
FT                   /note="similar to uniprot|P17065 Saccharomyces cerevisiae
FT                   YNL272c SEC2 protein transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61017"
FT                   /db_xref="GOA:Q6FNX8"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="InterPro:IPR040351"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX8"
FT                   /inference="similar to AA sequence:UniProtKB:P17065"
FT                   /protein_id="CAG61017.1"
FT                   /translation="MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINK
FT                   QKHVMHEFETLKQKNKELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVED
FT                   LTASLFDEANNMVSDARREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVD
FT                   SESSINANIRSPISTENSTTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLY
FT                   NEFLKFLAVLPSSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMM
FT                   EGQVVVEPLSGINEAYQLGYETKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPCAFCAEQ
FT                   RDDIIEHARMYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWH
FT                   LEKVTLNTISKGESLSKFSEVTKSTNGSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVET
FT                   HIDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPITDHPTHSQEL
FT                   LLPVLSESESLNMLEEYVPANDSESFNLKKTETSNTFDFEKSSNDAVDISSNQDINSQT
FT                   KVAPDVNENLKGQPSTGEASTIEPVNIKVDPATIGANVDAKKKNAISGNTLDTAKDTDN
FT                   LSKDKMEAKMIEKDTTEDSKKTTKSSKRTSEIIDQLNDIGSDAKELFGTVEESGKESQS
FT                   DDKQSDKHLNSDETKNGDATMPNEDDMTLDAKEVMRGLNDDDADSSSLDNFDDSKEFQ"
FT   gene            complement(<818234..>821764)
FT                   /locus_tag="CAGL0J08250g"
FT                   /old_locus_tag="CAGL-IPF6725"
FT                   /old_locus_tag="CAGL-CDS0259.1"
FT   CDS_pept        complement(818234..821764)
FT                   /locus_tag="CAGL0J08250g"
FT                   /old_locus_tag="CAGL-IPF6725"
FT                   /old_locus_tag="CAGL-CDS0259.1"
FT                   /note="similar to uniprot|P53840 Saccharomyces cerevisiae
FT                   YNL273w TOF1 topoisomerase I interacting factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61018"
FT                   /db_xref="GOA:Q6FNX7"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX7"
FT                   /inference="similar to AA sequence:UniProtKB:P53840"
FT                   /protein_id="CAG61018.1"
FT                   /translation="MSDTESPLTVLKARIALLATAIGGPDYTSQIDPPPYQIGDDCLAC
FT                   LKDLKRWFRLVDDNQRRWDVAMAVAEYKILTDDLLPILIDWENKCYLATKLSKGNSDIS
FT                   AHFKNKQYYDKIALNCLQLMVLMTWPLILTEQSSTNQINLYSELKKHQLTYKKAILSVE
FT                   NGKVLKAAIRIAIDVIKLDRLARTPRDNMVLKMVLNFIRNILAIEPGELTITARKNIAS
FT                   KGINSVDTLPPNVTQDDISQSTVISCFKKNKVFPFLLTLGSSMTKEFDQDFINIPLMEV
FT                   MFFLTKDISQDSLLFKSGELDTAQSENHLSKAGQELNDLLQKESQLKKKVIMNTSTRHS
FT                   RFGAMLSIQTLDQKRLTVSGSQNLLDNSKALQKIDDSKKSKGRRPMIRNETDNESLPTN
FT                   LLNVHKKSGTYLPLTISKYLNDFINDFIDSSFNYLLKSVTNYFVTEEDKIISLEKIEYL
FT                   LFFAWFNKYQILRCQVDKDADIMMISESIKETTFILVSSLLRSSYDSKAWAVVHSSMLA
FT                   FNELLKLVNSLKKFEDNEDIEYVLSRLFSDERIQLLSNLPRIASTHSLSFMKTSIELTH
FT                   TVLKILEMYSGDNSLVVESKRRAKKMKSISKEDYERLVNEEGYDPDEAIEILNPGHKTI
FT                   VINFKRVQSSFFHRNTIDLYINTLKRFNELEYSHIKMIISFLYRLFVENNEETLFYRLD
FT                   FIILLKDMLKQDGLPRTSKARTHINDFAKYYLSRLKRKLKSSPAWHVGILFPPLNDGVV
FT                   GYFQKYGEHKMTKESEIYAVQPSQFIPFEQQEMMSENMILDMQIGVLVSTLIDEGSQNL
FT                   VELVRENVQHLIAVFTSHLEVAGENEKTPNNEAFILKEEYDVNPLHYNRHIRALLQLVG
FT                   FEIPILKSDPCFYRGTTEFSRLVKCEESITKYLNIPFETPNGLPSSSYLKQQSEKNNSL
FT                   ESDGWKGNEDYDYTDPNIVPDNEVDDNDYFKDLDKSTNIRKEKRTVGIASKKTQSKNKT
FT                   SRNRKKASFRLPNAIEGKDKQPQENLEVFSKEYISDSDEDDEEILNPVFFENEMYMRWL
FT                   LDKYNGQLPNDKFLSFGRFVNERLSNNGKVVSDFTSLFDGPVPPIDALPLEGITRKGPD
FT                   KTLLTLSRVEINESNQDNENTQVNEQVDETSENLTINKNARNIGISHGHVESEADDDEP
FT                   ITKKRRTSAN"
FT   gene            <822590..>823642
FT                   /locus_tag="CAGL0J08272g"
FT                   /old_locus_tag="CAGL-IPF6724"
FT                   /old_locus_tag="CAGL-CDS3154.1"
FT   CDS_pept        822590..823642
FT                   /locus_tag="CAGL0J08272g"
FT                   /old_locus_tag="CAGL-IPF6724"
FT                   /old_locus_tag="CAGL-CDS3154.1"
FT                   /note="similar to uniprot|P53839 Saccharomyces cerevisiae
FT                   YNL274c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61019"
FT                   /db_xref="GOA:Q6FNX6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX6"
FT                   /inference="similar to AA sequence:UniProtKB:P53839"
FT                   /protein_id="CAG61019.1"
FT                   /translation="MAKPIILRLGSLTFAQPQWKEVEEIADVITVDDSMTREQFLKELK
FT                   NPESKLSKVSVITRTVGSASQTGLFDEEIAKALPDSVIAICHTGAGYDQIQVQYFKERH
FT                   IQVANVPEIVSNATADTHVFLLLGALRNFAYGHHNILAGKWQEVTSAAETPFGYDPDGK
FT                   TVAILGLGRIGRAIVDRLKPFGFGKFIYHNRHRLPEDEENGCEYVASIDDFYQQADVIS
FT                   INIPLNTHTKHLVNKEAFDKMKEGVVIVNTARGPVVDEKALIAALKSGKVRGAGLDVFE
FT                   DEPHIPKELLELPQVLTTPHMGTHSVQTRWRMEKLVLDNAISALKTGKVITPVPEIQND
FT                   NWIEEIQPVI"
FT   gene            complement(<823820..>825613)
FT                   /locus_tag="CAGL0J08294g"
FT                   /old_locus_tag="CAGL-IPF6723"
FT                   /old_locus_tag="CAGL-CDS1524.1"
FT   CDS_pept        complement(823820..825613)
FT                   /locus_tag="CAGL0J08294g"
FT                   /old_locus_tag="CAGL-IPF6723"
FT                   /old_locus_tag="CAGL-CDS1524.1"
FT                   /note="similar to uniprot|P53838 Saccharomyces cerevisiae
FT                   YNL275w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61020"
FT                   /db_xref="GOA:Q6FNX5"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX5"
FT                   /inference="similar to AA sequence:UniProtKB:P53838"
FT                   /protein_id="CAG61020.1"
FT                   /translation="MIIKRHSNMVKQPANLQATSINSMESSLRQPADGPYDLSSTPSDI
FT                   DGEKSALDSDEDSHKSKRRFPKPGIGIWLDLKDRLPWYWQDWTDSWDYRVIPSVVETYF
FT                   NNLLPAIAFAQDMFDRTDNAYGVNEVLLASAMGGIVFGALSGQPLCIVGVTGPISIFNY
FT                   TVYDIIKPLNTNYFGFMFWVYIWSMIFDLILAFGNAVCLLQYVTTFPCDIFGLFINIVY
FT                   LQKGVQILTHQFKDKNGNDDPAAGFANVIVAMAMTVFGTFFKLIKMTPLLTPKLRTIIS
FT                   DYSNALSVLFWSSFIHFGGYLNNVDFQKLPITKAYHPTSGTYRDRSTWLAYESIPVRDV
FT                   FIALPFGIILTLLFYFDHSVSSLMAQKEEYKLKKPSSFHYDFALLGLTTGVSGVLGIPA
FT                   PNGLIPQAPLHTETLLVHDKDEKVIRCVEQRFTNTAQGGLMLVTMSRGLLVCLGQIPQA
FT                   VLSGLFITMGIQGLTGNQIIHRLIWLFTEERKKDKSKLLQNVPKKKLILFLTFSLIGFA
FT                   GEFAITDTIAAIGFPIILLLTVVACLLFPYMFTKEELDILDSNVAQEFTIKNLLMKNIR
FT                   NANFFSNKDEVETDVEHVSSI"
FT   gene            complement(<826640..>828139)
FT                   /locus_tag="CAGL0J08316g"
FT                   /old_locus_tag="CAGL-IPF6722"
FT                   /old_locus_tag="CAGL-CDS2081.1"
FT   CDS_pept        complement(826640..828139)
FT                   /locus_tag="CAGL0J08316g"
FT                   /old_locus_tag="CAGL-IPF6722"
FT                   /old_locus_tag="CAGL-CDS2081.1"
FT                   /note="highly similar to uniprot|P08465 Saccharomyces
FT                   cerevisiae YNL277w MET2 homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61021"
FT                   /db_xref="GOA:Q6FNX4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX4"
FT                   /protein_id="CAG61021.1"
FT                   /translation="MGRRATNMLKEVDIAELSKTNPFVKLVKGQKIVEVPELVLESGVV
FT                   LNNFPIAYKTWGHLNSRGDNCMVICHALTGSSDVSDWWGPMLGNDLGFDPSRFFIVCLN
FT                   SMGSPYGSFSPLTINEETGRPYGPEFPLCTVRDDVRAHKIVLESLGVKSVACVIGGSMG
FT                   GMLALEWASLYGHGPEKYVHNLVALATSARHSAWCISWSEAQRQSIYSDPKYMDGYYTF
FT                   DEPPVTGLSAARMSALLTYRSRNSFENKFSRRKPSIEQAQKSNRKASAGEGQEATIPSS
FT                   VSEQSLRIHNDGYRSSTPQPRIEFNRNGRNGSVVSDVSSAESIKSASSLTSVSSVTGEA
FT                   KEVKPAQTYFSAQSYLRYQGAKFVNRFDANCYIAITRKLDTHDLARDRPEYDEDIERVL
FT                   ESIDIPSLIIGIKSDGLFTYSEQEFLAEYLPNSRLEKIESPEGHDAFLLEFKLINQLIL
FT                   EFLNKNVKDIMTAPPRQWTGEIGQDEHAGSVFGEAEEVTNW"
FT   gene            complement(<829222..>832233)
FT                   /locus_tag="CAGL0J08349g"
FT                   /old_locus_tag="CAGL-IPF6716"
FT                   /old_locus_tag="CAGL-CDS0444.1"
FT   CDS_pept        complement(829222..832233)
FT                   /locus_tag="CAGL0J08349g"
FT                   /old_locus_tag="CAGL-IPF6716"
FT                   /old_locus_tag="CAGL-CDS0444.1"
FT                   /note="similar to uniprot|P53836 Saccharomyces cerevisiae
FT                   YNL278w CAF120 and similar to uniprot|Q06315 Saccharomyces
FT                   cerevisiae YLR187w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08349g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61023"
FT                   /db_xref="GOA:Q6FNX2"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX2"
FT                   /inference="similar to AA sequence:UniProtKB:P53836"
FT                   /protein_id="CAG61023.1"
FT                   /translation="MKRIFSGSKSPDGLPKSPINSPNIGKSILKTSGTFNQDNLTSKSA
FT                   VSPELVPILTLLTAHTHRRYHEGVLLFLQDLKGDGSVGGRKWKEVYAVLIGTQLALWDA
FT                   QELAELNQAERLDVNKVSAKLKEAVSKPTYINFTDSTIKPLGAGDRAVTESGKKLENVL
FT                   IVSSTLKNRYFLQFSNKDSFNEWHAALRLSLYECASLQMAYTGAFLSSRGAKLSDIKVL
FT                   LADVKYDYEDWVSVRFGAGMPWKRCYAVISQPTKKNSLGEINFYESDKKIKKSNSMAKV
FT                   ISAEFLYAIYPSAVQLIDDSTIIKLEGKISFNKKEDPQDTTVFIMPEKHNAVPGYDTVI
FT                   RFLLPAFNAFKLYGRPKKLKADKRDQDSLIFALPVLPHIYYLEVSDLIQLSSSMSSIGW
FT                   DNREWWNQIRGVLQRKLNEGSSGCGSIVEASTFLGSPLLGSNDLFDTSKSIASPRSVSQ
FT                   PLMSGKPGSASNSSESLTNSKDRSRGSPSKGSNQRRIVSEKASSQAKPANYVPTIPPLP
FT                   NNQNQRNFQPSVPAQHINNARDTNKSGKPRDLNIVDSNFNAYGKDHLTVKQDDSKKLSV
FT                   ASDLASLIEKYSDDELEHMTGNEVQGRNYNKLDRRFNDANPRQRGENDASSDEISEMAR
FT                   SINEFGFEHPQKVMKGNFGSSGTLPIQDGPDESNLFDPDYLVQDEAMSIGHNDAYGDFN
FT                   NPYSSKFKGELVSPKIGNNPLPYPAEGGDTPTKQEKTSNNHLNAMENTNLPVNPYDKPK
FT                   NIVPNKQAGYPSQSVQRPSNDLGNSAPVKPGYANTRPNMHTPPPQGVRTGAPSGSYVSP
FT                   NNKMGYANGPNPQQMYRPPAREQFNSGSPNVRGNSSSPVIGQQSPMNPQQHNMRPPPGP
FT                   GTNQMRMSPGSPNMPGQGYPPQQPPYPQNMPMQRPMGGHPQNMPMPPYGYNNAPPNQMG
FT                   GYGYNQRPGFGSPQYPMPNGGMPTGVQSAMGRGPMPQWGQGQAPGGKQRAKVKGGFSQF
FT                   MPPSNTATNPYSNQ"
FT   gene            complement(<833113..>834981)
FT                   /locus_tag="CAGL0J08371g"
FT                   /old_locus_tag="CAGL-IPF6712"
FT                   /old_locus_tag="CAGL-CDS1391.1"
FT   CDS_pept        complement(833113..834981)
FT                   /locus_tag="CAGL0J08371g"
FT                   /old_locus_tag="CAGL-IPF6712"
FT                   /old_locus_tag="CAGL-CDS1391.1"
FT                   /note="similar to uniprot|P53835 Saccharomyces cerevisiae
FT                   YNL279w PRM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08371g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61024"
FT                   /db_xref="GOA:Q6FNX1"
FT                   /db_xref="InterPro:IPR026777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX1"
FT                   /inference="similar to AA sequence:UniProtKB:P53835"
FT                   /protein_id="CAG61024.1"
FT                   /translation="MRNYLLLRDRLTQVWLNKYSITVTILTAKIVLFNYFIIRILRYTE
FT                   KYAISSCNGLDQVNRKVYDDLPIFVNTLGNYMIRKSMLESVEASLRGLEILIDASEGLL
FT                   GFLVDLYLGTYACLLISAVDGAVDVATNTTEHILEAVNNTLIEATRGLDDGLNDLTSLI
FT                   NKGGNRLSSIFKSDNSVAASLSKVNFTVKGLRNIHLSSKINDQLQYMADKVPSFDDLKS
FT                   ETKDLISIPFYHVKREITKVNAESLLPDTKILYLRNNTDTTLYPICGQYIPNIKKVYEH
FT                   LIHILKVGNILVAILGIFIALFMAIPSIQKEYQESKRLNNVQDEVSQYIDNKEFMSSGD
FT                   NSSLNYSPFNDSKFNLAESYQRNFNPIARWMTIKMGKYFGNDETEYSERLQFCMLYIFS
FT                   SRSSTIMAMGLIGLITVAIQLIVIQIISNYLSNTGKVHIQLQASNDEINKMIKSDINLW
FT                   TSLANQYVNGTEANLNTQVFGWITNTTASVNATVAHAVDKIEYILASSFNNTPLYKPMK
FT                   TVVGCAILRKLISVENAMTWINNEAHIKLPRINTTELINIAGHTKMLPSSNESHMFDQV
FT                   EKIVNIARKTALNELYVPLALIGIWLTQIPMALLLSWRRCDTTGKT"
FT   gene            <835623..>837626
FT                   /locus_tag="CAGL0J08393g"
FT                   /old_locus_tag="CAGL-IPF6711"
FT                   /old_locus_tag="CAGL-CDS1205.1"
FT   CDS_pept        835623..837626
FT                   /locus_tag="CAGL0J08393g"
FT                   /old_locus_tag="CAGL-IPF6711"
FT                   /old_locus_tag="CAGL-CDS1205.1"
FT                   /note="similar to uniprot|Q04377 Saccharomyces cerevisiae
FT                   YDR499w LCD1 cell cycle checkpoint protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08393g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61025"
FT                   /db_xref="GOA:Q6FNX0"
FT                   /db_xref="InterPro:IPR018622"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX0"
FT                   /inference="similar to AA sequence:UniProtKB:Q04377"
FT                   /protein_id="CAG61025.1"
FT                   /translation="MLRDKLKLLQAQIEQERSKSNYRVNEVKEEFDKEIQKLRQQLQSL
FT                   EDEKKFLVLESRGINAVNQRIKTSPPEAFSRVSSQHRALNTPDSSHIQEHIPKKRKTEI
FT                   STQPSIVLNPNRVIKDEVSAFFDCLYVHRIVGVELSTIEILNCIKFEHIDEFNYKLLKI
FT                   NKDTSIGSGIVDFLQSCKKNMKLNELVDSVLEHLATLIKAIIINDQELNFSVPFLVALM
FT                   VQTILFRPSAVSVNSLKDLFIFTCDLIRKFQIVLKKPLHKSPLEVDLGPQIFQYELIDN
FT                   LILVYSFDLLESTTKVIRIQQLSETLYMEFFDESLMKSLEAVYKLTLTISFKPVINVIY
FT                   SMVAVFVTITNIMNNDNLSKPFGSSKWWSDLLTRLYQLLGKRILNFHVFDDTNTNNMHI
FT                   DRFFDFYSLLRNMGTNSVSPLLAQLVTRGEIKGIPNIVLKDDIIDKYESKKEKGVLSDN
FT                   LELEKWFVYLKDDILSIIENLMGYFKKDSKITNGEILINLTKLISVEQSQFMDHLIDQD
FT                   TDVFAVRMNLVEHALSIIYRMWKYYEENITQESIKEVESELVMSLWRIIVCKHASKKIC
FT                   KDDLMEHRILINQMENLHLQDTIDLYEDAFEDMPEYIKEELECSINNGTQQKMQVQYDD
FT                   IYIEMARYILESKLTNFISVENTDSLYLSMGF"
FT   gene            complement(<837967..>839118)
FT                   /locus_tag="CAGL0J08415g"
FT                   /old_locus_tag="CAGL-IPF6710"
FT                   /old_locus_tag="CAGL-CDS2876.1"
FT   CDS_pept        complement(837967..839118)
FT                   /locus_tag="CAGL0J08415g"
FT                   /old_locus_tag="CAGL-IPF6710"
FT                   /old_locus_tag="CAGL-CDS2876.1"
FT                   /note="highly similar to uniprot|P19358 Saccharomyces
FT                   cerevisiae YDR502c SAM2 S-adenosylmethionine synthetase 2
FT                   or uniprot|P10659 Saccharomyces cerevisiae YLR180w SAM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08415g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61026"
FT                   /db_xref="GOA:Q6FNW9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW9"
FT                   /protein_id="CAG61026.1"
FT                   /translation="MGNNRFLFTSESVGEGHPDKICDQVSDAILDACLEQDPLSKVACE
FT                   TAAKTGMIMVFGEITTKAHLDYQQIVRDTIKKIGYDDDEKGFDYKTCNVLVAIEQQSPD
FT                   IAQGLHFDKAIEELGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLEW
FT                   IRPDTKTQVTVEYEEKDGRWIPLRIDTIVISAQHAEYISTEDLRSQLKTEIIDKVIPSD
FT                   MLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGAAAVGGGAFSGKDYSKVDRS
FT                   AAYAARWVAKSLLAAGLCKRVQVQFSYAIGIAEPLSISVDTYGTSSKTDEEIIEIIKKN
FT                   FDLRPGVLVRELNLARPIYLPTATYGHFTNQEYPWEKPKKLQF"
FT   gene            complement(<839669..>840472)
FT                   /locus_tag="CAGL0J08437g"
FT                   /old_locus_tag="CAGL-IPF6709"
FT                   /old_locus_tag="CAGL-CDS3852.1"
FT   CDS_pept        complement(839669..840472)
FT                   /locus_tag="CAGL0J08437g"
FT                   /old_locus_tag="CAGL-IPF6709"
FT                   /old_locus_tag="CAGL-CDS3852.1"
FT                   /note="similar to uniprot|Q04396 Saccharomyces cerevisiae
FT                   YDR503c LPP1 lipid phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08437g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61027"
FT                   /db_xref="GOA:Q6FNW8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW8"
FT                   /inference="similar to AA sequence:UniProtKB:Q04396"
FT                   /protein_id="CAG61027.1"
FT                   /translation="MKVSFGLALEYTRMYSPQLLATVFCSILFLFTEFKLVPRLENKRF
FT                   RLDDKSIGKSHISNELISGFEVITMSALISGLIVVWFCTFGKDSLRKFHGNWTNMKPES
FT                   SSTRGHFFFISVLCLYLILSLNGAVTGCLKLVIGNFRPDFIARCEPALDKASDLTKYYG
FT                   LDICQQQNKRLLYEGLKSTPSGHSSFITSGLGFAYYWQKQFVSSHHTRHIWCIVLILLV
FT                   MMSRITDHRHHWYDVVSGCIIGIAMIAASWRWVFSPRSSTYELPA"
FT   gene            complement(<841369..>843774)
FT                   /locus_tag="CAGL0J08459g"
FT                   /old_locus_tag="CAGL-IPF6706"
FT                   /old_locus_tag="CAGL-CDS0812.1"
FT   CDS_pept        complement(841369..843774)
FT                   /locus_tag="CAGL0J08459g"
FT                   /old_locus_tag="CAGL-IPF6706"
FT                   /old_locus_tag="CAGL-CDS0812.1"
FT                   /note="similar to uniprot|P50896 Saccharomyces cerevisiae
FT                   YDR505c PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08459g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61028"
FT                   /db_xref="GOA:Q6FNW7"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW7"
FT                   /inference="similar to AA sequence:UniProtKB:P50896"
FT                   /protein_id="CAG61028.1"
FT                   /translation="MELPSISSTTSISDNADLRNYYEKLLFKNSSGKSLTDLQNRAHRS
FT                   NEDDENKERKFDFINGFKSNKNGIKLEQGRNRMPTFSGLKMTSMDTERKIPTSNFFNSQ
FT                   GQLQQQNHPSQNNNQNNLDPNSNGNYQDIFSNYNMSDKMGNGNDVSNSNSHSSPFSEFA
FT                   LPTLHKYQSNPGQDHMDYSNGNQSAGAWNNPKTALSGFEAQQDRNDGRRSSYISDTLIH
FT                   GQYDIHNNPIPNGIAALRHHSSAAGAMDPFMQVNPSQIYGQMPNQTATVQNTMPYGYKN
FT                   TSNIIPLLNNLNLKGENNYNPQNRSLNNQRFPHQNNPGSRQGQKDIQQYPYNASKQQQD
FT                   QYNSRFNHYNNGSNFENVKSSHLNDGAHQNTSKNHISESSLDFSICKDNYEELQNETGL
FT                   LLLAGRQIVSTPKLHQFYLECGANYFSSKEVFKFADFIKEQLVITNDNENTSSSVLSFL
FT                   DFLKSRNSNYFNKGSKQSNGEENGNLNENGNDPTNGGNASYKPLVLVALKNGKLELLST
FT                   PQTTNLLMKRGDLVIIDGDRGKDLVLVVEPSVDLNLALFVNFLKKKIHFDSLITNRNQH
FT                   ISNDNFIGLLEASKSGETPDINPKLYDVVELTELIIPSKQVLRFATPWEVSTNLHNKFQ
FT                   DELRAMHIARSKLSSLNETINGSQQGEKENDNSNQRSKMALNIKILNAEFQFDRKKLTF
FT                   YYLCEERNDFRDLIKELFKYYKTRIWLCALPNNLEVDTKYYDKDHKELNMYQNMIDGEN
FT                   QMEVQDAPLKSDNSSVLAPPLNKLELDNFQIGVYKELVNQLFKTHFDY"
FT   gene            complement(<844215..>845966)
FT                   /locus_tag="CAGL0J08481g"
FT                   /old_locus_tag="CAGL-IPF6705"
FT                   /old_locus_tag="CAGL-CDS1596.1"
FT   CDS_pept        complement(844215..845966)
FT                   /locus_tag="CAGL0J08481g"
FT                   /old_locus_tag="CAGL-IPF6705"
FT                   /old_locus_tag="CAGL-CDS1596.1"
FT                   /note="similar to uniprot|Q04399 Saccharomyces cerevisiae
FT                   YDR506c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08481g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61029"
FT                   /db_xref="GOA:Q6FNW6"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW6"
FT                   /inference="similar to AA sequence:UniProtKB:Q04399"
FT                   /protein_id="CAG61029.1"
FT                   /translation="MLMYFWFLVNLYVCVASTTHELVFNVASATNRDGRRIISINGRRN
FT                   TYGPQIRVKSGDTINLKVVNNICSAEELVSMETDEQLREYCHTALHFHGLIGIGNELDG
FT                   VPGITQDPIAPGEEFWYNITIPETICGTYWYHSHSSVQYGDGLRGVLLVDCDRYHTYLD
FT                   RILATIDGDPSVLDTNGVMTLSDAKKKLRTGMTEQIITLSDWYNSWNLDINSKIVLSPD
FT                   GTRDPRLDDSLINGKRSTFQVIDIPESTKYALIRFVNSGMSGTQIVNFPNHKIVVFETD
FT                   GVLIKPYVLDTLSMAVGQRYSVVVVKGENEALQMINGCNKMMGYYAKQAWLASKHVAGT
FT                   LTAETSIPRINSLPGLDKLEKYRDFQPVEDEVKGLEVAEKANTTVELSYDYYRDPEIQE
FT                   KYGTGMFLLNGKALSDYFKEPIELPEGKGNVVDIVLNSVEHMRHPWHLHGHRFQVISIG
FT                   KGGEGKFDSREAQQKYREDMEYWETHPEQSPMFRDSINLPGRSFVVLRIRTSEPGDWLL
FT                   HCHVDWHVSKGLGAMFRVKGNAKSDPTTEEATEYANPIKHNKTKVLLIYISIMVCVDIL
FT                   MYYTIMR"
FT   gene            complement(<846218..>846337)
FT                   /gene="tRNA-Leu (CAA)"
FT                   /locus_tag="CAGL0J08503r"
FT   tRNA            complement(join(846218..846262,846299..846337))
FT                   /gene="tRNA-Leu (CAA)"
FT                   /locus_tag="CAGL0J08503r"
FT                   /product="transfer RNA-Leu"
FT   gene            <846742..>847881
FT                   /locus_tag="CAGL0J08547g"
FT                   /old_locus_tag="CAGL-IPF6700"
FT                   /old_locus_tag="CAGL-CDS2911.1"
FT   CDS_pept        846742..847881
FT                   /locus_tag="CAGL0J08547g"
FT                   /old_locus_tag="CAGL-IPF6700"
FT                   /old_locus_tag="CAGL-CDS2911.1"
FT                   /note="similar to uniprot|Q12405 Saccharomyces cerevisiae
FT                   YOR084w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08547g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61030"
FT                   /db_xref="GOA:Q6FNW5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12405"
FT                   /protein_id="CAG61030.1"
FT                   /translation="MEARVNEKYEREVKTTAAVWPRSRNAVLNPDVDRLCVVYEVFTRC
FT                   TGNGGSKKKKVNLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSALL
FT                   NKGRLGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLFQLA
FT                   IVIEPVIIKDPSQLEPKTEYLFFPPNFYRALTAKMTDNFDSMQEFEEFMEKKSFYVKVH
FT                   PEIRKRLTEFEAIQRPDGSVVTKMKKVHNFMCYATDNTSAKRMVQLMPFIGIPVVSLVG
FT                   ASSRWTPPVNNEYVRTRIPNCKEVSVANGDHLMNLEMPDTIVDYISKHISQYVANPPQR
FT                   SEGDYVLDHNGSLAERNQFLDNSYKHFLNKIRLPQKSKL"
FT   gene            <848348..>849391
FT                   /locus_tag="CAGL0J08569g"
FT                   /old_locus_tag="CAGL-IPF6699"
FT                   /old_locus_tag="CAGL-CDS3181.1"
FT   CDS_pept        848348..849391
FT                   /locus_tag="CAGL0J08569g"
FT                   /old_locus_tag="CAGL-IPF6699"
FT                   /old_locus_tag="CAGL-CDS3181.1"
FT                   /note="similar to uniprot|P48439 Saccharomyces cerevisiae
FT                   YOR085w OST3 oligosaccharyltransferase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08569g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61031"
FT                   /db_xref="GOA:Q6FNW4"
FT                   /db_xref="InterPro:IPR021149"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW4"
FT                   /inference="similar to AA sequence:UniProtKB:P48439"
FT                   /protein_id="CAG61031.1"
FT                   /translation="MQMFNFSRLVALLLVLVNVSLALSPKQFNKERLKYKDSIIDLNDR
FT                   NWGRLLANPKESYLVTVFTATGRQYGCTMCTELAEHYETVVRSWFADHPDGISKNDGSK
FT                   SLFFAKVDAVDQNVPELFQKFNVEQVPRIIIYEPGKGDPQYKFLDIQLSGENVVETLIA
FT                   GIKESTDVQDFEIHEEINWSSVTITGVATFATVLLVKKQSTLALKIFTSRYVWGFGTIF
FT                   FIIAMLGGHMFNRIRNTPEAGMDKLKNVIYILPGQISGQYAIETQIVGLLYAVLCALIV
FT                   ALVMVVPNVSKKLSGPENAKETAQVIVTILTAVFIYMFFAAFTKVFEVKYTGYPYTLLK
FT                   LFNFFGK"
FT   gene            complement(<849629..>853219)
FT                   /locus_tag="CAGL0J08591g"
FT                   /old_locus_tag="CAGL-IPF6698"
FT                   /old_locus_tag="CAGL-CDS0246.1"
FT   CDS_pept        complement(849629..853219)
FT                   /locus_tag="CAGL0J08591g"
FT                   /old_locus_tag="CAGL-IPF6698"
FT                   /old_locus_tag="CAGL-CDS0246.1"
FT                   /note="similar to uniprot|Q12466 Saccharomyces cerevisiae
FT                   YOR086c or uniprot|P48231 Saccharomyces cerevisiae YNL087w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08591g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61032"
FT                   /db_xref="GOA:Q6FNW3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037756"
FT                   /db_xref="InterPro:IPR037761"
FT                   /db_xref="InterPro:IPR037762"
FT                   /db_xref="InterPro:IPR037765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW3"
FT                   /inference="similar to AA sequence:UniProtKB:Q12466"
FT                   /protein_id="CAG61032.1"
FT                   /translation="MVDEASTSGYKSSQHDEGIMFKGIGEITMSSSRETQDDMLKADKK
FT                   EADGDIKEIAAKQELKVSKNIQVSAGDLVDEFERQRKRAAYVGWKQMGGWEEKDELTLE
FT                   DELMDANSDTLLNNVLPEPLYGDWYHNVAIYFLAGVLSFAVGHFKFSLAPVFFITLFSA
FT                   LYYRTSAKKNRASIRELVQKEFTVQKIEDDYESLEWLNTLLDKYWPIIEPAVSQMVCEQ
FT                   VNDILATNDSIPAFIKALWIAQFTLGIKPPRVDYAKTFPNTDSDVVVMDWGLSFTPHDL
FT                   SDLNAKQMKNYVNQKILVKAKLFGMTIPVTVANVAFKAKTRIRFKLMTPFPHVETINIQ
FT                   LLEIPDIDFVANFMGNNLFGWEILAIPGLMPLAKALARKYAGPILLPPFSLQLNVPQLV
FT                   SESPLSVGVLEITVKNATDLKRVNNMIDTSVDPYITFQMGGKEVARTRTVRDTLNPVWN
FT                   ETIYMLLPSFTDPMTITVYDRREKLKDKILGRIEYNANSLHDKPTQRNVSQQFLRNSKP
FT                   VGKMTMDLRFFPTLSSKKLPDGTVEDAPDLNTGLAKIIVDEGSSIVDKDGSASVEVYFN
FT                   STMVLSTAKGSPKRGVITWGDMYEAIITDRRKARFRFVVKDKNGENINSTLQSLSDLID
FT                   RTQIGQKNIPLAHGNARLTVTTYWKPVMLDVGNKSIAYTPPIGALRVFVNKASNLKNLE
FT                   KIGKIDPYAKILVNGIQRGRTDFDAQTTNPVWNTGVYVALTSPNQRITLECMDVETSNK
FT                   DRTLGQFDIKLNDFFQKNSLDRYDTKVDSTQRQGRLTAKKFSKGVVTYSISFYPTLPVL
FT                   TLEEIQDIESAEKRKAKLDEKRKLLTDGKLSKEEKQKLEEEELEIKEIEEMHNNKRKLS
FT                   LDQLLEHKIGILAISVLSGDVPDIGVYVQSFFDGNAHARFISPKLTSRTINSGWTGDVM
FT                   IKELDNSVVTFKVTRDKFSGKTSDKLCDVTLSTIDLLRESYYKPSILTLSGQHTAKLML
FT                   QVQWFPMDIEDLPPEDLMSNSGDLTIIAKNAENLLSADTNGYSDPFLKFYYNDEDDACF
FT                   KTKTIKKTLNPTWNEKGVIEVRNRVYDVLYLKVMDWDAASADDVIGRATIPLSKIDPHN
FT                   TTTLDVPVVDDEGRDGGIVHLEFQFSPRFVTLTDSEQKTVADAPVKSIGSGLKAGTTVV
FT                   SSGLGSVGKIGKGIGRGLGLKKSKKHNEDD"
FT   gene            <853530..>855743
FT                   /locus_tag="CAGL0J08613g"
FT                   /old_locus_tag="CAGL-IPF6695"
FT                   /old_locus_tag="CAGL-CDS0973.1"
FT   CDS_pept        853530..855743
FT                   /locus_tag="CAGL0J08613g"
FT                   /old_locus_tag="CAGL-IPF6695"
FT                   /old_locus_tag="CAGL-CDS0973.1"
FT                   /note="similar to uniprot|Q12324 Saccharomyces cerevisiae
FT                   YOR088w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08613g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61033"
FT                   /db_xref="GOA:Q6FNW2"
FT                   /db_xref="InterPro:IPR024862"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12324"
FT                   /protein_id="CAG61033.1"
FT                   /translation="MLKYNPPHSTVLYHTLPVLYTWGLLEQLMSEQLPVDNEGCQPANS
FT                   GYNVEAPTSRQVLRVALNLKYLVDKVVPVTYGCDEIESDHSSVVTPAVVQLALEACGGD
FT                   PEDKKNRDKYRAVVVFALLKVYGWYSQLAATELHNAELYESRGVAAQQLCKIIIDQEEM
FT                   NDLHFMFMQMLLRRYTINENDEDSEPANAIELASDMHCTIVIGSGGFQRCLTWLWRGWI
FT                   IQNRRDPTTFIRDETVSSPYFIDHFNPDRIKTPKYQNLLNIFFSILFLVLYTVVVNGKN
FT                   SVTVSPIDLPELVFYLFTLGNILEEMTKMYYIGAAYFSFWSSFNLTMYSIISVSFVLRI
FT                   LSVAPLKLHNPSEYWDKISYRILSCAAPFVWSRMLLYLESEPFVGVMLVVLKHMMKESA
FT                   VFFVLLVLIMVGFCQGFLGLDSADGHREITGTIMENLTIAVLGLGSFDKFKRFAPPYAE
FT                   ILYYSYYFIVSVILLNILIALYANAYQRVVDNAADEYMALMVQKTLRFIRAPDEDVFVA
FT                   PLNLIELLFSPVFAFLSKAKKSQLSYYVMMVIYSPTLVLVALSEVRTSKRIKYNRLKNL
FT                   PDDANEVDTAWDLTDGYVDEEDTLFTRSHTSGIRATNKKNKFSLQVQREAEAKDPKFSV
FT                   PREWYSKVKHICHKHEQEKCASDDGSNDLSEKVSELLVKLSKVGLSVNSSGSSTLPDEV
FT                   FKEFKTDVEKLGNMVQELNDLKRELKDISDMKSLLKEIVNQKK"
FT   gene            complement(<856102..>856728)
FT                   /locus_tag="CAGL0J08635g"
FT                   /old_locus_tag="CAGL-IPF6692"
FT                   /old_locus_tag="CAGL-CDS4380.1"
FT   CDS_pept        complement(856102..856728)
FT                   /locus_tag="CAGL0J08635g"
FT                   /old_locus_tag="CAGL-IPF6692"
FT                   /old_locus_tag="CAGL-CDS4380.1"
FT                   /note="highly similar to uniprot|P36017 Saccharomyces
FT                   cerevisiae YOR089c VPS21 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08635g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61034"
FT                   /db_xref="GOA:Q6FNW1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW1"
FT                   /protein_id="CAG61034.1"
FT                   /translation="MNNNITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFL
FT                   TQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE
FT                   LQEQASKDIIIALVGNKIDVLENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDV
FT                   FLAIGEKVPLKTANQANVPNNANENQRVDLTSVVNNPAANSSCSC"
FT   gene            complement(<857192..>858865)
FT                   /locus_tag="CAGL0J08657g"
FT                   /old_locus_tag="CAGL-IPF6690"
FT                   /old_locus_tag="CAGL-CDS1730.1"
FT   CDS_pept        complement(857192..858865)
FT                   /locus_tag="CAGL0J08657g"
FT                   /old_locus_tag="CAGL-IPF6690"
FT                   /old_locus_tag="CAGL-CDS1730.1"
FT                   /note="similar to uniprot|Q12511 Saccharomyces cerevisiae
FT                   YOR090c PTC5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08657g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61035"
FT                   /db_xref="GOA:Q6FNW0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW0"
FT                   /inference="similar to AA sequence:UniProtKB:Q12511"
FT                   /protein_id="CAG61035.1"
FT                   /translation="MSSLSRIVNLKKSSKLAKGALRVGSRGLHMRPMARLGSSTLLLRE
FT                   LNLALVSGGLMYLTYSYFSEKRNPLEVFKAFKEYSTIHNDGGKLISSSGGSQNSNADFK
FT                   ILSQEEVDRRLRAREQSFFVKRNKGLVRYDVAQLPSNNPIEDNHVEKLITFPSPDGSKP
FT                   LKDREDEAFDNDLYFFGIFDGHSGAFTSAKLSTDLVPYVAHQIADVYQQHNKALTSDYT
FT                   HNMNFDVALEKGFVQLDNDIVYHSLGKLLKEPTNDNMLAALPAISGSCALLAVYNSYES
FT                   TVKVAVTGDSRALIGGLDSNGEWYVKSLSTDQTGDNLEEVQRIRSEHPGEDNVVRNGRV
FT                   LGSLQPSRAFGDYRYKVKEIDGKKLSDLPDHLKLYFRKEPRDFKTPPYVTAKPVVTTAK
FT                   VNDNTKFMVLASDGLFELLSNTEIAALVVKWMEKHSDDTKVKSLSFKKQLPKVKDLSTD
FT                   SESQRPAFRYRKDQSLENMSYFLEDANVATHLIRNALSAGGQNEYVSTLVSIPAPMSRK
FT                   YRDDLTVTVAFFGENNSSVVPDTQTILPNLDATTPVQSKL"
FT   gene            <859191..>860210
FT                   /locus_tag="CAGL0J08679g"
FT                   /old_locus_tag="CAGL-IPF6688"
FT   CDS_pept        859191..860210
FT                   /locus_tag="CAGL0J08679g"
FT                   /old_locus_tag="CAGL-IPF6688"
FT                   /note="highly similar to uniprot|Q12000 Saccharomyces
FT                   cerevisiae YOR091w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08679g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61036"
FT                   /db_xref="GOA:Q6FNV9"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR032378"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV9"
FT                   /protein_id="CAG61036.1"
FT                   /translation="MPPKKKQQQPAKKKDNVDKTFGMKNKNRSTKVQRFIKQVQAQADP
FT                   AKEEMKRKKLEEKKMREAAEAERRALFGNVADQRIRAGVDPKTVVCALFKMGNCNKGAK
FT                   CKFSHDLNVGRKVEKKDLYQDTRDEKEKDTMDDWDEEKLRKVILSKHGNPRTTTDKVCK
FT                   YFIEAVENGKYGWFWVCPNGGDKCMYKHSLPEGFVLKTKEQRRLEREALENQPKITLEE
FT                   FIETERERLDKSKLTPITMQNFAEWKKKHVIERLNAMKEENSKKKPSGREVVQKLLADN
FT                   KSFDDSSVAETAGTEGTAWDLTEFTEALRKADHADDANIKDYGDGSNPTFEITKKIEA"
FT   gene            <860867..>862108
FT                   /locus_tag="CAGL0J08712g"
FT                   /old_locus_tag="CAGL-IPF9793"
FT   CDS_pept        860867..862108
FT                   /locus_tag="CAGL0J08712g"
FT                   /old_locus_tag="CAGL-IPF9793"
FT                   /note="similar to uniprot|P31381 Saccharomyces cerevisiae
FT                   YAL022c FUN26"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61038"
FT                   /db_xref="GOA:Q6FNV7"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV7"
FT                   /inference="similar to AA sequence:UniProtKB:P31381"
FT                   /protein_id="CAG61038.1"
FT                   /translation="MNHDAIDSLENVGLWKKLSNLEYFTFCMIGIGLLWPWNCVLSAVL
FT                   YFKHSFFQDVTNWAKVFASSMMAVSTITSLVFNVWLANRQRNYTQRVVRGLVWQVMAFV
FT                   VLAIICMVHNMLPMWFSFLFIMVVILFSSVATALTQNGILAIANVFGSEYSQAVMLGQA
FT                   VAGVLPSVVLFGISYIGDSTAAETGEQSQAGIIVYIITTAIVCGISTTLFKFTGIGGQF
FT                   MAIMREESIDVDDNDEQIPFRVLFDKLRLLVLSILLTFVITLIFPVFASTVRSTGLGMK
FT                   DEHYMPLIFTLWNLGDLYGRVLADLPYFQSPSFTPLKTFIYALLRFLHIPFFFYFSSRN
FT                   DGHSVALDIGYMLLQFVFGLTNGHVISLSFMKVPQVLDNDLEKEAAGGFTNIFVSVGLA
FT                   LGSLVSYIFVFLIN"
FT   gene            <862513..>864741
FT                   /locus_tag="CAGL0J08734g"
FT                   /old_locus_tag="CAGL-IPF7004"
FT   CDS_pept        862513..864741
FT                   /locus_tag="CAGL0J08734g"
FT                   /old_locus_tag="CAGL-IPF7004"
FT                   /note="highly similar to uniprot|P31382 Saccharomyces
FT                   cerevisiae YAL023c PMT2 or uniprot|P47190 Saccharomyces
FT                   cerevisiae YOR321w PMT3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61039"
FT                   /db_xref="GOA:Q6FNV6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV6"
FT                   /protein_id="CAG61039.1"
FT                   /translation="MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQ
FT                   SPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPP
FT                   LGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIG
FT                   FSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWW
FT                   KWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVA
FT                   LICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIK
FT                   NQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVV
FT                   DGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSEN
FT                   TTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESH
FT                   ENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVG
FT                   LRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLF
FT                   LMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGS
FT                   IMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHIHD"
FT   gene            <865291..>867792
FT                   /locus_tag="CAGL0J08756g"
FT                   /old_locus_tag="CAGL-IPF7002"
FT                   /old_locus_tag="CAGL-CDS0725.1"
FT   CDS_pept        865291..867792
FT                   /locus_tag="CAGL0J08756g"
FT                   /old_locus_tag="CAGL-IPF7002"
FT                   /old_locus_tag="CAGL-CDS0725.1"
FT                   /note="similar to uniprot|Q05787 Saccharomyces cerevisiae
FT                   YLR207w HRD3 involved in degradation of HMG2P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61040"
FT                   /db_xref="GOA:Q6FNV5"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV5"
FT                   /inference="similar to AA sequence:UniProtKB:Q05787"
FT                   /protein_id="CAG61040.1"
FT                   /translation="MLLSTYLNWASVLLTIAGAESNIDPWDEVSSFLQGKLRKLDVTNP
FT                   NAYDMNDNEQDATFYVSMDYHEEEERSEYESVWQYYNENSDQDWHKSVYDKLQVSADQF
FT                   NNTEAMYKLSQINLWGQYGYPHNKSVAFQYLQKFNDMTSYENSSALFDLAVAYSTGLFG
FT                   TLPVDVARGLLYFQRSARLGDLKAKQVLAYRYFSGYSVARDVDKALLLYKEIAEEIKKK
FT                   YSEEQWNMVFPYIESYIVRIPDFDEGLLGKGLSTVPQSVRRKKTTRPPFAGSSNLKPIG
FT                   DVGYGEVVMQFKFNAGNGNPGSFVISDSEHEDRLVELFYTAWDLYKGTYTRGRDCDKAK
FT                   RLLLQVYKTYDAEVKYMDNLQKFFYVKSLDLLAHMYFTGEGFERPNVQAALDLFDRSEK
FT                   ILEGAEISRTASEVDKGLISQYYFNNTLGALKHYKKAKESGNAHGILFYQLGKLSEKNP
FT                   ELKIGDPYLYMQEASSQQYLPAQYEFAKMVESNELRKYSVEDITRLYKAFVEENENIMA
FT                   PHLRLGFSELLGGSSEVSLYAYAQAAEQGYEAAQISAAYLLYQLPYKFDDPPETTIERK
FT                   TMAISYYTRAFKQGNTDAAVVAGDIYFQMKNYTKALSLYQSAALKFSAQALWNIGYMYE
FT                   HGLGVEKDFHLAKRFYDQILEHNQKLYFAVKASVMKLQLKSWFMWLNGKELDNISIDQE
FT                   QESTVVRPFFDRLVQLLKNLSRETRGDNKKKNQHRILKEKKTPSQGIMERFGLQTEDLL
FT                   TMVCVLIIFAISMFFRTVAPRGQWNVRINGVNIAGGNALGEEGNPENENEEDDENDDEG
FT                   RARARNNFGFGNNFDVQVFAI"
FT   gene            <868299..>869195
FT                   /locus_tag="CAGL0J08778g"
FT                   /old_locus_tag="CAGL-IPF7001"
FT                   /old_locus_tag="CAGL-CDS3616.1"
FT   CDS_pept        868299..869195
FT                   /locus_tag="CAGL0J08778g"
FT                   /old_locus_tag="CAGL-IPF7001"
FT                   /old_locus_tag="CAGL-CDS3616.1"
FT                   /note="highly similar to uniprot|Q04491 Saccharomyces
FT                   cerevisiae YLR208w SEC13"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61041"
FT                   /db_xref="GOA:Q6FNV4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV4"
FT                   /protein_id="CAG61041.1"
FT                   /translation="MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVEGESHKL
FT                   VDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNS
FT                   VQWAPHEYGALLLAASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEGGNN
FT                   PGEAPKEVRRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSVLLRSY
FT                   IASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTL
FT                   WKENLNGKWESAGEVNQ"
FT   gene            complement(<869388..>870335)
FT                   /locus_tag="CAGL0J08800g"
FT                   /old_locus_tag="CAGL-IPF7000"
FT                   /old_locus_tag="CAGL-CDS3462.1"
FT   CDS_pept        complement(869388..870335)
FT                   /locus_tag="CAGL0J08800g"
FT                   /old_locus_tag="CAGL-IPF7000"
FT                   /old_locus_tag="CAGL-CDS3462.1"
FT                   /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
FT                   YLR209c PNP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61042"
FT                   /db_xref="GOA:Q6FNV3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV3"
FT                   /inference="similar to AA sequence:UniProtKB:Q05788"
FT                   /protein_id="CAG61042.1"
FT                   /translation="MNTNWDLGEERVKIEKASEYLSERFQERFQNEKFEPRALIICGSG
FT                   LSGIPDKLNKDKLEPLVIPYELIPGFKRSTVPGHSGNLVFGIMNDYPVVLMSGRLHGYE
FT                   GNTMQETVFPIRVLHHFSKGGIKTLIVTNAAGGINSEFKPGDIMCIYDHINFPGLAGLH
FT                   PLKGPNFDDIGPRFLALSDAYSHDLRKLLFQTHNELKMDRPLHEGTYFFASGPTFETRA
FT                   ESRMIRILGGDSVGMSTVPEVIVARHCGWDVLALSLITNVAVIDHPPSGKIDTPVPMDY
FT                   GKASHAEVLENGRIASKDVETLISTFVGKLHYRE"
FT   gene            <871867..>873198
FT                   /locus_tag="CAGL0J08822g"
FT                   /old_locus_tag="CAGL-IPF6999"
FT                   /old_locus_tag="CAGL-CDS2456.1"
FT   CDS_pept        871867..873198
FT                   /locus_tag="CAGL0J08822g"
FT                   /old_locus_tag="CAGL-IPF6999"
FT                   /old_locus_tag="CAGL-CDS2456.1"
FT                   /note="similar to uniprot|P24871 Saccharomyces cerevisiae
FT                   YLR210w CLB4 cyclin or uniprot|P24870 Saccharomyces
FT                   cerevisiae YDL155w CLB3 cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61043"
FT                   /db_xref="GOA:Q6FNV2"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV2"
FT                   /inference="similar to AA sequence:UniProtKB:P24871"
FT                   /protein_id="CAG61043.1"
FT                   /translation="MNNTEDMFRDVENASQNMASTVNTSRMDQRQRRALTDLTSQKVNR
FT                   IHTSKTIKDIPAYLSNYTADGENKNIDQAFNHSNDQDIGLVNQINSGYANVENEPGKET
FT                   DHIFIDQDDLSDLDIVQEDSLREQLEEFEHDFENFVEPLSPIFNDEIQDTLDRAFKEYY
FT                   RATPDMEDDDTFDAVMVTEYGSDIFRYMRKLELKYRPNPYYMAGQPELKWEYRKTVIDW
FT                   IVQVHERFQLLPETLYLTINIIDRFLSRKNITLNRFQLVSATALLIASKYEEINCPTIK
FT                   DIVYMVDNTYSRDDIIEAEKYMIDALDFEVSWPGPMSFLRRISKADDYEYRTRNLAKYL
FT                   LETTLMESSLISALPSWLAAGAYFLSRIILGYEEWTLKHVYYSGYTHEQLYPLATLILD
FT                   NCQNYEESHQAIWTKYSQPQYHQVSILVTKFLGRVSSDDMSEIY"
FT   gene            complement(<873456..>875855)
FT                   /locus_tag="CAGL0J08844g"
FT                   /old_locus_tag="CAGL-IPF6998"
FT                   /old_locus_tag="CAGL-CDS0814.1"
FT   CDS_pept        complement(873456..875855)
FT                   /locus_tag="CAGL0J08844g"
FT                   /old_locus_tag="CAGL-IPF6998"
FT                   /old_locus_tag="CAGL-CDS0814.1"
FT                   /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
FT                   YDL148c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61044"
FT                   /db_xref="GOA:Q6FNV1"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV1"
FT                   /inference="similar to AA sequence:UniProtKB:Q99207"
FT                   /protein_id="CAG61044.1"
FT                   /translation="MAGSQLKELKATLKAHGLTGQTNVKKSKKGKREAKKYDHEEKART
FT                   IAKIRDRFNPFEVKTTKNKRKGGDPGLLNSDRVAVGKPGISKQIGEEARRRAFEAKKLM
FT                   KKRKGGVIDKRFGERDKTLTEEEKMLERFTRERQAGSQRKKNLFNLEDDDEDGPIELDM
FT                   FGNKLTHLGESLSLADDLNVQAEDTEDLEEGQPQRKKTKLEVMKEIIAKSKFHKQERQA
FT                   AQRKLEDNIDELDEDFDDVMAELMTTQTLKQDDIEVPAEEKDYDIKVKELNLEKRAAPA
FT                   DRTKTEEELQKEAEERRQKLEEQRLNRMQGMLEDEEGEERGVEDLDDGFWGSDSEVEEG
FT                   ENIANSDEDIEVESSSEEAISYKSKKLVAISCPQTHPEFLNDLKGLSLLEQPIHVKAII
FT                   KAYQPKLAEGNKVKLANFSKVLLKHMIYLANQRYDKDLIKFDKTQNEFLIILKRLSEKY
FT                   NQAISEVSREYILDIQERFKKQNFHALNNGDILFFIIVGVLFSTSDQYHLVVTPAQIIL
FT                   CEFLEQIRFKSLKRIAVGSVLLRIILQYQRLSKRYIPETVYFLQKALLSLVVNPDDIES
FT                   DMTLPIRLDTFDCGLKLKEPSLPDDAVVHLHELFTKSTTNEEDLKINVLSNLFEDLEKL
FT                   IGSHWNNEAAFPEICEIFEPILSVYKVRYPSITTVESIEEKIKRMKKLNKHYPLALQAH
FT                   RPTAIPSYAPKFEENFNPAKKSYDTDVARNEVNKMKAQLKKERKFVMKELRKDTKFEAR
FT                   QRIDEKKKEAEAYHSKMSNIINTINTEEGAEKNKYEREKRLRAGKK"
FT   gene            complement(<876226..>876906)
FT                   /locus_tag="CAGL0J08866g"
FT                   /old_locus_tag="CAGL-IPF6997"
FT                   /old_locus_tag="CAGL-CDS4201.1"
FT   CDS_pept        complement(876226..876906)
FT                   /locus_tag="CAGL0J08866g"
FT                   /old_locus_tag="CAGL-IPF6997"
FT                   /old_locus_tag="CAGL-CDS4201.1"
FT                   /note="some similarities with uniprot|Q05789 Saccharomyces
FT                   cerevisiae YLR211c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61045"
FT                   /db_xref="GOA:Q6FNV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV0"
FT                   /protein_id="CAG61045.1"
FT                   /translation="MSDLNTVYEHIRRAEQKCRSGDLSDALDLYVSALEGLDLKSPNFD
FT                   LQGLDDTIIEAVKLLRDDIQLRIKELQICVIESSKDEKDSKNNKASMALVQSSAGNNNN
FT                   LAASKYWDSTRNITDITSSTFIDPYTSSMLSKLQNSMVDLIKEAKNQKTDVNDLVSTAL
FT                   FQIDQFKKEMLIYEQRRTREYQIKVEHLNKDVKKLSSQNSKLKERWDSLVESARQRKNR
FT                   QQGL"
FT   gene            complement(<877386..>878783)
FT                   /locus_tag="CAGL0J08888g"
FT                   /old_locus_tag="CAGL-IPF6996"
FT                   /old_locus_tag="CAGL-CDS2288.1"
FT   CDS_pept        complement(877386..878783)
FT                   /locus_tag="CAGL0J08888g"
FT                   /old_locus_tag="CAGL-IPF6996"
FT                   /old_locus_tag="CAGL-CDS2288.1"
FT                   /note="similar to uniprot|P53378 Saccharomyces cerevisiae
FT                   YLR212c TUB4 gamma tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61046"
FT                   /db_xref="GOA:Q6FNU9"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU9"
FT                   /inference="similar to AA sequence:UniProtKB:P53378"
FT                   /protein_id="CAG61046.1"
FT                   /translation="MTGEIITIQVGQCGNHVGKYFWNQLLKEHGIDKDGYSKYNDDLTH
FT                   IREDDTNPFFKQITNNRYVPRAIMIDLEPAAVTDVQSSFNDLFNPRNTWVSSEGLGAGN
FT                   SWSTGYDRGVQNQDRIMDIIDRELDSTDNFEGFQLLHSVAGGTGSGLGSSLLEALTDRY
FT                   SKSFITTYSVFPSKQSEVVVGPYNTVLTLRRLCEDADASIIFDNNALLNLTARTFRDPN
FT                   TSYEHTNQLISSALSSITNSLRFPSYMYNSMASIFSTLIPTPELHFLTPNFTPFTPDYI
FT                   IGGQRYKKNTAYDVLLDLLDPFNSLVTQRSDMVTHFNVFSTVIGEVDQNHILRALPKMQ
FT                   QRLNMPSWSTSALNVNIGRRSPYLPPLESRENSVSGLMLSNTSAITSVFERSASAFDKL
FT                   FYKGAFLNQFESGQLFQNGLDEFVESREVITRMMEEYSNAEQDTYLDDILNEDDIMIGG
FT                   FDNEGDS"
FT   gene            complement(<879267..>880751)
FT                   /locus_tag="CAGL0J08910g"
FT                   /old_locus_tag="CAGL-IPF6994"
FT                   /old_locus_tag="CAGL-CDS2105.1"
FT   CDS_pept        complement(879267..880751)
FT                   /locus_tag="CAGL0J08910g"
FT                   /old_locus_tag="CAGL-IPF6994"
FT                   /old_locus_tag="CAGL-CDS2105.1"
FT                   /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
FT                   YLR213c CRR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61047"
FT                   /db_xref="GOA:Q6FNU8"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU8"
FT                   /inference="similar to AA sequence:UniProtKB:Q05790"
FT                   /protein_id="CAG61047.1"
FT                   /translation="MAKQLKLLIIIRFLLSINFSRGIDLHKPETPVRCSIRDGSCPAEW
FT                   PCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRIASGNL
FT                   QKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMTQMDP
FT                   TTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDELDFEF
FT                   VGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDGVVVRT
FT                   LYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPPDMLEKG
FT                   YFSANVKVIRIEPSANRHLPRIYHCLTRKSHKDINDLTSRDLSMATFYYNSSRDNRYNE
FT                   NSLEWDCFNDIYLSNSSSSGTDLYYGNKGKQTNSLEKSPNSEYSNENDSEEINVEEWYR
FT                   RSMMFRPKRQKSSAAHKTKSSTLPLIIFLIISLFIK"
FT   gene            complement(<881038..>882105)
FT                   /locus_tag="CAGL0J08932g"
FT                   /old_locus_tag="CAGL-IPF6991"
FT                   /old_locus_tag="CAGL-CDS3119.1"
FT   CDS_pept        complement(881038..882105)
FT                   /locus_tag="CAGL0J08932g"
FT                   /old_locus_tag="CAGL-IPF6991"
FT                   /old_locus_tag="CAGL-CDS3119.1"
FT                   /note="highly similar to uniprot|Q05791 Saccharomyces
FT                   cerevisiae YLR215c CDC123"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61048"
FT                   /db_xref="GOA:Q6FNU7"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU7"
FT                   /protein_id="CAG61048.1"
FT                   /translation="MSEEYAVLSELPVTCSQIDNCAFSFWYEKFKKHVPKSRVIKPLPE
FT                   QFIQYLEQDGIKLPMSSTELSTYTDDVARTEDNEYSDWEGDEDTATEYEPGIEPLNDFP
FT                   ELHNQIKEIIVELGPVTPKLNWSAPKDATWILPNNTTKCNEVNEIYLLLNASNYIVHDL
FT                   NHAYDECIDKKEGFSTPEYELVLRQWFAINPALEFRVFVKDGKVAAVSQRDLNYYDYLD
FT                   KLTDTFKDLIDEFVEDEMVPQFPDKSFVTDLYIPRPFNRVFLIDINPFSRKTDPLLFTW
FT                   NEIININAQPDRDYELRLITENNIGRFASKEHSQNHVPKDVVDASLDPERIRELSQKWS
FT                   ELLLQQEKESSDEEK"
FT   gene            complement(<882437..>883552)
FT                   /locus_tag="CAGL0J08954g"
FT                   /old_locus_tag="CAGL-IPF6990"
FT                   /old_locus_tag="CAGL-CDS2979.1"
FT   CDS_pept        complement(882437..883552)
FT                   /locus_tag="CAGL0J08954g"
FT                   /old_locus_tag="CAGL-IPF6990"
FT                   /old_locus_tag="CAGL-CDS2979.1"
FT                   /note="highly similar to uniprot|P53691 Saccharomyces
FT                   cerevisiae YLR216c CPR6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61049"
FT                   /db_xref="GOA:Q6FNU6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU6"
FT                   /protein_id="CAG61049.1"
FT                   /translation="MTRPKAYFDISIGGTPKGRIVFELYKDVVPKTAENFLKLCEGKSG
FT                   MAKSKPDVPLSYKGSIFHRVIKDFMIQFGDFTNFDGTGGESIYGEKFEDENFEIKHDKP
FT                   FLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIEGKRLVRLIEKQQTEDGTDKP
FT                   MHDVKVEGCGLLPDDYEVPADAEQTPTDEFGDNYEESLKDDAKVDLKKVETVIKAIETV
FT                   KDIGTKQFKEQNYEVALAKYKKCDKFLKEYFPDDLNEEDMKKINDFKVTVPLNIAIAAL
FT                   KSKDYRSVMVACSEVLYAEAADAKAKAKALYRRGLAYYHVNDTDMALADLEMATTFQPN
FT                   DAAIAKAINDTIKKRKQETEKQKKSLSKMFG"
FT   gene            complement(<883894..>884154)
FT                   /locus_tag="CAGL0J08976g"
FT                   /old_locus_tag="CAGL-IPF13756"
FT   CDS_pept        complement(883894..884154)
FT                   /locus_tag="CAGL0J08976g"
FT                   /old_locus_tag="CAGL-IPF13756"
FT                   /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
FT                   YLR218c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61050"
FT                   /db_xref="GOA:Q6FNU5"
FT                   /db_xref="InterPro:IPR039870"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU5"
FT                   /inference="similar to AA sequence:UniProtKB:Q05809"
FT                   /protein_id="CAG61050.1"
FT                   /translation="MSESRYYKEALEQYKEMVEEEQDGSERDSWDKRITDTGCYVENLA
FT                   LQLCHAETNDWRQCFPEMAKFKECWESNGNRDRVKTVDRDS"
FT   gene            <884779..>888624
FT                   /locus_tag="CAGL0J08998g"
FT                   /old_locus_tag="CAGL-IPF6987"
FT                   /old_locus_tag="CAGL-CDS0202.1"
FT   CDS_pept        884779..888624
FT                   /locus_tag="CAGL0J08998g"
FT                   /old_locus_tag="CAGL-IPF6987"
FT                   /old_locus_tag="CAGL-CDS0202.1"
FT                   /note="highly similar to uniprot|P38968 Saccharomyces
FT                   cerevisiae YDL195w SEC31 component of the COPII coat of
FT                   ER-golgi vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61051"
FT                   /db_xref="GOA:Q6FNU4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR021614"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040251"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU4"
FT                   /protein_id="CAG61051.1"
FT                   /translation="MVRIAEYSRTATFAWSNDRIPYLVSGTASGTIDADFSNESKLELW
FT                   SLLGTDADKPSHSVSTDAKFKDLDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQGSF
FT                   KNHSTVVRTVKFNSKQNNVLLSGGNSQEIFIWDLNKLLDSKANYQPLTPGVSMSPIDEI
FT                   HSLSWNKSLAHVFASASNSSFASIWDLKAKKEVIHLSYTSQNTGLKSDFSAVEWHPLNS
FT                   TRVATATSNDNEPLILVWDLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDENLLLS
FT                   SARDSSVMLWNPQSGEALTEYNTTGNWCFKSKFAPQAPDLFAFATLDGKKIEVQTLQNY
FT                   ETTLDEEVSKTKQQESETDFWNHVSEEKAEIKSTVVHLQAPSWYGNKSASAQWAFGGKL
FT                   VQVTKDGKGVEVNKPEITDLKSDDTLKNALASKDFQPLINQRLVKVVNETNEEDWNLLE
FT                   KLSMDGKEEFLKEALELDEEEDEEKDQEGKDGDEFFQKIESNFQPSGSFKIDSNEESVI
FT                   NNILSGNNSKAVSELLKSGSILEAFVVAVTCNDEKLKEDVKDAYFAAHGKESSLSRVLF
FT                   SSSKKNSDDIVENLDISQWKYITKSIYNFHANDEVERTNKLLQLGDRLLANKNRQDALV
FT                   IYIAAGSLDKIATVWLNEFSTLENKIKDQEKTIYEAHIECLTEFVERFTILSNFVGKKQ
FT                   KITNESLISKFLEFINITSATGNFDLALLFLDILPEDNEYVIAEKKRVMVASGKVVDQS
FT                   QSRKGKYGSHANLASAGFSGHAKQPVNLPPTAAPFAAQTMGGYAPQAVGAVPTPAVPVP
FT                   QTRNASVSIKSNPYGPAGTNVGTSDNKFNAYAPPTHTQVPVATPVTSSFIPPANPYSNV
FT                   AAQSLAMAAEQNAMSPNLAGSAPPVKSPSVYSGQTPHLNKKANDGWNDLALPVKEKPQR
FT                   AKPVTVAPSPILAPATNGAAAAVPTKSIGTVFPPTGGNSRVPSSMVSPPPPQKRASRTP
FT                   SLINIDDVVNARPKAHTSIYAPQTTQAGPAPVAPQSDIPLAPTANPYAPNQSVGSTPLQ
FT                   KPVNPYAPPAQQAGIPSAANPYASQIPSKAPVNAPPPMSSKKAPVGPPPMSSRKKAHEG
FT                   KTLSHEAASVLDSSKPVQTQPIASELSREPAPVPTSASQTQVPPPVQETPARNTISPID
FT                   MAAPAVEQGISAAQQPIRDFFSSELARVTPLTPKEYNKQLKDCDKRLKILFTHLEKNLL
FT                   SQPTVDKLLHIIELLKEKKYHEAMEVHKDIATNHAEEGGNWLTGVKRLISISEATA"
FT   gene            <889269..>891839
FT                   /locus_tag="CAGL0J09020g"
FT                   /old_locus_tag="CAGL-IPF6983"
FT                   /old_locus_tag="CAGL-CDS0677.1"
FT   CDS_pept        889269..891839
FT                   /locus_tag="CAGL0J09020g"
FT                   /old_locus_tag="CAGL-IPF6983"
FT                   /old_locus_tag="CAGL-CDS0677.1"
FT                   /note="highly similar to uniprot|P10870 Saccharomyces
FT                   cerevisiae YDL194w SNF3 or uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138w RGT2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61052"
FT                   /db_xref="GOA:Q6FNU3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU3"
FT                   /protein_id="CAG61052.1"
FT                   /translation="MTIISEDEKSVARDREGVLARAIKVVNRKFRRKDVRREKLERALS
FT                   CDNQMTLNSTNLYAAQQQEYQRREENDIEENQEPEGGNDDIDYDISILSDEMSTVDDAS
FT                   LLFAEPPQKQSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDMRYVRENIAPNHVGFTAQ
FT                   QLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHNIQLLIA
FT                   GRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGTHNRND
FT                   ASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPIHDSGLL
FT                   EELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSGINFIFYY
FT                   GVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIMTLSNFIIA
FT                   IVGSSTQSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKCTAICAAANW
FT                   LINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVYETRGLTLEEIDE
FT                   LYTKSPNGIVSAKWNRRIRHREKTYGHKEQQNRDRNQQTTKENLRKNVVNEDMLSDDLT
FT                   PRNDSINTHHSVDSNEKYQSENTDNTLAPAVNDRSMMDFGNDMILHICNRGPPSISTAA
FT                   SVEEFGGNSTQMENLSYNESNSVEKKKVGLFSKFKLGSRKSSINGTEEDSKPKSPQLGQ
FT                   AEFSPSPLDVKVSDDDHNDFVDLGNGFGLYSVTRRLSSGVPDTSDEESAYDLGNAPSST
FT                   NTYRNRGNLDSINTYMSQLIQSNTYTSQNTGYSQNDNDQTQHHQ"
FT   gene            <892829..>893920
FT                   /locus_tag="CAGL0J09042g"
FT                   /old_locus_tag="CAGL-IPF6980"
FT                   /old_locus_tag="CAGL-CDS3044.1"
FT   CDS_pept        892829..893920
FT                   /locus_tag="CAGL0J09042g"
FT                   /old_locus_tag="CAGL-IPF6980"
FT                   /old_locus_tag="CAGL-CDS3044.1"
FT                   /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
FT                   YDL193w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61053"
FT                   /db_xref="GOA:Q6FNU2"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12063"
FT                   /protein_id="CAG61053.1"
FT                   /translation="MVEIRDDLVEDIVELTRRIPILHIEESGPLLVDLAPEKECLTNGS
FT                   ANTKIRYAQAILDSVLTEFGGGNSGSSFYEIQVPDGDVKKGRLIFRQFSKLEKFVYKIL
FT                   LAIIFFVFGMLRYALYQYNQMRLSLLHLIYNPSRIPHLIRRDTLRLKKMPTRVAFILEA
FT                   KPIGQVGGGLYGLLSNAAEVVSWSVYAGVKEVILYDMDGYFQKNIFHLEDEIYSSLTNY
FT                   SSRNSIPNFTIYVPHSGKTYKRYHTGNNESREHISITVLSHIDGRPTVVNVVKSIIQLC
FT                   KESKMSVGEISMELVNSVLTRLVCDEPDLLVYFGPTLDLQGFPPWQIRLTELFWEQDNN
FT                   RVSYSVFIRALNHYSNCKINLGK"
FT   gene            <894680..>895225
FT                   /locus_tag="CAGL0J09064g"
FT                   /old_locus_tag="CAGL-IPF6978"
FT                   /old_locus_tag="CAGL-CDS4595.1"
FT   CDS_pept        894680..895225
FT                   /locus_tag="CAGL0J09064g"
FT                   /old_locus_tag="CAGL-IPF6978"
FT                   /old_locus_tag="CAGL-CDS4595.1"
FT                   /note="highly similar to uniprot|P11076 Saccharomyces
FT                   cerevisiae YDL192w ARF1 or uniprot|P19146 Saccharomyces
FT                   cerevisiae YDL137w ARF2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61054"
FT                   /db_xref="GOA:Q6FNU1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU1"
FT                   /protein_id="CAG61054.1"
FT                   /translation="MGLFASKLFSNLFGSKEMRILMVGLDGAGKTTVLYKLKLGEVITT
FT                   IPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR
FT                   EVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSG
FT                   EGLYEGLEWLSNNLSNQS"
FT   gene            <897205..>898194
FT                   /locus_tag="CAGL0J09086g"
FT                   /old_locus_tag="CAGL-IPF6974"
FT                   /old_locus_tag="CAGL-CDS5125.1"
FT   CDS_pept        join(897205..897207,897835..898194)
FT                   /locus_tag="CAGL0J09086g"
FT                   /old_locus_tag="CAGL-IPF6974"
FT                   /old_locus_tag="CAGL-CDS5125.1"
FT                   /note="highly similar to uniprot|P39741 Saccharomyces
FT                   cerevisiae YDL191w SOS1 or uniprot|P39741 Saccharomyces
FT                   cerevisiae YDL136w SOS2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61055"
FT                   /db_xref="GOA:Q6FNU0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU0"
FT                   /protein_id="CAG61055.1"
FT                   /translation="MAGVKAYELRTKSKEQLENQLLSLKKELAELQVQKLSRPSLPKIH
FT                   TVRKDIARVLTIINEQQREAVRQLYKGKKYQPKDMRAKKTRALRRALTKFEATRVTEKQ
FT                   KKKQIAFPQRKYAIKA"
FT   gene            complement(<898456..>901299)
FT                   /locus_tag="CAGL0J09108g"
FT                   /old_locus_tag="CAGL-IPF6972"
FT                   /old_locus_tag="CAGL-CDS0519.1"
FT   CDS_pept        complement(898456..901299)
FT                   /locus_tag="CAGL0J09108g"
FT                   /old_locus_tag="CAGL-IPF6972"
FT                   /old_locus_tag="CAGL-CDS0519.1"
FT                   /note="highly similar to uniprot|P54860 Saccharomyces
FT                   cerevisiae YDL190c UFD2 ubiquitin fusion degradation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61056"
FT                   /db_xref="GOA:Q6FNT9"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT9"
FT                   /protein_id="CAG61056.1"
FT                   /translation="MELIIEDIFQVKLPGSETNNPQYTVLSDEIDRNIDGIILAQLTEN
FT                   EQLLEPFAYLNNCYNRTLTRRRKNKNAKELQSSFDEIETLLVGYGLVAFQIEEFCMNGN
FT                   FKNYIKKIIEKVDDYTNFIPKIIERANQEGSLLEFLTNVFTNLQFYLTKDMAMFDINDS
FT                   MTYNNTLSIYEMFLTFKPVAAIFTKVEGFFADYNCKANEFEKVTILGPILTLSPLNPNV
FT                   ALRNYGDNLERSKQQTMIIHESLQAEHKVIIERLFFVIDKIIRGSEESRSDMISYFAQI
FT                   VNKNHLRRGDHANQNKLASNAFMTNITLILVKFSQPFLDVSYKKIDKIDVNYFNTLNLY
FT                   LDLSQETRLNSDFKEADEFYDRNKKDAEMKPNFISDCFFLTLTYLQYGLGGTLLYDEKI
FT                   TPQLKRLREEIERVKEAANSQDMFASFANMQLKQMEKTLKITQSIRSALQGFFTHRNMQ
FT                   LEVFDFICGASTFLMRVIDPNHQYPAQAFKLPLIPDQVGFENVDNAEYLRKNAPVPFKY
FT                   YPEFCVEGPINYALYIAQYSTSPLFRNPRLQSFLEFGTTILRCPELVSNPHLKGKLVQL
FT                   FSVGAMPLTDGSPGFMMEIFEHDELIKENLLYALLDFYVIVEKTGSSSQFYDKFNSRYS
FT                   ISIILEELYSRIPLYKNQLIWQSQKNSDFFIRFVARMLNDLTFLLDEGLSSLADVHNIQ
FT                   NEIENRAKGNQPTREENDQELQSKLMSAERQAKSSCGLAGKSLKLFEIFTADIPSAFCS
FT                   SEIVDRLASMLNYNLVSLVGPKCGELKVKNPEKYSFHPKQLLKALTTVYVNLAGEDEFI
FT                   SAIARDSRSFDTALFERAVHILQSKIGLVSPEFCDKLMNLALKAEERKNAEEEEDMEYG
FT                   DAPEEFLDPLMYTIMKDPVTLPTSKVNIDRATIKAHLLSDSTDPFNRMPLKLEQVIPNT
FT                   ELKQKIEEYKKNKKMKK"
FT   gene            <902880..>904658
FT                   /locus_tag="CAGL0J09130g"
FT                   /old_locus_tag="CAGL-IPF6971"
FT                   /old_locus_tag="CAGL-CDS1546.1"
FT   CDS_pept        902880..904658
FT                   /locus_tag="CAGL0J09130g"
FT                   /old_locus_tag="CAGL-IPF6971"
FT                   /old_locus_tag="CAGL-CDS1546.1"
FT                   /note="some similarities with uniprot|Q05672 Saccharomyces
FT                   cerevisiae YDL189w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61057"
FT                   /db_xref="GOA:Q6FNT8"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT8"
FT                   /protein_id="CAG61057.1"
FT                   /translation="MEEKPNVSNSESSSKNVNDLDCEELGLSPAMITALFKRPHDRQFI
FT                   IDKEQAIINFIDSNQNSLELRPMNSYYRMLSHQIAEYHHLRHVIARSNDVSVILFKVED
FT                   THKFRNKKPLLKSLEPLYVTENKSTVSEEESKPANNSAGNTKKFKILKRSKSKDDAITD
FT                   NSSQENIQLTSETPETPLQESNNSSSSALLEEQRLKKEEEYNQIRQNLFENVNGDEVID
FT                   DNSLNDEDDGVHTDLSEVFGDVKTNNDSENQDTANGKDESTSAPYYRVKIVQEKFGGIN
FT                   DSKNGASPQPDEFQTSRNSLLTNQEYQYHYKGYQNRNSRRSFHSSNSASSLGNDMNPGY
FT                   KSKNRSGSFTRRSSNSSINSRRSSYNNNSEYGGLHYGKYMQQIPQGTPAGFPMPYMMYP
FT                   PHQMMQYQQIPHLGMFAGAGTIPIDGAGVPFSTSAPYMYPIPIPPTTDGINVPGNAAGS
FT                   MTANFTPFSPSLPNGVHMSPIMVPSVPRYNLNSTNHRSHYSSNNSESKGYTRNNKYQKN
FT                   SYRNKITTEGGSNESFDGSESEKSIDNGSNNNDREGNAPSYRSRGNEKGNSVSGDNSPK
FT                   GEDILSLNQNLKTLSI"
FT   gene            complement(<905105..>905707)
FT                   /locus_tag="CAGL0J09152g"
FT                   /old_locus_tag="CAGL-IPF6967"
FT                   /old_locus_tag="CAGL-CDS4447.1"
FT   CDS_pept        complement(905105..905707)
FT                   /locus_tag="CAGL0J09152g"
FT                   /old_locus_tag="CAGL-IPF6967"
FT                   /old_locus_tag="CAGL-CDS4447.1"
FT                   /note="highly similar to uniprot|Q12434 Saccharomyces
FT                   cerevisiae YDL135c RDI1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61058"
FT                   /db_xref="GOA:Q6FNT7"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT7"
FT                   /protein_id="CAG61058.1"
FT                   /translation="MSEPDFNDFEESTNDDKYKVSEKKTVDEYKKLDAEDESLAKWKES
FT                   LGLSSDVLPLEFPGDTRKVVIQKIQLLVDTEKEPITFDLTNETTIKELASKRYKVKEKS
FT                   IYKLRITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKQKPFYEVELPESE
FT                   APSGFLARGNYSAVSKFIDDDKTTHLTLNWGVEIVKK"
FT   gene            <906232..>907293
FT                   /locus_tag="CAGL0J09174g"
FT                   /old_locus_tag="CAGL-IPF6966"
FT                   /old_locus_tag="CAGL-CDS3132.1"
FT   CDS_pept        906232..907293
FT                   /locus_tag="CAGL0J09174g"
FT                   /old_locus_tag="CAGL-IPF6966"
FT                   /old_locus_tag="CAGL-CDS3132.1"
FT                   /note="some similarities with uniprot|P48568 Saccharomyces
FT                   cerevisiae YDL186w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61059"
FT                   /db_xref="GOA:Q6FNT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT6"
FT                   /protein_id="CAG61059.1"
FT                   /translation="MSKFARINLETASPLDLVFNLDSNDSQRGVDGTLDHGLSKNKYFL
FT                   PQDANVSSVRELVIDSQSKRKLRLGNRFVEKMEDNLVKWRPPLSSNRGTVMAIEGKHPY
FT                   QIAAEIYAPNCDPELFRTADQNNGNATQRQMSHTMFDSFTHWWKENARGALELRRQQFE
FT                   EEILGLSDLQDMDQVVEVTVAPAIKEEPQLEDTGMNTETQSALTNNTAELARLISQEDE
FT                   RRLEISDLSNSGISSGVSSQGTFLARPIVKTPPAAVVRRRQQLQQELKRTGAVPQIYEE
FT                   VYNAPVPVAYLPVSNNDPRYSQQLSQRQREHVSQNDGPLWSCSQTDIVSKLNEWSVAIM
FT                   NCLTPITQDHINP"
FT   gene            <907869..>909281
FT                   /locus_tag="CAGL0J09196g"
FT                   /old_locus_tag="CAGL-IPF6965"
FT                   /old_locus_tag="CAGL-CDS2250.1"
FT   CDS_pept        907869..909281
FT                   /locus_tag="CAGL0J09196g"
FT                   /old_locus_tag="CAGL-IPF6965"
FT                   /old_locus_tag="CAGL-CDS2250.1"
FT                   /note="similar to uniprot|Q12516 Saccharomyces cerevisiae
FT                   YDL133w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61060"
FT                   /db_xref="GOA:Q6FNT5"
FT                   /db_xref="InterPro:IPR037737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12516"
FT                   /protein_id="CAG61060.1"
FT                   /translation="MERMVKDVVGHPQDPDERSDNSVSDQPRVDGGKQSNKGNVGHGNG
FT                   VSDHKRQMVSLNPYGLYPSTVPPFVLESDFRRLHGINDDFNDREVRWANFIGNVGSNVA
FT                   YSTEQRLPSRGIANNATLRHNYSVGNIKDQPNRHIEDIIDPLVSTGNNSINESASLDHE
FT                   EMERKRKIQEEILYDLDSEWKGGERLDAVFNFSVNKDFEFKNEKDRIDWVNYISKVKNA
FT                   YYAPNKESSGINDESSSSLSQQQEGNRGDRQNYDWIEELNKEKEKWKKLKQRKIQKWKP
FT                   ALSNLLFYNQYLPLGFRIVIGILCLISLGLSVRIYQNSDSSIEQVEGGGADLDTGIPQQ
FT                   ASTIMAICVNTIAIAYTFYIAIDEFSGKPLGLRNPLGKLKLILLDLLFIIFASANLALA
FT                   FNTRFDKEWVCTGLGVTIAEEEVYYPKIPYICRKQKALASFLFVLLFAWVVTFSVSIAR
FT                   VVDKVHSSATRD"
FT   gene            <910167..>912635
FT                   /locus_tag="CAGL0J09218g"
FT                   /old_locus_tag="CAGL-IPF6963"
FT                   /old_locus_tag="CAGL-CDS0757.1"
FT   CDS_pept        910167..912635
FT                   /locus_tag="CAGL0J09218g"
FT                   /old_locus_tag="CAGL-IPF6963"
FT                   /old_locus_tag="CAGL-CDS0757.1"
FT                   /note="highly similar to uniprot|Q12018 Saccharomyces
FT                   cerevisiae YDL132w CDC53 controls G1/S transition"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61061"
FT                   /db_xref="GOA:Q6FNT4"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT4"
FT                   /protein_id="CAG61061.1"
FT                   /translation="MSENLPRSDDLDATWNFIQPGIDQILGNDSTEVTNKKVQKILSPT
FT                   MYMEIYTAIYNYCVNKSRSSGHFNADRQQSGSSGQSSILVGSEIYERLKKYLRHYISNF
FT                   KKDSNETFLQFYVRRWKRYTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMT
FT                   WKEVLFDPHSDELITEILDQITAERNGEIIQRDHITTSIKSLVALGIDPQDLKKLNLNV
FT                   YIQVFEKKFLKKTETYYQQYSEDYLTTHSVTEYIFKAHEIISREEKGMAMYWDDHTKKP
FT                   LSETLNEVLVKSHIEKLESEFIVLLDSRDNSKISALYSLILRDFSLLPRLANVFEEYIR
FT                   KSGENEVSQLISAHKAAVMEASADGNGTKKMAMATTQSLPPKDYIKALLKVYNTFKNID
FT                   RECFPTDPLFAKALDNACRAYININEFALPSGSSRSATSKTSEMLAKYSDQLLKKSTKP
FT                   EVANDMSDDDIITIFKFITDKDAFESHYRRLFAKRLIHGTSTSSDDEESIIKRLQTENS
FT                   MEYTGKITKMFQDVRLSKMLESDFDVMIKSQSDYSREKFPELQPFVLAENMWPFSYQEV
FT                   DFRLPEELVASHKKLESMYIGKHNGRILKWLWPLCRGELKADIGKPGRVPFVFTVTLFQ
FT                   MSILLLFNDKDVLTFEEIQEGTNLNIQNIASSMVPFIKFKLVQQLPPGLDNLVKGDTQF
FT                   KLNRPYKAVKTQINFAAGVKNDILGTISKSSNSVSNGVSGISDEKLSESEKIEKELNAE
FT                   RQMFLEACIVRIMKTKRNLPHSTLVNECIAQSHQRFKAKISMIKRAIDSLIQKGYLQRG
FT                   EDGESYTYLA"
FT   gene            <913793..>915106
FT                   /locus_tag="CAGL0J09240g"
FT                   /old_locus_tag="CAGL-IPF6962"
FT                   /old_locus_tag="CAGL-CDS2499.1"
FT   CDS_pept        913793..915106
FT                   /locus_tag="CAGL0J09240g"
FT                   /old_locus_tag="CAGL-IPF6962"
FT                   /old_locus_tag="CAGL-CDS2499.1"
FT                   /note="highly similar to uniprot|Q12122 Saccharomyces
FT                   cerevisiae YDL131w LYS21 or uniprot|P48570 Saccharomyces
FT                   cerevisiae YDL182w LYS20"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61062"
FT                   /db_xref="GOA:Q6FNT3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT3"
FT                   /protein_id="CAG61062.1"
FT                   /translation="MDQYQQVTESTPTVETSNPYGPNPADFLSNVKEFQLIDSTLREGE
FT                   QFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSFRDCKAICNLGLKAKILTHIR
FT                   CHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEIRF
FT                   SSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSCDIEC
FT                   HFHNDTGCAIANAYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKY
FT                   KLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFG
FT                   MKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVTTKIKKLGDIRPLNIDDVDSIIK
FT                   DFHADLATPMVRPTEDGADNEEPLQLDEPAKKKSKLSQ"
FT   gene            <915500..>915799
FT                   /locus_tag="CAGL0J09262g"
FT                   /old_locus_tag="CAGL-IPF11674"
FT                   /old_locus_tag="CAGL-CDS5592.1"
FT   CDS_pept        915500..915799
FT                   /locus_tag="CAGL0J09262g"
FT                   /old_locus_tag="CAGL-IPF11674"
FT                   /old_locus_tag="CAGL-CDS5592.1"
FT                   /note="similar to uniprot|P01098 Saccharomyces cerevisiae
FT                   YDL130wa STF1 or uniprot|P01097 Saccharomyces cerevisiae
FT                   YDL181w INH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61063"
FT                   /db_xref="GOA:Q6FNT2"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT2"
FT                   /inference="similar to AA sequence:UniProtKB:P01098"
FT                   /protein_id="CAG61063.1"
FT                   /translation="MPKNTLRSNDKFQSIKKMLAARTGSRAILRIRPQAVIRQYSDGFM
FT                   ATGNGIFDQREKAKEDYFIRQHEREQLQKLKEQLEHHKSKVKDIQEKIDKLSKK"
FT   gene            <916357..>917022
FT                   /locus_tag="CAGL0J09284g"
FT                   /old_locus_tag="CAGL-IPF6960"
FT                   /old_locus_tag="CAGL-CDS4244.1"
FT   CDS_pept        916357..917022
FT                   /locus_tag="CAGL0J09284g"
FT                   /old_locus_tag="CAGL-IPF6960"
FT                   /old_locus_tag="CAGL-CDS4244.1"
FT                   /note="similar to uniprot|Q07555 Saccharomyces cerevisiae
FT                   YDL129w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61064"
FT                   /db_xref="GOA:Q6FNT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT1"
FT                   /inference="similar to AA sequence:UniProtKB:Q07555"
FT                   /protein_id="CAG61064.1"
FT                   /translation="MSESSKFRPPIAETKKLESDILAIIQRLRDDEAGEGQVAKDEVIS
FT                   VLNRSLTALSHWVLQAQLMELDPNNQDRVAVENSLLKKEVEFLSGKASQKRLHPIQIPP
FT                   SQLKEPSERPYKVDVHTPVKEKRKKKIDISQITPKRGEFSPKQQNTGTKYDAEKSPTGR
FT                   SLNTRRTSGEPLSPKGLHEPGTQFKLVENKKPHPRMRRTSDNPSRNEYVRVFHLEKEK"
FT   gene            <917765..>918973
FT                   /locus_tag="CAGL0J09306g"
FT                   /old_locus_tag="CAGL-IPF6959"
FT                   /old_locus_tag="CAGL-CDS2755.1"
FT   CDS_pept        917765..918973
FT                   /locus_tag="CAGL0J09306g"
FT                   /old_locus_tag="CAGL-IPF6959"
FT                   /old_locus_tag="CAGL-CDS2755.1"
FT                   /note="highly similar to uniprot|Q99385 Saccharomyces
FT                   cerevisiae YDL128w VCX1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61065"
FT                   /db_xref="GOA:Q6FNT0"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT0"
FT                   /protein_id="CAG61065.1"
FT                   /translation="MDSTAPLLGPNSRQTALSTYSAAKRDLIYVCASSPLHLLLIFVPL
FT                   GIIWGYMELSHTWTFVFNFLAIIPLAAILAHATEELADKAGSTIGGLLNATFGNAVELI
FT                   VSVIALKEGQVRIVQASMLGSLLSNLLLVLGFCFLFGGYNRIQQTFNQTAAQTMSSLLA
FT                   ISCASLLIPAAFKATLPHGKEDWIVDDKILHLSRGTSLILLMIYVLFLVFQLGSHHAMF
FT                   EQQHEETDEVVSELSIKPHQSLSIRSSLWFLLLSTVIVSICADYLVGTIDNVVESTGLS
FT                   KTFIGLIVIPIVGNAAEHVTSVMVAMKDKMDLAISVAIGSSLQIALFVTPFMVLVGWWI
FT                   DVPMTLNFSTFETTTLFIAVFLSNYLILDGESNWLEGVMSLAMYVLIAMAFFYYPDVMA
FT                   DAA"
FT   gene            <920703..>921596
FT                   /locus_tag="CAGL0J09328g"
FT                   /old_locus_tag="CAGL-IPF6958"
FT                   /old_locus_tag="CAGL-CDS3627.1"
FT   CDS_pept        920703..921596
FT                   /locus_tag="CAGL0J09328g"
FT                   /old_locus_tag="CAGL-IPF6958"
FT                   /old_locus_tag="CAGL-CDS3627.1"
FT                   /note="similar to uniprot|P25693 Saccharomyces cerevisiae
FT                   YDL127w PCL2 and similar to uniprot|Q12477 Saccharomyces
FT                   cerevisiae YDL179w PCL9"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61066"
FT                   /db_xref="GOA:Q6FNS9"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS9"
FT                   /inference="similar to AA sequence:UniProtKB:P25693"
FT                   /protein_id="CAG61066.1"
FT                   /translation="MSDIEALLQFNRKPVSQEMITYLARSTESIIQVRETHSMIDVAIP
FT                   APKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLILSA
FT                   KTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNLTLSTNDLIQSLAPFLKPI
FT                   KDQIIRSRQQELLLFNAPTPSQLKSYMNSPQSRSSSYNSIPSLSSSNTISTINSSRSRS
FT                   SLNYSANIQTIPEGESDVVSQRKTSLSNLDPNKYANTSVSEKRKSSRPIILKTGLDKPM
FT                   VAGQTKIKRSNWTNFF"
FT   gene            complement(<922018..>924510)
FT                   /locus_tag="CAGL0J09350g"
FT                   /old_locus_tag="CAGL-IPF6957"
FT                   /old_locus_tag="CAGL-CDS0734.1"
FT   CDS_pept        complement(922018..924510)
FT                   /locus_tag="CAGL0J09350g"
FT                   /old_locus_tag="CAGL-IPF6957"
FT                   /old_locus_tag="CAGL-CDS0734.1"
FT                   /note="highly similar to uniprot|P25694 Saccharomyces
FT                   cerevisiae YDL126c CDC48"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61067"
FT                   /db_xref="GOA:Q6FNS8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS8"
FT                   /protein_id="CAG61067.1"
FT                   /translation="MGEEHKPLLDGSGAEPTVEDSTATAILRRKKKDNTLIVDDATNDD
FT                   NSVIAINSNTMDKLELFRGDSVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRV
FT                   RLGDLVSIHPCPDIKYASRISVLPIADTIEGITGNLFDVYLKPYFVEAYRPVRKGDHFV
FT                   VRGGMRAVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQ
FT                   MAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLING
FT                   PEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLT
FT                   LMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMK
FT                   LADDVDLETLAAETHGYVGADIASLCSEAAMQQIREKMDLIDLEEDEIDAEVLDSLGVT
FT                   MDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFG
FT                   LAPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKA
FT                   RAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNR
FT                   PDQIDPAILRPGRLDQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSG
FT                   ADLSYIVQRAAKYAIKDSIEAHRESLAAAEAEVKTEGGDVDMTSEDVKKEPVETVDPVP
FT                   YITREHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNFGDSNQGTTETGNDG
FT                   NSGANFGSAGDDDDDLYS"
FT   gene            complement(<924990..>925576)
FT                   /locus_tag="CAGL0J09372g"
FT                   /old_locus_tag="CAGL-IPF6953"
FT                   /old_locus_tag="CAGL-CDS4936.1"
FT   CDS_pept        complement(join(924990..925372,925522..925576))
FT                   /locus_tag="CAGL0J09372g"
FT                   /old_locus_tag="CAGL-IPF6953"
FT                   /old_locus_tag="CAGL-CDS4936.1"
FT                   /note="highly similar to uniprot|Q04344 Saccharomyces
FT                   cerevisiae YDL125c YHI1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61068"
FT                   /db_xref="GOA:Q6FNS7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS7"
FT                   /protein_id="CAG61068.1"
FT                   /translation="MSASVAHDAACIFCKIIKGEIPSFKLIETKHVYSFLDIQPTSQGH
FT                   ALVIPKWHGAKLHDIPDEYLHDVLPTAKKIAKALNLDADGNYNILQNNGRLAHQEVDHV
FT                   HFHLIPKPDEKTGLIVGWPAKQADMDQLAKFHKELVAKLES"
FT   gene            <925839..>926774
FT                   /locus_tag="CAGL0J09394g"
FT                   /old_locus_tag="CAGL-IPF6951"
FT                   /old_locus_tag="CAGL-CDS3507.1"
FT   CDS_pept        925839..926774
FT                   /locus_tag="CAGL0J09394g"
FT                   /old_locus_tag="CAGL-IPF6951"
FT                   /old_locus_tag="CAGL-CDS3507.1"
FT                   /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
FT                   YDL124w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61069"
FT                   /db_xref="GOA:Q6FNS6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS6"
FT                   /inference="similar to AA sequence:UniProtKB:Q07551"
FT                   /protein_id="CAG61069.1"
FT                   /translation="MVKQEFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQL
FT                   KYALSLPGVVHLDAAEFYMTYREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLE
FT                   TGLKRLGLEYVDLYLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDL
FT                   ERVLKVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQ
FT                   PFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVT
FT                   EITKLGLDHEPLRLYWHDQYNKYNSESQKA"
FT   gene            complement(<926972..>927418)
FT                   /locus_tag="CAGL0J09416g"
FT                   /old_locus_tag="CAGL-IPF6950"
FT                   /old_locus_tag="CAGL-CDS4857.1"
FT   CDS_pept        complement(926972..927418)
FT                   /locus_tag="CAGL0J09416g"
FT                   /old_locus_tag="CAGL-IPF6950"
FT                   /old_locus_tag="CAGL-CDS4857.1"
FT                   /note="similar to uniprot|Q07549 Saccharomyces cerevisiae
FT                   YDL123w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61070"
FT                   /db_xref="GOA:Q6FNS5"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS5"
FT                   /inference="similar to AA sequence:UniProtKB:Q07549"
FT                   /protein_id="CAG61070.1"
FT                   /translation="MCCCTFPDFLLMLLAFIFPPAAVVIRSGIASSDLVLNMLLTMCGF
FT                   VPGCIHAIYYISMTSPLRNDDYSTRYQQGWIDSERLVSSNSDTRPVPLATHDPTPQVES
FT                   SQGETPQATNDEVSRGYDVQTPLLNDPGYIVDNKKGGMPPPYSP"
FT   gene            <928134..>928207
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0J09438r"
FT   tRNA            928134..928207
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0J09438r"
FT                   /product="transfer RNA-Ile"
FT   gene            complement(<928455..>929489)
FT                   /locus_tag="CAGL0J09460g"
FT                   /old_locus_tag="CAGL-IPF6949"
FT                   /old_locus_tag="CAGL-CDS3210.1"
FT   CDS_pept        complement(928455..929489)
FT                   /locus_tag="CAGL0J09460g"
FT                   /old_locus_tag="CAGL-IPF6949"
FT                   /old_locus_tag="CAGL-CDS3210.1"
FT                   /note="similar to uniprot|P40507 Saccharomyces cerevisiae
FT                   YIL079c and similar to uniprot|Q12476 Saccharomyces
FT                   cerevisiae YDL175c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61071"
FT                   /db_xref="GOA:Q6FNS4"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS4"
FT                   /inference="similar to AA sequence:UniProtKB:P40507"
FT                   /protein_id="CAG61071.1"
FT                   /translation="MTSLSEVETMDTLPFVKDTTPMSNDDIKVVAPSIEQVGNDPNELR
FT                   FLRGEGRYFGLDDSEGIKEPEPKCRNCSQRGHFKRDCPHVICTFCGSMDDHYSQHCPKA
FT                   IKCANCNKVGHYRSQCPNKWKRVFCTLCNSKLHDRDRCPSLWRSYLLREELTGKGNKKK
FT                   LDLDTDAIYCYNCGGNGHFGDDCNQRRSSRVPKDDGSAFAGNNLRDELRTKYYKKLDQE
FT                   RGKKGRKNNSKVKGNHKRFDDNNNFNYDDYEYDDSIYDEWDNSQLDRKYSGSTKKKNTN
FT                   KKQKKNNNSHRDPLEFPRSKRNDFNDNSKRGNFSRNDDKAKAKNMRWNNSKKNRKSYRS
FT                   TERN"
FT   gene            <929926..>930627
FT                   /locus_tag="CAGL0J09482g"
FT                   /old_locus_tag="CAGL-IPF6948"
FT                   /old_locus_tag="CAGL-CDS4141.1"
FT   CDS_pept        929926..930627
FT                   /locus_tag="CAGL0J09482g"
FT                   /old_locus_tag="CAGL-IPF6948"
FT                   /old_locus_tag="CAGL-CDS4141.1"
FT                   /note="similar to uniprot|Q02685 Saccharomyces cerevisiae
FT                   YPL024w NCE4 negative regulator of CTS1 expression"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61072"
FT                   /db_xref="GOA:Q6FNS3"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="InterPro:IPR042470"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS3"
FT                   /inference="similar to AA sequence:UniProtKB:Q02685"
FT                   /protein_id="CAG61072.1"
FT                   /translation="MSLSDILPNDITTITSLGSFKATPGTRENTIYQALCNVPWLDGLG
FT                   RAQIIETKMLAVDRDLLFQIMMVENISKSKVTQIDDMKTTIDPRNQRVDRLHNSNPNGP
FT                   SKKYKVINEVNIEEDDGNGSTESNGVIGGEKVMYKLTLQSRSGQIFYAINLKPISWPLA
FT                   VLGSKIVIKKGTKFSRGMFLLAEDNAIFVGGMVKKWNEDKDLKILEYLETKANKENERL
FT                   QALKDSRKRKR"
FT   gene            complement(<930802..>932739)
FT                   /locus_tag="CAGL0J09504g"
FT                   /old_locus_tag="CAGL-IPF6947"
FT                   /old_locus_tag="CAGL-CDS1293.1"
FT   CDS_pept        complement(930802..932739)
FT                   /locus_tag="CAGL0J09504g"
FT                   /old_locus_tag="CAGL-IPF6947"
FT                   /old_locus_tag="CAGL-CDS1293.1"
FT                   /note="highly similar to uniprot|P46151 Saccharomyces
FT                   cerevisiae YPL023c MET12 methylenetetrahydrofolate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61073"
FT                   /db_xref="GOA:Q6FNS2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS2"
FT                   /protein_id="CAG61073.1"
FT                   /translation="MSICKTFSDRDGPLISLEFFPPKTESGKRNLLERMERMSALDPLF
FT                   ITVTWGAGGSTSEKTLELAQIAQRDLNVPICMHLTCTNMDTTLIKEALDACRSYGIKNI
FT                   LALRGDAPIEDQWDDKTINSSEGPEFRYAVDLVRYIKENYGDEFCIGVAAYPEGHCEGE
FT                   AEGNEQDPLKDLVFLKEKIDAGAQFVITQLFYDVSKFLDFEKMFREQISETIPVFPGLM
FT                   PINSFSLFHRAARLSHASIPKAVLDRFPQEIQNDDGIVKSIGVDVLIDIIEEIYSKTNG
FT                   RVKCFHFYTLNLEKAVAQIVSQSSTLSKILEESDNEEDQVVSQDEDGDIVLVDQHEENP
FT                   LKFKRRRQSSSVSADVIFNRAIINRGKTDRNESSELASKKLVVSISRGSGVLGRDATWD
FT                   EFPNGRFGDSRSPAYGEIDGYGPSLKVSNKRAYELWGSPTSIRDLKAVFVKYLEGSIQS
FT                   LPWCDLGLSPETALIQEELIQLNYRGYLTLASQPCTNASSSTDKIFGWGPSKGHVYQKA
FT                   FIEMFVHRQQWKTILKPKLDYYGRRKFSYYAGDSKGSFETNLDPHSSNVVTWGVFPNSQ
FT                   VIQTTIIEEESFKAWRDEAFSIWSEWAKLFPRNTPSNTLLREVHSDYYLVSIVHHDFIE
FT                   TDELWDLLLD"
FT   gene            <933145..>936360
FT                   /locus_tag="CAGL0J09526g"
FT                   /old_locus_tag="CAGL-IPF6945"
FT                   /old_locus_tag="CAGL-CDS0354.1"
FT   CDS_pept        933145..936360
FT                   /locus_tag="CAGL0J09526g"
FT                   /old_locus_tag="CAGL-IPF6945"
FT                   /old_locus_tag="CAGL-CDS0354.1"
FT                   /note="similar to uniprot|P06777 Saccharomyces cerevisiae
FT                   YPL022w RAD1 component of the nucleotide excision
FT                   repairosome"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61074"
FT                   /db_xref="GOA:Q6FNS1"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS1"
FT                   /inference="similar to AA sequence:UniProtKB:P06777"
FT                   /protein_id="CAG61074.1"
FT                   /translation="MQLFVQDDSDDELQLELSQQEEQKQKQFNDSRRLIDETQQKNDEQ
FT                   VSVVSETTVYSPNDEDAILYPLIPDDLDESTEFKPNIEDIRPVDIQLNLSLPFQQQIIE
FT                   DVLATDDPLVIMGKGLGMVPIVSNLLHVLATPTVIKGQLKRSLVVVLNATGSENRQISE
FT                   ELEELNWLVNADDNAGPFASIDEDDDDDPKYSIFNEVTAETLSVEKRRQLYLKGGIVSV
FT                   TSRIFIVDLLSGTIHPNRITGFVVLNADNLRNFSNESFILEIYRSKNRWGFIKAFSNNP
FT                   ESFSMSFSPLINKMKELHLKNVLLWPRFRIEVSASLNNEKVINGQIRSDKVIEVRINPT
FT                   NAMSQIQFGLMGCLKKCIEELTRKNTEISIEYWNIENILDANFIRSIDAIMVPNWHRIS
FT                   FESKQLVKDIKYLKRLLKMLYSSDAVDFYEEVQLSLEANKPSLGRKYSESPWLMAEESQ
FT                   LVISYARQRIFNGQDYVLEELPKWDQLLSILDDIAYEKTTRNIEGSTLIVCNNNTTVLQ
FT                   LRRVISKYDNEFGMRNIMLSKLEWYKMKREERKRIVRDFKKEETEPEVQLSVSSSFAKE
FT                   EVVTKRRRTRGAAAVAAVQKLHSAGSGIDIEDVIENYDFNAEAQGTMKSTSDDLIEDYR
FT                   VEEQEGYYNVEDEGEYDDFENSTLFKEFMKREADLIDQTMQKKKENFEYLDRQDQLLIE
FT                   TFSRIGDDVLFEEMMPSYIIMYEPDLAFIRKVEIFRALKRENPPKIFFLYYGDSAEEQT
FT                   HLLSIKKEKDAFSKLIRENATLAQRFEAQTDLSHFKNLAERKLKLSNIRKTNTRTAGGQ
FT                   LGLRELTQDVVLVDTREFNAALPGLLFRYGVRVIPCMLTVGDYVLTPDICVERKSISDL
FT                   IGSLQNHRLEAQCKKMSKHYKYPTLMIEFDEGQSFSLEPFSERRLYRSRDSSTTHPISN
FT                   KLSQDDIQMKLCKLVMKFPGLRIMWCSSPLQSVNIILELKLGREQPDPNIAIELGLHRK
FT                   MGLSEKSIDNEQSFKKLLSIPVLSKIDYFNIRKKVKTFRKLTKMRLIDIQNVVGNEMVA
FT                   TKVYEFLHNDDNDDDDYDISDLD"
FT   gene            complement(<936524..>940777)
FT                   /locus_tag="CAGL0J09548g"
FT                   /old_locus_tag="CAGL-IPF6943"
FT                   /old_locus_tag="CAGL-CDS0138.1"
FT   CDS_pept        complement(936524..940777)
FT                   /locus_tag="CAGL0J09548g"
FT                   /old_locus_tag="CAGL-IPF6943"
FT                   /old_locus_tag="CAGL-CDS0138.1"
FT                   /note="similar to uniprot|P09547 Saccharomyces cerevisiae
FT                   YPL016w SWI1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61075"
FT                   /db_xref="GOA:Q6FNS0"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS0"
FT                   /inference="similar to AA sequence:UniProtKB:P09547"
FT                   /protein_id="CAG61075.1"
FT                   /translation="MDFFNSGAPEGDDNNMDSPFFNNEMNSTQFLFGDLMDTSNSGNQK
FT                   MDDSQFYNNKPFNDGDIRTQSNNSNMNMNMNISNTSNNNGNNNSNNMNNFVSNPNTPYT
FT                   VPGNFVTNQSPMGSVGSNFDAAPPQNSSAMNNFQASGSLSPQAILAKNSMVDNQILGLN
FT                   FNGADNSNNNMNANMTNTLSPQMTMSNIQSSANTPQQILMFNQSANTPGSSNNMNLSGS
FT                   NSTPGAVGANQDNMNMQFGSNMPSNSIMSTHGSPNIPNQMQQNNLPMNQNSGRSSSNNS
FT                   KISGKDALALQNASPQDRAAILAALQQRQQRRFQALQQQQIRKQQSQQQLQKQAQQQVQ
FT                   QQVHAQKQAQMQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAKAKAQAQAQAQAQAQAQAQAQAQAKAQAQAQAQAQARFKAQNRQAMQQPNS
FT                   PNPANGNLQQQKKSILQNLHPALQQKISMELNNKQYELFMKSLIENCKRIHMPLQSIPE
FT                   IQGKKVNLFYLFMFTQRLGGGEQISRNQQWNFLAQKLQISNAQELEGVYYKLIYPYEKF
FT                   LESPEGQKETQAKKFFLQQFLQELLKKVQQQQGLQQQQGLQQQPSQQPGQIQNQNQGQT
FT                   PTQLQQQAIPQKNQMHFSNQSQNMVGSFDTTNSPMINQQTTFDSKQRKENRRKKASTDT
FT                   PTGTPIATPVPSTSIINLDQNAKKAVKKPRKPRQKKKTKKELELEKKQLEEMQKKQQQY
FT                   IEEQQLQQKMVIEQKLKDQYKKELEKLPKVYKRSLCRNYTPLKRVIQRSNGYDIEYVAK
FT                   VGEKVNANKPIFLFAPELGTVNLHALSMSLQAGNIGEINVALNTLLVTSSDAVLELNIE
FT                   MYPELIESLCILGINLLSNLCENKSDLRLLQTNLFSYVLSDEVESFLSNDTCTFSKTNH
FT                   NIDQIFDKLAKNTVESGNSVRVDSLTGTDILQNSSLNDNQDSKDTIPPMTSEISDLLKP
FT                   IYNNTWDLLPTPVKYLQNQFPNKLHVPSYLLSLRAVKDEVDCPLTKVNTKGAENARILI
FT                   TDQLSTICMILRNASFSEANARILASNPFLRRFFADMLWAVFLDHEKFVFERKRLNFRK
FT                   DIAITLSNIAHLMPFHSSVDGFLLLILILSFGEPKKNSGSLRSDELSYNEYSLTWGKYQ
FT                   SFGVDVLSKLLSTEQSTKNIIMRLLFSFSSATRDDSLSKDELLTKKLVDAYCKGDQYKL
FT                   LNDVVSFLLSVIPFEQINETSSLLYSMTPLISQSITSLLLIVDQVCDEKSVNEYTLKKN
FT                   MPLIWLTTAENYGYKLRSLGKLYNDISGDTNELSKANGNSVMENMEFKKLAPLIGSSCL
FT                   KLVNLMIDKALEIDEKVKTNDKDEIASKTLAAVPELFPGEIESIEIITNQYLHPDILQQ
FT                   TQCLIELKDEILSRA"
FT   gene            complement(<941571..>943220)
FT                   /locus_tag="CAGL0J09570g"
FT                   /old_locus_tag="CAGL-IPF6941"
FT                   /old_locus_tag="CAGL-CDS1772.1"
FT   CDS_pept        complement(941571..943220)
FT                   /locus_tag="CAGL0J09570g"
FT                   /old_locus_tag="CAGL-IPF6941"
FT                   /old_locus_tag="CAGL-CDS1772.1"
FT                   /note="some similarities with uniprot|P35056 Saccharomyces
FT                   cerevisiae YDR244w PAS10 peroxisomal targeting signal
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61076"
FT                   /db_xref="GOA:Q6FNR9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR9"
FT                   /protein_id="CAG61076.1"
FT                   /translation="MDCRGGNSVLQLTRRIDSSLRFGKKLENKVSPRDEASAFLYTNVP
FT                   NAPNVQPTPLAIPSITLNKAASSSTCSSTSSHAHNNVNYCANNDSGYDLVREFKKINEP
FT                   APPTNNYNFTRHVPVSHRPIGFSPRTMGLQQPLNLDGSFDWEREFAQIEGELGESQNVL
FT                   EGTTVSYGGEREHQESVHSTSTVGYHYSSDLEEDCLNIYDYVSSKATSVHSEGNTCSAG
FT                   PGLARSPSYRNPLTRDAYVFNTENKYLNSSPSAYEIACILMENNCNLSEIILAFEAALQ
FT                   EHEQQHMVDCWYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLLAVSHINQGNAV
FT                   EATVCLSRALELKGVTISNWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLAL
FT                   FNYLLGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSF
FT                   VRARYNLGSTLVKNGELQRGIESLLTALVMQGSPIPPIATNLESFIEHLIFTEAQGKNT
FT                   IVTSLKNALLKIPDDDIELKTNIENRIRLILS"
FT   gene            complement(<944110..>945030)
FT                   /locus_tag="CAGL0J09592g"
FT                   /old_locus_tag="CAGL-IPF6939"
FT                   /old_locus_tag="CAGL-CDS3557.1"
FT   CDS_pept        complement(944110..945030)
FT                   /locus_tag="CAGL0J09592g"
FT                   /old_locus_tag="CAGL-IPF6939"
FT                   /old_locus_tag="CAGL-CDS3557.1"
FT                   /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
FT                   YDL209c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61077"
FT                   /db_xref="GOA:Q6FNR8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR032297"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="InterPro:IPR039173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR8"
FT                   /inference="similar to AA sequence:UniProtKB:Q12046"
FT                   /protein_id="CAG61077.1"
FT                   /translation="MDSDKGWRQRKARVQLAEVSGELAAAQQTHSVNIWYGKWQSSRHV
FT                   SVHRLDPERDSGVTRGDSSGTWKFCLYFARGLCALGHKCEYLHHIPEQSDFDRYLVEGT
FT                   PLLDCFGREKHAENREDMAGVGSFNQQNRTLYVGNIGNAAVMKNGKPLNSRQVESRIRY
FT                   MFGRLGPMDRVRYLPEKNCAFVRYRHHITAEFAKEAMRDQSLSLSMAQDAALGAQDSTG
FT                   LLVKWAREDPDPQSRAHKEEDLVNALLSLLPPQQTQTPSRTTSRTTNKTTNEATSKVRK
FT                   LHRKVYRTTTAAMSHKNILTSYDSD"
FT   gene            <945660..>946055
FT                   /locus_tag="CAGL0J09614g"
FT                   /old_locus_tag="CAGL-IPF6936"
FT                   /old_locus_tag="CAGL-CDS5034.1"
FT   CDS_pept        945660..946055
FT                   /locus_tag="CAGL0J09614g"
FT                   /old_locus_tag="CAGL-IPF6936"
FT                   /old_locus_tag="CAGL-CDS5034.1"
FT                   /note="highly similar to uniprot|P32495 Saccharomyces
FT                   cerevisiae YDL208w NHP2 nucleolar rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61078"
FT                   /db_xref="GOA:Q6FNR7"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR7"
FT                   /protein_id="CAG61078.1"
FT                   /translation="MPAVLPFAKPLASKKLNKKVLKTVKKASRAKNVKRGVKEVVKALR
FT                   KGEKGLVVIAGDISPADVISHIPVLCEDHGVPYLFVPSKQDLGSASATKRPTSVIFIVP
FT                   GSNKKDKSKEEEYKESYNEVVKEVKAL"
FT   gene            <946436..>948028
FT                   /locus_tag="CAGL0J09636g"
FT                   /old_locus_tag="CAGL-IPF6935"
FT                   /old_locus_tag="CAGL-CDS1906.1"
FT   CDS_pept        946436..948028
FT                   /locus_tag="CAGL0J09636g"
FT                   /old_locus_tag="CAGL-IPF6935"
FT                   /old_locus_tag="CAGL-CDS1906.1"
FT                   /note="similar to uniprot|Q12315 Saccharomyces cerevisiae
FT                   YDL207w GLE1 RNA export mediator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61079"
FT                   /db_xref="GOA:Q6FNR6"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="InterPro:IPR038506"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR6"
FT                   /inference="similar to AA sequence:UniProtKB:Q12315"
FT                   /protein_id="CAG61079.1"
FT                   /translation="MRFVLDELYSDEESSLDLGVGSDSDSSNDPDYSNIADPHDLYSPK
FT                   LRIPKKKDVPTKTRTAKEEEVTLLPEIARILEGKQFKSSVIAANTVPSVIHLSREEEQN
FT                   TESLIDKRKDNKLAHSLAPDVNIEQMEAQFSKVMLGKLDSLETLNRKRIEEVRAEKKRI
FT                   EEEQKRKLEEEKRRKELEDKRLKEEEERAKKEQEKQEKERLAALEAEKKREQEEKAKKQ
FT                   AQAQEKDKAQKAVTDFDSISKTFWKYKAKIKSIKEEIVIPVKNADKELRNILSKHKRKI
FT                   NPKFGQLTNTFSQLQSIQNELSHLIDETKGQQLAYLWILNFIAKAIVHQAETEVRAKPE
FT                   SSVPLARLALYIMVRYPEFKELLLARFVKKCPFVMGFTCDIGTEDGRGNMGWKRDSSGK
FT                   WEEPTSYNERIGAMVTLFSVITRLELPQEFIQTSNHPLPISHSWHLVARIANTPLKLIQ
FT                   DTHFVVLGSWWDAAAKEFLQAYGVQAAKLLQLVGDNLTSAVADRKYVGAARLRILLESW
FT                   QENKLESFPEMVP"
FT   gene            <948675..>950921
FT                   /locus_tag="CAGL0J09658g"
FT                   /old_locus_tag="CAGL-IPF6933"
FT                   /old_locus_tag="CAGL-CDS0944.1"
FT   CDS_pept        948675..950921
FT                   /locus_tag="CAGL0J09658g"
FT                   /old_locus_tag="CAGL-IPF6933"
FT                   /old_locus_tag="CAGL-CDS0944.1"
FT                   /note="similar to uniprot|Q12424 Saccharomyces cerevisiae
FT                   YDL206w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61080"
FT                   /db_xref="GOA:Q6FNR5"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12424"
FT                   /protein_id="CAG61080.1"
FT                   /translation="MAVIPRLLAVCLFYSINLIAVIRYFDYDDRSGFGFYSKLILLTEC
FT                   FMMLGILTSDYLIPSLSFISRDILKISDRVSGMTLLALGNAIPDITTTYQSMKRNETSL
FT                   ALGELIGGVFFLLTVILGVVGIVSTVKFEPSTSPFADYPESCETYRESMQSHSYSREIF
FT                   LQDMKIFLTMIVVSTLFLYDGRLFVWECLIMVVTYVACAAYMVSSHLNYGLENNSAVLN
FT                   GDDHSSLRDIIYDNLSTITEENENSSLLGDNDHIVSPLTNENVNIRLFEAGIAERRKYI
FT                   RRGIQRYMRTHYTGWVRMTLNDCLDLWEHSDMLKSQENLGKQDQDDIVDRTREIGSNEM
FT                   DQTEISDTLSELPLPEQLPISKRIKRRSTSLTSNLERLEIPKIVYSDFSQGLVSDRFEQ
FT                   TATPAPVPIFSTPQPLHAPVFDGRPPTYRSLSYDHLGDIIQERNYRSVSDNRSELGEDL
FT                   ENMISRVSGTGREKKWYTASKLITYLIDAEVTLPISELITLLFSFPITLLLAILIPNDV
FT                   FRSAVGDNSFITALQLSIAPMVFSFTLDNMFNIYWLSLVSIILLFSLLIFEAPLKDYQK
FT                   HITSCFAFVLSLGGISFTVHLILDVLTSWADSFNLSPSVLGLTIFAWGNSIGDLVSNIT
FT                   FVQLGVIDVALGACFGSPLLYILFGIGIDGILVMLNKHGFRMPEKWYSLLFNCIQFKID
FT                   AHLISSSIGIIVAFFILIVGVPVNKWRLDFKVSILLLGLYVAVTVINIIFALKS"
FT   gene            complement(<952083..>953072)
FT                   /locus_tag="CAGL0J09680g"
FT                   /old_locus_tag="CAGL-IPF9292"
FT                   /old_locus_tag="CAGL-CDS3333.1"
FT   CDS_pept        complement(952083..953072)
FT                   /locus_tag="CAGL0J09680g"
FT                   /old_locus_tag="CAGL-IPF9292"
FT                   /old_locus_tag="CAGL-CDS3333.1"
FT                   /note="highly similar to uniprot|P28789 Saccharomyces
FT                   cerevisiae YDL205c HEM3 porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61081"
FT                   /db_xref="GOA:Q6FNR4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR4"
FT                   /protein_id="CAG61081.1"
FT                   /translation="MTRESINIGGRRSKLAVVQSNHVRDLVQAKFPQYDCTVFTLQTLG
FT                   DQIQFKPLYSFGGKALWTKELEDYLYCEDQEKRLDLIVHSLKDMPTLLPDGFELGCVTK
FT                   RVDPTDCIVMPRGSPHRCLADLPEGAVVGTSSVRRSAQLKRKFPHLKYQSVRGNIHTRL
FT                   EKLDDPEGPFQCLVLASAGLVRMGLEDRITQRLHSDIMYHAVGQGALGIEIRQGDKKIL
FT                   QILDEIADLESTVCCLAERSLMRTLEGGCSVPIGVESSYDHKTKKLLLKGIVVNVEGTM
FT                   AIEDQQEVVVNDIREDSIKCGVLLAHKMIKDGAKKILDEINLERVIQQ"
FT   gene            complement(<953621..>955708)
FT                   /locus_tag="CAGL0J09702g"
FT                   /old_locus_tag="CAGL-IPF9285"
FT                   /old_locus_tag="CAGL-CDS1112.1"
FT   CDS_pept        complement(953621..955708)
FT                   /locus_tag="CAGL0J09702g"
FT                   /old_locus_tag="CAGL-IPF9285"
FT                   /old_locus_tag="CAGL-CDS1112.1"
FT                   /note="similar to uniprot|Q07622 Saccharomyces cerevisiae
FT                   YDL203c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61082"
FT                   /db_xref="GOA:Q6FNR3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR3"
FT                   /inference="similar to AA sequence:UniProtKB:Q07622"
FT                   /protein_id="CAG61082.1"
FT                   /translation="MFNARDTQSGNRYETHINMYPVADSGVRDGTVSGAGASASASAKT
FT                   PYPIEDTAIGTLNRIPVFTKASMSPSPSPDELADESHGAGDKRYELPFMLSTGSTGSLG
FT                   GSASGGVMGGVIGGVSGSNAGTQPGVPRGDDAAGAEPVRREAHAKAANPFRQMIDYQDV
FT                   ETPPPPYVEKERKERDVLREKMYRTESRSPRKDTAGARPAEPDTGASVQPELAQPELVK
FT                   PELVKQRSESSTTTTGSSSSSKSKRDLTVFSREAVEFYEVYCSVVADQGNFTPSVQLKW
FT                   CETLLEYVFKPDFISHYNINAERLKRALKPEEAQKNQKVILEHAFKVLKKLISSRYAPA
FT                   IYLMGTLYSHQPYLDIKNKTIVTRNDEKALEFYCKAAALSHPESCYRAAVCYEFRRGCD
FT                   AALSHYECLQRAFQYYTQGAEQSTSCMYKLGMTHLYGLTSMNYAHEEDPRELERIVRQD
FT                   VPQALMWLSKATEQGSPQACYELGKIYEFTNMPLPIQQVLAESGIQRDTAKALAYYTRC
FT                   AREYDYPLAQWKLGHCYETGDLDVAVDPHKSIAWYYRSASDSSTLTTTGSTTGSTTTSE
FT                   GKTRRGNPMAMLALSGWCLTGSPGVLRSNDGEALRWAQRSSETAQGKLPRGVRARVLLR
FT                   ARHRHPWRHPGHPAGHRPLPPRAAVPQGRPGPPPPGPVESPHPPPPHTHTYIPSQSHTH
FT                   Y"
FT   gene            <956118..>956774
FT                   /locus_tag="CAGL0J09724g"
FT                   /old_locus_tag="CAGL-IPF9281"
FT                   /old_locus_tag="CAGL-CDS4271.1"
FT   CDS_pept        956118..956774
FT                   /locus_tag="CAGL0J09724g"
FT                   /old_locus_tag="CAGL-IPF9281"
FT                   /old_locus_tag="CAGL-CDS4271.1"
FT                   /note="similar to uniprot|P36521 Saccharomyces cerevisiae
FT                   YDL202w MRPL11"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61083"
FT                   /db_xref="GOA:Q6FNR2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR2"
FT                   /inference="similar to AA sequence:UniProtKB:P36521"
FT                   /protein_id="CAG61083.1"
FT                   /translation="MNSVGLVWQCVRRYSRVAVESGLKRQTWKPIDSRKTFLLDSYRYM
FT                   MDNNSMVLFAHYNNLTKNEDHHFREQIKQAGGKLTRIRNNIFKVCLRTLDREDPAVYIK
FT                   NKKELPHHPLIPLLKGPTAVISFQDTDPQGVAKVFKLLKNAQDKLLVMGAKVDKEVYDF
FT                   AKLDQFKTLPTKEVLQGQLAGLLQMLGGAGLVQVLEANKQHLYLTLKSHEDNIKE"
FT   gene            <957247..>958104
FT                   /locus_tag="CAGL0J09746g"
FT                   /old_locus_tag="CAGL-IPF9280"
FT                   /old_locus_tag="CAGL-CDS3722.1"
FT   CDS_pept        957247..958104
FT                   /locus_tag="CAGL0J09746g"
FT                   /old_locus_tag="CAGL-IPF9280"
FT                   /old_locus_tag="CAGL-CDS3722.1"
FT                   /note="highly similar to uniprot|Q12009 Saccharomyces
FT                   cerevisiae YDL201w TRM8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61084"
FT                   /db_xref="GOA:Q6FNR1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR1"
FT                   /protein_id="CAG61084.1"
FT                   /translation="MKAKPLSNDPGSKRYAYRVNKEENRKELKHVKIDESSLVEGHQVD
FT                   LPKKRFYRQRAHSNPFSDHQLEYPGSPEEMDWTKLYPHYVDPESGKMTKKVTIADIGCG
FT                   FGGLLVDLSPEFPDDLILGMEIRVQVTNYVEDRIIALRTNHVKEQGYQNINVLRGNAMK
FT                   FLPNFFQKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGIVYTITDVKD
FT                   LHDWMVKHLTEHPLFERLPEEWEEEDSCVRIMRHATEEGKKVERKKGDKFVACFRRLPT
FT                   PEII"
FT   gene            complement(<958467..>959090)
FT                   /locus_tag="CAGL0J09768g"
FT                   /old_locus_tag="CAGL-IPF9279"
FT                   /old_locus_tag="CAGL-CDS4392.1"
FT   CDS_pept        complement(958467..959090)
FT                   /locus_tag="CAGL0J09768g"
FT                   /old_locus_tag="CAGL-IPF9279"
FT                   /old_locus_tag="CAGL-CDS4392.1"
FT                   /note="similar to uniprot|P26188 Saccharomyces cerevisiae
FT                   YDL200c MGT1 O6-methylguanine DNA repair methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61085"
FT                   /db_xref="GOA:Q6FNR0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR0"
FT                   /inference="similar to AA sequence:UniProtKB:P26188"
FT                   /protein_id="CAG61085.1"
FT                   /translation="MEDLLYSFVVTDITSALVFVRRQTDALVYASLGLNKKQLLKGART
FT                   AFNQLSKKSAIHYNFKQIEVESEQEHVEKFQDTVNKFTKLLEGHIVKDLHYEYMFGTSL
FT                   QHRIWDELVKIPHGKVTTYKEIADKLKIKNGSRAIGSGIGSNNIAIVIPCHRVVCSNGT
FT                   LSGYKWSTSLKRKLLEREHVYASNKKDALNKDTKISLMKYKYSA"
FT   gene            complement(<959883..>960785)
FT                   /locus_tag="CAGL0J09790g"
FT                   /old_locus_tag="CAGL-IPF9278"
FT                   /old_locus_tag="CAGL-CDS3602.1"
FT   CDS_pept        complement(959883..960785)
FT                   /locus_tag="CAGL0J09790g"
FT                   /old_locus_tag="CAGL-IPF9278"
FT                   /old_locus_tag="CAGL-CDS3602.1"
FT                   /note="highly similar to uniprot|P38988 Saccharomyces
FT                   cerevisiae YDL198c YHM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61086"
FT                   /db_xref="GOA:Q6FNQ9"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ9"
FT                   /protein_id="CAG61086.1"
FT                   /translation="MAHNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKI
FT                   TSGAQLNSVIFRDHAAEAFGKRVFTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHF
FT                   KKDFDSAFGDKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPEAFKGRGFLKILK
FT                   DEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGAS
FT                   ASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLV
FT                   FSFALAQSLIPMFDNMLKK"
FT   gene            <961496..>962971
FT                   /locus_tag="CAGL0J09812g"
FT                   /old_locus_tag="CAGL-IPF9275"
FT                   /old_locus_tag="CAGL-CDS2118.1"
FT   CDS_pept        961496..962971
FT                   /locus_tag="CAGL0J09812g"
FT                   /old_locus_tag="CAGL-IPF9275"
FT                   /old_locus_tag="CAGL-CDS2118.1"
FT                   /note="highly similar to uniprot|Q00764 Saccharomyces
FT                   cerevisiae YBR126c TPS1 alpha alpha-trehalose-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61087"
FT                   /db_xref="GOA:Q6FNQ8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ8"
FT                   /protein_id="CAG61087.1"
FT                   /translation="MTQIDKKEVSGNIIVVSNRLPVTISKDDTGKYQYKMSSGGLVTAL
FT                   QGLKKTATFKWYGWPGLEIPDDEKEQVKQDLLEQFNAVPVFLSDEVADLHYNGFSNSIL
FT                   WPLFHYHPGEINFDENAWLAYNEANRAFAEVIFETMQDDDLIWVHDYHLMLLPQMLQEE
FT                   ITKRKLRNVKLGWFLHTPFPSSEIYRILPVRQEILRGVLSCDLLGFHTYDYARHFLSSV
FT                   QRVLNVNTLPNGVEYQGRFVNVGAFPIGIDVSTFQDGLLKQQVKDRISQLKETFKGQKI
FT                   IIGVDRLDYIKGVPQKLHAMEVFLSEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNE
FT                   LVGRINGQFGTAEFVPIHFMHKSVPFEELISLYAVSDVCLVSSTRDGMNLVSYEYIACQ
FT                   EETKGSLILSEFAGAAQSLNGAIIVNPWNIDEMSDAINEALTLPEVKREVNWEKLFKYI
FT                   SKYTSAFWGENFVHELYNTSSSSGSIKSSEEKH"
FT   gene            <963886..>965109
FT                   /locus_tag="CAGL0J09834g"
FT                   /old_locus_tag="CAGL-IPF9272"
FT                   /old_locus_tag="CAGL-CDS2722.1"
FT   CDS_pept        963886..965109
FT                   /locus_tag="CAGL0J09834g"
FT                   /old_locus_tag="CAGL-IPF9272"
FT                   /old_locus_tag="CAGL-CDS2722.1"
FT                   /note="highly similar to uniprot|P38089 Saccharomyces
FT                   cerevisiae YBR125c PTC4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61088"
FT                   /db_xref="GOA:Q6FNQ7"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ7"
FT                   /protein_id="CAG61088.1"
FT                   /translation="MGQLLSHPLTEKTIEYNDYKTKSSAAGSVPRFYNCVGSMQGYRLS
FT                   QEDAHKVQNEDTILRVRFFNPFTGKHEKMMISMFAVFDGHGGDSCSKFLSGTSNPHLRA
FT                   GLAKWVVYSFENHRYGAKKNISSVDNGGANNYTNTPNNSINGSNADNSTSYTRHFRTME
FT                   GLISQIIKDAYIKQDQELHQHFANSACGSTAVVALIINGTMLYVANCGDSRCILSSKAR
FT                   GIKTMSYDHKPQNIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVVYKNTNPM
FT                   RISANGNHNSPTPPQEAQVSVEPDVLMHKLDFNKDEFLVLACDGIWDIYNNTRLIQFIK
FT                   YHLMQGMKLDGIMTKLLDHGIAQANSSTGVGFDNMTAIVVVLNRPDESLHDWMNKMKLR
FT                   LEREKGII"
FT   gene            complement(<965386..>965919)
FT                   /locus_tag="CAGL0J09856g"
FT                   /old_locus_tag="CAGL-IPF9271"
FT                   /old_locus_tag="CAGL-CDS4620.1"
FT   CDS_pept        complement(965386..965919)
FT                   /locus_tag="CAGL0J09856g"
FT                   /old_locus_tag="CAGL-IPF9271"
FT                   /old_locus_tag="CAGL-CDS4620.1"
FT                   /note="highly similar to uniprot|P36531 Saccharomyces
FT                   cerevisiae YBR122c MRPL36"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61089"
FT                   /db_xref="GOA:Q6FNQ6"
FT                   /db_xref="InterPro:IPR034600"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ6"
FT                   /protein_id="CAG61089.1"
FT                   /translation="MLRNLIWKRLASTGGHPNATKISLPRRPLKKIRPGKARPAIYHQF
FT                   NVKVELSDGSVISRRSQFPKDEFRLISDQRNNPLWNPSRDDLVVIDVNSGGSKDKFKQK
FT                   YSSIFSVDDAVDTKAEEKEVKSSKETKTEDKKEVKKDVEEDAFGVDDYLSLLDDSSKQI
FT                   KTGKLAQKKKKDKK"
FT   gene            complement(<966181..>968085)
FT                   /locus_tag="CAGL0J09878g"
FT                   /old_locus_tag="CAGL-IPF9270"
FT                   /old_locus_tag="CAGL-CDS1337.1"
FT   CDS_pept        complement(966181..968085)
FT                   /locus_tag="CAGL0J09878g"
FT                   /old_locus_tag="CAGL-IPF9270"
FT                   /old_locus_tag="CAGL-CDS1337.1"
FT                   /note="similar to uniprot|P32367 Saccharomyces cerevisiae
FT                   YBR123c TFC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61090"
FT                   /db_xref="GOA:Q6FNQ5"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="InterPro:IPR040454"
FT                   /db_xref="InterPro:IPR041499"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ5"
FT                   /inference="similar to AA sequence:UniProtKB:P32367"
FT                   /protein_id="CAG61090.1"
FT                   /translation="MESNDTPAMEDVSQAVSSKYARYHTLDLPRISSVEFPLAISTKKH
FT                   SIVRAIEMCGGIEDVKQALDNSTEPSVTDKGLELFLNNGLSPVDPWDDATSSARKPFFN
FT                   EHPIIGKRVPFRDDSIVLKITMPEGTLEKNGNDVAKALRSLDSKDVCATPVAVVNNTIK
FT                   FREMSDFQVILDNVPAAREFQKSFGSLDWQNIKKFIDSVPDNDSRPQDNINNIILDRSV
FT                   KSPNCDFQLPPPPRFSMVGYPLQYKYKGNPFAVKKENGDHEVKGSYLKNYQLFVHDMSP
FT                   ELKVPVEPQDKLLEIYNQAKQSGVYPGTKKESKFFEALEECLAILRSLFEKRPIWVKRH
FT                   LDGLIPKNVYHTLKIALALLSYRFTMGPWRNTYIKFGVDPRSSSEYAKYQTEYFKIERK
FT                   LLESATVRKNIPKPPPLVFESDTKDGIDSRFRFDGTRIPWYLMLQIDLLLDEPNIAEVY
FT                   EKVEYLDKPNEVTGWFTALDLAKIRRIVKYELGCMVQGRYEFNKYKLKYFKSMLFFKES
FT                   MMNNNGENTDVDGDTNMDRDKNPDDITQDDDEENNGVEAGEDEETLQEKEDAESDNMKV
FT                   SVMKDISDDEQDEPEDDFDVNNATFQDIIGKIRRLDPELADKYSRDLSGLVNIAKLYD"
FT   gene            <969083..>969934
FT                   /locus_tag="CAGL0J09900g"
FT                   /old_locus_tag="CAGL-IPF9268"
FT                   /old_locus_tag="CAGL-CDS3731.1"
FT   CDS_pept        969083..969934
FT                   /locus_tag="CAGL0J09900g"
FT                   /old_locus_tag="CAGL-IPF9268"
FT                   /old_locus_tag="CAGL-CDS3731.1"
FT                   /note="highly similar to uniprot|P04840 Saccharomyces
FT                   cerevisiae YNL055c POR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61091"
FT                   /db_xref="GOA:Q6FNQ4"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ4"
FT                   /protein_id="CAG61091.1"
FT                   /translation="MAPPFFSDIFKSVNDLLNKDFYHSTPAAVDLESVAKNGVKFNVKS
FT                   KQLVKEGPLAATVDAKFTDKATGLTLTQGWSNANNLNTKIELNNITPGLKTELMTSFVP
FT                   NISKVANLNLSFVQPFFTARGAFDLLKGPGFVGDMTLAHESGVVAGAQFGYDIAAGSLS
FT                   KYAIALGYAAQDYHLGLNINNDQVTTATFFQNVSPQLQIGSRATLNPRQTVSNVNIEFA
FT                   TKYLPDPNSQVKAKISDAGIVALSYKQALRPGVTLGVGTSFDALKLSEPVHKIGWSLSF
FT                   VI"
FT   gene            <973259..>974542
FT                   /locus_tag="CAGL0J09922g"
FT                   /old_locus_tag="CAGL-IPF9056"
FT                   /old_locus_tag="CAGL-CDS2596.1"
FT   CDS_pept        973259..974542
FT                   /locus_tag="CAGL0J09922g"
FT                   /old_locus_tag="CAGL-IPF9056"
FT                   /old_locus_tag="CAGL-CDS2596.1"
FT                   /note="similar to uniprot|P53616 Saccharomyces cerevisiae
FT                   YNL066w SUN4 or uniprot|P40472 Saccharomyces cerevisiae
FT                   YIL123w SIM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61092"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ3"
FT                   /inference="similar to AA sequence:UniProtKB:P53616"
FT                   /protein_id="CAG61092.1"
FT                   /translation="MKFLTTAATLTAASILGSTALAAAMPDLKDCTTTAQGNHQHKRAV
FT                   AVEYVYETVIVDDQGHTLNVPPVKNDAASPTQAPKQSTQTPAAAPSTSTLAPASSSSPS
FT                   PAKKADSTTSTLAPSSSSSPSPSPSSSSSSSSSSQQSKPSSSTSSSSSYSGGIYGDLAA
FT                   FSGPSEKFQDGVIPCSQFPAGQGVIPISWLGENGWSGVENSDTSTGGDCKEGSYCSYAC
FT                   QPGMSKTQWPSSQPADGRSIGGLLCKNGYLYRSNTNADYLCEWGVNSAEVESKLSQGVA
FT                   ICRTDYPGTENMVIPTFVQAGATLPLTVVNQDTYYQWQGMKTSAQYYVNNAGISVEDGC
FT                   VWGNAGSGLGNWAPLNFGAGYTNGITYLSLIPNPNNKAPLNYNVKIVAADDSSVVNGEC
FT                   SYENGVYSGGADGCTVAVRSGKAKFVLY"
FT   gene            <976274..>978052
FT                   /locus_tag="CAGL0J09944g"
FT                   /old_locus_tag="CAGL-IPF9058"
FT                   /old_locus_tag="CAGL-CDS1549.1"
FT   CDS_pept        976274..978052
FT                   /locus_tag="CAGL0J09944g"
FT                   /old_locus_tag="CAGL-IPF9058"
FT                   /old_locus_tag="CAGL-CDS1549.1"
FT                   /note="similar to uniprot|P53943 Saccharomyces cerevisiae
FT                   YNL065w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61093"
FT                   /db_xref="GOA:Q6FNQ2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNQ2"
FT                   /inference="similar to AA sequence:UniProtKB:P53943"
FT                   /protein_id="CAG61093.1"
FT                   /translation="MVESGPHSINDDLSTNEYIEQPKFYHDDHASDSNSLSDIDDDNKK
FT                   HGGLYGTVSRTTTRELPEDLESEISSTHSQDAKEDLEIQHNAAPYSLLNYRDKWCMVAL
FT                   LTACGFWSSLGSPIYYPALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFG
FT                   RRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSER
FT                   GTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLPETKRS
FT                   IVGNLSIRPKNPLNIAPVTLLPAARRKLKYDNPDYETLDKTKPVFDLTSAFKICALPEI
FT                   FLSLLPPGLAFAMWTLMLSAISSELSAAPYNYKLTIIGVCYLPAGIGGLIGSFATGKII
FT                   DFQYKKKLKVFEEKKAAGIIPEDEKFNIMGARLQSVLPQNFLCVVTYILFGWSCDKGWK
FT                   IPSILITSCVSSFCAMSTLSAMSTLLVDLYPGKSSTASSCFNFMRCSLSAILMGCFAKM
FT                   KHSLTVGGTFTLLAGLVFVGNFLMFIPMKHGMRWREEREQRAALKAKSMDQANENGYKL
FT                   FSKIKFSSPFKSEEKV"
FT   gene            complement(<978692..>979915)
FT                   /locus_tag="CAGL0J09966g"
FT                   /old_locus_tag="CAGL-IPF9060"
FT                   /old_locus_tag="CAGL-CDS2721.1"
FT   CDS_pept        complement(978692..979915)
FT                   /locus_tag="CAGL0J09966g"
FT                   /old_locus_tag="CAGL-IPF9060"
FT                   /old_locus_tag="CAGL-CDS2721.1"
FT                   /note="highly similar to uniprot|P25491 Saccharomyces
FT                   cerevisiae YNL064c YDJ1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61094"
FT                   /db_xref="GOA:Q6FNQ1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ1"
FT                   /protein_id="CAG61094.1"
FT                   /translation="MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE
FT                   KFKEVSSAYEILSDSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGR
FT                   PRGPQRGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKKCSSCNGQ
FT                   GIKFVTRQMGPMIQRFQTECDVCHGTGDIIDAKDRCKSCNGKKVDNERKILEVRIEPGM
FT                   KDGQKIVFKGEADQAPDVIPGDVVFVISEKPHKHFQRAGDDLIYEAEIDLLTALAGGQF
FT                   ALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFPENHFTS
FT                   EENLKKLEEILPPRRQINIPAKAQVDDCVLSEFDPSKFGQSNGRSGANYDSDDEDAHGG
FT                   EGVQCASQ"
FT   gene            <980400..>981422
FT                   /locus_tag="CAGL0J09988g"
FT                   /old_locus_tag="CAGL-IPF9062"
FT                   /old_locus_tag="CAGL-CDS3238.1"
FT   CDS_pept        980400..981422
FT                   /locus_tag="CAGL0J09988g"
FT                   /old_locus_tag="CAGL-IPF9062"
FT                   /old_locus_tag="CAGL-CDS3238.1"
FT                   /note="weakly similar to uniprot|P53944 Saccharomyces
FT                   cerevisiae YNL063w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61095"
FT                   /db_xref="GOA:Q6FNQ0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ0"
FT                   /protein_id="CAG61095.1"
FT                   /translation="MRIRPCDMRAAWGRHRWLPLLLPQCRSVDQALVEFGWMQGLAPDN
FT                   IVQGNAVQGNAVQGNIVQGNAVPGNTAARRLLRGCAARFRGVPLQYVLGSQPFGAAELV
FT                   CRPGVLIPRWETEEWALKLARAIARYSSQQPLAQPLKLTLVDLCTGTGCVPIGIHDELA
FT                   RAPSLIKYTAVDVSPQAIDLCRLNVGRRAIEVKQVDVLRQDSPADIVGGLGPGRGLGLG
FT                   RGPAIDILLCNPPYIPRKAFTRTTARSVRLYEPRLALIADKEFYKNLVDVWSQHTNSFV
FT                   YEIGDSSQYEYVKQALDPSVWSVGLHIDSNGCPRAVYGYRNSIPSIAYIFEEFKQPRYV
FT                   "
FT   gene            complement(<981617..>983038)
FT                   /locus_tag="CAGL0J10010g"
FT                   /old_locus_tag="CAGL-IPF9063"
FT                   /old_locus_tag="CAGL-CDS2234.1"
FT   CDS_pept        complement(981617..983038)
FT                   /locus_tag="CAGL0J10010g"
FT                   /old_locus_tag="CAGL-IPF9063"
FT                   /old_locus_tag="CAGL-CDS2234.1"
FT                   /note="similar to uniprot|P41814 Saccharomyces cerevisiae
FT                   YNL062c GCD10"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61096"
FT                   /db_xref="GOA:Q6FNP9"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNP9"
FT                   /inference="similar to AA sequence:UniProtKB:P41814"
FT                   /protein_id="CAG61096.1"
FT                   /translation="MDPLKSIVQDQHVILTLPSGNSKIVELKPDSSVSLGKFGAFQVND
FT                   ILGWPLGTTFEIYYDNVEEIVENKKKKPKSNELNKVPVGKVRLYKEVATDDKAEEEVEE
FT                   MDSSAVIPVELQNVLSSATNQGLINIGNDVQKLTMHDVERFKQQSASANEIITKMIESH
FT                   GSFHQKTIYSQEKYLKRKKQKFAKFFTVDYLSSSMLLKFLVEKGDIQRVLDLSEESLGM
FT                   ILNLTNIRSDGTYLCMDETGGLIVYTMLERMFGGKEDLDAPGKIVVINENEHPNLDLLK
FT                   FSNYSEKFIEKHVVTLSILDYFRPPTMEEVEGRFTPLSKEEVNKLKSGKRSAYSRKLKW
FT                   YYTQLRVIEMATKQQYDGLVVASTLHLPSLVPRLAERVHGARPIVCFSQFKETLLELAH
FT                   TLYSDLRYLAPTILETRCRPYQTARGKLHPLMTMRGGGGYLLWCHRVIPAPEPEIEEPT
FT                   DVNADEQEEKKQKME"
FT   gene            <983405..>985264
FT                   /locus_tag="CAGL0J10032g"
FT                   /old_locus_tag="CAGL-IPF9064"
FT                   /old_locus_tag="CAGL-CDS1412.1"
FT   CDS_pept        983405..985264
FT                   /locus_tag="CAGL0J10032g"
FT                   /old_locus_tag="CAGL-IPF9064"
FT                   /old_locus_tag="CAGL-CDS1412.1"
FT                   /note="highly similar to uniprot|P40991 Saccharomyces
FT                   cerevisiae YNL061w NOP2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61097"
FT                   /db_xref="GOA:Q6FNP8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP8"
FT                   /protein_id="CAG61097.1"
FT                   /translation="MGKGRSKFKQAAPPSLDEFLAKKEKKQNKLNKKSKRTHEDKDDGK
FT                   KSKKQKKSKSKRAETEETEEEPADLPEVDYEELSKAKKSLFDDEEDAGADSNDEEELDD
FT                   DELKDEFDLEQEYDYDEDEEAEAKPMFSDDEEDEEELERLNANNMEFLSKRLDEEEAEE
FT                   AEEAELELTEAHKQNPRADVLPSKEEEELMAQNPPDLTSIRTRIIEIVKVLEDFKTLGA
FT                   EGRSRSEYTDRLLKDICEYFGYTPFLAEKLFNLFSPAEALEFFEANEIARPITIRTNTL
FT                   KTSRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQAASSFLP
FT                   VVALDPQENERVLDMASAPGGKTTYISALMKNTGCVFANDANKKRTKSLIANIHRLGCT
FT                   NTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQL
FT                   LLSAIDSVDANSKKGGVIVYSTCSVAVEEDEAVVDYALRKRPNVKLVDTGLQIGKEGFV
FT                   SFRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKIGPSPHDDNQATAKEKEAAARLEAI
FT                   EEGIIKEDFAEFEDEEDKEYIEKSKSKLLKKRGVNPKAKLEKK"
FT   gene            complement(<985402..>987666)
FT                   /locus_tag="CAGL0J10054g"
FT                   /old_locus_tag="CAGL-IPF9065"
FT                   /old_locus_tag="CAGL-CDS0926.1"
FT   CDS_pept        complement(985402..987666)
FT                   /locus_tag="CAGL0J10054g"
FT                   /old_locus_tag="CAGL-IPF9065"
FT                   /old_locus_tag="CAGL-CDS0926.1"
FT                   /note="highly similar to uniprot|P53946 Saccharomyces
FT                   cerevisiae YNL059c ARP5 Actin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61098"
FT                   /db_xref="GOA:Q6FNP7"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027664"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP7"
FT                   /protein_id="CAG61098.1"
FT                   /translation="MSREVSRDASLTPLRVDIIEDPPLRNSYEHFIDSATYDPNIPIAI
FT                   DFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARSPFD
FT                   GPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRSNWYQTLFESFGV
FT                   PKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDAKRINWGGHSSI
FT                   DYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETDIEGYLTLGNLENKNVVVEA
FT                   PFVEVQAPQKSEEELRIQAEKRKESGKRLQEQARIKRKERLVQKREEYEYFSKVKEQLE
FT                   GEPKKKVLAVLQSAGFDDERDFKKYLYNVQRSIKKAEALELSEAVDEAEEEENMEGKFD
FT                   LVDIPDEQLNEEQKQEKKVQKLLKANYDARQKAKEEKERILKEVEEQKKKDEEWRSTDF
FT                   NGWLKDKRNRLHDLMQKRKEKLKLKEDMKDRKSQVAQNRMKNLANLAEDNARGTKRTRQ
FT                   QATIDNDPNDTFGANDEDWMVYNDITQNPEALDEAIEDEYKEIVDLEGILLEYDPNFTE
FT                   EDTLDAQYDWRNSVFHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQ
FT                   AGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPS
FT                   DTKINVNISEAPTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKLSNVPYF
FT                   E"
FT   gene            complement(<988050..>989186)
FT                   /locus_tag="CAGL0J10076g"
FT                   /old_locus_tag="CAGL-IPF9066"
FT                   /old_locus_tag="CAGL-CDS2919.1"
FT   CDS_pept        complement(988050..989186)
FT                   /locus_tag="CAGL0J10076g"
FT                   /old_locus_tag="CAGL-IPF9066"
FT                   /old_locus_tag="CAGL-CDS2919.1"
FT                   /note="weakly similar to uniprot|P53947 Saccharomyces
FT                   cerevisiae YNL058c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61099"
FT                   /db_xref="GOA:Q6FNP6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNP6"
FT                   /protein_id="CAG61099.1"
FT                   /translation="MLRRKRAFTDESLMLMERGLPRLVTTSTTPTPTTEPTTEPTTTKD
FT                   ETSQTSATDASTATTSTAATSTAATSSTSTDITATSLTITSSSLSTDVANIVPPSAENN
FT                   PYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDYLESMATQYPYGS
FT                   RGGHAHHSSIFSTASSDVYSYGGDDEKLSLGHSRSQSVDKKTHEKVKKSKIGLFGGSTN
FT                   DIFKTPTRNDSWESLSDAITNYGDGSVHRFNPIQDDIQYNNRRSLFISPTVEVMNLPRQ
FT                   EVPDIFATPKKQQTSIYNDYDTPLIPDLSKPEDVALSPQRSHRKTPSNDKYHRRNRSSA
FT                   NLSPSRSPTRTPIRTRNMARDHRKTPSMYLEDLLDDNY"
FT   gene            <989719..>990279
FT                   /locus_tag="CAGL0J10098g"
FT                   /old_locus_tag="CAGL-IPF9070"
FT                   /old_locus_tag="CAGL-CDS4551.1"
FT   CDS_pept        989719..990279
FT                   /locus_tag="CAGL0J10098g"
FT                   /old_locus_tag="CAGL-IPF9070"
FT                   /old_locus_tag="CAGL-CDS4551.1"
FT                   /note="similar to uniprot|P53949 Saccharomyces cerevisiae
FT                   YNL056w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61100"
FT                   /db_xref="GOA:Q6FNP5"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP5"
FT                   /inference="similar to AA sequence:UniProtKB:P53949"
FT                   /protein_id="CAG61100.1"
FT                   /translation="MSGGRAKYIPPLNFAPIVSTDVSLYRSGYPMPLNYSFIRGQLHLK
FT                   TIIYVGDKSEPMPEYAEFLERERINYHHIHMDSCRDPDIDAQMDRVLQLVLRADNYPIL
FT                   IHSNKGKHRVGVVVGIIRKLLQGWSIAGIYQEYGLFSGGLKDEADLEYITMFETDILMD
FT                   PRTVPRFALRRHHPTVIQQETTP"
FT   gene            <990695..>993127
FT                   /locus_tag="CAGL0J10120g"
FT                   /old_locus_tag="CAGL-IPF9072"
FT                   /old_locus_tag="CAGL-CDS0785.1"
FT   CDS_pept        990695..993127
FT                   /locus_tag="CAGL0J10120g"
FT                   /old_locus_tag="CAGL-IPF9072"
FT                   /old_locus_tag="CAGL-CDS0785.1"
FT                   /note="similar to uniprot|P41813 Saccharomyces cerevisiae
FT                   YNL068c FKH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61101"
FT                   /db_xref="GOA:Q6FNP4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP4"
FT                   /inference="similar to AA sequence:UniProtKB:P41813"
FT                   /protein_id="CAG61101.1"
FT                   /translation="MEARSQHQQGLTNAVISALAVPEQSTTVSKQYSNERNVATEVQAY
FT                   AKISGRDWTYYVKNLEVSIGRNTDPSSKDGERDSGIDIDLGPAKVVSRRHATIKFNMEY
FT                   GGWELKILGRNGGKVNFHRVEAGANAPSIKLSSGTILDIGGTQMIFILPDQEPFIPQEC
FT                   LENLMPTLVSIYGVDGSNIANDNPLLREVIRESNYVKTHRELSRQPPGINQQVRTFKMY
FT                   GSGSSFHLGDSTPNFYGTAATPIPGMATSGIAANNKQPNSSYQNVNNAGPNGAGIGQNM
FT                   NTISDFPQSLDFASDLSRDENRNIKPPYSYATMITQAILSTGEGVISLADIYKYISSNY
FT                   SYYRYAKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISKDYQEEFLQKWNSGNG
FT                   NKIRRGSSVSRQLQLHMSKFNRLPTQNDYSNDVASEDKKVTKKHSKKSSTSSGGTMSTV
FT                   NSGQNSLSSIESHPDVNFDKYGIMGSSRNSMQLLPPTLPEQPTNTMQPPIRETLEPITS
FT                   YSVARKNPTNNALVSFTNASSSYLKPTTSSNSAPSLPSISTKGIQNLPLPTTAGSASNL
FT                   LQQNPHLSPSYDSLLRSPTKSFHVTAMEAYTPERGSAQTNFSPSNSRGENNPTGVGLPS
FT                   VSLPNGHTFSDDMRKTELMPSIQDPNPGGLRSTNMSDRLTPANFGSAKSSQYRNSPGGW
FT                   NSLLFSSVNNTPKFSLDSDTKNGNQTPKDLNGSASVKSSISEGRPDVGNPSATTSNGND
FT                   LTVSVPDLDSKDINSSPLKRHLENRRDTEGNIPEDPSRKTDRNMLLDTDSAKITIVK"
FT   gene            <994957..>996150
FT                   /locus_tag="CAGL0J10164g"
FT                   /old_locus_tag="CAGL-IPF9079"
FT                   /old_locus_tag="CAGL-CDS4527.1"
FT   CDS_pept        join(994957..994990,995582..996150)
FT                   /locus_tag="CAGL0J10164g"
FT                   /old_locus_tag="CAGL-IPF9079"
FT                   /old_locus_tag="CAGL-CDS4527.1"
FT                   /note="highly similar to uniprot|P26785 Saccharomyces
FT                   cerevisiae YNL069c RP23 or uniprot|P26784 Saccharomyces
FT                   cerevisiae YIL133c RP22"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61103"
FT                   /db_xref="GOA:Q6FNP2"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP2"
FT                   /protein_id="CAG61103.1"
FT                   /translation="MSTFEKVVVIDAKGHLVGRLASIVAKQLLNGQKIVVVRAEALNIS
FT                   GEFFRNKLKYHDFLRKATAFNKTRGPFHFRAPSRIFYKAVRGMISHKTARGKAALERLK
FT                   VFEGVPPPYDKKKRVVVPEALRVLRLKPGRKYTTLAKLSTSVGWKYEDVVAKLEEKRKV
FT                   RSAEYYAKKRAFNKKVTAATASAAETDAAKKLATLGY"
FT   gene            complement(<996792..>996974)
FT                   /locus_tag="CAGL0J10179g"
FT                   /old_locus_tag="CAGL-IPF13818"
FT   CDS_pept        complement(996792..996974)
FT                   /locus_tag="CAGL0J10179g"
FT                   /old_locus_tag="CAGL-IPF13818"
FT                   /note="highly similar to uniprot|P53507 Saccharomyces
FT                   cerevisiae YNL070w TOM7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10179g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61104"
FT                   /db_xref="GOA:Q6FNP1"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP1"
FT                   /protein_id="CAG61104.1"
FT                   /translation="MNFLPSFILSDESKERFNKILDLTQRVAHYGWIPFVLYLGWAQTA
FT                   NKPNLFNLLSPLPSV"
FT   gene            complement(<997347..>998756)
FT                   /locus_tag="CAGL0J10186g"
FT                   /old_locus_tag="CAGL-IPF9081"
FT                   /old_locus_tag="CAGL-CDS2264.1"
FT   CDS_pept        complement(997347..998756)
FT                   /locus_tag="CAGL0J10186g"
FT                   /old_locus_tag="CAGL-IPF9081"
FT                   /old_locus_tag="CAGL-CDS2264.1"
FT                   /note="highly similar to uniprot|P12695 Saccharomyces
FT                   cerevisiae YNL071w LAT1 dihydrolipoamide
FT                   S-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61105"
FT                   /db_xref="GOA:Q6FNP0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP0"
FT                   /protein_id="CAG61105.1"
FT                   /translation="MSALLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALSP
FT                   TMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVS
FT                   RPIAVYVEDEADVAAFKDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKAAKS
FT                   NSTPSSVASGDRIIASPLAKTIALEKGIALKSVKGTGPRGRITKADVEKYLESAPKSTS
FT                   TAAPSATPSTTGGASYEDLEITNMRQIIGDRLLQSRQSIPSYIVSSDISVSKLLKLRKS
FT                   LNATAKDQYKLSINDILIKAVTVAARRVPDANSYWLQNEGIIRQFKNVDVSVAVATPTG
FT                   LLTPIVKNAESKGLIEISKEVKELASRAKINKLVPEEFQGGTICISNLGMNPAVSMFTS
FT                   IINPPQSTILAIGTVKRVAVEDAGAENGIAFDDQVTITGTFDHRTIDGAKGADFMRELK
FT                   TVIENPLQLLL"
FT   gene            complement(<999365..>1000288)
FT                   /locus_tag="CAGL0J10208g"
FT                   /old_locus_tag="CAGL-IPF2810"
FT                   /old_locus_tag="CAGL-CDS3543.1"
FT   CDS_pept        complement(999365..1000288)
FT                   /locus_tag="CAGL0J10208g"
FT                   /old_locus_tag="CAGL-IPF2810"
FT                   /old_locus_tag="CAGL-CDS3543.1"
FT                   /note="highly similar to uniprot|P53942 Saccharomyces
FT                   cerevisiae YNL072w RNH35"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61106"
FT                   /db_xref="GOA:Q6FNN9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN9"
FT                   /protein_id="CAG61106.1"
FT                   /translation="MTVTEEKNVLPPTVQVSLNSLKTKTYYSEIPKSVIANESPVILGV
FT                   DEAGRGPVMGPMVYGISYCTKEYQDKVLIPKYTFDDSKKLTDPVRRMLFSKMYAGEIDQ
FT                   VGYATTAITPYDISTGMSRYPPSRNYNLNEQAHDVTMALIQGVIDRGVSIDHVYVDTVG
FT                   PPASYQRKLEDRFPSIKFTVAKKADSLYCVVSVASVVAKVTRDLLIESLRRTPDEIMGS
FT                   GYPSDPKTVAWLKGNQKPLLGWPIEIVRFSWQTCQTLLKDKSTGSVSIKWDEDYTNTKR
FT                   KLVPIPVPETNFYEKPPTLDNWFMRS"
FT   gene            complement(<1000573..>1002204)
FT                   /locus_tag="CAGL0J10230g"
FT                   /old_locus_tag="CAGL-IPF2813"
FT                   /old_locus_tag="CAGL-CDS1810.1"
FT   CDS_pept        complement(1000573..1002204)
FT                   /locus_tag="CAGL0J10230g"
FT                   /old_locus_tag="CAGL-IPF2813"
FT                   /old_locus_tag="CAGL-CDS1810.1"
FT                   /note="similar to uniprot|P32048 Saccharomyces cerevisiae
FT                   YNL073w MSK1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61107"
FT                   /db_xref="GOA:Q6FNN8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN8"
FT                   /inference="similar to AA sequence:UniProtKB:P32048"
FT                   /protein_id="CAG61107.1"
FT                   /translation="MLRIVGARLLYASSRIRIGRGLASKVAIDSSNLEFTKRNELVLSS
FT                   LDRYYPSMSSIERGNLVSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAF
FT                   IDLVDGIHGIQLILNCREIGNSATFESELSFLRKGDYVMTTGLPRLSKSRMKNISLRCT
FT                   DLPKILSVAQMPLPPKLIDTVKSNSNKVVDYQINGFQNIRIRSSILKSIRNFLEERDFI
FT                   EVETPILSSKSNGAVAKPFMSSSKDFDKLMLRVAPELWLKRLIISGCNKVFEIGKSFRN
FT                   EGIDGSHNPEFTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYLPESLLELE
FT                   DILKSNNWKFKRVEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSS
FT                   SQILNRLCSELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYS
FT                   NAYEEENCPQVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDR
FT                   LCMLITGCQRIEQVLPFGTLDDVNRQ"
FT   gene            complement(<1002530..>1003396)
FT                   /locus_tag="CAGL0J10252g"
FT                   /old_locus_tag="CAGL-IPF2814"
FT                   /old_locus_tag="CAGL-CDS3698.1"
FT   CDS_pept        complement(1002530..1003396)
FT                   /locus_tag="CAGL0J10252g"
FT                   /old_locus_tag="CAGL-IPF2814"
FT                   /old_locus_tag="CAGL-CDS3698.1"
FT                   /note="highly similar to uniprot|P53941 Saccharomyces
FT                   cerevisiae YNL075w IMP4 component of the U3 small nucleolar
FT                   ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61108"
FT                   /db_xref="GOA:Q6FNN7"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNN7"
FT                   /protein_id="CAG61108.1"
FT                   /translation="MLRRQARERREYLYRKAQELQETQLQQKRQIIKQALAQGKPLPKE
FT                   LAEDEQLQKDFRYDQSMADNEDEAGVDDEYSASSGIVEARVIVTTSRDPSSRLAQFAKE
FT                   IKLLFPNAVRLNRGNYVMADLVSACKKSGTTDLIVLHEHRGVPTSLTVSHFPYGPTAFF
FT                   SLHNVVLRHDILNRGNQSEVNPHLIFDNFTTPLGNRVVTILKNLFPPGPKKDSSRVITF
FT                   ANRGDFISVRQHVYVRTKDGVEMAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFVRT
FT                   ANRKDYL"
FT   gene            complement(<1003911..>1005890)
FT                   /locus_tag="CAGL0J10274g"
FT                   /old_locus_tag="CAGL-IPF2815"
FT                   /old_locus_tag="CAGL-CDS1233.1"
FT   CDS_pept        complement(1003911..1005890)
FT                   /locus_tag="CAGL0J10274g"
FT                   /old_locus_tag="CAGL-IPF2815"
FT                   /old_locus_tag="CAGL-CDS1233.1"
FT                   /note="similar to uniprot|P34072 Saccharomyces cerevisiae
FT                   YNL076w MKS1 pleiotropic regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61109"
FT                   /db_xref="GOA:Q6FNN6"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN6"
FT                   /inference="similar to AA sequence:UniProtKB:P34072"
FT                   /protein_id="CAG61109.1"
FT                   /translation="MPSKLGLPRGPDNIPPLELSPGTDSKIPTGNAIKQTITQQHSEQQ
FT                   QKQRQQQHSQNNPNNKQNSGLSKQAISSEFLKVSPNLFTPERLHLFDTVELYTTLIKTS
FT                   KTIQQGERLGNLSWRILNKALLRNNDINISKKRDGVKNIYSVLNPMNNNGNNKSAATTF
FT                   GTTTNITSKKPQTSFTQILPKNENTDKRSKITAIRPMEALNGATEPRRNRSNDSFQKND
FT                   QHADIRGILSKERQHKSTTALFQKNHNRSENAGNQNDSDFNKSNHLLYKQFNQIKQKKK
FT                   KEDPQMVITGFDTNMVIIKKKHSSDSPNDKRNKSRSRSPEVLNIGKSNHKRSNSGTSQV
FT                   SDNNSKSIFKHESLFGKPNRRGSESKHNNNKTRKDNKIFFSSEDEDESDWDSVSDSSEF
FT                   YTDEIDEEDEDEQYYNKQWDKLVLAKQASNDKKLSAHGSELQDGAHHLEKIQSNNLSQP
FT                   IRRSLLSGLFHNGSSTYSTKDSGEDSGRSSLFNSQNSTPTSISGQNYKVSSAHKPTIET
FT                   TNVTAVGSVTPPHDSFMQPSQYIRETLTRSTSNMRSTSRRGSSSSIVSEATGARYLYES
FT                   NAPPTAHTLLPTALSTHMFVPNNIQQQRMAVKADVNQREGRRLTRRESMDIPIKNVKNS
FT                   VLKTRMEISEEERYQRSQMQRRHK"
FT   gene            complement(<1006624..>1008063)
FT                   /locus_tag="CAGL0J10296g"
FT                   /old_locus_tag="CAGL-IPF2817"
FT                   /old_locus_tag="CAGL-CDS2197.1"
FT   CDS_pept        complement(1006624..1008063)
FT                   /locus_tag="CAGL0J10296g"
FT                   /old_locus_tag="CAGL-IPF2817"
FT                   /old_locus_tag="CAGL-CDS2197.1"
FT                   /note="similar to uniprot|P53940 Saccharomyces cerevisiae
FT                   YNL077w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61110"
FT                   /db_xref="GOA:Q6FNN5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN5"
FT                   /inference="similar to AA sequence:UniProtKB:P53940"
FT                   /protein_id="CAG61110.1"
FT                   /translation="MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESK
FT                   KQFQEISKAYEVLSDPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSA
FT                   GDLFAQFFNSSGDAGPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLY
FT                   QGKKTKLGLNRMRVCSSCDGKGGMRVASCRTCKGQGEVVKTRRVGPMVQTMSSTCNSCH
FT                   GTGTFIKDSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIK
FT                   VQPGDVVIVIDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSI
FT                   IPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPERLEDTTI
FT                   TKLQEILEQDPNVKKEDESDQKRIDDAVTNSDGAVEVEEHVLSDFVPDYKNFKEFKRSR
FT                   SNRSDSRKRRRCNDDDDCIVS"
FT   gene            complement(<1008835..>1009995)
FT                   /locus_tag="CAGL0J10318g"
FT                   /old_locus_tag="CAGL-IPF2821"
FT                   /old_locus_tag="CAGL-CDS2856.1"
FT   CDS_pept        complement(1008835..1009995)
FT                   /locus_tag="CAGL0J10318g"
FT                   /old_locus_tag="CAGL-IPF2821"
FT                   /old_locus_tag="CAGL-CDS2856.1"
FT                   /note="weakly similar to uniprot|P53939 Saccharomyces
FT                   cerevisiae YNL078w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61111"
FT                   /db_xref="GOA:Q6FNN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN4"
FT                   /protein_id="CAG61111.1"
FT                   /translation="MNTNEGHTTSVENDILNAVSNWEKYKQGQAGLPLTQATNAHRDYG
FT                   SIKRKASIARHSSIQRKDFTNVQELKKYKDKKKFIFHRGFFKRNSKKNTNFTRIQDSNV
FT                   KVKLEPHRFRNRAELESVMNYTDLRTLNLSQMYPRATDNAAAVYGIKRKYHYRPRVVPT
FT                   VERIPSRVYHVDDSTVSRKNSIKRSMPSVRNSKVNQMRHRDPVVSITSQAPSGLSTSST
FT                   PTAIRRTIRRSKTSPGGYRNIRYRNLSREHQTIMKLWEQYMRNIIYQRIQLRITLMTTA
FT                   LTTDDSGSESGEVSAEDDAAHSILDEYVFSLPPAIEDDKSLSFRYTPTSGLSIDDPIVI
FT                   PEEEMHEQLMAQPTALRSRLHVIHPGSSSITTTSSSHNHISTPVTA"
FT   gene            complement(<1010761..>1011777)
FT                   /locus_tag="CAGL0J10340g"
FT                   /old_locus_tag="CAGL-IPF2823"
FT                   /old_locus_tag="CAGL-CDS3257.1"
FT   CDS_pept        complement(1010761..1011777)
FT                   /locus_tag="CAGL0J10340g"
FT                   /old_locus_tag="CAGL-IPF2823"
FT                   /old_locus_tag="CAGL-CDS3257.1"
FT                   /note="highly similar to uniprot|P53011 Saccharomyces
FT                   cerevisiae YGL100w SEH1 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61112"
FT                   /db_xref="GOA:Q6FNN3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037597"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN3"
FT                   /protein_id="CAG61112.1"
FT                   /translation="MQPFNTGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRW
FT                   EVNDSWRAHDSSIVSLDWASPEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTL
FT                   NDSKGSLYCVKFAPSHLGLRIASIGNDGIMRMYDALDPSNLRSWTMTAEVKVLPVAPAN
FT                   NLQSAFGLSWCFTRFSPEKIAVCALDQAYIYQRGKDGHFYQAGKLPGHTSLIRSISWAP
FT                   LIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGIKQRQNNTDLEV
FT                   ELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYKCMSIITSKQDI"
FT   gene            complement(<1012289..>1012918)
FT                   /locus_tag="CAGL0J10362g"
FT                   /old_locus_tag="CAGL-IPF2824"
FT                   /old_locus_tag="CAGL-CDS4369.1"
FT   CDS_pept        complement(1012289..1012918)
FT                   /locus_tag="CAGL0J10362g"
FT                   /old_locus_tag="CAGL-IPF2824"
FT                   /old_locus_tag="CAGL-CDS4369.1"
FT                   /note="similar to uniprot|P53144 Saccharomyces cerevisiae
FT                   YGL101w or uniprot|P38331 Saccharomyces cerevisiae YBR242w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61113"
FT                   /db_xref="GOA:Q6FNN2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN2"
FT                   /inference="similar to AA sequence:UniProtKB:P53144"
FT                   /protein_id="CAG61113.1"
FT                   /translation="MNESWKPEDHIPDNVKKALAGTKNSNYVIALLNIVQQLKIQKRTG
FT                   WVDHKVKDPESISDHMYRMGITSMLITNPDINRDKCVRISLVHDLAESLVGDITPNDPM
FT                   TKEEKHRREYDTIKYLCDKIIAPFNSKAAKEILEDWLAYENVSSPEARYVKDIDKFEML
FT                   VQCFEYEQSNNIRLDQFWSAKDAIKTPEVSEWCNDLIKMREEYFSS"
FT   gene            complement(<1013323..>1014251)
FT                   /locus_tag="CAGL0J10384g"
FT                   /old_locus_tag="CAGL-IPF40106"
FT   CDS_pept        complement(join(1013323..1013723,1014203..1014251))
FT                   /locus_tag="CAGL0J10384g"
FT                   /old_locus_tag="CAGL-IPF40106"
FT                   /note="highly similar to uniprot|P02406 Saccharomyces
FT                   cerevisiae YGL103w CYH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61114"
FT                   /db_xref="GOA:Q6FNN1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN1"
FT                   /protein_id="CAG61114.1"
FT                   /translation="MPTRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRTNL
FT                   DKYHPGYFGKVGMRYFHKQQNHFWRPVLNLDKLWTLIPEDKRDEYLKSSSKSAAPVIDT
FT                   LAAGYGKVLGKGRIPNVPVIVKARFVSKLAEEKIKAAGGVVELIA"
FT   gene            complement(<1015309..>1016439)
FT                   /locus_tag="CAGL0J10406g"
FT                   /old_locus_tag="CAGL-IPF2828"
FT                   /old_locus_tag="CAGL-CDS2927.1"
FT   CDS_pept        complement(1015309..1016439)
FT                   /locus_tag="CAGL0J10406g"
FT                   /old_locus_tag="CAGL-IPF2828"
FT                   /old_locus_tag="CAGL-CDS2927.1"
FT                   /note="similar to uniprot|P46672 Saccharomyces cerevisiae
FT                   YGL105w G4P1 protein with specific affinity for G4
FT                   quadruplex nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61115"
FT                   /db_xref="GOA:Q6FNN0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN0"
FT                   /inference="similar to AA sequence:UniProtKB:P46672"
FT                   /protein_id="CAG61115.1"
FT                   /translation="MSDLVAKFKGLSVADSTAQLSREQSALVAQWESILKTGQLQANLN
FT                   NLNLQLRDNSFIAATSQPTVHDVELFEATLPVIKELVSSSKDIKGTLGSYRHIIRWVDY
FT                   LQALLQLSKDQTLEFDRNIELPREVIEKPKKKDDAKKDDGKKDDKKDDKKKANDGDKKQ
FT                   RGKPDEETLKKLREEAKAKKAAKKAAQAQQQKETKAPEKVLPSVIDFRVGFIQKAIKHP
FT                   DADSLYVSTIDVGDEEGPRTVCSGLVKHFPLEAMQERYVVAVCNLKPVNMRGVKSTAMV
FT                   LCGSNAEDKVEFVEPPKGSKAGDKVFFEGFGAEDPLKQLNPKKKLWEQLQPHFSTNENL
FT                   EVIFKDEEDKEHPVRKLTNAKGEEFKVATIVNANVR"
FT   gene            complement(<1016825..>1020031)
FT                   /locus_tag="CAGL0J10428g"
FT                   /old_locus_tag="CAGL-IPF2830"
FT                   /old_locus_tag="CAGL-CDS0357.1"
FT   CDS_pept        complement(1016825..1020031)
FT                   /locus_tag="CAGL0J10428g"
FT                   /old_locus_tag="CAGL-IPF2830"
FT                   /old_locus_tag="CAGL-CDS0357.1"
FT                   /note="similar to uniprot|P33314 Saccharomyces cerevisiae
FT                   YKL092c BUD2 GTPase-activating protein for Bud1p/RSR1P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61116"
FT                   /db_xref="GOA:Q6FNM9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR039360"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM9"
FT                   /inference="similar to AA sequence:UniProtKB:P33314"
FT                   /protein_id="CAG61116.1"
FT                   /translation="MSNIEQLQAHFTSERFQVLIKKNKGCFIGKVDWCSELSIDVWKTH
FT                   YLQITDQGSLTHAIETPIISKEFVGATSGFKEPKHPIIKHLQKCGVRLLSANQHSQPGG
FT                   QQTYQSQPLPIIEVIARNPNATKDMKVYLRIVNLEKFQELLVSLIWWSTFNSKGIFDKV
FT                   RIQHPEYLPQTEPTDRIDVLSESFEIECNVYGPIPFDANVTTLKNISNIENYLSHSSFI
FT                   DAGSMLDPDYLSNSSNFSWFKAKCILKKTGILDIIIDETIIYSLDVKTLLSSEVRIVNG
FT                   HLYDDNCLYIGHLSSLRSKINYVGGNLLGGVGLDDKHQALLLHSKLKHEIELMYTLFQL
FT                   FTSAEQLSLIGAARSNTLRLVNNLEVSVLEGNLNDMSGIEEGTLFVDVILWGKIFARTP
FT                   FVQSSKNPFWREIFEFTEAVIPDKLQFDLKYNSDYKQQILGRCTITKDMIHGTMLDKET
FT                   RVPLFSVANPEKQVGTLCLKVTSRRNYILPPNNFKKIDETLNSINLKYLTGFAYGESIG
FT                   TSKEVEKCAVTFLNIFQTLQKEDIWCTILINKELEDFSKQSGSRPGIDGQYMPSRVNSL
FT                   FRGNSILTKTLELYFLRIGREYLEKAFGTLIRNLLNEEVSFEMDPMRISAKDDIERRQI
FT                   IQHNSEDLKQWVCTIWNRIIETSNDLPKKIKKQLHELRKGFEIICLEKGQQSILNCISA
FT                   FLFLRFFCPLILNPKLFKFTESHLTMKQTRNMLLITKVLQNISTLNPFGVKEQWLQPLN
FT                   PFVEGFREQVIEYVDKVTERKIDFSTKLLGSTADRETAMSIIKPDVLPYMKSSVYGIDK
FT                   YQDETELIELITTDKLGVQNNIKSERTSDLDKLDDWTTVDEEKPEIGELEFEEITEDNS
FT                   DVFGDDLMRYLKSNESPKKKPSSKIYSMQFKEITKQDYDLFEQLETESALLVNKLDRLL
FT                   DRLADYEYPSIQLTEMGSFVQSMSNKIYYTKNGVIVADVLRDGYDDDQFSRLFNEDGKT
FT                   DVFLSLPTVDIQNKRDNTERSQLHLHHQMNGNGKVKSSSMYNLGKIIGTKKKMSESEEF
FT                   EDEKKLNATTRFGRWLKKKI"
FT   gene            complement(<1021676..>1022596)
FT                   /locus_tag="CAGL0J10450g"
FT                   /old_locus_tag="CAGL-IPF2831"
FT                   /old_locus_tag="CAGL-CDS3553.1"
FT   CDS_pept        complement(1021676..1022596)
FT                   /locus_tag="CAGL0J10450g"
FT                   /old_locus_tag="CAGL-IPF2831"
FT                   /old_locus_tag="CAGL-CDS3553.1"
FT                   /note="highly similar to uniprot|P24280 Saccharomyces
FT                   cerevisiae YMR079w SEC14
FT                   phosphatidylinositol(PI)/phosphatidylcholine(PC) transfer
FT                   protein or uniprot|P33324 Saccharomyces cerevisiae YKL091c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61117"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM8"
FT                   /protein_id="CAG61117.1"
FT                   /translation="MSEEAIKKEKEILDSFPSVCEPGSPSGTPGNLNDSQKKALAQLKE
FT                   QLQKDGYKLRLDDATLLRFLRARKFNVAMAKEMYVACEKWRKSAGVDTILEDFHYEEKP
FT                   LVAKYYPQYYHKIDKDGRPVYFEELGTVNLNEMYKITTHERMIKNLVWEYESFVKYRLP
FT                   ACSRSRGYLIETSCTIMDLKGISISSAYHVLSYVKEASHIGQNYYPERMGKFYLINAPF
FT                   GFSTAFRLFKPFLDPVTVSKIFILGSSYKKELLKQIPAENLPVKYGGKSEVSSSKGGLA
FT                   LSDIGPWRDPKFIGPEGEAPKSFVM"
FT   gene            <1023529..>1027566
FT                   /locus_tag="CAGL0J10472g"
FT                   /old_locus_tag="CAGL-IPF2833"
FT                   /old_locus_tag="CAGL-CDS0165.1"
FT   CDS_pept        1023529..1027566
FT                   /locus_tag="CAGL0J10472g"
FT                   /old_locus_tag="CAGL-IPF2833"
FT                   /old_locus_tag="CAGL-CDS0165.1"
FT                   /note="highly similar to uniprot|P38931 Saccharomyces
FT                   cerevisiae YDR443c SCA1 DNA-directed RNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61118"
FT                   /db_xref="GOA:Q6FNM7"
FT                   /db_xref="InterPro:IPR009401"
FT                   /db_xref="InterPro:IPR021643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNM7"
FT                   /protein_id="CAG61118.1"
FT                   /translation="MKEATDDYDLSKLVSNFYRLEKITKINYAQYLPKKQNDQWGIQME
FT                   IQMRKKDRKLLVALLSKELWCFSINDQVLPSPNDIDPELNVSADKTGSFTADYSKPNLP
FT                   PHYALFLKSLKRMIYLNLVEQSKNTLVQFGNSCINITKNNESNNLLQIEPHLFSNSELA
FT                   ISICVKDLGLLPLKVNSIDPAFLSSHALYMAPSGVRVYLVENKNDNSGTNQEHLHKYLV
FT                   PVPENGEVLLKTLYASHGIKLNSSTCQWVNIIPNITHLNGRAPNISQYMDLPKELRTIV
FT                   WPLDLVFAQPALDIDSSTTLSQINGLDTFEDTLSLIDNFLQLKQSSSYRTPGSSGGLTG
FT                   TNIGTNVFSSEGAYTDQFQVYPKSQTNQQQTSSNSKVSPSDAASPYPGIDKIIEQKQFT
FT                   PDFMASPSVSGNSNELFNDRKNGHTDLLISPSKMDVDTDFPGSNLAGQEAPSQPASDVK
FT                   KSSVSASDSELFGEEDEDEDDADLFGESNNDSTGESNANNSKGEITEDIFASSDDESSL
FT                   QPKKESTFYDGIKNGSAESGLNMQDRANLKRTYLDIRIEETPLSSPLYTDPGAPLPVET
FT                   PRDRRKSVFAPLNFNPIIAKDVDNKYKNGGKYSFSPLQKEEALNFDVSRTELSSSEGED
FT                   SESSDDELEDLANKNDGVVYDKAENIGYKTFANLQDSVPPGLIKQDFLGNPYLASLEGS
FT                   KEGQNTIWKMPQTDIAQTESPLKAIDTSIGPDGTLPNTTSSEQSKSVYVHDYGISPTKM
FT                   SNDPAFDTAKIEGKYEFMNNFPSSFPFLLRHMPLSLIPDTFKHLNPTITVNERNNQIID
FT                   LLAEQIVYDYNILGNLTIPDVPYSGIRNYSNGVVKNTIDNLFSEFTRLDGTTLISRLYP
FT                   METPFVSVRKQHDQIKLRSDVQQFTKYANLKPVRGIKNFKFLVLTDSFKEDCIQFISSL
FT                   SQTYINHELGFCEHLQLTNEDSKGLIYLKDFEDSKLLLLAAQIVSYLSTNRTSGKEVAF
FT                   MMIIPVQRCDISELVEKTAKFQIIQNEVKAKIPSMELYLKIVPMDFIKSPLTSVDDYTN
FT                   LCISIYNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFKYDAYIHLAYSRSVDKQWMFA
FT                   ALSDSAGKENMMKTWYLGSSKNKFDEACNHIWEMALSLAGKNYGKVCLILTRLNGILPD
FT                   DELMNWRRLSGRNIHLAVVCVDDNTKISFFDRNESYPSYKRLYQNANSIETLVDPERID
FT                   DYLIRDLDQDIHGVIFENPFPLVNSLHRCAIKSGALVKFNVSTTATEPHSLDKFEVNLL
FT                   NCPHSDSFKLLETILEEFRNLAALNVWFGITNGENGHIPWHVLAVKKMMKTLVHTRVKV
FT                   AQ"
FT   gene            <1029320..>1029910
FT                   /locus_tag="CAGL0J10494g"
FT                   /old_locus_tag="CAGL-IPF2837"
FT                   /old_locus_tag="CAGL-CDS4473.1"
FT   CDS_pept        1029320..1029910
FT                   /locus_tag="CAGL0J10494g"
FT                   /old_locus_tag="CAGL-IPF2837"
FT                   /old_locus_tag="CAGL-CDS4473.1"
FT                   /note="similar to uniprot|P49435 Saccharomyces cerevisiae
FT                   YML022w APT1 adenine phosphoribosyltransferase or
FT                   uniprot|P36973 Saccharomyces cerevisiae YDR441c APT2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61119"
FT                   /db_xref="GOA:Q6FNM6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM6"
FT                   /inference="similar to AA sequence:UniProtKB:P49435"
FT                   /protein_id="CAG61119.1"
FT                   /translation="MEMEEVSVVEECRRELRSALHQYPNFPTQGVLFEDFMTIFQNPSL
FT                   FKTLINTLKSHLNEEFPNGEIDYIVGIESRGFLFGPTLALAMDVGFVPIRKAGKLPGEL
FT                   VRADCEKEYGSATYELQKEAIPKGSNVVLIDDVLATGGSATAATQLLMSVGSNILEYCF
FT                   LMELDFLKGKLKLNDAPVFSLLHTQEEGLKRSP"
FT   gene            complement(<1030397..>1032355)
FT                   /locus_tag="CAGL0J10516g"
FT                   /old_locus_tag="CAGL-IPF2839"
FT                   /old_locus_tag="CAGL-CDS1260.1"
FT   CDS_pept        complement(1030397..1032355)
FT                   /locus_tag="CAGL0J10516g"
FT                   /old_locus_tag="CAGL-IPF2839"
FT                   /old_locus_tag="CAGL-CDS1260.1"
FT                   /note="similar to uniprot|Q04089 Saccharomyces cerevisiae
FT                   YDR440w DOT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61120"
FT                   /db_xref="GOA:Q6FNM5"
FT                   /db_xref="InterPro:IPR021162"
FT                   /db_xref="InterPro:IPR025789"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNM5"
FT                   /inference="similar to AA sequence:UniProtKB:Q04089"
FT                   /protein_id="CAG61120.1"
FT                   /translation="MQEGLKLAERYNASLGSSQTYPIDNHHDKESSTDVATDDIMEKDL
FT                   HSGKTISSQNSLDGSEASTPVHQLERPTIDVSERNDSRRKFRKKTSLDDLLDQASKFQP
FT                   QYEYSFPTSFLRKRKAPQSNESDGEEEAKQNRTNKIVKQKKTKKNVKVTSKSKASVPIE
FT                   EKHTINKQPKKTGTGGMKRGPKPGRKKKSQKNTKNSIKKESTNAINNHKMYEMDSASSR
FT                   FAEHKNSTNSESANNSFIDWSLPKFSPPYQIFDIDNINSYSNFQGQIYSSASLTKHHNE
FT                   IGSKTPFSRNRDGSKSPIDDGQGKLIGLRSILYPDYYEEYLMDYKKVNFRYDGMAEIGK
FT                   IMEYVGRIYLPEKYQKEYKETVVDIYNTAYDNKDLALSISTVEKYNQFVGSIPKAEIVN
FT                   HLAATKELPRSFLHDFLQIVYTRSIHPYASKLKQYKAFSNYVYGELLPGFLTDVYSKCG
FT                   LSKNHLFMDLGSGVGNCVIQASLEFGCRESFGCEIMEAASELTEIQMREYSNRCKLFGF
FT                   KQSKIDYSLRKSFINNEKVESLIPECDVLLVNNFLFDGKLNYEVTKLLQKTKVGCKIIS
FT                   LKNIRASGYTLDTVNIESVLNRLEVKKYRLDNNSVSWTHNGGEYFISTVLDRIDESLLD
FT                   PQKRDRRNTHRPAKYTR"
FT   gene            <1032847..>1034079
FT                   /locus_tag="CAGL0J10538g"
FT                   /old_locus_tag="CAGL-IPF2840"
FT                   /old_locus_tag="CAGL-CDS2696.1"
FT   CDS_pept        1032847..1034079
FT                   /locus_tag="CAGL0J10538g"
FT                   /old_locus_tag="CAGL-IPF2840"
FT                   /old_locus_tag="CAGL-CDS2696.1"
FT                   /note="similar to uniprot|Q03722 Saccharomyces cerevisiae
FT                   YML020w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61121"
FT                   /db_xref="GOA:Q6FNM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM4"
FT                   /inference="similar to AA sequence:UniProtKB:Q03722"
FT                   /protein_id="CAG61121.1"
FT                   /translation="MTVRPELSFPAKDLRRNLISLQPIENFVPVTCDTKRPIKCLIIGV
FT                   HGYFPNKAVDIILGERTGTSQRFVSQAESAVQLYFKELGVAVDTTTLALEKEGTVAKRV
FT                   EFFVDVLGEYRETLAEADFIYFVSHSQGVPVTVNLIGHLLIKGILQLDIDRVSHMSDKP
FT                   IYTQEKIVSVLGMAGVNYGPLYGADKNIWLRLFSVVERKSLMELFEFQNPATKLSMDYM
FT                   EKVQYILDAGVKITFVGSVNDQVVPLYSSLASFLQHPNIQRGIFYTSQCDVPPFIMGCI
FT                   LDSITLLNSGKKDQGFIKEISPYLHGPLTGNGHSDLYFQSEVYTYGIKHALNSQSIKHC
FT                   PSPIIRSDIVSLKVNPYNLPWTMRGLLNEIEKELGKEEVKKLYKLYDEWAPNTPLHQSL
FT                   RIKLSGVTSKF"
FT   gene            complement(<1034276..>1035178)
FT                   /locus_tag="CAGL0J10560g"
FT                   /old_locus_tag="CAGL-IPF2841"
FT                   /old_locus_tag="CAGL-CDS3596.1"
FT   CDS_pept        complement(1034276..1035178)
FT                   /locus_tag="CAGL0J10560g"
FT                   /old_locus_tag="CAGL-IPF2841"
FT                   /old_locus_tag="CAGL-CDS3596.1"
FT                   /note="similar to uniprot|Q04087 Saccharomyces cerevisiae
FT                   YDR439w LRS4 involved in rDNA silencing"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61122"
FT                   /db_xref="GOA:Q6FNM3"
FT                   /db_xref="InterPro:IPR018479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM3"
FT                   /inference="similar to AA sequence:UniProtKB:Q04087"
FT                   /protein_id="CAG61122.1"
FT                   /translation="MALQVVADYYRCVLENERIYYEYQLNRRETVKNSRSEDEFSGSER
FT                   TNALKTDEQLQLQRQVNKLTVDLQSMAHENERLREFQKTQKQILESKIQQLKKTVDSFK
FT                   NERNSSSSSHVRTPPRQTRSGAYTQGKDTDLSRRGGFHLLSPIVGNVNPGKEKAGGLKE
FT                   TLKVGRNTIFDKNSSLLDDDDDDDDDEINGTSVKERSRVTGRKLRSSSSLKDSKNNHIE
FT                   EEEAMEFTTDNSDEVGLMEGLKLRDGSAKANLQLPSGSLSPDEDTQSSNEETTNTRKKR
FT                   RRLTRRRIQTMNSDNSSSE"
FT   gene            <1035745..>1037154
FT                   /locus_tag="CAGL0J10582g"
FT                   /old_locus_tag="CAGL-IPF2842"
FT                   /old_locus_tag="CAGL-CDS2255.1"
FT   CDS_pept        1035745..1037154
FT                   /locus_tag="CAGL0J10582g"
FT                   /old_locus_tag="CAGL-IPF2842"
FT                   /old_locus_tag="CAGL-CDS2255.1"
FT                   /note="similar to uniprot|P50109 Saccharomyces cerevisiae
FT                   YML017w PSP2 suppressor of DNA polymerase alpha mutation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61123"
FT                   /db_xref="GOA:Q6FNM2"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM2"
FT                   /inference="similar to AA sequence:UniProtKB:P50109"
FT                   /protein_id="CAG61123.1"
FT                   /translation="MSKKLSLEEFLGDGILGESVWNEDEINLDAINNTTNLDILKTKST
FT                   EHGNARTPHFGPGMNGPGGPGGSSGSMQSPSMGGRVHAPPTNVNPNADYVVTGPPYIIK
FT                   FSNLPPRFSEFDIKDLFQAKSTQYVKFKLFWELNKNPSIDTMKNGTVFEKNFKKNWKVA
FT                   FVELFTARDMDKILKFWSTPLKELYNILLTPGEFPDFKEYIAKATLITDPNDDPAKPHL
FT                   EKELELQKEEKLKEKKTSPVPTTNKPSYSQILEKSLNSPSPAATPLSGGSSVINQSGHT
FT                   MQHGDNLSKYSKHETNDSDDELSKNFEDKVNFDDNQSSSNDNNDGSQAGSYNGNYNNYK
FT                   RGSSRGSYNRGGRGNFNGRGGNRGGYNSRGNFNNRGGYHNRDGANKDQQRTNSYGNRQD
FT                   RKDNYSKNDDERSNSNKSDNDSLSGLFKPASDFLRGSDDRNSSRGDRGRGGRGSHRGGR
FT                   FSTRGQGTNRF"
FT   gene            complement(<1037574..>1038017)
FT                   /locus_tag="CAGL0J10604g"
FT                   /old_locus_tag="CAGL-IPF2843"
FT                   /old_locus_tag="CAGL-CDS4863.1"
FT   CDS_pept        complement(1037574..1038017)
FT                   /locus_tag="CAGL0J10604g"
FT                   /old_locus_tag="CAGL-IPF2843"
FT                   /old_locus_tag="CAGL-CDS4863.1"
FT                   /note="similar to uniprot|Q04082 Saccharomyces cerevisiae
FT                   YDR437w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61124"
FT                   /db_xref="GOA:Q6FNM1"
FT                   /db_xref="InterPro:IPR013717"
FT                   /db_xref="InterPro:IPR016542"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM1"
FT                   /inference="similar to AA sequence:UniProtKB:Q04082"
FT                   /protein_id="CAG61124.1"
FT                   /translation="MNYRREYYWFSQYVLVTFTLFFAIFWTLLPKVNENDDWVYGFIPA
FT                   SFVRSIGEIIPQRGWIIYFECFLLMGMLCTYIGLQFFNEDILTPPIDDLRTITDSNANI
FT                   IVTDANDDFIRNYAFKESSGIVDLPIMDVCNILYKENYMGEYK"
FT   gene            complement(<1038392..>1039996)
FT                   /locus_tag="CAGL0J10626g"
FT                   /old_locus_tag="CAGL-IPF2845"
FT                   /old_locus_tag="CAGL-CDS1869.1"
FT   CDS_pept        complement(1038392..1039996)
FT                   /locus_tag="CAGL0J10626g"
FT                   /old_locus_tag="CAGL-IPF2845"
FT                   /old_locus_tag="CAGL-CDS1869.1"
FT                   /note="similar to uniprot|P38799 Saccharomyces cerevisiae
FT                   YHR078w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61125"
FT                   /db_xref="GOA:Q6FNM0"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="InterPro:IPR025969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNM0"
FT                   /inference="similar to AA sequence:UniProtKB:P38799"
FT                   /protein_id="CAG61125.1"
FT                   /translation="MEVFFVLLLLCATAFFVGKWSYDSLWLIASSIFETGYRLKTRNNK
FT                   SLYQLPSSGENSNYFFNKFYTVYSIKSQSITRGLRFLFAFGITCYAMTIEIVLWQIKTA
FT                   DASQEHDLITKYIWPLTSLSLTVILILVQPFFILITILNKFFNDSLNINQLVMGTFMSL
FT                   ALMIATLQYMSWGPFYYSKSILTSLSIAGVTVMAILSGIASISTLYYTFSMIFKRRSDI
FT                   SGMQSSSLISRNRRLNLWTTQRQLQSQIDNYERNIIENISILKKMDEDNVGVAAPLRRQ
FT                   MVDKISWFQLEVAKLEKSAKQPTLIRNSRRIFEISFLIYCCHKVLITFLKRIPHIISHA
FT                   LKYPNDIDYEYFYDSSGSSSTGSDPLAVTVAKLLDLFLFGFNYKQDLDSLTKQISLLIS
FT                   ISLFICTLSTVNTTITYLLSLLPSRIQVIATLVMQGEEDADLLPTNTKVSSRRNPSIIK
FT                   NLIVSELIGVYVVSTILLIRSNLPFGTALKLKELLGEKFTMPTGAIDSWFDKIYALVCI
FT                   ISVVGIHIAEKSTFYKT"
FT   gene            <1041784..>1045221
FT                   /locus_tag="CAGL0J10670g"
FT                   /old_locus_tag="CAGL-IPF2847"
FT                   /old_locus_tag="CAGL-CDS0370.1"
FT   CDS_pept        join(1041784..1041789,1041982..1045221)
FT                   /locus_tag="CAGL0J10670g"
FT                   /old_locus_tag="CAGL-IPF2847"
FT                   /old_locus_tag="CAGL-CDS0370.1"
FT                   /note="similar to uniprot|P38798 Saccharomyces cerevisiae
FT                   YHR077c NMD2 nonsense-mediated mRNA decay protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61126"
FT                   /db_xref="GOA:Q6FNL9"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR007193"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL9"
FT                   /inference="similar to AA sequence:UniProtKB:P38798"
FT                   /protein_id="CAG61126.1"
FT                   /translation="MNDERRNELYLLNSKAWLGEDVYPLKTMKLDSSIKRNTGFIKKLR
FT                   KGFTKENKPSLIKDLGEVSFQKYLSEIVSTTNEALTNVQSKNEEVETAVEVVSGLHQRF
FT                   NVAFTEPLSLAFLQNFNFKNIDPTITKDEMAFSAKLKNNLRVFTELYLVNVFANLDEMT
FT                   DKELPSFLMKKGQKKEPILLSILKEALNYNFKTGHSSIVAIYFAKKFPEFFSTDDQSTQ
FT                   SVPLNKDIKESVVSIYRLFFGALSTNASKLQTQVNKLIKEHHKCQIRTGKASDEYLEKY
FT                   EEISPIFERFKSSTLFLSQYLDVEAPQFEIIDINGSQHEQKEDIITNKILPPSQRLWEN
FT                   DETRKLYEVLPDISDIVKEHSQSNKDPKPETLNSFFTELQNIESKGHLDDLVRKYWSLN
FT                   LNNKATRNRIIKFFIETVDWSKISLYARFFAINAPYMKETVDEFIQYLDNGFRSQLHNT
FT                   KFNIKNVIFFGEMVKFSLIPQFMVFHKIRTLIINMNITNNVEILTILFENCGKFLLNKA
FT                   EYKDEMDKLVDRLKSRRTDHSLNMNTKASIEMLLRILFPPSTKSLNTEVVQLTPEENFY
FT                   TVLLRSELGNIGFKDTVRLIRKAHWKDPNTEKLFFTLFTEPEKVSYQNIPILTQVLSGL
FT                   YSFNRNFAIMCIDQVLENIENGLESNTYAENTSRIANIRYLVEIFNYEMMKSNVLMDTM
FT                   HHIVKYGHPNGQPNPFKLNPNDLPNNYFRIHLIVTILSNIRRTPSSLTSSLQLLLRFFE
FT                   YYIFTKEFPLPKETEYAVNNLFEKLSTLIEKKDKTKFTRSANLLESLQKFQEYLVLTKR
FT                   STTENQKGTDTSTLKTDLLEDGPAQDLDDDIGQENDEGLEMIEEFEIIEDDGESYEENN
FT                   LDTEVNTGSISSDESGTDLESDSELESADEDDSDDSMDSDSDSESDSDSGSEDEEDEFD
FT                   AVLDGEDTPFRNYEDERESEQQRIFDEYKKQLQTEEEIKAQAELDKQFDLMMSESLEAR
FT                   KSETSTNDRGLLMVHPSGTKLKDSLNEFNTPEKRPKEKVAFAFLTKTGRKTQSRVVNLS
FT                   RDIKFVSNVVEEGKKLETEREKIKNIVLNRQFD"
FT   gene            complement(<1045346..>1046446)
FT                   /locus_tag="CAGL0J10692g"
FT                   /old_locus_tag="CAGL-IPF2848"
FT                   /old_locus_tag="CAGL-CDS3017.1"
FT   CDS_pept        complement(1045346..1046446)
FT                   /locus_tag="CAGL0J10692g"
FT                   /old_locus_tag="CAGL-IPF2848"
FT                   /old_locus_tag="CAGL-CDS3017.1"
FT                   /note="similar to uniprot|P38797 Saccharomyces cerevisiae
FT                   YHR076w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61127"
FT                   /db_xref="GOA:Q6FNL8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL8"
FT                   /inference="similar to AA sequence:UniProtKB:P38797"
FT                   /protein_id="CAG61127.1"
FT                   /translation="MYSAGVRVVNPWVLTKSMLIISLIMLIAGFLLTYTGLYCPSYQIE
FT                   SGTLYNRVFGNCSRRLFFSGGKSWYWNGNNGSATTDHTGGNSFVYKTAVAYQPKDREDV
FT                   IYQKLKESLQSLTGEDNYFIQANAANDVYAGVADGVGGWAEHGYDSSAISRELCKALKE
FT                   MAATLHKPLTPKQLLDNAYAKIKIDKIVKVGGTTANVAHLSSDGRLDVTNLGDSWCAVF
FT                   RDSKLVFQTEPQTLGFNTPYQLAIIPDEIQQAAAKNGNRYIQNQPSDADEYNFQLSKGD
FT                   IVILATDGVTDNIAIEDLELFLRDNNDQLNENLQKTADELVKKVVKISKDPEFPSVFAQ
FT                   EISRLTGKLYKGGKEDDITMVVVKVE"
FT   gene            <1046800..>1047771
FT                   /locus_tag="CAGL0J10714g"
FT                   /old_locus_tag="CAGL-IPF2850"
FT                   /old_locus_tag="CAGL-CDS3378.1"
FT   CDS_pept        1046800..1047771
FT                   /locus_tag="CAGL0J10714g"
FT                   /old_locus_tag="CAGL-IPF2850"
FT                   /old_locus_tag="CAGL-CDS3378.1"
FT                   /note="weakly similar to uniprot|P39955 Saccharomyces
FT                   cerevisiae YER047c SAP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61128"
FT                   /db_xref="GOA:Q6FNL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL7"
FT                   /protein_id="CAG61128.1"
FT                   /translation="MNTDLIGLAIEEEPEYIDIGLRESQAYQPEMNPTLKKSLSQNALN
FT                   TIKRRNSTNSLHRTLSQSSCFSTSSSATAQIRDDSYKEFLLFLIGEENAKICWENLPRE
FT                   TKNVFIAKALKKSNYLKSESTLKDPSLSEILKDGRIPTKNSFFYYRNRVTPHIRNSERE
FT                   HDAIAISKKASGFYNNELSESERQRLKLDAKKEYDKFLIQRRKVAEQFIDTYDKADDCD
FT                   LVYQQLKEYKSQLPLEESLTKLTEAVERLSSQVSNTPATPIEKIPTTTVSKPKLTATNK
FT                   LSNDRNAPIMQSLYGRFIGKFKRKKKPAASTLIYRKPVEKCA"
FT   gene            <1048132..>1049292
FT                   /locus_tag="CAGL0J10736g"
FT                   /old_locus_tag="CAGL-IPF2851"
FT                   /old_locus_tag="CAGL-CDS2857.1"
FT   CDS_pept        1048132..1049292
FT                   /locus_tag="CAGL0J10736g"
FT                   /old_locus_tag="CAGL-IPF2851"
FT                   /old_locus_tag="CAGL-CDS2857.1"
FT                   /note="similar to uniprot|P38796 Saccharomyces cerevisiae
FT                   YHR075c PPE1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61129"
FT                   /db_xref="GOA:Q6FNL6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR016812"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNL6"
FT                   /inference="similar to AA sequence:UniProtKB:P38796"
FT                   /protein_id="CAG61129.1"
FT                   /translation="MGDDLKRKILLHNLSSNNPILEKLKGGQEPNSNEEGSDSIGDLPS
FT                   LKNDYKRQDNNSTNCTYIPPSQWNTYFRSNEHIKVQSRNIEFNTYYTVPSSILGPSLPV
FT                   FIFHHGAGSSGLSFANLARNLGDQLNNNCCCLSFDARGHGGTKFIDAKQAQNYFRDDFV
FT                   DDFHTLVEYFVSEKLKHLPTEKLSIIFIGHSLGGSICTFTYSKLSIELKKQVIGVAMFD
FT                   IVEEAATLALEKVNHFLQVTPNMFSGYEEAIDWHVSHELSRLRESADIAIPALFKSTES
FT                   GKVVRITNLETFRPFWRTWFSDLSKSFVSLPTCKLLILAGNDNLDRELIIGQMQGKYQL
FT                   VVFQDSGHFIQEDTPRKTALTLVDFWKRNDNKNVVIKSNWGSSNKV"
FT   gene            complement(<1049391..>1051532)
FT                   /locus_tag="CAGL0J10758g"
FT                   /old_locus_tag="CAGL-IPF2852"
FT                   /old_locus_tag="CAGL-CDS1047.1"
FT   CDS_pept        complement(1049391..1051532)
FT                   /locus_tag="CAGL0J10758g"
FT                   /old_locus_tag="CAGL-IPF2852"
FT                   /old_locus_tag="CAGL-CDS1047.1"
FT                   /note="highly similar to uniprot|P38795 Saccharomyces
FT                   cerevisiae YHR074w QNS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61130"
FT                   /db_xref="GOA:Q6FNL5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL5"
FT                   /protein_id="CAG61130.1"
FT                   /translation="MSHLVTLATCSLNQWALDFEGNRDRILESIRIAKERGARLRVGPE
FT                   LEISGYGCLDHFLENDVCLHSWEMYAQILKNPETHGLILDIGMPLLHKNVRYNCRLLSL
FT                   DGKILFIRPKIWLANDGNYREMRFFTPWMKPGVVEELTLPPMIQKITGQKKVPFGDAVI
FT                   NTLDTCIGAETCEEVFTPQSPHIAMSLDGVEIITNSSGSHHELRKLNKRLELILNGTGR
FT                   CGGVYLYANQKGCDGDRLYYDGCALIAINGKILAQGKQFSLDDVEVVTATVDLEEVRNH
FT                   RANVMSRGLQSSLADLKYEHIDVEIELAPRGSRFNPKITPTKSRDVTYHTPEEEIALGP
FT                   ACWLWDYIRRCNGTGYFLPLSGGIDSCATAMIIHSMCRLVHKACHEGNDLVLKDIRRIT
FT                   RSPDDWIPENPQEIANKMFHTCFMGTENSSVETRSRSKQLAEKIGSYHVDLNMDGLVSS
FT                   VVSLFEVATGRKPIFKIFGGSQIENLALQNIQARLRMVLAYLFAQLLPWVRGIPNSGGL
FT                   LVLGSANVDECLRGYLTKYDCSSADVNPIGGISKTDLKGFIKYASEEYDMPILDEFLNA
FT                   TPTAELEPITKDYVQSDERDMGMTYEELSVFGYLRKVEKCGPYSMFLKLLHEWTPRLTP
FT                   AQVAEKVKRFFFFYAINRHKQTVLTPSYHAEQYSPDDNRFDLRPFLINPRFPWASKKID
FT                   EVVKQCEGHSSEIDFMTID"
FT   gene            complement(<1051926..>1054949)
FT                   /locus_tag="CAGL0J10780g"
FT                   /old_locus_tag="CAGL-IPF2853"
FT                   /old_locus_tag="CAGL-CDS0439.1"
FT   CDS_pept        complement(1051926..1054949)
FT                   /locus_tag="CAGL0J10780g"
FT                   /old_locus_tag="CAGL-IPF2853"
FT                   /old_locus_tag="CAGL-CDS0439.1"
FT                   /note="similar to uniprot|P38713 Saccharomyces cerevisiae
FT                   YHR073w OSH3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61131"
FT                   /db_xref="GOA:Q6FNL4"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="InterPro:IPR041680"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL4"
FT                   /inference="similar to AA sequence:UniProtKB:P38713"
FT                   /protein_id="CAG61131.1"
FT                   /translation="METIDIQNRCFVVRWVKCSKDDVINYQVKPLKKSIQFGIYKKLKT
FT                   DIDAQPSAVHIAPDTKAMLDYTSRTLLKRNSSIYGSSTSSSSTNVSNRRRNSSPSIVSQ
FT                   SAEFKKKERSSSNLSIADIQQQTQELPLKEKLAASGFKLVEWLGTISGNNVKQGTIEVK
FT                   DNDYYYAFILDNTASKNAKKKILFNASVIKDTARPVMSPTSKKSSSSLFGRSRGNSAKT
FT                   SSTKLVNGAQGLHDLNLPKNAGILSVGQGRYLQGYLMKKRRKRLQGFKKRFFTLDYRYG
FT                   TLSYYLNDHNQTCRGEMVIHLSTVSANKKDRIIIIDSGMELWFLKAADAAAWQTWVDAL
FT                   QFCFEKNQPIASDIDADAEDTTLGSDAANIEGFSDRTINDSRVPSRPEFRNTSAFSSSR
FT                   NEYTPLSDDVYNEFAGNLGIIQEWVEKCKLDSLNYVPARKEFILEGSKSVGGDHEKKGK
FT                   MYLAGIQTPKEISSVDSLPEISEETPTSHQLYKRLSDLESIVDRFIKQSRVLLKDHRYI
FT                   SKQVKDSRQSIISTFSDNDEYFDAKDGIPQGVILLDDAEEEVGETGIMKDDSAVMIDDV
FT                   EDDEYDSDMESRNQNLNGFTSTDSLVPNDRVLTTESTPTMLASKSDETPSYKQQLYPFP
FT                   IGGQITRRKDILPSLTTPPSLLSFLRKNVGKDLSSITMPVTSNEPLSILQVISEAFEYS
FT                   DLLSRKDMQPLTSVTLFAISALSIQRDKTRALRKPFNPLLGETFEYVHDKLGFRLIAEK
FT                   VSHKPQIFAFNAEHQDWVCEYTMTPVQKFWGKSLELNNEGTIKLTMKSSGVVYKWVQPT
FT                   TMVKNLIAGERYTEPVNEFEILGSDGSKAKITFQKTGIFGGRSESLTATITPPKSSKWK
FT                   RQALQGKWSEFLEDSTTHKKLWTVGDLVKDSSKKYGFTVFTAQLNEITDIERNNLPPTD
FT                   SRLRPDIKAYESGDIEKAEELKLKLEQLQRDRRLKGHDVKPRYFEKISNVEWKRIEGSA
FT                   CYWSKRERNDWSDVEKLW"
FT   gene            complement(<1055802..>1055975)
FT                   /locus_tag="CAGL0J10802g"
FT                   /old_locus_tag="CAGL-IPF13846"
FT   CDS_pept        complement(1055802..1055975)
FT                   /locus_tag="CAGL0J10802g"
FT                   /old_locus_tag="CAGL-IPF13846"
FT                   /note="highly similar to uniprot|Q6Q547 Saccharomyces
FT                   cerevisiae YHR072wa NOP10"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61132"
FT                   /db_xref="GOA:Q6FNL3"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNL3"
FT                   /protein_id="CAG61132.1"
FT                   /translation="MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQR
FT                   VTLKKRYNLLPQ"
FT   gene            complement(<1056204..>1058405)
FT                   /locus_tag="CAGL0J10824g"
FT                   /old_locus_tag="CAGL-IPF2855"
FT                   /old_locus_tag="CAGL-CDS0986.1"
FT   CDS_pept        complement(1056204..1058405)
FT                   /locus_tag="CAGL0J10824g"
FT                   /old_locus_tag="CAGL-IPF2855"
FT                   /old_locus_tag="CAGL-CDS0986.1"
FT                   /note="highly similar to uniprot|P38604 Saccharomyces
FT                   cerevisiae YHR072w ERG7 lanosterol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61133"
FT                   /db_xref="GOA:Q6FNL2"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="InterPro:IPR032696"
FT                   /db_xref="InterPro:IPR032697"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL2"
FT                   /protein_id="CAG61133.1"
FT                   /translation="MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQS
FT                   TFVQWLLQDEEFPTPSPRKEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMT
FT                   IGYVAVNYIAGVKLPEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRL
FT                   LGLPKDHIVCVRARHTLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSL
FT                   PIHPGRWWVHTRAVYLPVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVC
FT                   GVDLYYPHSKILDTANDVIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVN
FT                   QAFCALVTYLEEGKDSKAFERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFV
FT                   AGLAEKPEFREMIINAYKFLCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAE
FT                   AIKAIIMVRNSPVFSSVHDEITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSM
FT                   EKLNPAEVFGNIMVEYPYVECTDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQ
FT                   DDGGWYGCWGICFTYAGMFAMEALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMK
FT                   SSELHDYVDSPKSLVVQTAWALIALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAE
FT                   GVFNHSCAIEYPSYRFLFPIKALGLYNGRNYTNSSQNTQ"
FT   gene            complement(<1058824..>1059513)
FT                   /locus_tag="CAGL0J10846g"
FT                   /old_locus_tag="CAGL-IPF2856"
FT                   /old_locus_tag="CAGL-CDS4174.1"
FT   CDS_pept        complement(1058824..1059513)
FT                   /locus_tag="CAGL0J10846g"
FT                   /old_locus_tag="CAGL-IPF2856"
FT                   /old_locus_tag="CAGL-CDS4174.1"
FT                   /note="similar to uniprot|P38794 Saccharomyces cerevisiae
FT                   YHR071w PCL5 cyclin like protein interacting with PHO85P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61134"
FT                   /db_xref="GOA:Q6FNL1"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL1"
FT                   /inference="similar to AA sequence:UniProtKB:P38794"
FT                   /protein_id="CAG61134.1"
FT                   /translation="MAFVTPSGELVPVETLSNNVYHTPPYQSLKSDGTSSEANTQLSSS
FT                   DFVSFITDVVAGVHSKSHKRINNSKTSIANFLKEVTKRAHISRDILLLASIYFDKLIKS
FT                   HEGAINVPEFAYCGKRLLLVCIILAHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLK
FT                   QLNYGLTVTNEAMTSWGSKLAGYEQRHTTSVCTLTSIANATLKRKMELDDDVTIGDINP
FT                   RKIIRTV"
FT   gene            complement(<1060575..>1061423)
FT                   /locus_tag="CAGL0J10868g"
FT                   /old_locus_tag="CAGL-IPF2858"
FT                   /old_locus_tag="CAGL-CDS3737.1"
FT   CDS_pept        complement(1060575..1061423)
FT                   /locus_tag="CAGL0J10868g"
FT                   /old_locus_tag="CAGL-IPF2858"
FT                   /old_locus_tag="CAGL-CDS3737.1"
FT                   /note="weakly similar to uniprot|P38790 Saccharomyces
FT                   cerevisiae YHR067w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61135"
FT                   /db_xref="GOA:Q6FNL0"
FT                   /db_xref="InterPro:IPR026223"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNL0"
FT                   /protein_id="CAG61135.1"
FT                   /translation="MSWKSLHWLHKDIISFEKNQAFNNLFKNAVRTNIKMTENIQLADN
FT                   LLYFNPVDSDLDPDGYFSYQSPSSLISTLQRYRLRRWTNGEITNNKPLVPGKEYSCHER
FT                   IKFIKPIGDSCFVSLQRTIRDSNDVTAITEDRTLQYTNRIGDRFSALEEMAQETKQYEA
FT                   VAGINISDLDIVKYCQMTNNPHRIHWDRDYCRTQEGIKDILVPGPLITQIMARLLCPNS
FT                   ASLITRIKYKTVSPIYPFTPLRAIKVSPTALWLADESKLYAKMEIKESHRDIMPDQHLE
FT                   A"
FT   gene            complement(<1061847..>1063241)
FT                   /locus_tag="CAGL0J10890g"
FT                   /old_locus_tag="CAGL-IPF2860"
FT                   /old_locus_tag="CAGL-CDS2292.1"
FT   CDS_pept        complement(1061847..1063241)
FT                   /locus_tag="CAGL0J10890g"
FT                   /old_locus_tag="CAGL-IPF2860"
FT                   /old_locus_tag="CAGL-CDS2292.1"
FT                   /note="highly similar to uniprot|P38789 Saccharomyces
FT                   cerevisiae YHR066w SSF1 mating protein or uniprot|Q12153
FT                   Saccharomyces cerevisiae YDR312w SSF2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61136"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK9"
FT                   /protein_id="CAG61136.1"
FT                   /translation="MAKRRQKKRTHVQVVPDEERGIPKSMVIRVGQTSLGNHSLNQLVK
FT                   DFRQIMQPHTAIRLKERKSNKLKDFVVMCGPLGVSHLFMFTQSEKTGNVSLKIARTPKG
FT                   PTITFQVMDYSLGRDIKKYLRRPKSLTKEDVMNPPLLVLNGFTTKPKDENDEKEVERAN
FT                   VDKIVVSMFQNIFPPLNPSRIHINSIKRVFMINKDKETGEISMRHYFIDIREVDISRNL
FT                   KKLYKAKNNLSKAVPNLHKKEDISSLILDHDIGAYTSESEIEEDSIVKVMDTESVKVKR
FT                   SVKHKEDDTVEEAKDVDGDEDMKDFESSNIPLEEDDENEQEQAPVSTPRKKAVRLTEIG
FT                   PRLTLKLVKLEEGICSGKVLHHEFVQKTDSEIRALEKRHKEKMRIKEQRRKEQEENIAK
FT                   KKAHKEAKRQRKLERRAARKAAAEEGSEEGKDISESESDSSSSESENEYKDVPEDIDSD
FT                   LYSDIE"
FT   gene            <1063600..>1065081
FT                   /locus_tag="CAGL0J10912g"
FT                   /old_locus_tag="CAGL-IPF2861"
FT                   /old_locus_tag="CAGL-CDS2107.1"
FT   CDS_pept        1063600..1065081
FT                   /locus_tag="CAGL0J10912g"
FT                   /old_locus_tag="CAGL-IPF2861"
FT                   /old_locus_tag="CAGL-CDS2107.1"
FT                   /note="highly similar to uniprot|P38712 Saccharomyces
FT                   cerevisiae YHR065c RRP3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61137"
FT                   /db_xref="GOA:Q6FNK8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNK8"
FT                   /protein_id="CAG61137.1"
FT                   /translation="MAGKVGKVSKKSDDVSSLAAKIRARALENQKKMQAASRKDSESDS
FT                   SDEEVERPAKKQAKDEKVEEPEEEVTFESFAQLNLVPELIQACQNLNFTKPTPIQARAI
FT                   PPALAGSDVIGLAQTGSGKTAAFAIPILNKLWEDQQPYYACVLAPTRELAQQIKETFDS
FT                   LGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLKNLKFLVM
FT                   DEADRLLDMEFGPVLDRILKIIPTKGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNK
FT                   YQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIGKTVIIFTRTKANAERLSGLCNLLEFSA
FT                   TALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIH
FT                   RVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKESVDKNIILTLRDSVDKANG
FT                   EVVMEMNRRNKEKQARGKGRRGRMMAKENMDREEK"
FT   gene            complement(<1065251..>1067086)
FT                   /locus_tag="CAGL0J10934g"
FT                   /old_locus_tag="CAGL-IPF2864"
FT                   /old_locus_tag="CAGL-CDS1443.1"
FT   CDS_pept        complement(1065251..1067086)
FT                   /locus_tag="CAGL0J10934g"
FT                   /old_locus_tag="CAGL-IPF2864"
FT                   /old_locus_tag="CAGL-CDS1443.1"
FT                   /note="similar to uniprot|P32776 Saccharomyces cerevisiae
FT                   YDR311w TFB1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61138"
FT                   /db_xref="GOA:Q6FNK7"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="InterPro:IPR027079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK7"
FT                   /inference="similar to AA sequence:UniProtKB:P32776"
FT                   /protein_id="CAG61138.1"
FT                   /translation="MSHSGAASYKKVNGILTINEDVSPAELLWRSTDGDKTHMIVLDVV
FT                   DKLQATPATSEKLMLRLIEKVDESKKVKNNDGEMVSPKPAAHMFSFNNRSVMDNIKITL
FT                   QAIISRYKDTEIHEQKQAVSGDSNAVSKESQQSQQQELINTSKLDDSLSYDNLMKNLKL
FT                   QQSLLTSNKQLMKTFQETVINSNLPPEEFWSTRIPMLRAFALSTSQKIGPYNVLSVIKP
FT                   VASSENQVNVNLSRDKIISIFQNYPIVKKAYLDNVPKNFKESEFWARFFSSKLFRKLRG
FT                   EKIMANDRGDVIIDRYLSLDIEFDRKDDERLFHPVSKFIDLGGNTQDDPVKRGNKPDFT
FT                   MQPGMDMNGNNDGTLDILRSMNRLSEKMTTALENEYSRSNLTNSAELEQEGNEQELELN
FT                   DLNDEYKAEYSIVHLKIGTKERSNGNEGEGRTTEHIKITDPIVRNQIEEVNIGLQRELD
FT                   LTDVVSGKDDKEGTIIDAINQQVIKTVRINAKQAKHNNMDSSYMTTFTTNKINETDVPS
FT                   EMPPDLLESCRMLHGTCCEFLKHFYIHFQSGDQKQANSVRKLYNHLKECVAKLKELLKD
FT                   VKDGDGEKLASLCEAYLKTTMNSIELAISKYESCL"
FT   gene            <1068578..>1070431
FT                   /locus_tag="CAGL0J10956g"
FT                   /old_locus_tag="CAGL-IPF2866"
FT                   /old_locus_tag="CAGL-CDS1417.1"
FT   CDS_pept        1068578..1070431
FT                   /locus_tag="CAGL0J10956g"
FT                   /old_locus_tag="CAGL-IPF2866"
FT                   /old_locus_tag="CAGL-CDS1417.1"
FT                   /note="some similarities with uniprot|P46676 Saccharomyces
FT                   cerevisiae YDR310c SUM1 suppressor of SIR mutations"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61139"
FT                   /db_xref="GOA:Q6FNK6"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK6"
FT                   /protein_id="CAG61139.1"
FT                   /translation="MTTDYNSLRQEIDSVSEKVAELESKVKKNDVDTTTSIEDMLVAIK
FT                   TIAYNQTVLESKFEDILKNQMNTDVLVNTISSRLDRIAKIIPTAGNNGTRSSTSSTSTY
FT                   TNSNSSGVQTRASSSRRVSTSNSATVTNNQAPAVPVKRGPGRPRKDGTYGGVSKTASSA
FT                   NSSASNSNTSNLTALKKTPNEAELPLGGRTRLPNNVPQVSKSKRYFVNPTDSPPQKTTA
FT                   TTHNRPGRPPTKTEAKTVAPGENPPVKRKRGRPPKKRPAVAIAAAARKESKSELGSQIK
FT                   TENKETNGRSISDKSLSSSANESADSIITRFRRKRRYEQDDDNEEEKSSKIKREDEDVD
FT                   EEEDEVDVEVEDEDVSVIENDDNSTEENEDGDSQITDNLYSKEDLDKRIKAFKFGKKGP
FT                   FWMGSRMTRLERIEFLKNSTRWNSHTEGTRKALAMALELESNADDDNISLSEKMLELVD
FT                   KYENENDDDYHRNINRDVNVDSDDTTSYENTSDRLVRAAQQVTDNLAARFSKTNASNTE
FT                   IKEVKKDLPRDDNSNKGIAMNPVHEDASNNTPTHGLPSHSNDEGPKVPIISKDLSQGPN
FT                   NMAQLTDQNNQPAGVDTINEKKDKSDADANNVISNHLATST"
FT   gene            <1071911..>1073158
FT                   /locus_tag="CAGL0J10978g"
FT                   /old_locus_tag="CAGL-IPF2868"
FT                   /old_locus_tag="CAGL-CDS2667.1"
FT   CDS_pept        1071911..1073158
FT                   /locus_tag="CAGL0J10978g"
FT                   /old_locus_tag="CAGL-IPF2868"
FT                   /old_locus_tag="CAGL-CDS2667.1"
FT                   /note="weakly similar to uniprot|Q06648 Saccharomyces
FT                   cerevisiae YDR309c GIC2 CDC42 GTPase-binding protein or
FT                   uniprot|P38785 Saccharomyces cerevisiae YHR061c GIC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61140"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK5"
FT                   /protein_id="CAG61140.1"
FT                   /translation="MASIQGNQMLPQIKSIWIDEDQEAEKLYGMAGQTLLLDESDMESD
FT                   NEEFDVTVLNSDKPVLNHKKKIMLPPLVPRSPTYHRYNKIASPDAGKKDKKFFRSLFKS
FT                   NGSKNKGSNGDKAMKISTPFDFHHISHASFNRNQSTDLPNLEDIENYYGSEQLSQLAAS
FT                   RATGLNKAFVTKSTATKAPSNFSSLTKSQGYGNLALKKDRVVSSSSISLARSGSVASSN
FT                   LSNNNSLMKNGRVVSSSTIATSLFDYEDHLSPNHSVGMKPTFASHTTPNFENKENRDSG
FT                   NSELSINFLKSYSFPTLLEEEEEDAAFEVNKASEDKLVGNVLESLMDSCDSLESKNDSQ
FT                   TVHHDIDELESGIKRLSFENTPKKILTRRNSDTQVFKNFGESPLIHHSPKNMKSADDLL
FT                   TMLDNQINQAYSEDYF"
FT   gene            <1073752..>1074513
FT                   /locus_tag="CAGL0J11000g"
FT                   /old_locus_tag="CAGL-IPF2869"
FT                   /old_locus_tag="CAGL-CDS3971.1"
FT   CDS_pept        1073752..1074513
FT                   /locus_tag="CAGL0J11000g"
FT                   /old_locus_tag="CAGL-IPF2869"
FT                   /old_locus_tag="CAGL-CDS3971.1"
FT                   /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
FT                   YPL199c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61141"
FT                   /db_xref="GOA:Q6FNK4"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK4"
FT                   /inference="similar to AA sequence:UniProtKB:Q08954"
FT                   /protein_id="CAG61141.1"
FT                   /translation="MDTDVLRRNNGADYNHSIDPEYQRLRAAADDAIKSRQKLSAESQK
FT                   AYKSGDKAKAHQLSEEAKKKAALADTLNLQAAEYVFVQNNADSSSNEIDLHGLYVKEAM
FT                   WILKKRMAFAADKGELELRIITGKGNHSQNHISKIKEETIELCQSLGLNYHVNSKNTGV
FT                   VIVEVDKNKIPTDWVNPESTVSEPKPSAKINSHTQYQQSQNAGYQPQQGPTYQQGPSYQ
FT                   QQPQQQSQTSAGGIAALVAGLLCLCLNNDRK"
FT   gene            <1075366..>1076025
FT                   /locus_tag="CAGL0J11022g"
FT                   /old_locus_tag="CAGL-IPF2870"
FT                   /old_locus_tag="CAGL-CDS4252.1"
FT   CDS_pept        1075366..1076025
FT                   /locus_tag="CAGL0J11022g"
FT                   /old_locus_tag="CAGL-IPF2870"
FT                   /old_locus_tag="CAGL-CDS4252.1"
FT                   /note="highly similar to uniprot|P47822 Saccharomyces
FT                   cerevisiae YDR308c SRB7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61142"
FT                   /db_xref="GOA:Q6FNK3"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNK3"
FT                   /protein_id="CAG61142.1"
FT                   /translation="MTDRLTQLQRCLDQVMEQFCATLNFIDKRHDFEPFNDKEPKMTDK
FT                   HASVATPEEFSNGIDELSTDIIVKIRQITTLIDSLPGVGVSAEEQLHKIDSLQKKLVDI
FT                   EDEKIHAIKKKDDLLKQVDDLITVFVGGIADSRRGTSLAPENVQEDNDIKQEAEVPTSS
FT                   EAIEQKIANEKIESKIEGEYNDNINEDSDSKSADSELFMDKDDADNISESISPGKI"
FT   gene            complement(<1076112..>1078322)
FT                   /locus_tag="CAGL0J11044g"
FT                   /old_locus_tag="CAGL-IPF2872"
FT                   /old_locus_tag="CAGL-CDS0976.1"
FT   CDS_pept        complement(1076112..1078322)
FT                   /locus_tag="CAGL0J11044g"
FT                   /old_locus_tag="CAGL-IPF2872"
FT                   /old_locus_tag="CAGL-CDS0976.1"
FT                   /note="weakly similar to uniprot|Q06644 Saccharomyces
FT                   cerevisiae YDR307w PMT7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61143"
FT                   /db_xref="GOA:Q6FNK2"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK2"
FT                   /protein_id="CAG61143.1"
FT                   /translation="MPEAKRQDAQPGETASSVLIKGPQGIPFVPIDAYKQHGIINTKIC
FT                   YTDKIIGALVIPAQFAAMCQPLIEEYLNSDSFLNEISEGLLAESLIDQMDKRAFIPNIH
FT                   PFIIQLLTLVLCKNRLLFQLRVLSFLCSCWTLTMLYFITRKLNINKLISVSVLSIYMSL
FT                   DIVQESAISNLTDNIQLASIMTLFFLWESYKYNVQNKITCSRMLFVSIPAIILVGTKYL
FT                   GSTMSWLFFVLIVVYHLWQNILPDVKNFKYLKNFFGLFKLLLISMTFIPFGVLTCSYLL
FT                   QDYSMIYLYDNSNYHVRSFMPIEYKKLVPTFDNYNSDEIIFKKSTVRIRHVESLGGYLS
FT                   TLPNVNYMSGSFEQIAFLSQFEDSELNNWIIEPSTEAQNNKEVRSGSRIRLRNVVTGKL
FT                   LRASSSRPPMSDQEYNSEVSLTGSANFSGDADETWLIDQKYVIGKAIPFNKMGLPPSEN
FT                   INALINTNSVFTLRNDGHGCMLLSHDTDLPDDWDSMSSFKPEFHRQELTCNTTPTKKLT
FT                   YFMFESVVDQTNDTASRAPLTIHDKLKEVFKLIPSMLKTNYKFNYYIRNSQFLKGRREE
FT                   DDEIDMQYNLQKFQNRVPPEKWATWRPVSLITKKPSSVYIVSIIVLVLYVLFEITNLLI
FT                   SWNPLSFDTPSLMVHKRLLGKISDEWMLQRMMSDDFLLECFLGWITHYYIFTRTPHQNL
FT                   DIVLYLPSLLFNLLFVITIFDTLTKSNKMWFSLLPIYIALAI"
FT   gene            complement(<1078886..>1080901)
FT                   /locus_tag="CAGL0J11066g"
FT                   /old_locus_tag="CAGL-IPF2873"
FT                   /old_locus_tag="CAGL-CDS1193.1"
FT   CDS_pept        complement(1078886..1080901)
FT                   /locus_tag="CAGL0J11066g"
FT                   /old_locus_tag="CAGL-IPF2873"
FT                   /old_locus_tag="CAGL-CDS1193.1"
FT                   /note="similar to uniprot|Q07896 Saccharomyces cerevisiae
FT                   YLR002c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61144"
FT                   /db_xref="GOA:Q6FNK1"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK1"
FT                   /inference="similar to AA sequence:UniProtKB:Q07896"
FT                   /protein_id="CAG61144.1"
FT                   /translation="MARKSKSLKLIEERNKKRQLEQDSLLQPGSFNNLDNVEEEYQADE
FT                   GRRNKKAKQSWDDEEQSYELQPRKLRNDGEEMVEGLPIKINGKVERQLIAKNRKKVTQT
FT                   NESEDEDSEEENNKNAEKDKDSQSEVEKEDEPDTEEKIIQLQEEIADLVDKLMNEPEEY
FT                   PAALTRLVKMTTSKNPNTCIFSMLALVPVFKSVIPGYRIRPLTDLEKKEKVSKEVARLR
FT                   TFEQGLVHNYKLYLDTLKELAKVPNNADPIKVNIGRQAVRAANELATTGSHFNYRTELF
FT                   TILVRRICKPNLQADPESLNIIKTIEGLFNDDTEGNVSAEFMRLLSKVIKTRNYNVEES
FT                   VINMFLSLDVLHDYDPNTKSENEPVRIKMKKKDRVHLSKKQRKARKEMKQIEQEMEKAE
FT                   QTVSAEERERNQGEILQLMLSLYLNFLKSDNPKLIGASLEGLTKFGSQVNFDLLGDFLA
FT                   VMKEIILTSKFDSLSSEEVRKILLCIVSAFSLVSNHNTMKFSVDLSSFVDALYYVLPYI
FT                   ALDADIEYSYKSLRLADPLENEIIKPSVNVSTKAELLLKALNHIFFRSKSGTRERACAF
FT                   TKRIYGCILQTPEKSSIALLKFIEKLMTRFPEIASLYSTEDRVLNGKFDLFTDAIAQSN
FT                   PTAAMLWENAVLQKHYCPTVVKGIRALSTRSKDSNK"
FT   gene            <1081270..>1081962
FT                   /locus_tag="CAGL0J11088g"
FT                   /old_locus_tag="CAGL-IPF2874"
FT                   /old_locus_tag="CAGL-CDS4160.1"
FT   CDS_pept        1081270..1081962
FT                   /locus_tag="CAGL0J11088g"
FT                   /old_locus_tag="CAGL-IPF2874"
FT                   /old_locus_tag="CAGL-CDS4160.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61145"
FT                   /db_xref="GOA:Q6FNK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNK0"
FT                   /protein_id="CAG61145.1"
FT                   /translation="MRVIRFKGYGKKLQRKVREPKPINLKYAQLLNRTFVIQNFTYTHA
FT                   KLKRDDFEDEIVSDGDYEELVNEFRAANNKQEQVEREEQEEISPVGSNDVELQVAQHRP
FT                   QLKLRHVSFMKDETNNIKSSKSATILHSMGNESVLQTSKVKHQRIIAKKMVSLQANNTI
FT                   VHTSQKSHCKPKSSHVGTILHLNRCNNNSMPINKFMTNTSHMLKTSKRESVYSPKAPFS
FT                   FRVKLNRR"
FT   gene            complement(<1082062..>1083588)
FT                   /locus_tag="CAGL0J11110g"
FT                   /old_locus_tag="CAGL-IPF2875"
FT                   /old_locus_tag="CAGL-CDS2024.1"
FT   CDS_pept        complement(1082062..1083588)
FT                   /locus_tag="CAGL0J11110g"
FT                   /old_locus_tag="CAGL-IPF2875"
FT                   /old_locus_tag="CAGL-CDS2024.1"
FT                   /note="similar to uniprot|P47084 Saccharomyces cerevisiae
FT                   YJR003c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61146"
FT                   /db_xref="GOA:Q6FNJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ9"
FT                   /inference="similar to AA sequence:UniProtKB:P47084"
FT                   /protein_id="CAG61146.1"
FT                   /translation="MSLVQRRLFGSAKLLCSYAKLLNRPHFKPLKETLSKVDTVDVSAA
FT                   RQIVNLLEKLDVSARDQAAVHNDILATLVKDNYGISNVHLKALQDLSVQPSKEALLELI
FT                   RSNPGRVDSSWDLFVKYRGTEVSDDIVHAVIQKIIQMDQAMIADGKHNLDVNDIAQIVI
FT                   LLESLSDKTALDPQLYESFLNDIFREQLSCLLPLALSLAEVDSKVLKEKLVDATDIQFI
FT                   HLLEKIDPQSIVNDEELLLLSLDRLKPSTSATETEIETKNKGLLLEAIENARTVSKLPF
FT                   EHTLLDEPLEDKKAKLFSQITGEVQNNKLDETNIQLALKLLRIVGLEIGDVKLALEMYH
FT                   NYLIKYVSHSEELMFEAFLMLSYQAVKTNNKQLQQYSEAFIPANLDIRDSLYTKFLCGL
FT                   ILSKSKFSMDDALELYNDKNQVISKTADEHTLKSPFDRVTECLIMGYMLNRDIDFARVI
FT                   FQEAMGQKLFSGTTITKSIKSHMAEYGEATEKGTIQESMEKRILDYLCSI"
FT   gene            <1084251..>1085066
FT                   /locus_tag="CAGL0J11132g"
FT                   /old_locus_tag="CAGL-IPF2876"
FT                   /old_locus_tag="CAGL-CDS3820.1"
FT   CDS_pept        1084251..1085066
FT                   /locus_tag="CAGL0J11132g"
FT                   /old_locus_tag="CAGL-IPF2876"
FT                   /old_locus_tag="CAGL-CDS3820.1"
FT                   /note="weakly similar to uniprot|P53885 Saccharomyces
FT                   cerevisiae YNL173c MDG1 GTP-binding protein of the
FT                   pheromone-response pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61147"
FT                   /db_xref="GOA:Q6FNJ8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ8"
FT                   /protein_id="CAG61147.1"
FT                   /translation="MSEVEFVWKSGTPSEVVVTGDFDEWKCSHKLEKRGDEFRGVVPVK
FT                   FTAPKVYFKFVVDGEWVASGDYKRESNDLGSENNYITKEDARMGSMDASMDAAPKGTAP
FT                   MSSSTDGLQSTTTHELTSEVESQVKGSGEQRKKFKIKRVVKTNKKTGEREVVSQEVIAL
FT                   DENDQPITESMENTPTAEPMMEDAKADTMEENKKEEKMAAPMAAEEKMNGDSVKKSEPM
FT                   KSENKPMAEQKKPMANGKPMTNSTKNGKQPEKKSFMKKVKTFFAPRQSL"
FT   gene            <1085737..>1086879
FT                   /locus_tag="CAGL0J11154g"
FT                   /old_locus_tag="CAGL-IPF2878"
FT                   /old_locus_tag="CAGL-CDS2897.1"
FT   CDS_pept        1085737..1086879
FT                   /locus_tag="CAGL0J11154g"
FT                   /old_locus_tag="CAGL-IPF2878"
FT                   /old_locus_tag="CAGL-CDS2897.1"
FT                   /note="similar to uniprot|P53883 Saccharomyces cerevisiae
FT                   YNL175c NOP13"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61148"
FT                   /db_xref="GOA:Q6FNJ7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034226"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ7"
FT                   /inference="similar to AA sequence:UniProtKB:P53883"
FT                   /protein_id="CAG61148.1"
FT                   /translation="MSDVEKEVKEVQEVPADEAEKIQKALSDPTKKRKAEDEIEIDLSQ
FT                   TIPLSKKQKRLLRRGKITLEELNAKFNLDPSSVDEFHKEVAEKERGKDGESKDSAKESE
FT                   SSVKDSRKNGVWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRVNMPLAKNDGKQ
FT                   IKNKGFCYVDFKTQEQVEAAIKLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPS
FT                   RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNAL
FT                   KDKSCRKIAGRPLRMEFGEDRSKRQVRKRPDAAPKKSFDLPNHDAVSRPPREEKSYNEK
FT                   KPRQRNYVESNNRVKSSIALKTAQRASAAIVPSQGKKITF"
FT   gene            <1088473..>1090362
FT                   /locus_tag="CAGL0J11176g"
FT                   /old_locus_tag="CAGL-IPF2882"
FT                   /old_locus_tag="CAGL-CDS1354.1"
FT   CDS_pept        1088473..1090362
FT                   /locus_tag="CAGL0J11176g"
FT                   /old_locus_tag="CAGL-IPF2882"
FT                   /old_locus_tag="CAGL-CDS1354.1"
FT                   /note="some similarities with uniprot|P53882 Saccharomyces
FT                   cerevisiae YNL176c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61149"
FT                   /db_xref="GOA:Q6FNJ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNJ6"
FT                   /protein_id="CAG61149.1"
FT                   /translation="MIHNSSYTEAADIKSLSSFIEESSRVPDYISESNNIGWSSNINNP
FT                   PLFESSSFDITTQNDNWILTETMQNITTESSSTFSRSVASSVFPSSSQAFVSPPSIIDI
FT                   PISSIPESSSISISSDVLSSAITVSQTSSSSYSSLISSYSTIQSTSSSSISENEISSSS
FT                   RISPGLLSSVPSITTSFSSGISSSVSPTSSLQQIAEQSSNSSLAENDLLSSSLTILSSV
FT                   LSSSVLLHNSGVSSSSFTDNFSSTLTNSSNSLAILSSISESSLINTITDLPSSSVLLSP
FT                   NNSESSIKVSSASSSSSRRKASTYTTPSRIPFSNSSEWYTPLPTPSISSSTNDTSSLLS
FT                   ELALIGISSSSSSSSSSQFYTSSTSSSSLVSSSENYSSSQPTTIEPITSTISSSYSDLS
FT                   NDGEILSSTLGKSVYYSYIQTFDITASTTTFETALPIVTAFNLKDSYTFSKPSSIITTD
FT                   LHFYKDWLSGALDSNEENGNKSKNAGTIAGSVVGSVVGLLVCTLIVWYFYIRKRRRNQK
FT                   WKSFEVPSRSKDVEYNNNDNPFNNEFDFQHRVPPPLPPQRKNHNSIGVPPSSMGLSNTR
FT                   SADYHMRFSYISSSTDSSDDYSDSMQSALHIGSDSGRERSNDVPEMGYLREII"
FT   gene            <1091056..>1091982
FT                   /locus_tag="CAGL0J11198g"
FT                   /old_locus_tag="CAGL-IPF2884"
FT                   /old_locus_tag="CAGL-CDS3536.1"
FT   CDS_pept        1091056..1091982
FT                   /locus_tag="CAGL0J11198g"
FT                   /old_locus_tag="CAGL-IPF2884"
FT                   /old_locus_tag="CAGL-CDS3536.1"
FT                   /note="similar to uniprot|P53881 Saccharomyces cerevisiae
FT                   YNL177c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61150"
FT                   /db_xref="GOA:Q6FNJ5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ5"
FT                   /inference="similar to AA sequence:UniProtKB:P53881"
FT                   /protein_id="CAG61150.1"
FT                   /translation="MFSRSLMRNAGLPLRNASRVLANRRLLSTSFPCLNNSGNLFGSIT
FT                   DTGNTNLEDKYDPTRETSRLEAAVKSTDDSGEISVDKDSITFEKDEVLQNYIREQFQKE
FT                   ALAPELLLSPLKRQVYELNCKQNGGFYKEDTVVTIPETKEKYKLKLSRQELEALEPSIY
FT                   LRSYRLKYSTKKAIHLLRMLSGLDVKKAITQCHFSDKKIARDLAELFQKGIEDGKKLGL
FT                   DADDLYISQIWSGNDGYLQKRVEYKGRGRIGIIRHRHIHVRCILKTHSVTKKRLEYEKQ
FT                   LKEQNKKPWVQLADRPIRGVPGNAYKW"
FT   gene            complement(<1092254..>1092997)
FT                   /locus_tag="CAGL0J11220g"
FT                   /old_locus_tag="CAGL-IPF2885"
FT                   /old_locus_tag="CAGL-CDS4027.1"
FT   CDS_pept        complement(1092254..1092997)
FT                   /locus_tag="CAGL0J11220g"
FT                   /old_locus_tag="CAGL-IPF2885"
FT                   /old_locus_tag="CAGL-CDS4027.1"
FT                   /note="highly similar to uniprot|P05750 Saccharomyces
FT                   cerevisiae YNL178w RPS3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61151"
FT                   /db_xref="GOA:Q6FNJ4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ4"
FT                   /protein_id="CAG61151.1"
FT                   /translation="MVSLISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTK
FT                   TEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAES
FT                   MKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQP
FT                   VNDFIDVATRHVLMRQGVLGIKVKIMRDPATNRGGPRALPDAVSIVEPKDEEPVLTPTV
FT                   RDYRSAEEVGEKTEAPAEQAVEASA"
FT   gene            <1094754..>1095908
FT                   /locus_tag="CAGL0J11242g"
FT                   /old_locus_tag="CAGL-IPF2887"
FT                   /old_locus_tag="CAGL-CDS2866.1"
FT   CDS_pept        1094754..1095908
FT                   /locus_tag="CAGL0J11242g"
FT                   /old_locus_tag="CAGL-IPF2887"
FT                   /old_locus_tag="CAGL-CDS2866.1"
FT                   /note="similar to uniprot|P53879 Saccharomyces cerevisiae
FT                   YNL180c RHO5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61152"
FT                   /db_xref="GOA:Q6FNJ3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ3"
FT                   /inference="similar to AA sequence:UniProtKB:P53879"
FT                   /protein_id="CAG61152.1"
FT                   /translation="MRSIKCVVIGDGAVGKTSLLISYTTNTFPTDYVPTVFDNYTTTLA
FT                   LAAPMPLSSHSTSTSSMTGSSSVLVDHNTPVFKQSNSSRRKPLTEGDTLSSSASSFSTG
FT                   ADSGSGALKRQIFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKW
FT                   FPELKRVSGIESGDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKV
FT                   VEDNGFMGYVECSAATQNNVRQVFEKAVHIVAFEPDKLQRAKCVDEARKMSIQEDSLVQ
FT                   EESPAAEPKKSAHPQKQSHPQSQLQSQISVPKPHKLSSVSEKPTHEKRKASPISPESSP
FT                   SQETSIGKSSGSRSDMEKSKQSVKSEIRQTKKKLKKKSVKCVII"
FT   gene            complement(<1096342..>1097571)
FT                   /locus_tag="CAGL0J11264g"
FT                   /old_locus_tag="CAGL-IPF2888"
FT                   /old_locus_tag="CAGL-CDS2705.1"
FT   CDS_pept        complement(1096342..1097571)
FT                   /locus_tag="CAGL0J11264g"
FT                   /old_locus_tag="CAGL-IPF2888"
FT                   /old_locus_tag="CAGL-CDS2705.1"
FT                   /note="highly similar to uniprot|P53878 Saccharomyces
FT                   cerevisiae YNL181w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61153"
FT                   /db_xref="GOA:Q6FNJ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ2"
FT                   /protein_id="CAG61153.1"
FT                   /translation="MPLNIIGTALLDGTDKIPYFQEIKKVAPYALAGAAVKYWSRGPSN
FT                   NWERKLHGKVYIVTGATSQGMGTSVVLEMARLGAQLIILCRDVDEWTTDWCEDLRERTQ
FT                   NELIFVEQCDLSDLYEVRKFATTWLDNSPPRRLDGVVALSGDMEPWGIPMLSRPIRRSS
FT                   KDGLEIQMAVNFVGLFHLLDILQPSFKAQPPDRDVRIIVSTCWLQSLGDIKLDDPLWQD
FT                   VKYQSALKFFASSKLQLGLCLAELQRKVVEDVQSQKKAEKSGKNVTVTLVQPGTMRSTS
FT                   LRRVISNGSVFLLLFLYCVVLYPFLWFFTKSGNRGAQTVLYALMTPELEEVNLKDTEIK
FT                   YISDCRLVKFARKEYQDKALQQNMYNKTKDAIFELEKKSAVKRNAAEKSNNKDKKNTKS
FT                   TSKAKKSKKA"
FT   gene            <1097912..>1099498
FT                   /locus_tag="CAGL0J11286g"
FT                   /old_locus_tag="CAGL-IPF2890"
FT                   /old_locus_tag="CAGL-CDS1918.1"
FT   CDS_pept        1097912..1099498
FT                   /locus_tag="CAGL0J11286g"
FT                   /old_locus_tag="CAGL-IPF2890"
FT                   /old_locus_tag="CAGL-CDS1918.1"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61154"
FT                   /db_xref="GOA:Q6FNJ1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNJ1"
FT                   /inference="similar to AA sequence:UniProtKB:P53877"
FT                   /protein_id="CAG61154.1"
FT                   /translation="MDESVIFTTEQNALSTSLYSAEQAVLRQCSTNSRNSAVRVGDKYL
FT                   FVAQSNKALINVYNISGAHKRETVEQRLPTPEVITCLEVIQNRYEEKSAISDFELPHLL
FT                   LGSTDGGKIYCWELNSGALLSVKQMAHYQGITKIKSFMDGKYFITSGKDSRVIVWQTID
FT                   FVSNNASEPKPICILHDHNLTVNDIAVSMTHGANMSTSGAKLFTASEDSTVRCYDFSFL
FT                   RGDFRKNRKSQEQDQKMYQPRLLATFTFPAAIEAMSLDPADRALYVGTSEGLFSLPLYY
FT                   TVKGTSTVANLAQASGSNRNKLYSVVISGHDDDYKKLFSMGQLVCDKLISTPVTKLELT
FT                   FDATTILVGNKFGRISVVEIASKQILKTLQPLTTADTEEDAITNIIVTTVNNSRQDSIL
FT                   EQHQSNKNVQKLPVLQRVVHDKDHAEHEVWYRAPETPEFSHELESLPPIADFEKYMDSI
FT                   RSEETVFLTTETTSQVKNVKQELAPASHSNSQEQQELQQELQQVKSAYKELRELHESLF
FT                   KEHEQLLSSMK"
FT   gene            <1099969..>1102155
FT                   /locus_tag="CAGL0J11308g"
FT                   /old_locus_tag="CAGL-IPF2895"
FT                   /old_locus_tag="CAGL-CDS0995.1"
FT   CDS_pept        1099969..1102155
FT                   /locus_tag="CAGL0J11308g"
FT                   /old_locus_tag="CAGL-IPF2895"
FT                   /old_locus_tag="CAGL-CDS0995.1"
FT                   /note="similar to uniprot|P22211 Saccharomyces cerevisiae
FT                   YNL183c NPR1 ser/thr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61155"
FT                   /db_xref="GOA:Q6FNJ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNJ0"
FT                   /inference="similar to AA sequence:UniProtKB:P22211"
FT                   /protein_id="CAG61155.1"
FT                   /translation="MSSLTKLLQEKNNKEVKTEPTIREESVGEAVGEAVPYYDGRSVLG
FT                   SSLMSTNFAQTATAYGSSLQMKERASYMDKHANGSLQYGYSSSLAVPTKNGGKMHSSSA
FT                   KQLPSLSTSIPYAVPNSNKESTHNGSVGSSLSSSWVDQYGGGMPSNISAIDSNVISSPK
FT                   VDNVEPRFVISKEKFHKSSQDNQAHTVSRSSSLSSQLGNLFFSKNTTTNNGSSSPGNSS
FT                   SIQTINGRDIPNATATQIPKPTRARQSSIYSSSRQPSRSSYNDTYFGSPSSLHENQPSQ
FT                   SVPRSHHSSIADFKRFFKKSTSTSVTSMSMLSDSPVSGSFITGDSTLGTQHTQQSHGFN
FT                   SESLHKQSSFSSNSGDIIYTNNYETSIPFSKRYSRTGEELGAGAGGSVKLVKRIADNSV
FT                   FAVKEFRSKHENESKRDYIKKITSEYCIGTTLNHPNIIETVEIVYEDNRIFQVMEYCDY
FT                   DLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVINSKGIVKLIDFG
FT                   AAVVFSYPFSKTLVEASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAIIFACMILKKFP
FT                   WKIPKLRDNSFKLFCSGRNCDSLSALVTRTPEPPSYDSSEFSPSKPSHYDSANSADPEN
FT                   SSIGPQRLLHALPEESQHIIGRMVDLAPACRSNIEEVLEDSWIKSIDMCHMESNGLVMK
FT                   YVGGTDHTHTQVDQSEAHIAGLEKKKKKAKNKDK"
FT   gene            <1102695..>1103144
FT                   /locus_tag="CAGL0J11330g"
FT                   /old_locus_tag="CAGL-IPF2896"
FT                   /old_locus_tag="CAGL-CDS4838.1"
FT   CDS_pept        1102695..1103144
FT                   /locus_tag="CAGL0J11330g"
FT                   /old_locus_tag="CAGL-IPF2896"
FT                   /old_locus_tag="CAGL-CDS4838.1"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185c MRPL19"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61156"
FT                   /db_xref="GOA:Q6FNI9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI9"
FT                   /protein_id="CAG61156.1"
FT                   /translation="MSQAAKNVLVKLIVGAGQAAPAPPVGPALGSKGIKAIDFCKEFNA
FT                   RTASYQPGVPIPVLITIRPDRSFTFEMKSPPTGYLLLKALGAEKGHGQPNILQKEKTLG
FT                   ELSLKHVYEIAKIKKTDSRHAMLDMPGIVKSIIAVAKSMGIKVVP"
FT   gene            complement(<1103473..>1105788)
FT                   /locus_tag="CAGL0J11352g"
FT                   /old_locus_tag="CAGL-IPF2898"
FT                   /old_locus_tag="CAGL-CDS0883.1"
FT   CDS_pept        complement(1103473..1105788)
FT                   /locus_tag="CAGL0J11352g"
FT                   /old_locus_tag="CAGL-IPF2898"
FT                   /old_locus_tag="CAGL-CDS0883.1"
FT                   /note="similar to uniprot|P53874 Saccharomyces cerevisiae
FT                   YNL186w UBP10"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61157"
FT                   /db_xref="GOA:Q6FNI8"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI8"
FT                   /inference="similar to AA sequence:UniProtKB:P53874"
FT                   /protein_id="CAG61157.1"
FT                   /translation="MTTQETIKPLVDRILNNPLQFRRSTASPNISNKDTDMNGNSDSPY
FT                   IVIGKRKLADQNSKNNGKSDPNQRQSDENDSSEIVQKKRKMPTSVAEALNWYTNAALKD
FT                   KTPKVKALPIVKDDSTSDRKGAIEKQADSNSSDSSDTDVFHEAVDFIEEPVKDLGAANV
FT                   EITSQQDEDTGEDLGEDLGEDLGEDLGEDLGEDLGEDLGEEIKKVIKETEQNTKVKEST
FT                   NEVPNVQAAIPKIEPTKKKRKSSVSKELSLLQRDNEDYEREQLMIKQIKEQREKARKQD
FT                   EELQQNKSKKTENSSQSQEKQKEGKDPETKDQQQAQEEVTETKHEEKDTFAESISPKKS
FT                   VTPPSTIPDISEFYQFNENFDDKGCLENSSIVKSWGPTYSKLKPKGLLNHGVTCYTNAA
FT                   VQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVLAETSRRMWHNDGKKSGNSYINPKK
FT                   LIARLDDINCMMSEWQQEDSHEYFMSIMSRLQEDSVPKGHKMTESIIYDIFGGSLKQTV
FT                   TCKSCGEVSTTEQPFYDLSLHLKGKKTDENTVNQEKSSSQSETKDSDSQTSRYSIEKSI
FT                   RDFFNPELIKVDKEKKGYVCEKCHKTTNALKRNSILRAPETLLVHLKKFRFNGTSSSKM
FT                   KQAVSYPMFLDMTEYCEESKKMLPVKYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATY
FT                   DDEYINKITEREVLKERNAYYVLYTRLTPKSVQLNEPKKQSTPNPITNVKQNNGKNNKS
FT                   NKRSSNKKNWKKNKRRRL"
FT   gene            complement(<1106215..>1106466)
FT                   /locus_tag="CAGL0J11374g"
FT                   /old_locus_tag="CAGL-IPF10274"
FT                   /old_locus_tag="CAGL-CDS5704.1"
FT   CDS_pept        complement(1106215..1106466)
FT                   /locus_tag="CAGL0J11374g"
FT                   /old_locus_tag="CAGL-IPF10274"
FT                   /old_locus_tag="CAGL-CDS5704.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61158"
FT                   /db_xref="GOA:Q6FNI7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI7"
FT                   /protein_id="CAG61158.1"
FT                   /translation="MCYVLPECVGIASQILETSVQPLVDCTSNAHSLTLLLSEFSKNFL
FT                   FNNLWIRRPIAFFFGKFFFFFRAGVLLQLIPFCVRFGG"
FT   gene            complement(<1106524..>1107783)
FT                   /locus_tag="CAGL0J11396g"
FT                   /old_locus_tag="CAGL-IPF2899"
FT                   /old_locus_tag="CAGL-CDS2641.1"
FT   CDS_pept        complement(1106524..1107783)
FT                   /locus_tag="CAGL0J11396g"
FT                   /old_locus_tag="CAGL-IPF2899"
FT                   /old_locus_tag="CAGL-CDS2641.1"
FT                   /note="weakly similar to uniprot|P53873 Saccharomyces
FT                   cerevisiae YNL187w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61159"
FT                   /db_xref="GOA:Q6FNI6"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNI6"
FT                   /protein_id="CAG61159.1"
FT                   /translation="MNQANVKNTTFHSMTSVSYNLSPYCSTGTTFRKQPLYRIWETESS
FT                   TSADLSQKLNYMFPKLGLSESQTSLKDKDVTKDVVCQDIHWSVDATSLFTINSDYGIRQ
FT                   YLIPDPKSDQTLLNPYSRIFAHESVLSSDISPRYSLYEGSSEPLANSILIGAKNVPIKL
FT                   VDLNDTNNLSTIRSYDISNLENEKFETPYVLKYHRESLFLSGTVRNKVNVYDVNRREPV
FT                   NTLTYSRRSKCGTQSYKSIISCLDDSFSDNQVRYCGSYKNQVFIIDLRGKTLQLLNNLQ
FT                   GNGARGCYQIINSDNGSYLYVLQRYSSRIEILDHRRPDRPVNHLELPGRSDFQKLKACY
FT                   NGSFQVGSPLGKGQILSWDKSTIESGGITRENQVVQCQPDILYNVPQCKSMRINIIKTS
FT                   SDATAISYSGDTAGIALLQR"
FT   gene            complement(<1107909..>1108949)
FT                   /locus_tag="CAGL0J11418g"
FT                   /old_locus_tag="CAGL-IPF2900"
FT                   /old_locus_tag="CAGL-CDS3188.1"
FT   CDS_pept        complement(1107909..1108949)
FT                   /locus_tag="CAGL0J11418g"
FT                   /old_locus_tag="CAGL-IPF2900"
FT                   /old_locus_tag="CAGL-CDS3188.1"
FT                   /note="some similarities with uniprot|P11927 Saccharomyces
FT                   cerevisiae YNL188w KAR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61160"
FT                   /db_xref="GOA:Q6FNI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI5"
FT                   /protein_id="CAG61160.1"
FT                   /translation="MKENGRKSRSNALRATLNPNSQNNNISDLDLYKKHKAEYGTRLMT
FT                   EDLTSPEEIMLLNEGSPTTLRSKGKSFTENDEKDSMRKVVINNLEEDNLDPPKLKKELQ
FT                   FIGKKKASPQYQVLENKERSLDPIERHRRKTSLLKAIGEPVPLPYLQNGPNNYVNVKNE
FT                   ESQRFDQTEMDSIDQRWNSVIESNRKIVKARLNEIRNAGKGIRLDSPQPRRVSEENVQG
FT                   HSHNILEQSEKSNVSLKSEGHQDMYASFDDGYGDSIVIGTPKQDLIKSKRLDDAKVLSD
FT                   IKSILLENSTKLDTVIEVLGSSKKVKLDKNNKIALNRLYYSKNNLYWILCIIILLICNI
FT                   YVYYYV"
FT   gene            complement(<1109677..>1111308)
FT                   /locus_tag="CAGL0J11440g"
FT                   /old_locus_tag="CAGL-IPF2902"
FT                   /old_locus_tag="CAGL-CDS1811.1"
FT   CDS_pept        complement(1109677..1111308)
FT                   /locus_tag="CAGL0J11440g"
FT                   /old_locus_tag="CAGL-IPF2902"
FT                   /old_locus_tag="CAGL-CDS1811.1"
FT                   /note="highly similar to uniprot|Q02821 Saccharomyces
FT                   cerevisiae YNL189w SRP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61161"
FT                   /db_xref="GOA:Q6FNI4"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="InterPro:IPR036975"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI4"
FT                   /protein_id="CAG61161.1"
FT                   /translation="MDPSINDSTSNKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELR
FT                   KAKRDEVLAKRRNFVPPTDSVDSDEEDEESSAADQQFYGQLQQELPQMVQQINSSDMQE
FT                   QLAATVKFRQILSREHNPPIDIVIQSGVVPTLVNFMNENQPEMLQLEAAWALTNIASGT
FT                   SAQTQVVVDAGAVPLFIQLLYTGSVELQEQAIWALGNVAGDSTSYRDYVLQCSAMEPIL
FT                   SLFNSEKVTLIRTATWTLSNLCRGKKPQPDWSIVSKALPTLAKLIYSFDNETLIDACWA
FT                   ISYLSDGPAEAIQAVIDARIPKRLVELLSHQSTLVQTPALRAVGNIVTGNDLHTQVVIN
FT                   CGVLSALRNLLSSPKESIRKEACWTISNITAGNTEQIQAVVDANLIPPLIKLLETAEYK
FT                   IKKEACWAISNASSGGLQRPEIIRYMVSQGCIKPLCDLLEIADNRIIEVTLDALENILK
FT                   MGETDKEARGLAINENADLIEKAGGMEKIFNCQQNENDRIYEKAYKIIETYFGEEDDTV
FT                   DDNLAPQNAGNTFGFGSNVNQQFNFN"
FT   gene            complement(<1112678..>1113304)
FT                   /locus_tag="CAGL0J11462g"
FT                   /old_locus_tag="CAGL-IPF2905"
FT                   /old_locus_tag="CAGL-CDS4376.1"
FT   CDS_pept        complement(1112678..1113304)
FT                   /locus_tag="CAGL0J11462g"
FT                   /old_locus_tag="CAGL-IPF2905"
FT                   /old_locus_tag="CAGL-CDS4376.1"
FT                   /note="similar to uniprot|P53872 Saccharomyces cerevisiae
FT                   YNL190w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61162"
FT                   /db_xref="GOA:Q6FNI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI3"
FT                   /inference="similar to AA sequence:UniProtKB:P53872"
FT                   /protein_id="CAG61162.1"
FT                   /translation="MKFSAVTVAAMAISSVLAKDRQYTTEITYTSDGATKTYTSTHKTH
FT                   KYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGSKK
FT                   PKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKFNNT
FT                   HHEKPTTEVEIKVPENDASGNRMNSMKLFGLTTGTAVVAGALMLL"
FT   gene            complement(<1114086..>1115174)
FT                   /locus_tag="CAGL0J11484g"
FT                   /old_locus_tag="CAGL-IPF2908"
FT                   /old_locus_tag="CAGL-CDS3048.1"
FT   CDS_pept        complement(1114086..1115174)
FT                   /locus_tag="CAGL0J11484g"
FT                   /old_locus_tag="CAGL-IPF2908"
FT                   /old_locus_tag="CAGL-CDS3048.1"
FT                   /note="highly similar to uniprot|P53871 Saccharomyces
FT                   cerevisiae YNL191w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61163"
FT                   /db_xref="GOA:Q6FNI2"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI2"
FT                   /protein_id="CAG61163.1"
FT                   /translation="MCRFLIFKGKEPIRLSHLLTRPAHSIINQSFDSRLRLDRRRPING
FT                   DGFGVAYYPLDKELEEDGPCLFKAITPAWNNQNLETLAEKTKSSLVFAHVRASTYGVLS
FT                   ETNCHPFTYHSLCFMHNGGISNFKRIKRVLLNHIDDEYLNFLQGGTDSECAFALFLDTL
FT                   HKLGHDPRKRDGDFGHEALRSALLKTIEYIKDWTLALRKDSRLDGELDSEPSLLNFAVT
FT                   DGSTVVVSRYITSRTDEAASLHFSSGSRFIETSPGEYRMERLDRNQDVIMVASEPLTFE
FT                   RGDWTAVPTNSVLTIRKQTILLHPIVDEYYQEDPLYLRSSKLAESKGLMGAVPLAKAVE
FT                   KNVPPLEREGRSRPISATAHLV"
FT   gene            complement(<1115691..>1119185)
FT                   /locus_tag="CAGL0J11506g"
FT                   /old_locus_tag="CAGL-IPF2912"
FT                   /old_locus_tag="CAGL-CDS0267.1"
FT   CDS_pept        complement(1115691..1119185)
FT                   /locus_tag="CAGL0J11506g"
FT                   /old_locus_tag="CAGL-IPF2912"
FT                   /old_locus_tag="CAGL-CDS0267.1"
FT                   /note="similar to uniprot|P08004 Saccharomyces cerevisiae
FT                   YNL192w CHS1 chitin synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61164"
FT                   /db_xref="GOA:Q6FNI1"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI1"
FT                   /inference="similar to AA sequence:UniProtKB:P08004"
FT                   /protein_id="CAG61164.1"
FT                   /translation="MSYQYGSGGSYGYNGYSGQGNGNSGNYNNNNSSYNNNNSNRQSRH
FT                   PYVSDSIPEEEAQSYEMHDVAQGVANDGYGNVGTMHSNPMYRNFVNTNSRGRPAPPPQE
FT                   YTDVFVNTDLNYRNNSFTDHNQEHSLVTPTTNGPSINIIQNTPELIHGTTSSSILASQT
FT                   GNSTTHYFNEEDYYYNNNIIRTEDDINNGDRVNSSYLNTQSGVTPVISDTPSIISNSED
FT                   TRPILNNPVGNEPSFNNHYGYNNNYNNYEQNATHPYYGGEVPNGDIENSYVDPNGDDYQ
FT                   INSYLGKNGEMIDPYEVDEDQYGYGHRSGRELLSVDYMKNKKYDAVTSNRELPEAEGEY
FT                   SYGDGEDGDLSSGSVISGYAHEDLADLDTNTIDKIKSLNTSFTSSMGSRDMLINQEESF
FT                   KKRSLKRAGTQVRKFKLWKGNFVFDSPISRSLLNQYQSGIDKNNDLSNEFKFMRYQAVT
FT                   CEPNVLAQQNFTVRQLRYLNPRSTELLIVITMYNEDHILLGRTLKGVMDNIKHMVKKTR
FT                   SSTWGPDAWKKIVVCIVSDGRAKINEKSLALLSSLGCYQDGFAKDEINGKKVVTHVYEH
FT                   TTMMNVVDVTDDNVELRCDQSTVPIQMLFCLKEQNQKKINSHRWAFEGFAELLRPNIVT
FT                   LLDAGTMPGKDSIYELWREFRNPQVGGACGEIRTDLGKNYSNLINPLIASQNFEYKMSN
FT                   ILDKTTESNFGFITVLPGAFSAYRLEAVQGLPLQKYFYGESMEHEEKFHFFSSNMYLAE
FT                   DRILCFEVVMKKNANWILKYSRSSHATTDVPDRVPEFILQRRRWLNGSFFASVYSFCHF
FT                   YRIWTSGHNIFRKCFLMIEFLYLFFNTLLSWFSLSSYFLVFRILTLSIATTYKSVFGVL
FT                   SVVFLWLYGVCLLSTFILSLGNKPKSTELYYVVTFIFFAVLMIYMMFCSVFMSVKSFEN
FT                   LLKEDHITFHGLFTQETFRDMVISLGSTVCLYIASSVIYLQPWHMLTSFVQYLLLSPSY
FT                   VNVLNIYAFCNVHDLSWGTKGSASKPLGKITSKEDGTFKMEILVSSAEIEANYEKYKKM
FT                   LYEQPNEEDSKPELSPEEKKTGYYANVRSLVIIFWVMTNFAICAVVLETGGIGDYLTLK
FT                   TMNKQHTEQIQPRPLLSNKASIYFAIILWLVALSAVIRFFGCTIYMISRFFKRLRHW"
FT   gene            complement(<1119969..>1121642)
FT                   /locus_tag="CAGL0J11528g"
FT                   /old_locus_tag="CAGL-IPF2915"
FT                   /old_locus_tag="CAGL-CDS1727.1"
FT   CDS_pept        complement(1119969..1121642)
FT                   /locus_tag="CAGL0J11528g"
FT                   /old_locus_tag="CAGL-IPF2915"
FT                   /old_locus_tag="CAGL-CDS1727.1"
FT                   /note="similar to uniprot|P53870 Saccharomyces cerevisiae
FT                   YNL193w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61165"
FT                   /db_xref="GOA:Q6FNI0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNI0"
FT                   /inference="similar to AA sequence:UniProtKB:P53870"
FT                   /protein_id="CAG61165.1"
FT                   /translation="MSSAGRRRIPKKKQSKEPVLVTQEDFYLEATNLEEQAERWILSDI
FT                   KKTLRFYIQASELYTKALHCTNEASQANRYNILYNQVRLYLVVYTEYVAANGYINILNY
FT                   INNLEELVGLDQIIFTLPEITQKFESVLQECTSDNSVWDLKFNLLTCYLLLIEGINGVN
FT                   PGIGWELDGAQVLTLFQEKFYPCFRELVDDIITSLKEWSEIQQSTDAELNNGLDEKGFQ
FT                   NDTLQDQQASNDGTGVKHMQDSDQQETSLMEVSDQITPDTLIETYTIAYKLIEAITALI
FT                   VESKYNGKNALFNDSQIFFFVDALKRFQAQLEEPLLDGQDQQIVDSLDINLSKFSIYGQ
FT                   FMLLEGNTQKESLTKYLEEFELPFGQYNDQEIDIKILSVKADLIETILSTLDDGQQITP
FT                   ANVEEQWFFSSMLSKIYQTISKQLNERRGDVISGKIRGLSDQLSNIVFRQCDIIINASD
FT                   NDLLRAFLMSIRNPSETRTIEILQKNARTFLTNAMKIAERPCGLEECIVDKLKRNYIFN
FT                   QAKNRLAILNNELARDQLHQSPDMLAQISDHPYYMRLLSL"
FT   gene            <1123203..>1124381
FT                   /locus_tag="CAGL0J11550g"
FT                   /old_locus_tag="CAGL-IPF2917"
FT                   /old_locus_tag="CAGL-CDS2809.1"
FT   CDS_pept        1123203..1124381
FT                   /locus_tag="CAGL0J11550g"
FT                   /old_locus_tag="CAGL-IPF2917"
FT                   /old_locus_tag="CAGL-CDS2809.1"
FT                   /note="weakly similar to uniprot|P40168 Saccharomyces
FT                   cerevisiae YNL195c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61166"
FT                   /db_xref="GOA:Q6FNH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH9"
FT                   /protein_id="CAG61166.1"
FT                   /translation="MFFPGYFPVKYQNPDIKKAQHFDSKKKSHHHKHHHTDKQSLEVES
FT                   SEHISKTNHSQEFGYHSAEDYAKILGEGQAAQAYVNESDNMQSNTHHNMQSGSHHDHDV
FT                   HMGRAGIPGCGTASHLDYPHTGHGQHYDHHKVGMLPNECPGKDLLHMSPNKVGIPGCGT
FT                   AGGFTGENISARMNSKNVPMNAQDTTDPEFGPQSRNIPGAGRMDTGIVGGSMATAGANT
FT                   AGGQFDDAKMNSRNVPMGGMDTTDRAFGGQETANEIPGAGRMGNNGNGGMSSNSGYNAG
FT                   NVEPNVMLNSTHPKLETGSGAEYETTGKDRKISVGSFEDRHDNSHAYETVEGITVGHPV
FT                   SAMPPQQQYNYIRAESTPRSHQHHHGEHKTAEEKKPGFVKKVEQTLHIGSEK"
FT   gene            complement(<1124993..>1126375)
FT                   /locus_tag="CAGL0J11572g"
FT                   /old_locus_tag="CAGL-IPF2918"
FT                   /old_locus_tag="CAGL-CDS2318.1"
FT   CDS_pept        complement(1124993..1126375)
FT                   /locus_tag="CAGL0J11572g"
FT                   /old_locus_tag="CAGL-IPF2918"
FT                   /old_locus_tag="CAGL-CDS2318.1"
FT                   /note="similar to uniprot|P33895 Saccharomyces cerevisiae
FT                   YOL069w NUF2 spindle pole body protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61167"
FT                   /db_xref="GOA:Q6FNH8"
FT                   /db_xref="InterPro:IPR005549"
FT                   /db_xref="InterPro:IPR038275"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNH8"
FT                   /inference="similar to AA sequence:UniProtKB:P33895"
FT                   /protein_id="CAG61167.1"
FT                   /translation="MATPTQDIFPLLDLEELVICLQSCDFAMATEEHIARPTSQYVITL
FT                   YKQIIENFMGISPEQVLAEQLSSRQNTEGNDESTSVDMFDGPYRETLQMLTLNKICYKF
FT                   FENVGINDFNIVDLYKPEAYRTRRLLSAVVNYARFREERMFDCNQFIIQMEEMLDELKS
FT                   KFDDFNYLKAQLTAIEDDDEKTPGELEDLLQKNKVLETNLKKLTILQEKLSIDYNNYKM
FT                   KKQELLRELEKNSFTLIELESKKERLMNYNDDDQDLQNSLNNSIDRLTEEKKKQIGYVS
FT                   KLEGNVSNLKVTVDTLEKAIEHIYDILRLLSTDLQESHRAELNIEGIKGPLTEKRTRLK
FT                   NLLESNVIYKYDVLKEQLNVAETEYQRINEEHYRETLENKKLIQELEGKYNNIIHNKMQ
FT                   EAEVYIENEITEKKIKILQSELNDIQIQFNNEIDNIELHYSTLVGHINNYMKKLITALN
FT                   NH"
FT   gene            complement(<1126896..>1129709)
FT                   /locus_tag="CAGL0J11594g"
FT                   /old_locus_tag="CAGL-IPF2921"
FT                   /old_locus_tag="CAGL-CDS0539.1"
FT   CDS_pept        complement(1126896..1129709)
FT                   /locus_tag="CAGL0J11594g"
FT                   /old_locus_tag="CAGL-IPF2921"
FT                   /old_locus_tag="CAGL-CDS0539.1"
FT                   /note="weakly similar to uniprot|P22579 Saccharomyces
FT                   cerevisiae YOL004w SIN3 transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61168"
FT                   /db_xref="GOA:Q6FNH7"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH7"
FT                   /protein_id="CAG61168.1"
FT                   /translation="MVTLEFNNVTDSVVKSYNDLKKNLSHEDYNSLISAIRSDIDEFSN
FT                   GESSPDNSIERVIKGINEQYPHLSSTIRDIFGKDPNEYTTRTCGQNLNVDLIVDELCGI
FT                   LENKQITYIERVLYSDLSRDEKISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNE
FT                   EQISSIRSTLSQNTDNRCAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPE
FT                   FLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTLKSNDF
FT                   DDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKK
FT                   NQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMI
FT                   SLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAW
FT                   REVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKEHYDNYEYKYEFF
FT                   DKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLFEESSFTKHLDFQFCHNP
FT                   AISSNSQISEDDVEAMFMKGILEEKGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLF
FT                   HYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSDNGLELGQDDGYE
FT                   WIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPSLLQ
FT                   ILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLL
FT                   HAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREEQNIPFMNGNIYKP
FT                   HLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKTQMASLISKIAKNRKQQRA
FT                   RTIGTMK"
FT   gene            <1130080..>1130436
FT                   /locus_tag="CAGL0J11616g"
FT                   /old_locus_tag="CAGL-IPF10271"
FT                   /old_locus_tag="CAGL-CDS5195.1"
FT   CDS_pept        1130080..1130436
FT                   /locus_tag="CAGL0J11616g"
FT                   /old_locus_tag="CAGL-IPF10271"
FT                   /old_locus_tag="CAGL-CDS5195.1"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61169"
FT                   /db_xref="GOA:Q6FNH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH6"
FT                   /protein_id="CAG61169.1"
FT                   /translation="MISIFSYSSANNLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYFR
FT                   KIFEGQLLHRLVVQLENKTVFLLLPEKCILIWPSYLKLQLFRGNDMKIIEGRIKIKIKI
FT                   MIIKYNYWYRNEMK"
FT   gene            complement(<1130744..>1132984)
FT                   /locus_tag="CAGL0J11638g"
FT                   /old_locus_tag="CAGL-IPF2922"
FT                   /old_locus_tag="CAGL-CDS0947.1"
FT   CDS_pept        complement(1130744..1132984)
FT                   /locus_tag="CAGL0J11638g"
FT                   /old_locus_tag="CAGL-IPF2922"
FT                   /old_locus_tag="CAGL-CDS0947.1"
FT                   /note="highly similar to uniprot|P32562 Saccharomyces
FT                   cerevisiae YMR001c CDC5 involved in regulation of DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61170"
FT                   /db_xref="GOA:Q6FNH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="InterPro:IPR036947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH5"
FT                   /protein_id="CAG61170.1"
FT                   /translation="MMGPLKNVDDKQLNVRIARTPVKTNPTASHNHYEEGKENYVVNQH
FT                   HKRIDQQGQQHKRKKEKLSSLCKTPPSLIKTRGRDYHRGQFLGEGGFARCFQIKDDSGK
FT                   IFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNG
FT                   SLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDF
FT                   GLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ
FT                   AKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTF
FT                   PPYTLNSVMTTVPDYSHITPQESFMNFQNCLEASGLLSVHQNHMVANISERTVPTNKLH
FT                   IAPAHKYSSNPYMTEYNNAGNSIGNNGYPDTVQTSASKRFHMEKFQQQEQFQPILPHSL
FT                   SPGGTKNKYKEVIDLEAQRKLNDLAREARIRKARQSMARKELIPTSTNLIKSDISLRIL
FT                   ASECQLTLNGILEAEAQKRMGGLPKSRLPSIKNPMVVTKWVDYSNKHGFSYQLSTEDIG
FT                   VLFNNGSTVLRLADADEFWYITYDEREGWVASHYLLDEKPKELSRHLEVVDFFAKYMRA
FT                   NLSRVSNFVREEYHKDDVFLRRYTRYKEFVMFELSDGTFQFNFKDHHKLAISDGGKLVT
FT                   YISPDHESETYPLVELLRIGEIPGHTDCNFESKLMLVKEGLKQKASIITVDH"
FT   gene            <1135618..>1137852
FT                   /locus_tag="CAGL0J11660g"
FT                   /old_locus_tag="CAGL-IPF2924"
FT                   /old_locus_tag="CAGL-CDS0956.1"
FT   CDS_pept        1135618..1137852
FT                   /locus_tag="CAGL0J11660g"
FT                   /old_locus_tag="CAGL-IPF2924"
FT                   /old_locus_tag="CAGL-CDS0956.1"
FT                   /note="highly similar to uniprot|P04786 Saccharomyces
FT                   cerevisiae YOL006c TOP1 DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61171"
FT                   /db_xref="GOA:Q6FNH4"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH4"
FT                   /protein_id="CAG61171.1"
FT                   /translation="MTSDEVKPNKGSGGEYNEDAPLSQTLAQPVISDPVPKKDEKEKKL
FT                   KRSRELSSTSKEKTKKVKKIKTEKPAIKSENDEDIDEKMSLSQVAELKRENSTFDDEEE
FT                   KYKWWENEKNDDTIKWVSLKHNGVLFPPEYEPLPSHVKLYYDGKPVDLPPAAEEVAGFF
FT                   ANLLHTDHAKNPVFQKNFFEDFLQVLKESGGTRNKINITVFKKCDFSKMNQYFELKKEE
FT                   KRNMSREEKKQIKLEKDKFEEKFKFCELDGRKEQVGNFRVEPPDLFRGRGAHPKTGKLK
FT                   RRVYPEDIILNLSKDAPIPPAPQGHHWGEIRHDNTVQWLAMWKENIFGSFKYVRLAANS
FT                   SLNGQSDLKKFEKARELKKYIGDIRKDYRESFKSKIMLERQKAVATYFIDVFALRAGGE
FT                   KSEDEADTVGCCSLRFEHVTLKPPNTVIFDFLGKDSIRYHQEVEVEKQVFKNLKIFKRP
FT                   PKKDGDDLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKL
FT                   LKYNAANRAVAILCNHQRSVTKGHAQSVEKMNQKIEELLWQKIRLKKGILQLEPSRAQK
FT                   NKKYFKEINDMTKVEQATIHKRIVDRERERLKKKFERDNEKLVAEKKDPLPKTELKEWL
FT                   KKVDDLEKQYKTELKTGKVELKATMQSVEKLEKQVEKLEERIKTSSIQLKDKEENSQVS
FT                   LGTSKINYIDPRLSVVFCKKYNVPIEKIFTKTLREKFAWAIESADENWRF"
FT   gene            <1138725..>1139204
FT                   /locus_tag="CAGL0J11682g"
FT                   /old_locus_tag="CAGL-IPF2927"
FT                   /old_locus_tag="CAGL-CDS4746.1"
FT   CDS_pept        1138725..1139204
FT                   /locus_tag="CAGL0J11682g"
FT                   /old_locus_tag="CAGL-IPF2927"
FT                   /old_locus_tag="CAGL-CDS4746.1"
FT                   /note="similar to uniprot|Q03667 Saccharomyces cerevisiae
FT                   YMR002w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61172"
FT                   /db_xref="GOA:Q6FNH3"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNH3"
FT                   /inference="similar to AA sequence:UniProtKB:Q03667"
FT                   /protein_id="CAG61172.1"
FT                   /translation="MARSRGGSRPAGRSSAFSRPQQSRSASTAAYPAAPPRQQPVAPAN
FT                   AHPQAGAQPQQPGLFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSSEVSDQQQQPM
FT                   QNFDAAAQQQQQQFRTCDADAKNFTRCLDENNGNFQICDYYLQQLKACQEAARQY"
FT   gene            <1140133..>1141662
FT                   /locus_tag="CAGL0J11704g"
FT                   /old_locus_tag="CAGL-IPF2928"
FT                   /old_locus_tag="CAGL-CDS2013.1"
FT   CDS_pept        1140133..1141662
FT                   /locus_tag="CAGL0J11704g"
FT                   /old_locus_tag="CAGL-IPF2928"
FT                   /old_locus_tag="CAGL-CDS2013.1"
FT                   /note="similar to uniprot|P40959 Saccharomyces cerevisiae
FT                   YMR004w MVP1 required for vacuolar protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61173"
FT                   /db_xref="GOA:Q6FNH2"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028662"
FT                   /db_xref="InterPro:IPR035704"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNH2"
FT                   /inference="similar to AA sequence:UniProtKB:P40959"
FT                   /protein_id="CAG61173.1"
FT                   /translation="MDTYSGQNGWADTSNASPWGDTNDTMPIDNSLSNSLSGLQLNEDI
FT                   NTVRANLTESIWGTERTGAPNNVETGLEAKDSLNVSTNFNELNTAILSPTSSTSNIEEQ
FT                   NSFTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLFKHANYSVKHLIDLPNTEPPK
FT                   NRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNLDPVFLNKRRIGLSKFINLV
FT                   MKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKRISKDFVKIWKKDLAEIWN
FT                   NTANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIHDVGNLTKSVYPIDQNPT
FT                   ILDINSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDILRALKNVFERYKMLAT
FT                   NNVSMLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKIMYEQSNRAWLIRECI
FT                   LEEFTIFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHILEMPLSRE"
FT   gene            <1142247..>1143257
FT                   /locus_tag="CAGL0J11726g"
FT                   /old_locus_tag="CAGL-IPF2930"
FT                   /old_locus_tag="CAGL-CDS3278.1"
FT   CDS_pept        1142247..1143257
FT                   /locus_tag="CAGL0J11726g"
FT                   /old_locus_tag="CAGL-IPF2930"
FT                   /old_locus_tag="CAGL-CDS3278.1"
FT                   /note="similar to uniprot|P50105 Saccharomyces cerevisiae
FT                   YMR005w MPT1 required for protein synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61174"
FT                   /db_xref="GOA:Q6FNH1"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNH1"
FT                   /inference="similar to AA sequence:UniProtKB:P50105"
FT                   /protein_id="CAG61174.1"
FT                   /translation="MSSQKRPSEESTGSGTKKVKLEETKTPSLKSEASNLALPKMNDSS
FT                   NNINAVPLALPKGGDKKKKANSKTAQSGKNGGKEDGTGQKQKATDPNKMQDVLISAGVD
FT                   LKEEEALLSSTVNVSKTQQNAVVIPPHPPFLHPDQVSNFMKKVAKTQNFNLSFTKNTEI
FT                   LDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRRSQVAAALRSIAINQKKEEERRM
FT                   KKRIALGLEKEDYENKMDSEETLHRASNVTATLRAGSKKQYGWLTSSINKPASIGVKSA
FT                   GKVATEIAARGESGLKFREAREEPGIVMRDLLFALEHRRIGVHNIISKGYARIRD"
FT   gene            complement(<1143621..>1145708)
FT                   /locus_tag="CAGL0J11748g"
FT                   /old_locus_tag="CAGL-IPF2931"
FT                   /old_locus_tag="CAGL-CDS1107.1"
FT   CDS_pept        complement(1143621..1145708)
FT                   /locus_tag="CAGL0J11748g"
FT                   /old_locus_tag="CAGL-IPF2931"
FT                   /old_locus_tag="CAGL-CDS1107.1"
FT                   /note="similar to uniprot|Q03674 Saccharomyces cerevisiae
FT                   YMR006c PLB2 or uniprot|P39105 Saccharomyces cerevisiae
FT                   YMR008c PLB1 or uniprot|Q08108 Saccharomyces cerevisiae
FT                   YOL011w PLB3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61175"
FT                   /db_xref="GOA:Q8TG06"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TG06"
FT                   /inference="similar to AA sequence:UniProtKB:Q03674"
FT                   /protein_id="CAG61175.1"
FT                   /translation="MQLSVLIASVLAAGAAVDAASYTPQNVSCPDNANFIRNAADGLSP
FT                   AEKEWLKKRDPITRDALQTFLRRAFANVSTEITSALFNDTENVPKLGIAVAGGGYRAMF
FT                   VGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQILEEG
FT                   DKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGW
FT                   FPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIG
FT                   SWDPSLNAFSDIKYLGTQVTDGKPETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVA
FT                   YTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDL
FT                   QGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPD
FT                   MTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNSYHSFESNVSTFKLNYNYSER
FT                   VGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTI
FT                   DNTPTKLLTPNNQDPAAISSAIAAVTDDSPIGALLNTGSGTKSNSSSKTNSTLVTSSRA
FT                   TSTGTLISNSSSNSTVSSTAARSSTSSTAKKNAGSVLKLEFSKSASVMVAIAAAAVASL
FT                   I"
FT   gene            complement(<1147259..>1149238)
FT                   /locus_tag="CAGL0J11770g"
FT                   /old_locus_tag="CAGL-IPF2933"
FT                   /old_locus_tag="CAGL-CDS1234.1"
FT   CDS_pept        complement(1147259..1149238)
FT                   /locus_tag="CAGL0J11770g"
FT                   /old_locus_tag="CAGL-IPF2933"
FT                   /old_locus_tag="CAGL-CDS1234.1"
FT                   /note="highly similar to uniprot|P39105 Saccharomyces
FT                   cerevisiae YMR008c PLB1 or uniprot|Q08108 Saccharomyces
FT                   cerevisiae YOL011w PLB3 or uniprot|Q03674 Saccharomyces
FT                   cerevisiae YMR006c PLB2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0J11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG61176"
FT                   /db