(data stored in ACNUC8465 zone)

EMBL: CR380959

ID   CR380959; SV 2; linear; genomic DNA; STD; FUN; 1402899 BP.
XX
AC   CR380959;
XX
PR   Project:PRJNA13831;
XX
DT   30-JUN-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 13)
XX
DE   Candida glabrata strain CBS138 chromosome M complete sequence.
XX
KW   complete genome.
XX
OS   [Candida] glabrata
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces;
OC   Nakaseomyces/Candida clade.
XX
RN   [1]
RC   revised by [3]
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RG   Genolevures
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
RN   [2]
RA   Frangeul L., Sherman D.;
RT   ;
RL   Submitted (05-MAY-2004) to the INSDC.
RL   B. Dujon, Institut Pasteur, Unite de Genetique Moleculaire des Levures, 25
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   lfrangeu@pasteur.fr E-mail: david@labri.fr
XX
RN   [3]
RP   1-1402899
RA   Sherman D.;
RT   ;
RL   Submitted (25-JUL-2008) to the INSDC.
RL   INRIA uipe Magnome,  CR INRIA Bordeaux Sud-Ouest Laboratoire Bordelais de
RL   Recherche en Informatique, FRANCE
XX
DR   MD5; 91744ad1ae6ecf6020fbe65fca835187.
DR   BioSample; SAMEA3138172.
DR   CABRI; CBS 138.
DR   EnsemblGenomes-Gn; CAGL0M01012r.
DR   EnsemblGenomes-Gn; CAGL0M01584r.
DR   EnsemblGenomes-Gn; CAGL0M03443r.
DR   EnsemblGenomes-Gn; CAGL0M03509r.
DR   EnsemblGenomes-Gn; CAGL0M04785r.
DR   EnsemblGenomes-Gn; CAGL0M05071r.
DR   EnsemblGenomes-Gn; CAGL0M05093r.
DR   EnsemblGenomes-Gn; CAGL0M05555r.
DR   EnsemblGenomes-Gn; CAGL0M06743r.
DR   EnsemblGenomes-Gn; CAGL0M07535r.
DR   EnsemblGenomes-Gn; CAGL0M07788r.
DR   EnsemblGenomes-Gn; CAGL0M07964r.
DR   EnsemblGenomes-Gn; CAGL0M08470r.
DR   EnsemblGenomes-Gn; CAGL0M08998r.
DR   EnsemblGenomes-Gn; CAGL0M11000r.
DR   EnsemblGenomes-Gn; CAGL0M11132r.
DR   EnsemblGenomes-Gn; CAGL0M11652r.
DR   EnsemblGenomes-Gn; CAGL0M12529r.
DR   EnsemblGenomes-Gn; CAGL0M13299r.
DR   EnsemblGenomes-Gn; ENSRNA049501210.
DR   EnsemblGenomes-Gn; ENSRNA049501213.
DR   EnsemblGenomes-Gn; ENSRNA049501235.
DR   EnsemblGenomes-Gn; ENSRNA049501245.
DR   EnsemblGenomes-Gn; ENSRNA049501261.
DR   EnsemblGenomes-Gn; ENSRNA049501276.
DR   EnsemblGenomes-Gn; ENSRNA049501288.
DR   EnsemblGenomes-Gn; ENSRNA049501301.
DR   EnsemblGenomes-Gn; ENSRNA049501313.
DR   EnsemblGenomes-Gn; ENSRNA049501327.
DR   EnsemblGenomes-Gn; ENSRNA049501334.
DR   EnsemblGenomes-Gn; ENSRNA049501344.
DR   EnsemblGenomes-Gn; ENSRNA049501357.
DR   EnsemblGenomes-Gn; ENSRNA049521205.
DR   EnsemblGenomes-Gn; ENSRNA049521232.
DR   EnsemblGenomes-Gn; ENSRNA049521267.
DR   EnsemblGenomes-Gn; ENSRNA049521296.
DR   EnsemblGenomes-Gn; ENSRNA049521332.
DR   EnsemblGenomes-Gn; ENSRNA049521364.
DR   EnsemblGenomes-Gn; ENSRNA049521392.
DR   EnsemblGenomes-Gn; ENSRNA049521440.
DR   EnsemblGenomes-Gn; ENSRNA049521465.
DR   EnsemblGenomes-Gn; ENSRNA049521500.
DR   EnsemblGenomes-Gn; ENSRNA049521536.
DR   EnsemblGenomes-Gn; ENSRNA049521573.
DR   EnsemblGenomes-Gn; ENSRNA049521632.
DR   EnsemblGenomes-Gn; ENSRNA049521679.
DR   EnsemblGenomes-Gn; ENSRNA049521712.
DR   EnsemblGenomes-Gn; ENSRNA049521739.
DR   EnsemblGenomes-Gn; ENSRNA049521770.
DR   EnsemblGenomes-Gn; ENSRNA049521826.
DR   EnsemblGenomes-Tr; CAGL0M01012r-1.
DR   EnsemblGenomes-Tr; CAGL0M01584r-1.
DR   EnsemblGenomes-Tr; CAGL0M03443r-1.
DR   EnsemblGenomes-Tr; CAGL0M03509r-1.
DR   EnsemblGenomes-Tr; CAGL0M04785r-1.
DR   EnsemblGenomes-Tr; CAGL0M05071r-1.
DR   EnsemblGenomes-Tr; CAGL0M05093r-1.
DR   EnsemblGenomes-Tr; CAGL0M05555r-1.
DR   EnsemblGenomes-Tr; CAGL0M06743r-1.
DR   EnsemblGenomes-Tr; CAGL0M07535r-1.
DR   EnsemblGenomes-Tr; CAGL0M07788r-1.
DR   EnsemblGenomes-Tr; CAGL0M07964r-1.
DR   EnsemblGenomes-Tr; CAGL0M08470r-1.
DR   EnsemblGenomes-Tr; CAGL0M08998r-1.
DR   EnsemblGenomes-Tr; CAGL0M11000r-1.
DR   EnsemblGenomes-Tr; CAGL0M11132r-1.
DR   EnsemblGenomes-Tr; CAGL0M11652r-1.
DR   EnsemblGenomes-Tr; CAGL0M12529r-1.
DR   EnsemblGenomes-Tr; CAGL0M13299r-1.
DR   EnsemblGenomes-Tr; EFT00001981398.
DR   EnsemblGenomes-Tr; EFT00001981399.
DR   EnsemblGenomes-Tr; EFT00001981400.
DR   EnsemblGenomes-Tr; EFT00001981401.
DR   EnsemblGenomes-Tr; EFT00001981402.
DR   EnsemblGenomes-Tr; EFT00001981403.
DR   EnsemblGenomes-Tr; EFT00001981404.
DR   EnsemblGenomes-Tr; EFT00001981405.
DR   EnsemblGenomes-Tr; EFT00001981406.
DR   EnsemblGenomes-Tr; EFT00001981407.
DR   EnsemblGenomes-Tr; EFT00001981408.
DR   EnsemblGenomes-Tr; EFT00001981409.
DR   EnsemblGenomes-Tr; EFT00001981410.
DR   EnsemblGenomes-Tr; EFT00001981411.
DR   EnsemblGenomes-Tr; EFT00001981412.
DR   EnsemblGenomes-Tr; EFT00001981413.
DR   EnsemblGenomes-Tr; EFT00001981414.
DR   EnsemblGenomes-Tr; EFT00001981415.
DR   EnsemblGenomes-Tr; EFT00001981416.
DR   EnsemblGenomes-Tr; EFT00001981417.
DR   EnsemblGenomes-Tr; EFT00001981418.
DR   EnsemblGenomes-Tr; EFT00001981419.
DR   EnsemblGenomes-Tr; EFT00001981420.
DR   EnsemblGenomes-Tr; EFT00001981421.
DR   EnsemblGenomes-Tr; EFT00001981422.
DR   EnsemblGenomes-Tr; EFT00001981423.
DR   EnsemblGenomes-Tr; EFT00001981424.
DR   EnsemblGenomes-Tr; EFT00001981425.
DR   EnsemblGenomes-Tr; EFT00001981426.
DR   EnsemblGenomes-Tr; EFT00001981427.
DR   EnsemblGenomes-Tr; EFT00001981428.
DR   EuropePMC; PMC4381506; 25834639.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00477; snosnR66.
DR   RFAM; RF01176; snR78.
DR   RFAM; RF01181; snR77.
DR   RFAM; RF01184; snR79.
DR   RFAM; RF01185; snR75.
DR   RFAM; RF01201; snR40.
DR   RFAM; RF01207; snR73.
DR   RFAM; RF01209; snR76.
DR   RFAM; RF01249; snR190.
DR   RFAM; RF01251; snR3.
DR   RFAM; RF01255; snR35.
DR   RFAM; RF01265; snR42.
DR   StrainInfo; 93937; 0.
XX
CC   This is an updated version of the complete genome sequence. The Candida
CC   glabrata sequence is made of 13 chromosomes (A to M). The sequence was
CC   annotated by the Genolevures Consortium.  For more information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1402899
FT                   /organism="[Candida] glabrata"
FT                   /chromosome="M"
FT                   /strain="CBS 138"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5478"
FT   gene            complement(<2..>559)
FT                   /pseudo
FT                   /locus_tag="CAGL0M00110g"
FT                   /old_locus_tag="CAGL-IPF5376"
FT                   /note="no similarity frameshift"
FT   gene            complement(<11636..>14404)
FT                   /locus_tag="CAGL0M00132g"
FT                   /old_locus_tag="CAGL-IPF5389"
FT   CDS_pept        complement(11636..14404)
FT                   /locus_tag="CAGL0M00132g"
FT                   /old_locus_tag="CAGL-IPF5389"
FT                   /note="some similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62326"
FT                   /db_xref="GOA:Q6FK94"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK94"
FT                   /protein_id="CAG62326.1"
FT                   /translation="MYSKTTFTANILFCLLLLLRCCAAILEPDNSLQIFDSFLSNPSKY
FT                   PLGCSPKITNPKKGLSMELYSYPYRKKGSHPCWDPAYLDPNFPRVGYKKNKLIARVDGV
FT                   SGDINFNFHPKRQCTPIADYLPPNFNYNEPITTTNFTMLLYGYFKPKVTGLHTFDISAD
FT                   DLLFMNFGAGNAFDCCRRDSTADTFGNYVAWAIWGRRIVRNKLTVRLDKGIYYPLRLFF
FT                   NNRDYYGQMRLTFKTEHGSERITDFSDYFFSVDDTSEGCPGLITYESECADVKSSTVLE
FT                   TDYITIQAEKEVLPIIKTIYYVGIPCSSSQSIYGSSSSSSSSKRLDCPSGLFFDPLAEK
FT                   CVSISTPPLPPIPSSSSLPTSSQEYSSSSHRVPSSSHALIHSSSVVISTISSSIPSSMP
FT                   SSIPSSMPSSMPSSIPSSMPSSIPSSMPSSIPSSMPSSVIKPSTVSNHSSSIPSSIPSS
FT                   MPSSIPSSIPSSMPSSMPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSMPSSMPSSVI
FT                   KPSTVSNHSSSMPSSIPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSIPSSMPSSMPS
FT                   SIPSSMPSSVIKPSTVSNHSSSIPKSSTPTGDIPEPRILNITTTTTNHSSETPPFSSSD
FT                   SSSYIESSIISSSSSFELRSVSTPKLISSTMVPIFSKTKSSTRSHIYWNSSTIETSSSL
FT                   SPSPSPSPSPSPSPSPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPR
FT                   PDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDP
FT                   QPSPRPDPQPSPRPNPQPSPTPKLLSDFSSLHHSRSLNAIFRSATSRHDTYTTISAFFT
FT                   PRLSLQITTLVQQPTASDALNSLYLGGTYRLNVSYFLFPALLIFTIANILV"
FT   gene            <22039..>23691
FT                   /locus_tag="CAGL0M00154g"
FT                   /old_locus_tag="CAGL-IPF5394"
FT                   /old_locus_tag="CAGL-CDS1762.1"
FT   CDS_pept        22039..23691
FT                   /locus_tag="CAGL0M00154g"
FT                   /old_locus_tag="CAGL-IPF5394"
FT                   /old_locus_tag="CAGL-CDS1762.1"
FT                   /note="similar to uniprot|P32487 Saccharomyces cerevisiae
FT                   YNL268w LYP1 or uniprot|P04817 Saccharomyces cerevisiae
FT                   YEL063c CAN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62327"
FT                   /db_xref="GOA:Q6FK93"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK93"
FT                   /inference="similar to AA sequence:UniProtKB:P32487"
FT                   /protein_id="CAG62327.1"
FT                   /translation="MSSSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIRED
FT                   LTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE
FT                   MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHH
FT                   FPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHE
FT                   YIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTV
FT                   FWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTS
FT                   VISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFI
FT                   GAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKTDLLQFKNWTYPFGPYFLV
FT                   IFTVFIILIQGWQAFDPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMDFVTD
FT                   RYIPTKEIVELNERLDNLKGWKKVRQIFSDYIA"
FT   gene            complement(<24106..>25221)
FT                   /locus_tag="CAGL0M00176g"
FT                   /old_locus_tag="CAGL-IPF5395"
FT                   /old_locus_tag="CAGL-CDS2975.1"
FT   CDS_pept        complement(24106..25221)
FT                   /locus_tag="CAGL0M00176g"
FT                   /old_locus_tag="CAGL-IPF5395"
FT                   /old_locus_tag="CAGL-CDS2975.1"
FT                   /note="highly similar to uniprot|P47176 Saccharomyces
FT                   cerevisiae YJR148w TWT2 or uniprot|P38891 Saccharomyces
FT                   cerevisiae YHR208w TWT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62328"
FT                   /db_xref="GOA:Q6FK92"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK92"
FT                   /protein_id="CAG62328.1"
FT                   /translation="MDASRLKITKVSTPSERKPNDQLVFGKTFTDHMLTIEWTSENGWD
FT                   APEIKPYGKLCLDPSSIVFHYAFELFEGMKAYRTKDGKIAMFRPEKNMERMNKSAARIC
FT                   LPTFDGEELIKLIGKLIELDKHLIPEGEGYSLYIRPTLIGTSEGLGVKEPDRALLFVIC
FT                   SPVGPYYKTGFKAVRLDATDYATRAWPGGVGDKKLGANYAPCVLPQTQAAAKGFQQNLW
FT                   LFGPEHYVTEVGTMNAFFAFNCKETGKKELVTAPLDGTILEGVTRDSILTLARKYLDPN
FT                   EWEINERYFTIHEVQEKAHKGELLEAFGSGTAAIVSPIKEIGWKDTIINVPLIPGEQSG
FT                   PLTKQIASWMMDIQYGKVELDNWLRIVADIN"
FT   gene            complement(<26473..>27207)
FT                   /locus_tag="CAGL0M00198g"
FT                   /old_locus_tag="CAGL-IPF5396"
FT                   /old_locus_tag="CAGL-CDS4054.1"
FT   CDS_pept        complement(26473..27207)
FT                   /locus_tag="CAGL0M00198g"
FT                   /old_locus_tag="CAGL-IPF5396"
FT                   /old_locus_tag="CAGL-CDS4054.1"
FT                   /note="similar to uniprot|P32787 Saccharomyces cerevisiae
FT                   YJR144w MGM101"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62329"
FT                   /db_xref="GOA:Q6FK91"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91"
FT                   /inference="similar to AA sequence:UniProtKB:P32787"
FT                   /protein_id="CAG62329.1"
FT                   /translation="MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVKP
FT                   TEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPTDI
FT                   EIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLVSVS
FT                   RGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKFVTHI
FT                   ATSKKKKIWIRKDRSVEYPYKA"
FT   gene            <28137..>30434
FT                   /locus_tag="CAGL0M00220g"
FT                   /old_locus_tag="CAGL-IPF5403"
FT                   /old_locus_tag="CAGL-CDS0898.1"
FT   CDS_pept        28137..30434
FT                   /locus_tag="CAGL0M00220g"
FT                   /old_locus_tag="CAGL-IPF5403"
FT                   /old_locus_tag="CAGL-CDS0898.1"
FT                   /note="similar to uniprot|P46971 Saccharomyces cerevisiae
FT                   YJR143c PMT4 dolichyl-phosphate-mannose--protein O-mannosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62330"
FT                   /db_xref="GOA:Q6FK90"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK90"
FT                   /inference="similar to AA sequence:UniProtKB:P46971"
FT                   /protein_id="CAG62330.1"
FT                   /translation="MAVTKRSPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQN
FT                   WLLNPKPDSDNSYRLGFYLVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFF
FT                   DVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMF
FT                   ESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLK
FT                   EPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLI
FT                   KHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEV
FT                   QFFDIVTFENQDTGAFLHSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVAD
FT                   KAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFR
FT                   FQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKKMTDSG
FT                   NAWTIDSIMNLDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEHPFASQPESW
FT                   PGSMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKV
FT                   TREKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKS
FT                   DDPYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYATPLSAREVIK
FT                   RKWLDISLSFAK"
FT   gene            complement(<30628..>31665)
FT                   /locus_tag="CAGL0M00242g"
FT                   /old_locus_tag="CAGL-IPF5404"
FT                   /old_locus_tag="CAGL-CDS3198.1"
FT   CDS_pept        complement(30628..31665)
FT                   /locus_tag="CAGL0M00242g"
FT                   /old_locus_tag="CAGL-IPF5404"
FT                   /old_locus_tag="CAGL-CDS3198.1"
FT                   /note="similar to uniprot|P47173 Saccharomyces cerevisiae
FT                   YJR142w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62331"
FT                   /db_xref="GOA:Q6FK89"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK89"
FT                   /inference="similar to AA sequence:UniProtKB:P47173"
FT                   /protein_id="CAG62331.1"
FT                   /translation="MVKVETDSATGRQILVRTTEDNREGFSFVEVIDRVDSLPSDFELN
FT                   EQFRKNVFYMTTHDGVKVGFVNRGILEEIQRVANEELLELFEIKEAENILQFKYNLDFD
FT                   SRNTRLDELGLKLRDKSKLQGVKGWRNEKYAVWVGKKPYVLVERALSGVLGIITYGVHV
FT                   NGYMFDEHTQEIKFWIPRRSKDKPTWPYLLDNVIAGGLGYPYGIEETLYKESIEEANLD
FT                   KESIQKNIRAGGVVSYFYFPKGNIRDNFYNESSAIVGEVEYIYDLRFDSNMKPSPNDGE
FT                   VDSFNLLDLQQTIDALVNNEFKPNCGLIMLEFLIRYGYINAENEPNYLKIINRMHRSFP
FT                   FPTLN"
FT   gene            complement(<32100..>33173)
FT                   /locus_tag="CAGL0M00264g"
FT                   /old_locus_tag="CAGL-IPF5405"
FT                   /old_locus_tag="CAGL-CDS3103.1"
FT   CDS_pept        complement(32100..33173)
FT                   /locus_tag="CAGL0M00264g"
FT                   /old_locus_tag="CAGL-IPF5405"
FT                   /old_locus_tag="CAGL-CDS3103.1"
FT                   /note="weakly similar to uniprot|P47172 Saccharomyces
FT                   cerevisiae YJR141w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62332"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK88"
FT                   /protein_id="CAG62332.1"
FT                   /translation="MKYLVEELENVGVTLIAVEALNNVSYSISTNRSTLELRVINDSYK
FT                   TSIRLKGLNLDNLYDEKNGHIHLSETSCGYVRLKRKTQALTNRISLVDLPDDKWNIERF
FT                   KKMQGFQIACNNCKLVVLDSEVNIKKISEMPSEFWAEFMDYWHCHKPTIGESKTDAKPY
FT                   DYYKELKPRLNEVLVGNTYFQTIGSTIDRKVVVQTDGSVDCSNCRSTLGYKEGSEILVL
FT                   EKQNLQLQDTFKELSEDYPGYLVVLARILSLLKFNSTRYFALKTGGQKPIFIWVLAYDC
FT                   SVAYTGNELVQRAYKLLYKDSWDRPPSSMEDIQLSDDLLDSFLQQLTKIHELIPENLKM
FT                   FNGWKVSYMSIEDTNPI"
FT   gene            <33549..>38396
FT                   /locus_tag="CAGL0M00286g"
FT                   /old_locus_tag="CAGL-IPF5406"
FT                   /old_locus_tag="CAGL-CDS0081.1"
FT   CDS_pept        33549..38396
FT                   /locus_tag="CAGL0M00286g"
FT                   /old_locus_tag="CAGL-IPF5406"
FT                   /old_locus_tag="CAGL-CDS0081.1"
FT                   /note="similar to uniprot|P47171 Saccharomyces cerevisiae
FT                   YJR140c HIR3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62333"
FT                   /db_xref="GOA:Q6FK87"
FT                   /db_xref="InterPro:IPR033053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK87"
FT                   /inference="similar to AA sequence:UniProtKB:P47171"
FT                   /protein_id="CAG62333.1"
FT                   /translation="MSSFSFLNQSPDIEQLEAEEHTRETQIELCFQLFQDALERLKDDK
FT                   FGDANDLFEKLMSQEVIKPDKWGLYAYSSSIVDNLRYLAYRNRGFFYYKFLMNQYSESM
FT                   SSEDVVDNILKIVENLLESLRHSEADYNVIEVLVQIFESFKSKRLQKLLLENEFMNNDS
FT                   HLLFSGRKRTNILPQLKVLISQYINLLKDLHASSVLEKKIICNGQAKNTSHLPRTNVKF
FT                   KNILEQLNKLRTEDDELIKSLDIHDIELDNYDWTSLLRSLRETLPTVKSLALFGRNSDP
FT                   YAETETPIEAVKVIVKEEVVIDKIHDNSNNENEVTEEKEITDNKVVTTNGNNRKRSITE
FT                   IETKHAQRSSKRFRDRDSSAADSETPMTFEPMFYSYTKILSLLGCKAPYDYEAIYPDLM
FT                   EVKANDIIYADFLACLKEWSHWHTDCLSSQNEKEIKTKKVESSTDVSLSHFKTLLNSKN
FT                   FQKSDDHIPEISQTSLRRFLDKVNRQQCHFHELRFKLIWFLFDNQNGDRLLTSTRWTKQ
FT                   MYRDVEWITLSIEKNIFSFIQSDIAKYRHVALSIFETLINSLVELCEEINSKLSLGQKA
FT                   NDQKTQKVKIEKKITKWNSIIAQVETTDRDWTVRYLWAYYTLIQCTSDIQNCLLSNILE
FT                   KVHQILMKDNSSTVYLYPNADFISSFDLSFVDTQLKKLKMIKKLVNVDKHSESDKSEDN
FT                   NSQFIMLENVLLSTISENHAVGGDDDDMIDFFMSAPFMLKFKLWELIYMKYVKKNDIEK
FT                   TTLIYGIMLKLLVDTLECKTYRTLGPKKRQERLLIMMSCLKDITHNCIEVLKNNAWLQK
FT                   KLSWYDDTTSQLVFIFFILFPMLPVNTPNKLSGTQTFFQKATKSSKTIKSIFVDILTLL
FT                   LFHLNIGLKSKISSEPELENSIIDLVSTTHISISFYNFCDYASGNFLQIAENLICQFTN
FT                   EEAFTQLKQIMWCKYHYQLSGDSSIVSQHKTKAMEMSKMVSLPLGIYLVKLQYQDKHPY
FT                   INSAKIASKQILDNIVETFGDLSSQDNYIIMRNLHAFNGYLRSNITSKLFQSCFEGKDK
FT                   VDLKNPNDEFQKAMDAGVFYVSGIQALNLYKIRKRSVQARPSELDAIITMFKNDILYNT
FT                   KRFESWYLLGKCYSYIVEDDLLWTADKISSSEKKAVIATTQKRAILCYAMSLTLFFENE
FT                   TTRTVDEQIVIVECLESLANELMIAVYKPMEALCFDTNLSSLVVSSSNPATSSEIEKSS
FT                   VAPIYSITDSSIEDTMIKCLTLANRYQESLLEAGKLDRLNWFNFYSIAIVYSTEKLDRK
FT                   GDMIDNMSKACELANKYTSVKDSVVEPHVALIHMLYKLYIEGKVTMEDTLSTLKRDKFF
FT                   EGFDDDFWILDVSLTQDYQKREFFSKLIELLKYVISKDKKKWQHEPYFYIAEILFMEMK
FT                   DVEKSREWMDNIISIRSVNKNLVNIWKPDYERPGKHFVFTHNYVMFYLELLKYDKDAQS
FT                   IGLLTKKLRRFSSGMAYIGKANDVATSYFIECVTKKYLLHDKVYTESYMGNINYNDFVK
FT                   YSQEIVDNSKAADIAEDILEVLKIAYQLKKGTNSVVYDTVCLSLFFQYIYEPYRKEHPE
FT                   TEPQLVSDSENKSNIRKKVSKKDAFDKIRALVDKLP"
FT   gene            complement(<38758..>39072)
FT                   /locus_tag="CAGL0M00308g"
FT                   /old_locus_tag="CAGL-IPF5407"
FT   CDS_pept        complement(38758..39072)
FT                   /locus_tag="CAGL0M00308g"
FT                   /old_locus_tag="CAGL-IPF5407"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62334"
FT                   /db_xref="GOA:Q6FK86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK86"
FT                   /protein_id="CAG62334.1"
FT                   /translation="MSTKPIVNEFERTEVRDEITLERDERPGEKSFVIGLTPRSLFSHC
FT                   VKFHALLATFSSMCDIPITFSAANLEIQLSSSPQQTVNYKPNALKSKNQLPKTHLWLEP
FT                   "
FT   gene            <39196..>40284
FT                   /locus_tag="CAGL0M00330g"
FT                   /old_locus_tag="CAGL-IPF5408"
FT                   /old_locus_tag="CAGL-CDS3051.1"
FT   CDS_pept        39196..40284
FT                   /locus_tag="CAGL0M00330g"
FT                   /old_locus_tag="CAGL-IPF5408"
FT                   /old_locus_tag="CAGL-CDS3051.1"
FT                   /note="highly similar to uniprot|P31116 Saccharomyces
FT                   cerevisiae YJR139c HOM6 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62335"
FT                   /db_xref="GOA:Q6FK85"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK85"
FT                   /protein_id="CAG62335.1"
FT                   /translation="MSNKSVNVAIIGTGVVGSSFLDQIVAMKSNITYNIIYVAELSKAL
FT                   ISEDYSPLALGSDWAKAVNGANQGPLALEKLVDFLKKSPIPVILVDNTSSAAIASFYPT
FT                   FVENGISIATPNKKAFSSDLATWDSLFSGKPTNGLVYHEATVGAGLPILGFLREIIQTG
FT                   DEIEKIEGIFSGTLSYIFNEFSTTTTNDVKFSDVVKVAKQLGYTEPDPRDDLNGLDVAR
FT                   KVTIVARISGVKVESPTSFPVQSLIPKPLESVESVDEFLQKLPEYDDELTQLKKEAAEE
FT                   NKVLRFIGKVDVATGKPSVGIEKYDHSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAG
FT                   AAVTAAGILGDVIKAAQRLVGA"
FT   gene            complement(<40767..>46181)
FT                   /locus_tag="CAGL0M00352g"
FT                   /old_locus_tag="CAGL-IPF5409"
FT                   /old_locus_tag="CAGL-CDS0051.1"
FT   CDS_pept        complement(40767..46181)
FT                   /locus_tag="CAGL0M00352g"
FT                   /old_locus_tag="CAGL-IPF5409"
FT                   /old_locus_tag="CAGL-CDS0051.1"
FT                   /note="similar to uniprot|P47170 Saccharomyces cerevisiae
FT                   YJR138w IML1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62336"
FT                   /db_xref="GOA:Q6FK84"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR027244"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK84"
FT                   /inference="similar to AA sequence:UniProtKB:P47170"
FT                   /protein_id="CAG62336.1"
FT                   /translation="MFSALRSKNQSNKRSNDDSINSRKDVNELSLGAGGTSTSTNTNHN
FT                   DSPSIKNKNKNKNKNKTENENIYKLTISSGRSRGTASNTTNANTLVLNAGVAIVGKAPI
FT                   ASSQNEIQTISGQSLQSGIDTNLMTAGFGRSAGIDSTTTVSHDANSVKSRLQRLPTITT
FT                   SYKEINNGNKPVQVEPQDDSHYTSSLLVDTDPRSNNQPQSISSNAVANVEINRTLQLDL
FT                   VYHESRVSEKLVMLDLKKLPHIKEGQLCELRTYRKRKSTSARSNKNSRDKKLYFIAHDF
FT                   DEETRKRCHKFGNISVALGQLQLLLDLPPRSRVWIKPKRKEDTAADLIELHIKDILVNR
FT                   GDMWCMSSELVDTCVFTGQRIMFLDSIRTTVNGIYKNGKKVLSGYINDNTKIVFRSESS
FT                   RLLFIIQITNEMWSFDESGEQMFQKMINSFFPKIFNKWKDIETHHSITIAFAISMDMST
FT                   SSYKDLKPGQRIKNTTDYYRIVVDQVSVIYWVEIMESLRKEFMEITRELLSRKSDDKKD
FT                   NELSVIKGRFAPVIKSNILELINFAATTIVDPFRQLDLRHTSTHVMIISPGKGLYDVDY
FT                   DLLQLSCKKLLSLELTMDLICLSNPPLHVVPLFRYIDYENKLHHCIPPWLNIFFWNDKT
FT                   KDTNKWTPRCQIYDLQMMGLTDTELVQELELDYLNPSDDINDLQTFLKDYDRDIFLPIS
FT                   TANFKAENISSDPDEEDLKELKKINDKTTTIHKSSTSRNTLTKSQRTNSEENNSIRSRK
FT                   GDTIIKDPQFVGKISNSSRNNPPYDLSDKSTFEKQFKPKTTFHPSAMIKKTPENMKKLT
FT                   NPVFQQQYFDIQTDNGLTGNSKNLLIKNTKYLTPIIDEPQTPLVTGNLYRTRFESQSND
FT                   NELNENSKLPERGGGTDERRNVSAADTLKDVTKKSSIKDFTQRIFTKFLATTKQSNFNS
FT                   DGINSSAITEDAVLISDDTDGKTNNNNDFAVYPSSVADGDVSGDNQHRLNNKDSFTSIL
FT                   KPIPRPQLGVKIFKSDINNLSSNENVNSETKQNLLGTRNTINRKQFTASPHFTSSTKNS
FT                   VSNHSRFIKFDSMDDWIEILEDSIPSYSFLGDDLLPTRWRDVWPKNVFRKYSKWKSFTS
FT                   PAELPITLKRFPSKYELENNFMLRNHSVTQNWEQEQYKLTTKDLLRNMIYLRLLVGFQI
FT                   CTSSTIEEVESARKGDRDVFAIHKYLRGDLTGTFKIYMLMGSEIHRLHYDNSGTINVER
FT                   YIEKSERNVFDQVPSYTSFVKTRYDSNYRKTDVDPIHTKRSEFNWNLLDQLLAGYSDPY
FT                   LYDEWHGFRSKYVILPAEIPSNTFSMVVNGKNETLTTEEIRVEGLRKLIASITRLKLLS
FT                   VEESKIQKDRKTEIQPEVIFYTGSLFDFLNEQQAQLDSSTLNFKDSIFGDVTKKLNKNI
FT                   DLKNLAQELQMGENKLNLVTRKWHWKRHANCFVGSEMVNWLIRNFSDIDTRSTAISYGQ
FT                   KLMNDGLFIHVLDKHSFLDGNYFYQISPEFIINMNTVERTNSKNSNTSDNNTLKKTTSR
FT                   NSTESNLTPLSMRNKVSTMDDDSTQLANTTSANSYKEKKTVVLSNSMLINVDPSSKSYK
FT                   EELCTVHFDRVHNPEHCFHIRLEWLTTTPKLIDNMLGNWARICEKYGLKLIEIPWNELC
FT                   TIPSVDPFHTFVQLHLVINPWEDPEFNDPELFAVSKFYYHIHLLKMSGFLLDNRASRFF
FT                   QRDDADFEIMYSWGKPQFKYAQYIHTTGAYIAEMRENGNIFLAPNNVYMSRVNRANVIS
FT                   KTRSSPTFTVDSRKVVIEFSRTCYSYAKLRAVFLDAKEKWLSNKTVED"
FT   gene            <49330..>53538
FT                   /locus_tag="CAGL0M00374g"
FT                   /old_locus_tag="CAGL-IPF5413"
FT                   /old_locus_tag="CAGL-CDS0144.1"
FT   CDS_pept        49330..53538
FT                   /locus_tag="CAGL0M00374g"
FT                   /old_locus_tag="CAGL-IPF5413"
FT                   /old_locus_tag="CAGL-CDS0144.1"
FT                   /note="similar to uniprot|P47169 Saccharomyces cerevisiae
FT                   YJR137c ECM17"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62337"
FT                   /db_xref="GOA:Q6FK83"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK83"
FT                   /inference="similar to AA sequence:UniProtKB:P47169"
FT                   /protein_id="CAG62337.1"
FT                   /translation="MTAGTAGLDTGRPLYYVGAQKDNTPRDESLVSYVFKGETDYIKLL
FT                   ASTDPLSRVIDNNKGGVVLLDQVTLLESLPHLYSIGKKDSTSNITEGSVITIIVDLNLE
FT                   DYSIIPAVSDLHLPIHIGLESINLEQNGIHFINFNRINGTQTANNIFTSGAASPKNLII
FT                   NLSQYYNELVKSVPEDVAIFNITEYKKNLLPEILANVPSSITRINLLQGSSTASENQEY
FT                   EDGFEPFLLDFFADFEVLVQNNIQQLLLTKIGNKVDDFNSVSAKIISNLESAKPVKNLF
FT                   VGEVVDISKDVTEDYSNSIKNILKLEDAYIKVLKQLLGNNLSIINEYSNSTINTLSPEF
FT                   GYGRYLQEKEIQNKLVELARKSLDPQLFHSQESDEFVKKLSKWVSFKSSSLDQNLLEEA
FT                   NKIGSDIFEYLKTDAHSQTAIKLLEVAENDEKYFQFKSSWLIGSDAWSYDLGNSGVHQV
FT                   LTSSDNINMLIIDSEPYEQRKASTQRKKDVGLYAMNFHNVYVASVAVYSSYTQLLTAFI
FT                   EANKFNGPSIVLAYLPYKSEKDTPLDVLKETKSGVESGYWPLYRYDPSKEEADEQSAFQ
FT                   LDSSVIRKQLEAFLERENKLTLLTKRNPALARTLAQSASDVVTQKQNKRAEAALESLLN
FT                   GLSGPPLHIYFASDGGNASNLAKRLHGRASARGLKSTVLSMDDLILDELPGEENVVFIT
FT                   STGGQGEFPQDGKSFWDALKGSTDLDLSNLNVSVFGLGDSQYWPRKEDKKYYNKPAQDL
FT                   YRRLEFLGAKILAPLGLGDDQGDDGYQTGYSEWEPKLWEALGVANVEVEDEPKPITNED
FT                   IKLNSDFLRGTIASDLKDESTGTVQYSNEQLMKFHGIYTQDDRDIREVRKSEGLEPYYY
FT                   FMARARLPGGKCTPHQWLGLDKLSEDSGNGTLKLTTRATFQIHGVLKKNLKHTLRGMNA
FT                   VLIDTLAAAGDVNRNVMVTALPAQAKIHKQISTMAAEISEHFLPKTTAYHEIWLDGPEE
FT                   QDYEDDWNERFNNRKEGPRKKKTLVSGNALVDIEPIYGPTYMPRKFKFNLTVPPYNDVD
FT                   VFSSDIGLIAIVDKEKNSIEGYNIYVGGGMGTTHGNKKTYPRVASSFGYVKNEDVLPAL
FT                   EALLIIQRDYGNREDRKQARVKYTVDRLGVQGYKEKAEEIWGKKFEPERSYEITSNIDY
FT                   FGWVKDENGLNHFTAYIENGRVIDTPDLPQKTGLRVLAQYMEKNNTGHFRLTGNQHLVV
FT                   SDITDEHLDAVKEILAKYTLDNADFSGLRLSSSACVGLPTCGLAFAESERYLPDVITQL
FT                   EDTLEEYGLRHDSIIMRMTGCPNGCSRPWLAELALVGKAPHTYNLYLGGGYYGQRVNKL
FT                   YRANLNDEEIVDVIKPLFKRYAAERNEGEYFGDFVIRAGIVKPTLEGRLFHEDISEDAF
FT                   "
FT   gene            <53938..>55200
FT                   /locus_tag="CAGL0M00396g"
FT                   /old_locus_tag="CAGL-IPF5414"
FT                   /old_locus_tag="CAGL-CDS2636.1"
FT   CDS_pept        53938..55200
FT                   /locus_tag="CAGL0M00396g"
FT                   /old_locus_tag="CAGL-IPF5414"
FT                   /old_locus_tag="CAGL-CDS2636.1"
FT                   /note="similar to uniprot|P47168 Saccharomyces cerevisiae
FT                   YJR136c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62338"
FT                   /db_xref="GOA:Q6FK82"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK82"
FT                   /inference="similar to AA sequence:UniProtKB:P47168"
FT                   /protein_id="CAG62338.1"
FT                   /translation="MKCGNLIIVADGVIDDKDIINLACDEVLDTDDDLIHNDALDWRNI
FT                   ILNLSFRCYSVNDEDYLLAEKSNLVISRYFSRASRDKILEITSFLITKIQPLLINKKNA
FT                   VIDKQSKGLNPKLGFSFGDDEVYEIWKKNGGIRSIPLCLTILSHLPIDKISTNLWWISP
FT                   FILNLLDATSDLQNLRLPGVKLLHVMLEKVFIDQYSNKWLKFKDTGLFQEYERILINFC
FT                   FYLPPSYDSQNTLLIWRQVFPAIYSLYKAQYIEDEYQLRLHILKFISEVILQNCLPRCG
FT                   CKYDQLTSFLIHFMIEMIRTLGEKSTIYIQRVIYDIGQYLIKDPFFTAFDKLIFETIEL
FT                   VEAIIGYCNTTRVLEHKYDILGIILLIYGKLKNEESMSDKIRKQLQHTIKMLKDRGCNF
FT                   SYEIKHLKSVKGIDYTELFAV"
FT   gene            complement(<55412..>55675)
FT                   /locus_tag="CAGL0M00418g"
FT                   /old_locus_tag="CAGL-IPF5415"
FT                   /old_locus_tag="CAGL-CDS5680.1"
FT   CDS_pept        complement(55412..55675)
FT                   /locus_tag="CAGL0M00418g"
FT                   /old_locus_tag="CAGL-IPF5415"
FT                   /old_locus_tag="CAGL-CDS5680.1"
FT                   /note="highly similar to uniprot|P57744 Saccharomyces
FT                   cerevisiae YJR135wa"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62339"
FT                   /db_xref="GOA:Q6FK81"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK81"
FT                   /protein_id="CAG62339.1"
FT                   /translation="MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDICF
FT                   KKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ"
FT   gene            <56009..>56707
FT                   /locus_tag="CAGL0M00440g"
FT                   /old_locus_tag="CAGL-IPF5416"
FT                   /old_locus_tag="CAGL-CDS4149.1"
FT   CDS_pept        56009..56707
FT                   /locus_tag="CAGL0M00440g"
FT                   /old_locus_tag="CAGL-IPF5416"
FT                   /old_locus_tag="CAGL-CDS4149.1"
FT                   /note="similar to uniprot|P47167 Saccharomyces cerevisiae
FT                   YJR135c MCM22"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62340"
FT                   /db_xref="GOA:Q6FK80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK80"
FT                   /inference="similar to AA sequence:UniProtKB:P47167"
FT                   /protein_id="CAG62340.1"
FT                   /translation="MTNKSEIIDEYTAVLEREIENKRYFLKESHDALRDLIESKAERLN
FT                   GAGSVQGRRSAINKDVWQKFMEKPMYLPERQDPIGLNLVSARLREKTESMGPWLEVEKE
FT                   IVHVEETYLNSLRQLNAAMQDTIAEFRKNPPKPREELVSKDYSLSSLKTQHESLHKELK
FT                   EFVTRYLEPNAPENTSAEEMLQLISTLVQGKTLDKDQFKNSQSLFRLLMKGMLLENTDT
FT                   NSYKLIDLVS"
FT   gene            <57126..>58961
FT                   /locus_tag="CAGL0M00462g"
FT                   /old_locus_tag="CAGL-IPF5418"
FT                   /old_locus_tag="CAGL-CDS1446.1"
FT   CDS_pept        57126..58961
FT                   /locus_tag="CAGL0M00462g"
FT                   /old_locus_tag="CAGL-IPF5418"
FT                   /old_locus_tag="CAGL-CDS1446.1"
FT                   /note="similar to uniprot|P47166 Saccharomyces cerevisiae
FT                   YJR134c SGM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62341"
FT                   /db_xref="GOA:Q6FK79"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK79"
FT                   /inference="similar to AA sequence:UniProtKB:P47166"
FT                   /protein_id="CAG62341.1"
FT                   /translation="MNESKRLTLEERLNLAAQKRRKPKKIVPGGNAEDSGLHTNPSSKE
FT                   SLVEDHEIELNTWIPEDISSISRDDLIKALEPHFIEYKTKQKNASTTTTGDSSVFKLIK
FT                   GKDEEIAQLTKKLEDRRKQDTANEKLLSKLTADNEKLNKNNDNLSKKLNESNQEISNLQ
FT                   QKYSLSEKMLEESTKNSHDVQVLESSNKQLRQSIIDKEKTIQDLYAKIEKLEDEILKGK
FT                   DTFKIEKENINKANRENITALESQIEQLRIELENCNVITNENEDSQSKYQLIKEQFESS
FT                   KANWSSIESVLNSKISTLEDTIEKEKDHRANLLTQLETKTQRLLTLEKQQDQESSENIT
FT                   LKKTCITLESKVATLERDLQNLKDDYNLLESKYNTQRSQYRKSSESRLNNSSRSINEEV
FT                   SESWNDFGSGLNSLKITESNGALDTLMGQSSNIGDLTASDFTNNHELDPIDRDISFEKN
FT                   LDAIEETSFPEDADELDQRNSRGVSMRRHSTRNSTQMQSNAQLVTKLGHEIGRLETEIQ
FT                   SHREKIERLQKEKQLANDEILKLIDKNNGLSSIKLEKEELEKQVRDLQEKLDTSLQILG
FT                   EKTERVEELQNDVLDLKDMLHEQVKQMVDLQERLR"
FT   gene            complement(<59097..>59723)
FT                   /locus_tag="CAGL0M00484g"
FT                   /old_locus_tag="CAGL-IPF5419"
FT                   /old_locus_tag="CAGL-CDS4379.1"
FT   CDS_pept        complement(59097..59723)
FT                   /locus_tag="CAGL0M00484g"
FT                   /old_locus_tag="CAGL-IPF5419"
FT                   /old_locus_tag="CAGL-CDS4379.1"
FT                   /note="highly similar to uniprot|P47165 Saccharomyces
FT                   cerevisiae YJR133w XPT1 xanthine phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62342"
FT                   /db_xref="GOA:Q6FK78"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK78"
FT                   /protein_id="CAG62342.1"
FT                   /translation="MSEEKIYISYNNIHKLCQKIAKQILEREERPDVIIAITGGGMIPA
FT                   RIIRSFLKVQGQKNIPIQAIGLSLYEDLGLGNTADVIGKEVIRTQWLDFGALDQHFDSL
FT                   IGKKVLIVDEVDDTRTTLHYAVTELQKEVEEQQKRLNRLNEDTIFSIFVLHNKDKKKRA
FT                   QLPAEMMDSGRYLAALTVPDKWLCYPWEAQDIEEHTILAKQQGND"
FT   gene            complement(<60245..>63385)
FT                   /locus_tag="CAGL0M00506g"
FT                   /old_locus_tag="CAGL-IPF5420"
FT                   /old_locus_tag="CAGL-CDS0381.1"
FT   CDS_pept        complement(60245..63385)
FT                   /locus_tag="CAGL0M00506g"
FT                   /old_locus_tag="CAGL-IPF5420"
FT                   /old_locus_tag="CAGL-CDS0381.1"
FT                   /note="similar to uniprot|P46970 Saccharomyces cerevisiae
FT                   YJR132w NMD5 NAM7P interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62343"
FT                   /db_xref="GOA:Q6FK77"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK77"
FT                   /inference="similar to AA sequence:UniProtKB:P46970"
FT                   /protein_id="CAG62343.1"
FT                   /translation="MDPNTLLQCFAGTLNQDAGIRHAAEEQLKEASKVQGFLGASLEII
FT                   ASSEVPDNIKLSASLYFKNKITYGWSSNNYSGKNELLMFEVDNDEKPVIMDMLIQTLIA
FT                   CAKQSSNCVRILKPALTVIISAEYPAKKWESLLPKSLELLSSDDINVTHIGLICLSELF
FT                   RTYRWKENDSRQDLEMLILQYFPELLKYGKDVLFNEGKNMENPKIGEMLKLILKTYKFV
FT                   IYHDLPFVLQRPESFIPWAEFLVQIVQQPLPESIKNMDPDLRRTNSWVKCKKWAYANLY
FT                   RLFQRYASTSLTKKFEYNDFKKIYQEDFLPHFLQLLFQQIEQWNNRQTWLSDEALYYIL
FT                   NFIEQCVIQKSTWDLVGGYYENILQHIIYPLLRPNEETLEIFETDPQEYIHRNMELWDE
FT                   NYTPDLAALSLLTSAVHKRGKSTRGITLEFVTGNLNRNVGDFNNITLENAVEVESSLRI
FT                   ISSIIDILTSKNSPYAGQLEPFLKNMVLPFFKSPYGFLRSRVCEICSKLGYIDLQDPEL
FT                   NAIIFEGVMTCFNEERDCVPVNLMAALALQAFIQNPFFQEHLSQSVVPTMQKLLMLSNE
FT                   FEMDTLSGVMQEFVEQFAEQLQPFGVELMKSLVQQFLKLAIDLHEVSNIDPNSFLKADD
FT                   VPDETDKQMAAIGVLSTTISILLSFENSVDIVKNLEQSFYPAAEFILNNDMEDFYHEIC
FT                   EFFENSTFLMRTISPIAWKVLELIGECNRREESTVSVYLEDFMLVLNNFLIYGKDELRK
FT                   NEFYCKILFEVYEKAANREDADLDELQIIFELSQKLTLSLEQKLPDPIRVKFLNDAISA
FT                   IISEKDSLKKSIVFGVTSFNVIISNMIVTPVIVLNALASQNCIELFFEVWVSHYIPNYI
FT                   RTYDIKLSVLALMSILCSVSEEEILKFNLGNLLFQVYPLVLKMMARYPAALKLLEEKRK
FT                   EFSSLDFNDNEAWDDHFDFNEGGDEDNNEANIEDVIEMLRGDHNDLKFVDGLADGEDFD
FT                   DLEEDPLAGSILDDINIYELVKSSTSGLEQSNPAKFSTIMNSLSDEDKSMHTQIMNI"
FT   gene            complement(<63827..>65470)
FT                   /locus_tag="CAGL0M00528g"
FT                   /old_locus_tag="CAGL-IPF5421"
FT                   /old_locus_tag="CAGL-CDS1788.1"
FT   CDS_pept        complement(63827..65470)
FT                   /locus_tag="CAGL0M00528g"
FT                   /old_locus_tag="CAGL-IPF5421"
FT                   /old_locus_tag="CAGL-CDS1788.1"
FT                   /note="similar to uniprot|P32906 Saccharomyces cerevisiae
FT                   YJR131w MNS1 alpha1 2-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62344"
FT                   /db_xref="GOA:Q6FK76"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK76"
FT                   /inference="similar to AA sequence:UniProtKB:P32906"
FT                   /protein_id="CAG62344.1"
FT                   /translation="MAYILSAVVLCVSLALWFYNLQTSGFDGDAAAMRNKVEEVFLESW
FT                   RDYSQYGWGYDVYSPTSHHRHNMLGEERPMGWIIVDSLDTLMVMYNSSANYKDEFREHI
FT                   NAATEWIDRELNFDYDNSVSLFETTIRLLGGLLSAYHLSTELDLPQRYSNIYLDKAQDL
FT                   GRRLAVALEVNKDGVPFQTVNLKHGITAMDGGGYTTTPTAEFTTLQMEFKYLAYLTDNS
FT                   TLWQLSEKLYAPLYLNNNLMNQFNGLVPILTNSQNGRFSTATIRLGSMGDSFYEYLLKQ
FT                   YQLTGEEIYRQLYLVSLDGIAKHLLGRTTPSNLLFIGEREQGLNGPFSTKMDHLVCFIG
FT                   GVLGMGATNGLHLEQARKASFWNSERESEWLLAKELTKTCYEMYHQVPTGLAPEIVVFN
FT                   DGKARPGHDWWKSKKGDFWIKPNDAHNRQRPEAVESIMFLYQLSGNEMYREWGYEIFQN
FT                   FIQNTCVDCDDPKSRKYVNLGDVTKPGSLGDNMETFWLSETLKYMYYLFNDNVDLTSMV
FT                   FTTEAHIFPRLSHATLLKKGFETNWHKSKK"
FT   gene            <66078..>67787
FT                   /locus_tag="CAGL0M00550g"
FT                   /old_locus_tag="CAGL-IPF5423"
FT                   /old_locus_tag="CAGL-CDS1665.1"
FT   CDS_pept        66078..67787
FT                   /locus_tag="CAGL0M00550g"
FT                   /old_locus_tag="CAGL-IPF5423"
FT                   /old_locus_tag="CAGL-CDS1665.1"
FT                   /note="similar to uniprot|P47164 Saccharomyces cerevisiae
FT                   YJR130c STR2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62345"
FT                   /db_xref="GOA:Q6FK75"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK75"
FT                   /inference="similar to AA sequence:UniProtKB:P47164"
FT                   /protein_id="CAG62345.1"
FT                   /translation="MISEILGESIPKNTEHAVSVCLPLWADVVGYEEGDARVLDSLTTG
FT                   YPRFFIHASVKRLCNLISEQYARAGESCLCFPSYLVAKRCREYITVKSKQLDKDADIGK
FT                   IRILQLAMPQDDTDHTGIFDCKIAALFFKSELFPLAKQYWQHSGEIVSSRLADYVTERL
FT                   YPNAIHIDEATKDNKTFIETRFGRNLDSSFINRAKDILRNRIAHKVVETDHNQDVATNV
FT                   FLFPSGMASIFTAHRLLLNYDHIRVSNIKHNGVDKSDDIIGYGEPYLKTVMFGFPYTDT
FT                   LSILKKFNHTYFLGLGDESAMKDLIGILESGEQILAVFLEAPSNPLLKMCDMSKLKQLS
FT                   QQYGFFIVVDETVSGFVNIDILSYCDIVCSSLTKIFSGDSNVIAGSLVVNPASKLHDFA
FT                   IDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKINKIAEDLVSTVLLEEEGQLLEKI
FT                   YYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKREDQAKVFYDNLSLNKGPSLGTNFTL
FT                   VCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLETLQTIFRKAFDAAKDV"
FT   gene            <68018..>69001
FT                   /locus_tag="CAGL0M00572g"
FT                   /old_locus_tag="CAGL-IPF5424"
FT                   /old_locus_tag="CAGL-CDS3348.1"
FT   CDS_pept        68018..69001
FT                   /locus_tag="CAGL0M00572g"
FT                   /old_locus_tag="CAGL-IPF5424"
FT                   /old_locus_tag="CAGL-CDS3348.1"
FT                   /note="similar to uniprot|P47163 Saccharomyces cerevisiae
FT                   YJR129c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62346"
FT                   /db_xref="GOA:Q6FK74"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK74"
FT                   /inference="similar to AA sequence:UniProtKB:P47163"
FT                   /protein_id="CAG62346.1"
FT                   /translation="MDKSGELLLRRCPVERLVDELQEGKLLRLCDEENGFRKVLMEEVK
FT                   PVNNNYCKKVLREIVDRLDRTAGQLPEDVYESWEWAYEVYFDMLNDVQDELAMDEADND
FT                   VIMYKFSEQYKVNIAETPRTIANGSTGNRTWEAAVYLGLYLIDQCASNVVAAPSRILEL
FT                   GSGTGLVSLLYQQLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWGPRDA
FT                   NSGDNQWDYDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFE
FT                   KYMREYKLQYEVITETTDEDFERLEEITFTRPIAPIRIYRINNAKI"
FT   gene            <70659..>73721
FT                   /locus_tag="CAGL0M00594g"
FT                   /old_locus_tag="CAGL-IPF5429"
FT                   /old_locus_tag="CAGL-CDS0420.1"
FT   CDS_pept        70659..73721
FT                   /locus_tag="CAGL0M00594g"
FT                   /old_locus_tag="CAGL-IPF5429"
FT                   /old_locus_tag="CAGL-CDS0420.1"
FT                   /note="similar to uniprot|P46974 Saccharomyces cerevisiae
FT                   YJR127c ZMS1 or uniprot|Q04545 Saccharomyces cerevisiae
FT                   YML081w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62347"
FT                   /db_xref="GOA:Q6FK73"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK73"
FT                   /inference="similar to AA sequence:UniProtKB:P46974"
FT                   /protein_id="CAG62347.1"
FT                   /translation="MMTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRH
FT                   QNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDKTIGRGKWDEKILNTPD
FT                   VWNNDIVKVKGNKASILPTVDYTMHRQDLVLKSNDGNDSQTGISSQNSITFNNMSVSVG
FT                   SSGVLEYESTSKRSTPGNHSSDSTPTDSSISRLRTEGSYTNTNNADGTLNPVPYHDLDL
FT                   SSSSSLSFATPSYQNTRTSNNPVPIGGGTPLDVNWLNSVLESDNKINELASKSLSPSAT
FT                   LGQKSDKHNNIADFKLSLPESKKNRRYSYPNNLNDTTAKQSNDKNYTGSPLNPNGRMHS
FT                   NGHNNPPSASNATITLNTSAGIENHTINDKDLFRPDLNHNPSLSSLFKTEDPTSSEQPV
FT                   IDIISQLSSEYTSPNDLSFVNLNQPNLGFFTQEWRDLILQKYSLLDNNFPTIKELNEYI
FT                   EQYQKEFHPYFAFLHLHSVQPSLSRISLFLSVAAIGAFYSYNSTHSNLLANLAYGEINQ
FT                   LIKSVKLDSSPLWLVQTMLVLGFYAIFNNDISLVQSASDQFVMIVKIVKSAKINQPLET
FT                   MVVPPTNLFPNPVTKTLTSDQIDAAYRYFITAQSRIHICHSMLFLSNIFPAMSGLEACF
FT                   LSSDVLCGVPCPYEDLYTSKSPGEWYNNVLKNSIEIANSSQLVNLSNGMVSFQTCLEYL
FT                   TTGNHVLYENIKLSLYTLLSLLVSIHEKILLERHKAKTEKDVQYNDTQWKLKQGPLIDS
FT                   VIRKWEILYMKNGGILLPTENNVAKITGSHVMRNNVSFYLFAKLKRCIDLNHVIQKIWM
FT                   RDWTTMNTALEEVIYDKESLQEATDYAISLLRSWASTFTILDDESMQAMKTPMFSMACI
FT                   FSSILIIAEYLRSVERWAKTFNAGDPNAKTMNPTDKILWLKAGRLLKMFQKKLMSSDAK
FT                   KYSEFAGVQKHEMLDITEVDESVLQRAIGLEAKVDETIQMILAASLASKALYIGVRVIG
FT                   DTPIWPISVLFAQGLQSRAVYCVMKDEGVFT"
FT   gene            <74369..>76687
FT                   /locus_tag="CAGL0M00616g"
FT                   /old_locus_tag="CAGL-IPF5431"
FT                   /old_locus_tag="CAGL-CDS0881.1"
FT   CDS_pept        74369..76687
FT                   /locus_tag="CAGL0M00616g"
FT                   /old_locus_tag="CAGL-IPF5431"
FT                   /old_locus_tag="CAGL-CDS0881.1"
FT                   /note="similar to uniprot|P47161 Saccharomyces cerevisiae
FT                   YJR126c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62348"
FT                   /db_xref="GOA:Q6FK72"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR034308"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK72"
FT                   /inference="similar to AA sequence:UniProtKB:P47161"
FT                   /protein_id="CAG62348.1"
FT                   /translation="MSAIDDSQSDLRPFPVDSNDGSSQPDGYGSIEQDERAFRRPRSDT
FT                   MSTIRSGIEIVRENMDRWKFLYLILASLFIYLSFIAAFAPRTSLARDLRRFHSARMTQS
FT                   EVYRIFLDTLLYENKAEQHHDAISKTNGTSYIKNYLIDLGFEIKNDSYYAWVNTPVKQQ
FT                   VRVIQDDEVIYQAKLKEDLTGVSHNAFHGYSKDGKLTARFVYCNYCTIEDYTKLVNDKI
FT                   DIEGKVHICKYGINAPGNKLKNAELYGSTGVLIFTDINEIPNMPVNYGTINSSETNSYD
FT                   DAIQRDTVRFGSDIFGDPTTPGYAALYPDTERMNPNDYMPSIPSLPISYRDASKLLDML
FT                   HAKGSFWVSNDGVNSAKLFSGPSDPNTEVQLVNRQEYGVQQIDNIIVEIPGILSENDIL
FT                   IGAHRDGFPIGNGTSSMSSHSGIAVLLEFARGISKLRKKGWKPLRTIKFVLWDGLHNSQ
FT                   LGSSSFGTRYATSLKRDSLLYVNLDNAIAGQYFNVKANPMLISAITEASKNIDYKKNED
FT                   WSLFQEWYNTSNAKVDSLEGVNDYSVFQFYLGIPVVNFSFNSRTSNQPQFPINTGYDNK
FT                   EWLIRYVDPEFLLHNTLSRFLGMFVLMVSETELSYYNPHPFFKHLNIQFDKVKRFAEKT
FT                   FSRNEKLLYKLDSLGKLIKDIADYDSKYYERRNKEVADGVSSELPIWAFVRKYRVFLSL
FT                   IRANKKLREIGKVFLTNNGIEGRPLMKSSLFAPNLENSTEIMMFPGLLEATKQKDVQKA
FT                   MKSLIVLEAQFLNVRYLLL"
FT   gene            complement(<76881..>78077)
FT                   /locus_tag="CAGL0M00638g"
FT                   /old_locus_tag="CAGL-IPF5432"
FT                   /old_locus_tag="CAGL-CDS2777.1"
FT   CDS_pept        complement(76881..78077)
FT                   /locus_tag="CAGL0M00638g"
FT                   /old_locus_tag="CAGL-IPF5432"
FT                   /old_locus_tag="CAGL-CDS2777.1"
FT                   /note="similar to uniprot|Q06205 Saccharomyces cerevisiae
FT                   YLR449w FPR4 or uniprot|P38911 Saccharomyces cerevisiae
FT                   YML074c NPI46"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62349"
FT                   /db_xref="GOA:Q6FK71"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK71"
FT                   /inference="similar to AA sequence:UniProtKB:Q06205"
FT                   /protein_id="CAG62349.1"
FT                   /translation="MSDMLPLAMYALNVEPYTHTPAVLLDTPVTVRITMAAIDPEPFDE
FT                   DKKPSTLRIIRRNPVYLDAGEVDEEKLIEELEGDEAAEDGDEASDDDKEEEDEDEDVDE
FT                   DDEDDDEDDDGEDEYEECVVVTLSPETRCQQAIDITIAPEEDVQFLVTGSYTISLTGNY
FT                   VKHPFDEPLEDLYSDEDSEEYSDDELDQEIEEDDELDHDEASSEESDEDQEFYDAISEG
FT                   DEDIDEQLAKLEETSDVEAHLEDLIAKDNKKKRKQEQLDEQPETKKSKKTKDEKNTKAT
FT                   ENEKKNKAQVLEGGVIIEDRKIGEGPKAKKGSKVGMRYIGKLKNGKVFDKNTSGKPFYF
FT                   KLHRGEVIKGWDIGVTGMAIGGERRIVIPAPYAYGKQTLPGIPANSELTFDVKLVSLK"
FT   gene            <78392..>79429
FT                   /locus_tag="CAGL0M00660g"
FT                   /old_locus_tag="CAGL-IPF5434"
FT                   /old_locus_tag="CAGL-CDS3199.1"
FT   CDS_pept        78392..79429
FT                   /locus_tag="CAGL0M00660g"
FT                   /old_locus_tag="CAGL-IPF5434"
FT                   /old_locus_tag="CAGL-CDS3199.1"
FT                   /note="highly similar to uniprot|P32366 Saccharomyces
FT                   cerevisiae YLR447c VMA6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62350"
FT                   /db_xref="GOA:Q6FK70"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR016727"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK70"
FT                   /protein_id="CAG62350.1"
FT                   /translation="MEGLYFNVDNGFLEGLIRGYRNGLLTNNQYINLTQCDNLDDLKLQ
FT                   LSSTDYGNFLSQVSNDALTTSVMQEKASEKLYKEFGYIRDQSSGLTRKFIDYITYSYMI
FT                   DNVALMITGTIHERDKSEILSRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPFFR
FT                   DCFDAADELDDLNIEIIRNKLYKAYLEDFYKFVSEEIDEPSREIMQTLLGFEADRRSIN
FT                   IALNSLQSPDLDPALKKQLLPEIGKLYPVATEQLANAKDFESIRAVLGQVPDYRNALES
FT                   GSLEDHFYKLEMDLCRDAFTQQFTISTIWAWMKSREQEVRNITWIAECIAQNQRERINN
FT                   YISVY"
FT   gene            complement(<79782..>81101)
FT                   /locus_tag="CAGL0M00682g"
FT                   /old_locus_tag="CAGL-IPF5436"
FT                   /old_locus_tag="CAGL-CDS2478.1"
FT   CDS_pept        complement(79782..81101)
FT                   /locus_tag="CAGL0M00682g"
FT                   /old_locus_tag="CAGL-IPF5436"
FT                   /old_locus_tag="CAGL-CDS2478.1"
FT                   /note="similar to uniprot|Q06204 Saccharomyces cerevisiae
FT                   YLR446w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62351"
FT                   /db_xref="GOA:Q6FK69"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK69"
FT                   /inference="similar to AA sequence:UniProtKB:Q06204"
FT                   /protein_id="CAG62351.1"
FT                   /translation="MRPIGTMTIANPEKILEEVKSQLGVRQSLATITEKFQEELDFMLK
FT                   NCKKSMLPFPQVCCRGWSEYNEPMDMLAIDFGGSVLKFAVINMPQCQMELKYELEIKSK
FT                   VVDFKFFDNIVEWICNRIPINNERSLPRKFIVAITFSFPVNANNEIVAMGKGFRMSPEL
FT                   KGISILDILKQSFDRLEKEYSSSFTFEISNVINDSLAVHMTSKYLQSDNNDKISLILGT
FT                   GVNSCFEVQYEDLPQFKKDILTQFSDDYREKVLINSEMGFLGRYSKSIEFGNFDTNIDD
FT                   KMPLESITSGKWIPQILHNIIRYYNLLPMVGDEEIKYDGRLICEILSDGECPSEYLLSL
FT                   WDYEVYQIIRQITKLLINRAAIYLVAAIIAIRKFVSPEIYFTKGGIDIDYVGSFLNYCQ
FT                   YYQERIHLHSKGMVKLQFLNDSNLYGCAITAYSNIFENRI"
FT   gene            <81930..>82796
FT                   /locus_tag="CAGL0M00704g"
FT                   /old_locus_tag="CAGL-IPF5438"
FT                   /old_locus_tag="CAGL-CDS3700.1"
FT   CDS_pept        81930..82796
FT                   /locus_tag="CAGL0M00704g"
FT                   /old_locus_tag="CAGL-IPF5438"
FT                   /old_locus_tag="CAGL-CDS3700.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62352"
FT                   /db_xref="GOA:Q6FK68"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK68"
FT                   /protein_id="CAG62352.1"
FT                   /translation="MQTEVIIRNKVAVYKLIGLCQKYRDDVQNLHKCMLRLNSLFYKMT
FT                   TEEIESQSKKNNDSSTTLIASATSDKCSNLNYNRCDEGLSACQVSPVENNLDEASPQDN
FT                   DLLLRPKTYSAVMLDTAAISDDVRPLMESIRKDTPKKFHFYKNYGFHLGTLQDESRIIA
FT                   QKLHYELKHISLKIIIPMKLFDKQCTHYLKHCPCGNKIVTPYEVKQVDKFIEYIPKFWH
FT                   YWFLSYYSIFYRIHFLLYLQSCQLLLQKSRNTVINKSELSSISLLNDYREKAESIVRQM
FT                   ESFNFTS"
FT   gene            complement(<82968..>83656)
FT                   /locus_tag="CAGL0M00726g"
FT                   /old_locus_tag="CAGL-IPF5440"
FT                   /old_locus_tag="CAGL-CDS4568.1"
FT   CDS_pept        complement(join(82968..83162,83279..83656))
FT                   /locus_tag="CAGL0M00726g"
FT                   /old_locus_tag="CAGL-IPF5440"
FT                   /old_locus_tag="CAGL-CDS4568.1"
FT                   /note="weakly similar to uniprot|Q06201 Saccharomyces
FT                   cerevisiae YLR445w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62353"
FT                   /db_xref="GOA:Q6FK67"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK67"
FT                   /protein_id="CAG62353.2"
FT                   /translation="MGTKQSDTEVEGETIVKQDALTTKHPDVEFHPMLKQTIEMWCKSG
FT                   IRDTYDNKCFKRDVLSRISEITSIMSQIAEESNGGNSDKCRINDGVYRLDWESVYEVGA
FT                   SIMDQYSATVDELLADLDKLYRKQYLWQDSAVLLDSFKGATIIGRLEKWTKLKEAQLEY
FT                   KQNELVRSAGEIKRALKRLSTENVYGS"
FT   gene            complement(<84109..>85422)
FT                   /locus_tag="CAGL0M00748g"
FT                   /old_locus_tag="CAGL-IPF5441"
FT                   /old_locus_tag="CAGL-CDS2498.1"
FT   CDS_pept        complement(84109..85422)
FT                   /locus_tag="CAGL0M00748g"
FT                   /old_locus_tag="CAGL-IPF5441"
FT                   /old_locus_tag="CAGL-CDS2498.1"
FT                   /note="similar to uniprot|Q06200 Saccharomyces cerevisiae
FT                   YLR443w ECM7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62354"
FT                   /db_xref="GOA:Q6FK66"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK66"
FT                   /inference="similar to AA sequence:UniProtKB:Q06200"
FT                   /protein_id="CAG62354.1"
FT                   /translation="MLHVARLLMRPFTNLNSLEILVQWLRLISSGMVILLSGLVCLAPF
FT                   TFPKSMYMSKLDAFSADITQGLFDVLRLNMETASLTSINNGVGLTTSELVILTEYTAQQ
FT                   VRSSPQYIVVSLYGRCDCTFTTEQMMDSKGRLYQVQNSTTMCDCIDTGSDYIFDYREVL
FT                   SNLGLGIILDYAYSKDGSRMGLSTSYSKYINSLRSRKVTVTNLLYAIFVIELVKFCVTF
FT                   WYYYIKGRFLNIFLEQFLVHTLSIFSLTVFICGLTSVISLAWLNYTVQARIKSELQSFG
FT                   FSYHLGASWFTCLWMLAFFVSLSCFVWSGLEWCIAENYDPRTSDLKDGFLDRAEESQYE
FT                   NPFDDENVITGEDSNSASSRSGGKLSSSHTEDTGIHGSTSYNNMTRLDSSRIIKNFKNK
FT                   QFDDTEEQFELQSITLRSSTDSDSSIQRVIQPSSTMHF"
FT   gene            <86290..>89556
FT                   /locus_tag="CAGL0M00770g"
FT                   /old_locus_tag="CAGL-IPF5444"
FT                   /old_locus_tag="CAGL-CDS0339.1"
FT   CDS_pept        86290..89556
FT                   /locus_tag="CAGL0M00770g"
FT                   /old_locus_tag="CAGL-IPF5444"
FT                   /old_locus_tag="CAGL-CDS0339.1"
FT                   /note="weakly similar to uniprot|P06701 Saccharomyces
FT                   cerevisiae YLR442c SIR3 silencing regulatory and DNA-repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62355"
FT                   /db_xref="GOA:Q6FK65"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK65"
FT                   /protein_id="CAG62355.1"
FT                   /translation="MAELIKDLEGWQIIIKDQDGNVMDERDRKVRRKRNVSTDLFIFRE
FT                   KDALTFGRGQNVVVHDEVSDSYAVYLIHEIRQNTLNHALEILCFTYLRWFELEPRDYYK
FT                   EFKPEYLSMTNQQITEKFLEEIDRDEIYLTAEITPIWLKDFIDIAEVYNAKKWAQVRQS
FT                   VNKERNFLVRYVCEPVAENFVPVDIDNIMDQMRKRSARDFETMLKNLTVNGFVHSSSKK
FT                   RQKIKAEDTDNTVTKKNLLHNQKQKEPESHELKYQKVQLEDSPQPHHKKPQSRIDDHYS
FT                   VVSDMPHGRIVNTGVKPTTKKSSTSSQTQTDHTQKRKLQSDGGKSGPSNMKSTVGNGSS
FT                   NDNIQKKRKTEDSSKTPSNLHTTMTGVSRSTGVTSDAGKVVDKEIIKNPTSVPSQGGNR
FT                   TKGNDMSKKEPYSKAIAAANQLKAGRTNQKSNQTAKKPSTTSSNEREEKIPAYLSGRFQ
FT                   PSEVIDSVQSGTLNDLMTQVRKRGGVSEALKYKAKNHVDGTGQDLYATAKSFTSNLRRT
FT                   LLGSENSAQSQQQNASDIEKRKPYNVIDDFKNNSSAKILEHVKRGNTVSELLCHQPIDK
FT                   TPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKNSGSIFEKLRKCTTSESLI
FT                   QCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRNKSLYLTGDDEYTIKYVFNKVAHE
FT                   LLLSATFEEIPQFKLASVPSSYDNFYQGLWQNISGDILSDTEAAIALDSYFSVMQPVQR
FT                   FPILIYIENMDEFFNNSETIYKDLINWFLNPLSKITLICNGTVVNNEIGNPLKDIFLHV
FT                   NFPSVSEEQDCSVANISKVINQINSSYFYFNADLQAATFCEFYKHYTKNWQKINFRINE
FT                   PEVGISVKNIQNALTLKGFDSIINVHKHIYQCLRNVVNRYIDSTAKKTTVDIQANQLSV
FT                   SAGSANTHYDLMEPLYGRIMSSLAELTFVDKLVLFCTVLCRLRKSSVEKIDLNEVYNVI
FT                   VDVLHHNCDNSPMISNLLLTYSTIKNRNDKGSAIKLFLSSLMWLDVFTRLYRTGFVTLH
FT                   VDQEDRNQIKVALAGFEVDSILAELKRDSSMSWIQSCLTE"
FT   gene            complement(<90755..>91057)
FT                   /locus_tag="CAGL0M00792g"
FT                   /old_locus_tag="CAGL-IPF5448"
FT   CDS_pept        complement(90755..91057)
FT                   /locus_tag="CAGL0M00792g"
FT                   /old_locus_tag="CAGL-IPF5448"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62356"
FT                   /db_xref="GOA:Q6FK64"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK64"
FT                   /protein_id="CAG62356.1"
FT                   /translation="MSSQAFALCRKRFFHCLSQLRCTIFQNLTACGSVGPRRSSGNPGS
FT                   LPSWDGHCSQWLPQDHRWGPLPSEPKTMPRFEPNLSLTSAWPQPKLSPGSKVRLQ"
FT   gene            <91268..>92035
FT                   /locus_tag="CAGL0M00814g"
FT                   /old_locus_tag="CAGL-IPF5452"
FT                   /old_locus_tag="CAGL-CDS3962.1"
FT   CDS_pept        91268..92035
FT                   /locus_tag="CAGL0M00814g"
FT                   /old_locus_tag="CAGL-IPF5452"
FT                   /old_locus_tag="CAGL-CDS3962.1"
FT                   /note="highly similar to uniprot|P33442 Saccharomyces
FT                   cerevisiae YLR441c RP10A or uniprot|P23248 Saccharomyces
FT                   cerevisiae YML063w RP10B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62357"
FT                   /db_xref="GOA:Q6FK63"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK63"
FT                   /protein_id="CAG62357.1"
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVGK
FT                   TLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDDVQGKNLLTNFHGMD
FT                   FTADKLRSMVRKWQTLIEANVTVKTSDEYIIRVFAIAFTRKQSNQVKRTAYAQSSHIRA
FT                   IRKVISDILTREVSNSTLAQFTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLLKQPK
FT                   FDLGSLMALHGEGSAEEKGKKVSGFKDEVLETV"
FT   gene            <93206..>95191
FT                   /locus_tag="CAGL0M00836g"
FT                   /old_locus_tag="CAGL-IPF5453"
FT                   /old_locus_tag="CAGL-CDS1223.1"
FT   CDS_pept        93206..95191
FT                   /locus_tag="CAGL0M00836g"
FT                   /old_locus_tag="CAGL-IPF5453"
FT                   /old_locus_tag="CAGL-CDS1223.1"
FT                   /note="similar to uniprot|Q12745 Saccharomyces cerevisiae
FT                   YLR440c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62358"
FT                   /db_xref="GOA:Q6FK62"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK62"
FT                   /inference="similar to AA sequence:UniProtKB:Q12745"
FT                   /protein_id="CAG62358.1"
FT                   /translation="MIEKKLAILASVYCSKADIKQLKRIIPYFKNQKALIFQFVQALWP
FT                   ELQDPLDLKFLFDVDTFNGDEDHAANSLNDILVQCLEQDSSLIPLVETNPDVVLERYDQ
FT                   LIKYVTRDSQIDFNIPPSHSSWIKNRIIHCNNYDKNLILYYQPLWSQLELTSEFNEWVN
FT                   GVLLPLNNIPANNRIHIEELIKMDSAKRITFLLGCMPSSTSDLGFFSNIFLPMLRYYKE
FT                   TDLDYYTSHYVNPQTYKLENNNEITILSKIYEISGSVEVGAKVLGILYENGQNYFKSHP
FT                   NKFTDSELRVLLTKIGTEDSSLHLKLLDLIRDIDDLEHFNSFKTLFDIQEGTEAQQYDL
FT                   FTIYSRSFRIDNISELEKDFLFNKLSLRQKLEIIIESLIEKNNLSEVKKLLDEDPTPEN
FT                   NELLIKNFWKFFYRSENIHDEAFKIAETILSMIPSNFNGSAKRHQLEYLLKNSRDLSQH
FT                   SINLHPHGFKPNYLLNYKDEPMAIISNLLELNPKLYKMTDKTQDILSNLNSCFDKKTTE
FT                   VAKSKLLALHIDHALVNRDFMFAYQLCKEWFAICKDAGNDEGIGKQWLTIFQVGKFIDP
FT                   EWPDNEAPTEILILQMEILSELLQYSPIDQIEIIATQWSALEVELSIRDLSTDTSISND
FT                   SNSLQFIQNSLNEVSHTMAAFLGRNR"
FT   gene            complement(<95426..>96373)
FT                   /locus_tag="CAGL0M00858g"
FT                   /old_locus_tag="CAGL-IPF5454"
FT                   /old_locus_tag="CAGL-CDS3457.1"
FT   CDS_pept        complement(95426..96373)
FT                   /locus_tag="CAGL0M00858g"
FT                   /old_locus_tag="CAGL-IPF5454"
FT                   /old_locus_tag="CAGL-CDS3457.1"
FT                   /note="similar to uniprot|P36517 Saccharomyces cerevisiae
FT                   YLR439w MRPL4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62359"
FT                   /db_xref="GOA:Q6FK61"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="InterPro:IPR038340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK61"
FT                   /inference="similar to AA sequence:UniProtKB:P36517"
FT                   /protein_id="CAG62359.1"
FT                   /translation="MLRRQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHSN
FT                   ELRIQPPIPPSTKNIVVPDDHPLWQFFSDKKFMRRPEDLDTTSRAWSIPELRRKSFEDL
FT                   HSLWYTCLKERNILARENHLLKNAAKNNRNDYEDISEKIRTTMWRIRHVLSERDWAFKR
FT                   ARETFAQNKELQDNLVDDFKKEFLELDSSEDEQAFEMLTRFQEALFGIHEVIEDNVVDR
FT                   KFVDGLKLVATLKLQRFQSRNDSINAILEESDGQINDVGEAFVVFTADNNLKAVEEACD
FT                   AIKELRQGENGVSRFDELPTVRGYLKRLVSATTV"
FT   gene            <96799..>97056
FT                   /locus_tag="CAGL0M00874g"
FT                   /old_locus_tag="CAGL-IPF14426"
FT   CDS_pept        96799..97056
FT                   /locus_tag="CAGL0M00874g"
FT                   /old_locus_tag="CAGL-IPF14426"
FT                   /note="highly similar to uniprot|P57743 Saccharomyces
FT                   cerevisiae YLR438ca LSM3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58072"
FT                   /db_xref="GOA:B4UN56"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR040002"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN56"
FT                   /protein_id="CAR58072.1"
FT                   /translation="MSLSTPLDLLKLNLDERVYVKLRGARAMEGVLQAFDSHCNIVLSD
FT                   AVETIYELVDGELKSQERASEMIFVRGDSVTLITAVSEEE"
FT   gene            complement(<97304..>98599)
FT                   /locus_tag="CAGL0M00880g"
FT                   /old_locus_tag="CAGL-IPF5456"
FT                   /old_locus_tag="CAGL-CDS2553.1"
FT   CDS_pept        complement(97304..98599)
FT                   /locus_tag="CAGL0M00880g"
FT                   /old_locus_tag="CAGL-IPF5456"
FT                   /old_locus_tag="CAGL-CDS2553.1"
FT                   /note="highly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438w CAR2 ornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62360"
FT                   /db_xref="GOA:Q6FK60"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034758"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK60"
FT                   /protein_id="CAG62360.1"
FT                   /translation="MNFNISSKETVELEQKYSAHNYHPLPVVFHKASGAHVWDPEGKEY
FT                   LDFLSAYSAVNQGHCHPKIVKALVDQASTLTLSSRAFSNDVFAVFAKYVTEYFGYEMVL
FT                   PMNTGAEAVETALKLARRWGYEVKKIPDNEAIVLGAQGNFHGRTFGAISLSTDEEDSRK
FT                   HFGPFLTNTTAKNPSKGQAIRYGHIEDLEQAFESHGDKIAAVILEPIQGEAGIVVPPKG
FT                   YLLDVQNLCKKYNSLFICDEIQTGIGRTGKLLCFEHTEGVKPDVVLLGKAISGGVLPVS
FT                   CVLSSREIMSCFTPGSHGSTFGGNPMASRVAIAALDVIKEEKLVERAQKLGDLLQDELR
FT                   KLQAQSDGMISEVRGVGLLTAIVIDSQKAQGRTAWDLCLLMKDKGVLAKPTHDHIIRLA
FT                   PPLVISEEDLLKGVQAMKEALVELPSAPISGH"
FT   gene            <99946..>100296
FT                   /locus_tag="CAGL0M00902g"
FT                   /old_locus_tag="CAGL-IPF5457"
FT                   /old_locus_tag="CAGL-CDS5230.1"
FT   CDS_pept        99946..100296
FT                   /locus_tag="CAGL0M00902g"
FT                   /old_locus_tag="CAGL-IPF5457"
FT                   /old_locus_tag="CAGL-CDS5230.1"
FT                   /note="weakly similar to uniprot|O13577 Saccharomyces
FT                   cerevisiae YLR437c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62361"
FT                   /db_xref="GOA:Q6FK59"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK59"
FT                   /protein_id="CAG62361.1"
FT                   /translation="MDNKRHQTSIGSELSEAQNRLSTVGMRIRQRIDRGYAYSGKNVSG
FT                   MDDQVPIRDVASTIVPQFRTQVLYEQQQQPQQMHRPAMNGPAPMLVNQRTESSNLDCMQ
FT                   EEMLSNGKRRVF"
FT   gene            <102735..>106646
FT                   /locus_tag="CAGL0M00924g"
FT                   /old_locus_tag="CAGL-IPF5460"
FT                   /old_locus_tag="CAGL-CDS0191.1"
FT   CDS_pept        102735..106646
FT                   /locus_tag="CAGL0M00924g"
FT                   /old_locus_tag="CAGL-IPF5460"
FT                   /old_locus_tag="CAGL-CDS0191.1"
FT                   /note="similar to uniprot|Q06673 Saccharomyces cerevisiae
FT                   YLR436c ECM30 involved in cell wall biogenesis and
FT                   architecture"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62362"
FT                   /db_xref="GOA:Q6FK58"
FT                   /db_xref="InterPro:IPR026705"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK58"
FT                   /inference="similar to AA sequence:UniProtKB:Q06673"
FT                   /protein_id="CAG62362.1"
FT                   /translation="MGNTDSKLNSLYKEHLLKLARPEITSIDNSQNGVICLFNPEYSLR
FT                   EIIDLYNNRGNITPDKSLKHTSDNHSTSIEDNLFTDYYKNFLKFDFQKIDNFNDLISKD
FT                   ELRTIYKNNKENYLNLIRFVILKIILIPSIFGNTQNKSSFNKLFKQLLTCIKILTKLVP
FT                   VYLENIVNGEKDILWDTSPDALFGEHIPDTDLIPVSMTSALKTSLDMPTADLASPHMER
FT                   PLGAALLDSCLNLLFIEDFTVSSSSDTSQKTGDLTMILWENGINTYDTSYYTQFVHLDA
FT                   NRLQIIELLLALVSIDIYLPVNSDGFKAKDKIKNKYLDYMKYEAREHSVICLTASIINL
FT                   FCRHSAYYKQEGTNPYKIIPKENSRENPKYSNRNSFDTNPGSSNNINSQWLPELRSKLV
FT                   ISSLQFLNVMICPEESNTKVTKKRMVNTAVSYLATLQREFDLKLILTSVIRIFKLPIDA
FT                   AIDEDSNLFTFPTASSRKKHQNLSNHSRTSSSSNIKRSTSNSSATSRYDSNPNTVTGSP
FT                   KLANMRENNTSSYSSLPPLPPILCQSLVFLINVIKINKLVKNQFADKFASKFVVFAVYY
FT                   LKYYNDNPEYSLTVIPVINMLALYLTSKPLVLLKMLDPFNSNYYTNKIPNAFKLTSGNI
FT                   NNLTYRDFTVIQLCNIADYEVKNNIQPNPIIYETLYNLIPIDPKWLASDTSGADDEELT
FT                   LLSRKKSINSSGNGLKSCERLSYNASLAVLHLISKMSSRNYLTTYSTPRIASMVTSIPA
FT                   YVLSPGFKLDLLAILLRAVSLYVVSNTDEAMNLIFAFARHKSVILQLSEVMNSIAKNFS
FT                   PTNTQISTTDKNIRLRDFYRLHDLSYNNINFRKAFNNDEGFHRSSSPNLIKSNNGKNND
FT                   NNDSDNDSMDMNSSAYLVLTKPIAREYSSDDLRNNNLTTREHAGSNNNNNINSSNDKTL
FT                   QVLEYVDFINDPIISLANESDYFKMRPKWPVGISMKSKVKSSMKKDFVRSWQGNDSMVL
FT                   LVKIVKVLLYDFPEIATINNSEYYVLLKKMEESKDHFLSMIKDNIPIYMRTGSSIQHQK
FT                   LSIDDESKFSTIWFYTLCWSDIFNTHSSPYNKSLINELEEVEETNDIIPTISNNGSNIF
FT                   ADPGSPVLERWNSNSSNLSRTNSNSSSLMGYFFQQPQSASSNRSSVDHTSRFIESKNAS
FT                   APTKKASAPQNSSFSLFKFSWTGFNKNGNSDDCDVIKEEEETTVSQTSTRNGVNQQIFV
FT                   SALDMSLLKSNIWVDTKVRMFIVEREEKEEFSLLDMTSTFFKKLKFNNSAAMSNWESNN
FT                   IPGSTPLASVPFAARNPMF"
FT   gene            complement(<106985..>107617)
FT                   /locus_tag="CAGL0M00946g"
FT                   /old_locus_tag="CAGL-IPF5461"
FT                   /old_locus_tag="CAGL-CDS4360.1"
FT   CDS_pept        complement(106985..107617)
FT                   /locus_tag="CAGL0M00946g"
FT                   /old_locus_tag="CAGL-IPF5461"
FT                   /old_locus_tag="CAGL-CDS4360.1"
FT                   /note="similar to uniprot|Q06672 Saccharomyces cerevisiae
FT                   YLR435w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62363"
FT                   /db_xref="GOA:Q6FK57"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK57"
FT                   /inference="similar to AA sequence:UniProtKB:Q06672"
FT                   /protein_id="CAG62363.1"
FT                   /translation="MEFDETVYVEAPQGQGNLMFSDEKQQARFELGCSMMVYKWDALDI
FT                   AVDNQWGGPESAEKRDWITGIIVDLFKNEKIVDAALLEETLLYAMVDEFDTNVEDDSAL
FT                   PIATGIIQVYKDCAAQNYQIVEQLYLEWQSKEKNKPQRVIKVTGDDESSSDEDDEDEEY
FT                   MNGATGEDTHMHYEEIDVDMENDKSRSEPIVDDDGFELVQKKGKRRN"
FT   gene            <107989..>109311
FT                   /locus_tag="CAGL0M00968g"
FT                   /old_locus_tag="CAGL-IPF5462"
FT                   /old_locus_tag="CAGL-CDS2474.1"
FT   CDS_pept        107989..109311
FT                   /locus_tag="CAGL0M00968g"
FT                   /old_locus_tag="CAGL-IPF5462"
FT                   /old_locus_tag="CAGL-CDS2474.1"
FT                   /note="similar to uniprot|Q06671 Saccharomyces cerevisiae
FT                   YLR431c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62364"
FT                   /db_xref="GOA:Q6FK56"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK56"
FT                   /inference="similar to AA sequence:UniProtKB:Q06671"
FT                   /protein_id="CAG62364.1"
FT                   /translation="MLNDILVEVAEKTQLLESLIIPHERALTESDYSDQLENIRAEISA
FT                   TLNSLSNLNDLLISHDGPLRTEISSLMASKSKLKKINMKELTLLNEQETLETLRNDSSN
FT                   LESSRPGFTTQQQQSITIASSYRHELQKYLDLVDVEKTSLNTNKLADNSKISKEDVENS
FT                   DFNFNLKRYEKQQSILHSALTVNEIEIKKLETLLKEFRKDNNFIRDELKLINSNLKSHE
FT                   DLISDELKQIDESRYAIMQSIGYSGRNEQQSSILDSIVKLSIKKPDIRTLIQERIEEYS
FT                   NLLNFIDMKLNGLDQMLQEYKSRKSEWAEKSILWSQCLALISELEVTVRDQLSSAHTVG
FT                   SEISPDQIKAQIKKFLTKLNKLLDESDLEDVVYSLVRNEVNSLNVALDEMNQMPQIKND
FT                   ISDRESIHNPSFKLISKSPPKTGFSSENVSYKLNNTNIKKD"
FT   gene            complement(<109609..>115548)
FT                   /locus_tag="CAGL0M00990g"
FT                   /old_locus_tag="CAGL-IPF5466"
FT                   /old_locus_tag="CAGL-CDS0037.1"
FT   CDS_pept        complement(109609..115548)
FT                   /locus_tag="CAGL0M00990g"
FT                   /old_locus_tag="CAGL-IPF5466"
FT                   /old_locus_tag="CAGL-CDS0037.1"
FT                   /note="similar to uniprot|Q00416 Saccharomyces cerevisiae
FT                   YLR430w SEN1 positive effector of tRNA-splicing
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62365"
FT                   /db_xref="GOA:Q6FK55"
FT                   /db_xref="InterPro:IPR024481"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK55"
FT                   /inference="similar to AA sequence:UniProtKB:Q00416"
FT                   /protein_id="CAG62365.1"
FT                   /translation="MSLPIAQLYEKAGQFVPLIEKVYNGSNVGISESKLLGDVLHFIAE
FT                   LKDQHIFCDPQFEPIAVFCLTIFSFNDQSTIDWLKSRFNSILASCNKCVLAFARGKSRM
FT                   LRHFAIQRNVPHEHVAKFNNLICSWRLDTIRVPIEKLSNLPIGSQVENDFSCAFYECMT
FT                   DPNLMRMDRAFRALFDKSFSVLLSSQDSLLNGKTPNDGDILLAGTIFCWCEGNKDENDW
FT                   ARKVLRNLIQSKTTFNMKTIGDDVLDEIQTHFLFLQNPGNWNEVIVSQFWTRFIPIFTM
FT                   LDREIIEEYFGIPKNQESLKRSFKYPIESLVKLWCNHMTKLYSDKPVDFLLRALHMFLD
FT                   KLGQDFWQLIEPYTFHSILDSLFEQPVFLARLMRLQKEPIIENREELIFSFSGSLTDLL
FT                   AWTLPFYNALSPSKRIQMVKKVSISFLKIVAHQPNLESISKACLVTSSCTLLSSVLFIT
FT                   DDERAKLYSVNDFENVLLTKVDSRLLLDNSLIQNVLLKSITEPASFYPGLGNSATSVAA
FT                   STMGVLTTCIDFDLLTLCQRTYKLYFGTAVNEFPLPLSLLENMVGSIQLGSFHNGPLLT
FT                   KLLLTSLKNVYGIVIITKSNLNTTQHNKTVENVWNLVINLVENFNDLLPNQLMEILGDK
FT                   DAMVGFWSCIFSSNEKLYQAATNILYNTFDVDGRLEGVQALFKQNVSSHLNSINFILSK
FT                   LIKCEYFELCPRTVKVLMDIISAFIDPTNGVLSNPEISNSSETKDEMFSFWNLVWSFLD
FT                   SIYRCTLKWATKYNYSLLENFTKDTLDLSNALVGSFREFKDVLGENVNLFHVVLKAFKN
FT                   MLYWLRLSDEILLESCVKLITSTSDLAQERKMKFDDELVELMAKYGSKYRKFSNKLSLQ
FT                   QSNEIISRAQTLNPTLTSKIMDEASAYNKMKEQAKQTIVISDSEETGTGKSPAELKSEY
FT                   LQRKALGLAAHTKSKVTQSKITSFGTVQAGAALSLKTKPQPKPLSKMEMARRQLLQNRV
FT                   IHPPSQPAFHTKAPSKSQTAEDDTSSDESDIDMETARELFAVAKSKSKGIETLDISGKP
FT                   IKINSAAERAKMEEEYMRKRLNVDLNPLYEQLLQWDYTKISEYPDDKGADAYRDIKDEF
FT                   KSANDYKNVMKPLLLLESWQGMCSARDRDENTPFSIVIGNRTSISDFYEIYASISKKML
FT                   QDSNITESDLIVLAYFPNIAPGQKVRYEEFKKAQFTCLAKVKTLKKTKGGNVDMSLRVH
FT                   RNHSFAKYLTHRAEINAVKVMQMTTIEREYSTLEALQYYDLVNQILSAKLSPPSNTFEQ
FT                   QIMKVQQEYFLNESQARAIVNTVISSGFSLIQGPPGTGKTKTILGIVGYFLSLRNATPT
FT                   GTIQAPTDKKSTTLDQMLKKPKILICAPSNAAVDEICLRLKSGIKTKGQTVRPAIIRLG
FT                   RTDVVNAELKDVTLEEIVDKKLGDKSYEFTNNPDIEKKFQSLLSERRQLRDKLNAENGS
FT                   PDSSMSTNDIANLQMKIRELTKSINELGREKDEMREKNAINYRNRDLDRRNAQAQVLAS
FT                   CDIICSTLSGSAHDVLATLGMKFETVVIDEACQCTELSAIIPLRYGSKRCIMVGDPNQL
FT                   PPTVLSGAASNFKYNQSLFVRMEKNSKPFLLDVQYRMHPAISKFPSAEFYDGRLMDGPD
FT                   MESLNKRIWHEQEPFKPYKFFDITSGQQVQNVKTMSYTNKEEIEVAIEMVDKLFRLYDN
FT                   KIDFSNKIGVISPYKEQIQRMRREFMRYFGGSITKFVDFNTIDGFQGQEKEIIIISCVR
FT                   ADDSQSGVGFLKDFRRMNVALTRARTSIWILGHQKSLRKSKLWSHLIDDAEGRGCLQQA
FT                   YSGFLNSSNSRAQDTLNKYKESKSKEKKKHPIPAAADKKDADISNRNISEATDISDGED
FT                   DYDPVTAFKPIEKIAIKRRADNQDKSPFIEKKRIKKPKIQANDENPSGTKKKSSIFGSK
FT                   ENNQVPSKPAVPYIKDKASKKDKKEDKKKSKKSRHISFSDSIETIP"
FT   gene            <116503..>116605
FT                   /gene="tRNA-Ser (GCT)"
FT                   /locus_tag="CAGL0M01012r"
FT   tRNA            join(116503..116540,116560..116605)
FT                   /gene="tRNA-Ser (GCT)"
FT                   /locus_tag="CAGL0M01012r"
FT                   /product="transfer RNA-Ser"
FT   gene            <117010..>117579
FT                   /locus_tag="CAGL0M01056g"
FT                   /old_locus_tag="CAGL-IPF5467"
FT                   /old_locus_tag="CAGL-CDS4535.1"
FT   CDS_pept        117010..117579
FT                   /locus_tag="CAGL0M01056g"
FT                   /old_locus_tag="CAGL-IPF5467"
FT                   /old_locus_tag="CAGL-CDS4535.1"
FT                   /note="highly similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62366"
FT                   /db_xref="GOA:F2Z5Y9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z5Y9"
FT                   /protein_id="CAG62366.1"
FT                   /translation="MGKAKKTRKFALVKRTLNAKKDQRLKGNQEKQKSQEDPELTRNIP
FT                   QVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIA
FT                   ELEKLGPKYRIALKLARDPRIKRLTCTHKGTYADDCIVNRVLQHKCYIVATNDAGLKQR
FT                   VRKIPGIPLMSVGGHAYVIEKLPDVF"
FT   gene            <118018..>120105
FT                   /locus_tag="CAGL0M01078g"
FT                   /old_locus_tag="CAGL-IPF5470"
FT                   /old_locus_tag="CAGL-CDS1109.1"
FT   CDS_pept        118018..120105
FT                   /locus_tag="CAGL0M01078g"
FT                   /old_locus_tag="CAGL-IPF5470"
FT                   /old_locus_tag="CAGL-CDS1109.1"
FT                   /note="highly similar to uniprot|Q05497 Saccharomyces
FT                   cerevisiae YDR338c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62367"
FT                   /db_xref="GOA:Q6FK53"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK53"
FT                   /protein_id="CAG62367.1"
FT                   /translation="MVGILSKTLSEVHPTLLTNGMGITNTHRRISLGFFPPNRKNPLVR
FT                   KYRRKRANLNTNDQRSFQSLVDDFGSSVHEPSQFLNYINEDEEDLYYNDIEEGGELSRT
FT                   VSLPSLVSETPDLSPPDTDWIIQEHERRYSSVYNSDNENDLADEPVSIGGSMTNRELEY
FT                   DEFMNRIKAQKQVYDSIASHKYRRRPSLISVSSRGTVPTIYQEINGTDGADVCLPEKIT
FT                   FREEAKVLSSFSFPLIFTFLLEQIFPMVCSLTVGHLGKNQLAAVSLASMTSNITLAVFE
FT                   GIATSLDTLCPQAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFLVVPEKE
FT                   LIALTSQFLRVLIFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFVSYTLVWN
FT                   KYIGIGFIGSAVAVVINFWLMFILLLLYTIYIDGKKCWGGFSKKAFTHWKDLGHLAFSG
FT                   IIMLEAEELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISASTRIANFIG
FT                   AKRVDLAHNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDLMTGLLRLVAV
FT                   VQIFDSLNAVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGWVFNMKLYGLWIGIG
FT                   CAMLLIGLIEAYNVLYPNWDYILNYAEILKETEEDDDDDSYFTDSDDNDEEPTERSPLL
FT                   D"
FT   gene            complement(<120294..>121178)
FT                   /locus_tag="CAGL0M01100g"
FT                   /old_locus_tag="CAGL-IPF5471"
FT                   /old_locus_tag="CAGL-CDS3656.1"
FT   CDS_pept        complement(120294..121178)
FT                   /locus_tag="CAGL0M01100g"
FT                   /old_locus_tag="CAGL-IPF5471"
FT                   /old_locus_tag="CAGL-CDS3656.1"
FT                   /note="similar to uniprot|P21771 Saccharomyces cerevisiae
FT                   YDR337w MRPS28"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62368"
FT                   /db_xref="GOA:Q6FK52"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK52"
FT                   /inference="similar to AA sequence:UniProtKB:P21771"
FT                   /protein_id="CAG62368.1"
FT                   /translation="MVFARTLIRNIEGVGLKVNPLRYYHATPVTQGAKAVKFLKAQKRR
FT                   QKNEARQASIKSQSEMVDPVLGRKDTPFINRINAEIKEPTVLSSDYNYDEVEKFLVSVE
FT                   ATKQEHRDLSPLNPEFATTETTESLSLRHEALFRILNIRNANRKDTMQIAIRLAREEFQ
FT                   RFPGDTGSSEVQAACLTVRIQNLANHIKNHKKDYANTRMLRMLVQQRQSLLRYLKRDNP
FT                   ERYYWTIEKLGLNDAAITQEFNLDRRYMQDFKFFGDKILVKESKKVAQQIRKDERKQKK
FT                   ASSSSTVEQQPVL"
FT   gene            complement(<121796..>122782)
FT                   /locus_tag="CAGL0M01122g"
FT                   /old_locus_tag="CAGL-IPF5472"
FT                   /old_locus_tag="CAGL-CDS3337.1"
FT   CDS_pept        complement(121796..122782)
FT                   /locus_tag="CAGL0M01122g"
FT                   /old_locus_tag="CAGL-IPF5472"
FT                   /old_locus_tag="CAGL-CDS3337.1"
FT                   /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
FT                   YDR336w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62369"
FT                   /db_xref="GOA:Q6FK51"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK51"
FT                   /inference="similar to AA sequence:UniProtKB:Q05473"
FT                   /protein_id="CAG62369.1"
FT                   /translation="MSSGKISGRNAINIVKNVKVKPTSDSLISGSNKVNVKRSGLLSKP
FT                   HKKHASSDKSHSWINLNKYMNNSYAYPSASQLNAINHFFNRAECKYEWSVADFGNIPSE
FT                   QMKSVYGHNSGMNHEGGKLYNGKTRYPFQLLNPLPEIAFLGKTNVGKSTILNNLITSFK
FT                   QKDLDVHARMSNRAGFTKTLNCYNVGNKFRIIDTPGYGFHSAIEQGNVTLDYLSNRKEL
FT                   KRCFLLISAKKEISEHDRYLMDLMTESGIPFELIFSKMDKVTDVDEFVQWIDSSGLRNL
FT                   PTLPKLIFTNSMVSKFIKKRYGVDLLRYSIFEACNLDSSVKPERIKY"
FT   gene            complement(<123429..>127094)
FT                   /locus_tag="CAGL0M01144g"
FT                   /old_locus_tag="CAGL-IPF5473"
FT                   /old_locus_tag="CAGL-CDS0225.1"
FT   CDS_pept        complement(123429..127094)
FT                   /locus_tag="CAGL0M01144g"
FT                   /old_locus_tag="CAGL-IPF5473"
FT                   /old_locus_tag="CAGL-CDS0225.1"
FT                   /note="highly similar to uniprot|P52918 Saccharomyces
FT                   cerevisiae YDR335w MSN5 multicopy supressor of SNF1
FT                   mutation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62370"
FT                   /db_xref="GOA:Q6FK50"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040018"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK50"
FT                   /protein_id="CAG62370.1"
FT                   /translation="MNVGANQVVEALNVIYSPKSNNGQRLEAQKFLDSVRTLEESPLWG
FT                   FEIALNNSDNNILKYFGLNLLEYNIKKNWNSYNNEKRQQLKKWIIELNYNVSTVDTRYI
FT                   KEKLASLWVEIAKRIWGEALKETNPSNDQLLDSWVDLDRDLHQLWNINESSREVTLIIF
FT                   RILFEDVFLLDDMTVLKRMTIIQPLCVMIVCPMDIFITKYKFSEKWTLFKADSDGWFSI
FT                   WIPELRTALLNKNSEYIIRLLETLKTCLNWPLSEVIIKNDILTTLLDCLATDIRKAQSM
FT                   ALDSIHILLTRPYGNDEHYQTIIDKVFDSMDLLARVYEDLLFNPEEEVDETRYPIVKKF
FT                   VDMTSCLYVSIPKIKDTNNQIEKYFKLVMQTTYNPSLIVSGLTLDLWCSCLRNDDYIPL
FT                   IQKYAIKDLLNFAADALVYYEQIDGHISRNYVDIDFQSNSEFQSYCSTYRKRIRDIIRL
FT                   ISCVEIDMTYEWLNNRLNVYFSSPAGQQVLTSSFLDHKSEPYLGALSQYMIVECFINGC
FT                   IRWKIWYPSGPDYNQKLDSILQKLEILSNQLIALNMKEPLLLKKQIQNFALFLTMLRDN
FT                   VLFTLLEKIITSATMDYPEVNLDDRSEQSDAVRDLRYACGIELNRMALLMPESLKSIYP
FT                   DLEAVIAKIMPNLSYHEKISFKSFLLIIVLKSSLDNKEQRFSELVDVELMAWSEKTTEV
FT                   GLSDLHWFMERLGIVQIAEYFQKRGINENSDLLTIPIDDEGRALKAELTKRWQTLFPVR
FT                   ATRMFIHYSMQSIKGDEEFKRLQDLWRPRIIPVLPYILRLLFQLQSYHDAENWKNLPVI
FT                   VQTFVKCTTVERFWEAGASSKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLVL
FT                   SAISSLGSIFFELDDVPDMLINSIAIFKPGNNEISPGVSTHGWKHILNIAIRPMLKNCP
FT                   DDCAPKFMSAFLPKLFEMLDHLLYQRWSVRMDVMDVNPAPVDNDQMTEDILEENLLRQL
FT                   TTVVVRIVIDCVGQASVSSQSARSNLTSHQLRMRKIIFNDINILAPFLKLVNHLMAYKD
FT                   NKCSFNSILVMKGCINEVAAKDETVDVFFTTELMKNLLINVLCNSAFKDFFNEALYVFT
FT                   TLFLTLCKESTSARQFFYELSGGYDIDSLHSNLKKVDDYKSQRALMVEFIDWTKMTLGK
FT                   DDFDEEQAMQENRKQEKREAILQKANERLIKKNKESGDMLDDPNTEDGAVGNLFS"
FT   gene            <131016..>131990
FT                   /locus_tag="CAGL0M01166g"
FT                   /old_locus_tag="CAGL-IPF11688"
FT   CDS_pept        131016..131990
FT                   /locus_tag="CAGL0M01166g"
FT                   /old_locus_tag="CAGL-IPF11688"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144w THI4 involved in thiamine biosynthesis
FT                   and DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62371"
FT                   /db_xref="GOA:Q6FK49"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK49"
FT                   /protein_id="CAG62371.1"
FT                   /translation="MSATATTTTTSQLQLNSTSIEHALSDVVKTDDWSDFQFRPIREST
FT                   VSRAMTSRYFKDLDKFAVSDVVIIGCGSSGLSAAYVIAKNRPDLKIAILEANVAPGGGA
FT                   WLGGQLFSAMIMRKPADLFLKELEIPYEDEGDYVVVKHAALFTSTVLSKVLQFPNVKLF
FT                   NATAVEDLVTRPAGPNGEVSVAGVVTNWTLVTMAHDLQSCMDPNVIELSGYKEDGTRDP
FT                   SKKHGVVLSTTGHDGPFGAFSAKRIVSIDKNKKLAGMKGLDMNNAEAGVVKNSGSYNGV
FT                   GSMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAGEEILKHFAE"
FT   gene            complement(<132330..>136682)
FT                   /locus_tag="CAGL0M01188g"
FT                   /old_locus_tag="CAGL-IPF9576"
FT                   /old_locus_tag="CAGL-CDS0126.1"
FT   CDS_pept        complement(132330..136682)
FT                   /locus_tag="CAGL0M01188g"
FT                   /old_locus_tag="CAGL-IPF9576"
FT                   /old_locus_tag="CAGL-CDS0126.1"
FT                   /note="similar to uniprot|Q05471 Saccharomyces cerevisiae
FT                   YDR334w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62372"
FT                   /db_xref="GOA:Q6FK48"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK48"
FT                   /inference="similar to AA sequence:UniProtKB:Q05471"
FT                   /protein_id="CAG62372.1"
FT                   /translation="MSKNNKLNGKDNRQSKIEKLSELKLRHDQLTNELYHLHEYISLVE
FT                   YDPFYIPNSENYERLLEEKDVTWGSIFQEKKQLHNESSGKKVRRSVRHLRDSGSSTINE
FT                   LDTMSENDINLLKEVDILAKQKLQDLKLQFSNSHIKKKGNTKRAKIVKQVPNHQDKSES
FT                   PQISERDVKTVVKDLKPNHRGSEIKPEIMESSDVKNEIENCDFNEKQLKLYKDDDIASE
FT                   SDFYFTTSSEDELPNKRRGTIKRRKRINLYVNPPKAVITNPDNIANSHYPTLHEYLDSF
FT                   KILEDDMTNEEYNTFIKEQQRFAKMIKKGIETGALKYDPVTETVQPSARKVPNMFSHAK
FT                   VDPIQYMYKEQNLHIHQEHLINQGLFSSKLVQNRKKQRIAGAKKIAQMIEQHFKHIAGA
FT                   EDRRLKENEKQRKAIARNIIQSVKKRWNLAEKAYRILKKDEEEQLKRIQGKEHLSKMLE
FT                   KSSKLLGAQLKQHPNEDDIENSTSDDFSSTGDSDNLSSSSDEESDDEINDLSEDQKNNI
FT                   NELKTSSTSAFSSPEISSPSKNPDLGLNSLLTNDFENESNSSDTNEEFIMGDSDTSHSD
FT                   DENLTDDSEDSNDGEHDTTSDNEKSDLFPADTTNDPLAVQDVPTPSLLRGTLRTYQKQG
FT                   LNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWGPHLIVVPTSVLLNWEM
FT                   EFKRFAPGFKVLTYYGNPQQRKEKRKGWNKPDAFHVCIVSYQLIVQDQHSFKRKKWQYM
FT                   VLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDGQK
FT                   VSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVEK
FT                   QIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPDL
FT                   FEVRPIKTSFLFGESVIARYSERANSITRRIHFHDKDTLVDLQNINLQFTNNDLEKTSY
FT                   HTNTINKLACINEFVEEVQKLRKQNAEEERQKSRHLKINTQNISNFYEEFMQQKLDEQE
FT                   NKINFIGYLNSQRCSRKTVYGMNLIRLLEMPHVSNNCIDDPNYDDLIKPLQTRLLDGRT
FT                   TIEKFAVLTPGAVTSNIGELTLGMDEFVTPNSKSGIIPYEELVQLDNPFHQVQTKLTIA
FT                   FPDKSLLQYDCGKLQKLAILLQQLKDGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLD
FT                   GATKIEDRQILTERFNSDPKITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQ
FT                   DRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEFTTDYFSKLSVKD
FT                   LFGSDVVGDLPVIDTKPLLGSDSEAIKDPKKLEKLLAQAEDEDDVKAANSALREVNVDD
FT                   EDFDESSTNKTGGNILNGDDIDEDVDEYEGTNHVEEYMLRFIANGFYF"
FT   gene            complement(<137725..>138729)
FT                   /locus_tag="CAGL0M01210g"
FT                   /old_locus_tag="CAGL-IPF9575"
FT                   /old_locus_tag="CAGL-CDS3299.1"
FT   CDS_pept        complement(137725..138729)
FT                   /locus_tag="CAGL0M01210g"
FT                   /old_locus_tag="CAGL-IPF9575"
FT                   /old_locus_tag="CAGL-CDS3299.1"
FT                   /note="similar to uniprot|P38803 Saccharomyces cerevisiae
FT                   YHR085w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62373"
FT                   /db_xref="GOA:Q6FK47"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024679"
FT                   /db_xref="InterPro:IPR037947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK47"
FT                   /inference="similar to AA sequence:UniProtKB:P38803"
FT                   /protein_id="CAG62373.1"
FT                   /translation="MTKSKKQKQKKKDFLKKKLKVGKPTGKPSNSTDTSFTARTLSVRS
FT                   QLVNNAGDDLRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLICDD
FT                   SKDVREQLLELFDEVGKHDEQVLKLHCRSLVLYINMGMTHILPRVQADSTKFLGCLLKY
FT                   CGQEFCDQAWNKLMAGIFRVLSWETQHSKNSNQAAGAMQTSKRDNKFQAAHLSTLYALL
FT                   ECGCKEPTVETTDEDTTSNIQNFEEVQYMTPSFPQAYGYLKLFDKQLKSSSSNKDNSSV
FT                   SSSDALDVESRIRNVENVYLPTMKKQIEQIIQEGGEAGKNANNIKKLISEIFS"
FT   gene            <139130..>141289
FT                   /locus_tag="CAGL0M01232g"
FT                   /old_locus_tag="CAGL-IPF9105"
FT                   /old_locus_tag="CAGL-CDS1030.1"
FT   CDS_pept        139130..141289
FT                   /locus_tag="CAGL0M01232g"
FT                   /old_locus_tag="CAGL-IPF9105"
FT                   /old_locus_tag="CAGL-CDS1030.1"
FT                   /note="similar to uniprot|Q05468 Saccharomyces cerevisiae
FT                   YDR333c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62374"
FT                   /db_xref="GOA:Q6FK46"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK46"
FT                   /inference="similar to AA sequence:UniProtKB:Q05468"
FT                   /protein_id="CAG62374.1"
FT                   /translation="MSSRALRKQQNDAELLESILNSNATTKRTTQQQKPKANMATTNIF
FT                   SLMDDYNSDDSEDVKDDAEEFELHKDVADEENEAIAAPKIQLASKKSRKKANKGRKNKK
FT                   KDNKPVNEPQSDTKDDIGNDEELDKIIREFQKSYINTTNLHHDDDIDGDEFVTASESES
FT                   YDEGTRSSTKKTSNHNLFTDPGFSNFNIRGLKACERFFNTDIRKLDPHTEYKLLFDDIS
FT                   AKSLEDIDSVSSVSISPQQLKQIQRLKRMVKNWGGRDRRTVPNGPGNSPHRLRLTKVRD
FT                   DWIPTQRGEFKMALMTKSEVMDWQLWMSPLDWKDVVEERVGSLHKFISFYKFESVTPDI
FT                   TRKSLSEFYVSVILHPDHEALISLISSRYPYLVPGLLQVALIAIRQGDRSNTNGLLQRA
FT                   LFVFDRALKTTVQFDGVKCQLPYIYFMNRQFYLTIFRYIQALGQRGAVGTASEWTKVLW
FT                   SLSPLEDPLGCRYFIDHYLLLNEEYQYIIDVAKSPLFTTYKQWYTLGFSLAVTLSLIRL
FT                   GKLKEARQEIEKNAKINTACLMTLFLEHLKGDVSQVQTTIEPTERDILEFKSYVTRFQH
FT                   HWKSTEEVNFLHDELSRIFTNSIDLDSDLDNAATNDDVESPFYIDGIPVNLLRFAILSE
FT                   ESSLMAAIPKRIWSNYEIYEFDVLPPIPTTKESRDVIENIKSLINESELISSQAEALQN
FT                   EEILRRIQQLSLQEYMEGNPQELDI"
FT   gene            complement(<141519..>143315)
FT                   /locus_tag="CAGL0M01254g"
FT                   /old_locus_tag="CAGL-IPF9106"
FT                   /old_locus_tag="CAGL-CDS1517.1"
FT   CDS_pept        complement(141519..143315)
FT                   /locus_tag="CAGL0M01254g"
FT                   /old_locus_tag="CAGL-IPF9106"
FT                   /old_locus_tag="CAGL-CDS1517.1"
FT                   /note="similar to uniprot|P13574 Saccharomyces cerevisiae
FT                   YHR084w STE12 transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62375"
FT                   /db_xref="GOA:Q6FK45"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK45"
FT                   /inference="similar to AA sequence:UniProtKB:P13574"
FT                   /protein_id="CAG62375.1"
FT                   /translation="MSPFIKGRQRRTEEILKGDLKHHNDDGLVKSVIDDLEDAISAIED
FT                   LKFFLATAPLNWHENQVIRRYYLNNSQGFISCVFWNSLYYMTGTDIVKACMYRMEKFGR
FT                   KVIERKKFEEGLFSDLRNLKCGLDATLEQPKSKFLKFLFRNLCLKTQKKQKVFFWFSIP
FT                   HDKLFADALERDLKREFNGQNPTTIAIQEPALSFNYDQDSKLSLQEQLSRHISTKKCNT
FT                   ITKSGDKDISKNKITNAVVDNQNEEQKEANDISSLEEVSNSVNIGDPLSRSNHSSSYAY
FT                   SKFQSCNTSHAQSAISSPLSPTNNLPASMDTDYSSDLKELTSDSPNFDNDDNFMNIKIE
FT                   YPDENISNGFLATSLNPDQSFLYYDDRNMEIDKNSSIDTNKIVTAQFSPFLVSASLDPQ
FT                   YLLPHVQRTPFQDIKSAAKDGAFTTQKINPSVGNNLHFPYPEVTSPGLVDSITLSELLD
FT                   ENCNNASFELNNERVKISSQELSIWNMLPHNSTSHMTPVFHSLLSAGIKGTHLPAYSPF
FT                   LTTTPWGSLSSPFSSAKSNKSSQRRQSQFDTRTLGKRRKTKTCSKYSSPNGIARNTKPN
FT                   KVLKNSINKMIDTLRSNTKNVS"
FT   gene            complement(<144593..>146641)
FT                   /locus_tag="CAGL0M01276g"
FT                   /old_locus_tag="CAGL-IPF9108"
FT                   /old_locus_tag="CAGL-CDS1150.1"
FT   CDS_pept        complement(144593..146641)
FT                   /locus_tag="CAGL0M01276g"
FT                   /old_locus_tag="CAGL-IPF9108"
FT                   /old_locus_tag="CAGL-CDS1150.1"
FT                   /note="similar to uniprot|Q06683 Saccharomyces cerevisiae
FT                   YDR332w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62376"
FT                   /db_xref="GOA:Q6FK44"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK44"
FT                   /inference="similar to AA sequence:UniProtKB:Q06683"
FT                   /protein_id="CAG62376.1"
FT                   /translation="MLRILKQSFRNNAPSLKWYSTTATPILRDYQNDAIKSCLDAIALG
FT                   KKRIGVSLATGGGKTVIFSSLINLLRQRNRGNACRFRTLILVHRRELAEQAVRTTSRIN
FT                   EDLNIQLEMGNQNCDVSNSDVIVASVQSIIRRLHKYREGDIDLIIIDEAHHAAADSYKK
FT                   VLKHFRCDTANTRIPVIGFSATFERYDKKSLKESFDELVYHRGIIEMIDDNWLCESKFT
FT                   TVRLEVDLSKIPTSTLTSDFQTGALSRLLNTQTVNSIIYNSYLEKRKENNIKSSLLFGV
FT                   DINHIECLERYFNERGIKAKAVSSKTSVEDRQKAIRDIKSGELEVLLNCGIFTEGTDIP
FT                   NIDCILLCRPTKSRTLLVQMIGRGLRLHHSKEYCHIIDFVGSTKAGVVSVPSLLGIESC
FT                   EDTFDNATLEELRKIKLEEETRMAEYQQMQTQAELQKRAHEEMLRNQLNKMEQTLLEVS
FT                   HGDALDLNLISYANFKEYHEKLQAGIAVDLNKINQIEEELSFIHKSKYAWVRITKNCWA
FT                   FDLSNGHHIRLYRSSDKPGGTRYTLKLYREIPKLYRDEVNSSIRYVPTILEKDQDLSQI
FT                   TLKLEQVIKKYEDLGNSNSLGRIIKYARWRSQEASPKQKILVEKIIQKQLTKLKNSNDS
FT                   MNIDPFSISSYIKNLTKGSASKLLFATSIAPTFPVQGLLKNLKNTSK"
FT   gene            complement(<147015..>148187)
FT                   /locus_tag="CAGL0M01298g"
FT                   /old_locus_tag="CAGL-IPF9109"
FT                   /old_locus_tag="CAGL-CDS2831.1"
FT   CDS_pept        complement(147015..148187)
FT                   /locus_tag="CAGL0M01298g"
FT                   /old_locus_tag="CAGL-IPF9109"
FT                   /old_locus_tag="CAGL-CDS2831.1"
FT                   /note="similar to uniprot|P49018 Saccharomyces cerevisiae
FT                   YDR331w GPI8 essential for GPI anchor attachment"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62377"
FT                   /db_xref="GOA:Q6FK43"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="InterPro:IPR028361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK43"
FT                   /inference="similar to AA sequence:UniProtKB:P49018"
FT                   /protein_id="CAG62377.1"
FT                   /translation="MRIVLPCLLWLVTLACGVVNAEHTNNWAVLVSTSRFWFNYRHMAN
FT                   VLSMYRTVRRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGESVEVDYRG
FT                   YEVTVENFIRLLTDRWTEDQPKSKRLQTDENSNIFIYLTGHGGDDFLKFQDAEEIASED
FT                   IADAFAQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDVEI
FT                   GVAVIDRFTYYSLEFLEQIDKTSNLTLKDLFDSYTFEKVHSHVGVRSDLFKRNVSDVLI
FT                   TDFFANVQNVIPDDNSGKTSGNNEDIIDLAIQKSQLASKKDKSSQTPKPKEPASSIYFR
FT                   TASSLNKNITDAKNNSNEGLMTVLLIILVMLGLYTTFKRTSKKETAKFSL"
FT   gene            complement(<148547..>150079)
FT                   /locus_tag="CAGL0M01320g"
FT                   /old_locus_tag="CAGL-IPF9110"
FT                   /old_locus_tag="CAGL-CDS2012.1"
FT   CDS_pept        complement(148547..150079)
FT                   /locus_tag="CAGL0M01320g"
FT                   /old_locus_tag="CAGL-IPF9110"
FT                   /old_locus_tag="CAGL-CDS2012.1"
FT                   /note="similar to uniprot|Q06682 Saccharomyces cerevisiae
FT                   YDR330w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62378"
FT                   /db_xref="GOA:Q6FK42"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK42"
FT                   /inference="similar to AA sequence:UniProtKB:Q06682"
FT                   /protein_id="CAG62378.1"
FT                   /translation="MEEDKINNFLVITAVEDADVARQFLDMAGGDVDTAISLYFEHGVS
FT                   GLPSGGADAGAGTSGASSSVAHAESDSALAERLQQEAYQEPQTDVRPPDEARHETLAET
FT                   HVFPTTYGGIGGSFGSLRHHSGNVAQDMFDNSTPQGIFNQRMDFDYSDDSSSEGSSSSS
FT                   LSEFNSNSDDDDEYEYVEEDVVEVDDDGNITERKELVRRLKNPITKEARLAMLFRPPFD
FT                   IMSKVNLDRAKLKARKKKRWIMINIQDSGVFQCQALNRDIWSNKRVKRLIKKNFIFLQY
FT                   QFESRNAEPYVHFYGLKSKEELPHIAILDPLTGERLKQWDSTVPRLESFLDEVEKFLKD
FT                   FSLEPGSKNPLIKQPTPDLDPTTLSEEQQMELAIRQSLGAGEQEVSPSNNERNTDEVSE
FT                   TEIADAKEEEKPSTGSLFDQIEPINHEEPQNEPGKTTRIQIRTGDGRRMVRRFNLTDTV
FT                   RNIYEVIKAKLDGFADCQFILSNHQRENLIEKLSLTIAEAELGNSSLLVEKE"
FT   gene            <150584..>152002
FT                   /locus_tag="CAGL0M01342g"
FT                   /old_locus_tag="CAGL-IPF9111"
FT                   /old_locus_tag="CAGL-CDS2240.1"
FT   CDS_pept        150584..152002
FT                   /locus_tag="CAGL0M01342g"
FT                   /old_locus_tag="CAGL-IPF9111"
FT                   /old_locus_tag="CAGL-CDS2240.1"
FT                   /note="similar to uniprot|P28795 Saccharomyces cerevisiae
FT                   YDR329c PAS3 peroxisomal assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62379"
FT                   /db_xref="GOA:Q6FK41"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK41"
FT                   /inference="similar to AA sequence:UniProtKB:P28795"
FT                   /protein_id="CAG62379.1"
FT                   /translation="MVQGRAPVSRRVQRYRGGLFIAAASVGTLVAVGSLAVYIVKQWLY
FT                   RQQLRIAEEHFVKEQIKRRFDQTQSDSLATLYELVQVSSMVYDQKDLNLDEIMLALRDK
FT                   KLQKQSQTGSAARAADTTSNSSVTGVTSALNDKVSEKASSIRSSKTDDIRNMTKGELWN
FT                   QLKIRSISKLVTVTYTTSCLLLMTRLQLNILTRKEYLETVVKTTMQKNNDAGNSSGFFS
FT                   WVASKIWGSPSNGEEKRKSAQDMYGELVQAEKAGKHMSKGKVEYINEQAFLSIFWWLIN
FT                   RGWSKIHEIVEREVRSEFGHLDPKDALTIDDFSERLTKVYYRVNKTLFLVNEEKEKPLL
FT                   DIMIPRTPQELKNVLEQAMDLESLQLLEQDDSILRQLCKEMEKYMKSEATSIVMEQAIN
FT                   ESFDYAITEIDASIKKRNQEETQMALFALSCKECCDKMLKTNMMTMDNDYLTVLDGIAV
FT                   LDDLSAMVYSNFGL"
FT   gene            <153430..>153969
FT                   /locus_tag="CAGL0M01364g"
FT                   /old_locus_tag="CAGL-IPF9113"
FT                   /old_locus_tag="CAGL-CDS4608.1"
FT   CDS_pept        153430..153969
FT                   /locus_tag="CAGL0M01364g"
FT                   /old_locus_tag="CAGL-IPF9113"
FT                   /old_locus_tag="CAGL-CDS4608.1"
FT                   /note="highly similar to uniprot|P52286 Saccharomyces
FT                   cerevisiae YDR328c SKP1 kinetochore protein complex CBF3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62380"
FT                   /db_xref="GOA:F2Z631"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="InterPro:IPR036296"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z631"
FT                   /protein_id="CAG62380.1"
FT                   /translation="MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLDD
FT                   EDEEQDEDEDEDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDAW
FT                   DREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTP
FT                   EEEAAIRRENEWAEDR"
FT   gene            <155052..>159335
FT                   /locus_tag="CAGL0M01386g"
FT                   /old_locus_tag="CAGL-IPF9116"
FT   CDS_pept        155052..159335
FT                   /locus_tag="CAGL0M01386g"
FT                   /old_locus_tag="CAGL-IPF9116"
FT                   /note="similar to uniprot|Q06681 Saccharomyces cerevisiae
FT                   YDR326c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62381"
FT                   /db_xref="GOA:Q6FK39"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK39"
FT                   /inference="similar to AA sequence:UniProtKB:Q06681"
FT                   /protein_id="CAG62381.1"
FT                   /translation="MVDKKKKRSFSETGIFKLFKSKSRSKSSKSKSNLKGKNGHSSQRN
FT                   SRSKHKERTLSRPSVSDRKRLETESGDRTVSESHLLSSKLRKLGNHNHNHIHNNGNIEY
FT                   PEIRSIRSGGSRSFNDRYNDYNDYDDDDDDDDNNDNGNRDGLDNGHTDTMSDATEDGID
FT                   ISFKPRRSLQNSTAGLNRINTLQGYFNIPVTIDSHHTNSHNNNSGTRTNPISRKTSEFF
FT                   NSKNPSKTGTQSNLQETNHTQGILDTIVSFAQNAVGRVPKIVVNDPSAEEIVDSGDKDK
FT                   TTATNTLKANIPGITSNISSLSSVTTNRNGTSTSGRIPLKTEDDLLNGGEQHNDTVLHS
FT                   PLNEENRSSSFLKHLDYLLSPRTSDPLKEKSTPLADLAVDNKSENSVPKHDAKLPVANK
FT                   EQQRYSYNTVEEENKTMNSQGTNYTDKGLDPTKIKFQSHVGNHEPAIATFGRGNLTLDV
FT                   LIDHSNSDETIDNSESRVSFKNNNPNHPGMPIFNENYRNSSYIDVQRHLGLNKGNEIGR
FT                   GRSRTLPTNDASAVLDQKIEGDSKRNSRITTLSNDEIVGDNDRKPRSLSRKFLNRRSFS
FT                   PSIGSKVLPSMAFRNSMNKTRNSNDKMDTSKPRSSGVFSATVNSTQDTEYTKPFSLVGI
FT                   EYSSEKKNIEFHNIFKDAGVTPQERLILDHSCALSRDILLQGRMYISDQHIGFNSNILG
FT                   FVSTVFIPFKEIVQIEKKTTAGIFPNGIVIDTLHSKYIFASFISRDATFNLITDVWNQI
FT                   ILGRRYSDDTDQSDYSSRLNDLSDSNSLYNQLKDIDDDGGDDAALSDIDSTDMTSSEEV
FT                   EDIIGSGIGIKKTKGQIKSLSLGPSQHEPTSSGYKPTNNEKLVTEFLVEAPLGTVVNLL
FT                   YGENTKYITDILASMKSTDISPIPKLLGTSSRKFNYVKPLPGNIGPSKTKCFITETLDH
FT                   YDLEKYVKVSQVSDTPDVPSGNVFSARSVFLFTWDKDNNTKVVVYGCVDWKGKSWLKSF
FT                   IEKGTMDGILEVAKTTHHEIKTILNNQSSSEQSVEDNGDSAEEVIEESNLPKMGPLSHQ
FT                   PTEPPFSKESEDTVIEENVNFQAPLGTIFQILFGDDTSYIKKMIEKQNNFNLSEIPPFN
FT                   NKMREFTYTKRLANSFGPKQTRCFITEKIEHMDLNSYILVRQIVKSPDVPSGNNFAVHT
FT                   RTYLTWGNDNSTNMLVVTNVEWSGKSLLKGTIEKGSIEGQRVTTKQVIEELRDIIANAG
FT                   SSRKKLKKRSKTITSLKKVTSQPLEKKPDTVAQNMDSSANLLDQFVSFVMELDFTSLKG
FT                   IGFIIITVFLFFLLLRGLFFSNAKSATKIIRPGVIIIDGEEYSYVPNSKTIYNAYEKKI
FT                   GKFDYSFKSDDNNPVMESEFLIWDWLDDRTNGNSNNLSFRKQYKRGFKPVKTHKLQQLK
FT                   ESIKIAENELNEMKRLLNEEEELLL"
FT   gene            complement(<159500..>162646)
FT                   /locus_tag="CAGL0M01408g"
FT                   /old_locus_tag="CAGL-IPF9117"
FT                   /old_locus_tag="CAGL-CDS0380.1"
FT   CDS_pept        complement(159500..162646)
FT                   /locus_tag="CAGL0M01408g"
FT                   /old_locus_tag="CAGL-IPF9117"
FT                   /old_locus_tag="CAGL-CDS0380.1"
FT                   /note="similar to uniprot|Q06680 Saccharomyces cerevisiae
FT                   YDR325w YCG1 Yeast Condensin G"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62382"
FT                   /db_xref="GOA:Q6FK38"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025977"
FT                   /db_xref="InterPro:IPR027165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK38"
FT                   /inference="similar to AA sequence:UniProtKB:Q06680"
FT                   /protein_id="CAG62382.1"
FT                   /translation="MTEVTTDGSDINSKIFGSIANVFQAAQLSYAGHRKHVAVLKKIQT
FT                   KAIAQGYEDAFNYWFNRLILAILPLKKTEVVGDRIIKLVASFIASLDKEIELAKAQGKP
FT                   LPNNAESAFTKFVDHFIRNILRGIESKDKNVRFRVVQLLAVIMDNIGEIDESLYELLTW
FT                   SLNKRIYDKDPNVRIQAVFCLTKFQAEDVGRENEPSNDLIAIEINESTKTLMSLIQNDP
FT                   SAEVRRAAMLNLISLPATLPYILERARDVNQINRRLVYSRILKAAGKECFTKIDTKILD
FT                   QLIKWGLEDREESVRAACKKLIHHDWLGLVDGDLIRLLEHLNVKDSTTCDKVLVCIFEK
FT                   HPEIIQKIKFSHDIWSNFTIEVAFLFRCFYLYCIQYNINEVLYDNFPEASRLAEYLQSY
FT                   INKAFKDNQSQSITDNDKKHLEFIIEQILMAADKYDYSDEIGRRSMLTVVRNFLGIKSL
FT                   SVTSIKIGIDVLKTLSINEKDFITMVIEMINDIRDEDIDMQEKEEKAAKRKSKKSKKLQ
FT                   KKKDKQSSTEVLVNKKNDDLGDAQSAKKDTTLETSTFDYADDDESSNEEESDNEDENEN
FT                   DGDDDDLDSFHSAVEGLVNGDSNTMNEADIMRKMLYEKEARPDTLILCLTRSGYMLELV
FT                   SSSIQENILIASLIDTLITPAVRNSEPTVRELGIKNLGLCCLLDAQLATENIYILGMCV
FT                   SKGNESLKMIALQVLFDIFALHGNVVVDGEGKVDSISLHKIFYKVLKNTELPSCQKIAA
FT                   EGLCKLFLADIFTDDDLFETLVLSYYTPANSANEELIQAFAFCLPVYCYSHINHQNRMA
FT                   RIGADILLRLCVLWDEFRYSDEYNDEKMTMLKPNIIFQQLIDWTDPRKIINRDEKDANA
FT                   DSSQIRFLLDVLKIVPQIEKSEIKRLLLNNINLVHLHHTQEYSTLKQLEDNIIDILEND
FT                   AIDQNQRNSLTRFKLSLQDVIEKTESKLDEHSDADTSTEQYSMILESSQVYSKPPTRND
FT                   EENCSDEDNAAALPSELNTKKRKRSESVENRDDTTNRTNRTDTSREGLTGENSDIMMSD
FT                   "
FT   gene            <164428..>166683
FT                   /locus_tag="CAGL0M01430g"
FT                   /old_locus_tag="CAGL-IPF6323"
FT                   /old_locus_tag="CAGL-CDS0941.1"
FT   CDS_pept        164428..166683
FT                   /locus_tag="CAGL0M01430g"
FT                   /old_locus_tag="CAGL-IPF6323"
FT                   /old_locus_tag="CAGL-CDS0941.1"
FT                   /note="highly similar to uniprot|Q06679 Saccharomyces
FT                   cerevisiae YDR324c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62383"
FT                   /db_xref="GOA:Q6FK37"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK37"
FT                   /protein_id="CAG62383.1"
FT                   /translation="MTMLVHRSRFVDFTPSNITALAFSHKSSAELTPSDLRLAVGRADG
FT                   NIEVWNPRHDWFQEMIIEGGQDRTIEGLCWCNVAGEPLRLFSIGGSTIITEWDLNTGLP
FT                   MKNYDCNAGVIWSIAINAAGDKLAVGCDNGTVVIVNIAGGPGIIEHDSILMRQEARVLS
FT                   LAWNGNDYVIGGCSDGRIRIWAAHEKDESRGRIINTMRVDKSKKESTLVWSVLYLPSKN
FT                   TIVSGDSTGSIKFWNFQYATLSQSFKSHSADILCLTTDAKESTIFSAGVDRKIFQYSLD
FT                   HSKKWLISSNRLLHGNDIRAMCAYQSKGADFLVSGGVDKTLFINPISSFADGRYRKMPF
FT                   VVPYNKNVLINNTQRLIVMWDGSVVKIWTMGTEVENEKNYKLVCKLVLKDEQKIHTCAM
FT                   SPDGQVLLVGRATTTKIFHLQPMENKLKVTKLSNDFLFTIGTKAAKFINNSKVVICNTD
FT                   DELLMLDLEEEDDEKPEYFELDEPQNTKSSLKIPYMNKINRIDANESAVVVSRYCGIVT
FT                   VINLKTKKSQNLLHLMNFVTSIYIHEQRKTVIVVTAENKIYELSLASIFREDTEDKEGD
FT                   EQADVTNEENSVFTAWSKRNTENIPKQLKDMRQKCLGVFASDEDSNKIWLWGSTWICRI
FT                   DMSKNLPVITRKKTKKHGRDGLTITDDSNYMNNNLEDEDEDVDMDIDEDLEILKGGKVK
FT                   SISNQKDPLTSEVFYFNDKYRHLLMADLLSSSELVVVERPPIFLKDQKAFQQPKLVF"
FT   gene            <167313..>168917
FT                   /locus_tag="CAGL0M01452g"
FT                   /old_locus_tag="CAGL-IPF6325"
FT                   /old_locus_tag="CAGL-CDS1873.1"
FT   CDS_pept        167313..168917
FT                   /locus_tag="CAGL0M01452g"
FT                   /old_locus_tag="CAGL-IPF6325"
FT                   /old_locus_tag="CAGL-CDS1873.1"
FT                   /note="similar to uniprot|P32609 Saccharomyces cerevisiae
FT                   YDR323c PEP7 vacuolar segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62384"
FT                   /db_xref="GOA:Q6FK36"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="InterPro:IPR036531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK36"
FT                   /inference="similar to AA sequence:UniProtKB:P32609"
FT                   /protein_id="CAG62384.1"
FT                   /translation="MQSSDVRPNDTQQEYSKLIQEENTKSSCPICFKECANLNELNKHL
FT                   DKDHNFGNENSNGDHVKKHQNKKKSSGIRTSHHEVYNEGMSKCAYCRKKLTKSNGVSNC
FT                   YHCGKLYCRSHLLWQMKLDKRARYDPQHGKFYPCCFKCTSSRPGYNDYGLTVSKTSEFS
FT                   RLRSSKMEDKQLRSLQLETRLLKLIDGYISISRKYGNNLFSTVVRNSELSKYERSIVHW
FT                   KDDSNVHTCNICTSEFGLVRLSRKHHCRLCGNIVCDTDGYEEEVINTRRRKTTMKKCSY
FT                   QIKLRNLKSSTDDLHYNSQLRPDEEYIAELQVRLCSTCIDNLLLKRKFKRDLTKPMPPL
FT                   LSRYETLHNIADVIRTILPPFQDALQKIDNERTKKVSDEKELADLSKLRVKLLRSFANY
FT                   NSVNKQLCSIKPSNFSEERVKNSLLVESSYFINENILPLRSLPAVLSGEDYVMSKSEPE
FT                   VKKLSELMSSDLSIKEIKQGREELMVLEEQIFQIESLVETAKRQRKFDEVATLATNLNE
FT                   LNQRATELREKLGQEGF"
FT   gene            <170175..>170609
FT                   /locus_tag="CAGL0M01474g"
FT                   /old_locus_tag="CAGL-IPF14407"
FT   CDS_pept        170175..170609
FT                   /locus_tag="CAGL0M01474g"
FT                   /old_locus_tag="CAGL-IPF14407"
FT                   /note="highly similar to uniprot|Q92317 Saccharomyces
FT                   cerevisiae YDR397c YNC2beta"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62385"
FT                   /db_xref="GOA:Q6FK35"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR042225"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK35"
FT                   /protein_id="CAG62385.1"
FT                   /translation="MIGDGDDVTLPKATVQKIISEVLDSDLMFNRDAREIIIKSGIEFI
FT                   MILSSMASEMAESDAKKTIAPEHVIKALKELEYNEFIPLLEQILIEFKGTQKIKEKKNS
FT                   KFKKSGLTEEELLQQQEELFRKSRSRLHQNSVSGSATDST"
FT   gene            complement(<171045..>173900)
FT                   /locus_tag="CAGL0M01496g"
FT                   /old_locus_tag="CAGL-IPF6331"
FT                   /old_locus_tag="CAGL-CDS0512.1"
FT   CDS_pept        complement(171045..173900)
FT                   /locus_tag="CAGL0M01496g"
FT                   /old_locus_tag="CAGL-IPF6331"
FT                   /old_locus_tag="CAGL-CDS0512.1"
FT                   /note="similar to uniprot|Q04175 Saccharomyces cerevisiae
FT                   YDR395w SXM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62386"
FT                   /db_xref="GOA:Q6FK34"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK34"
FT                   /inference="similar to AA sequence:UniProtKB:Q04175"
FT                   /protein_id="CAG62386.1"
FT                   /translation="MLDERAILTCIGHTLISDAKVIKQAEDQLYEYQKQPGFTSFLLNV
FT                   VTDNSIAMNVRLSAAIYMKNKIQRSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSESSH
FT                   LRPHLTESIRGILNADNSWDLTATVKELLTSGKQEYLYPGLLLVFEVAIVHRWDMSDNR
FT                   EVIDNFIIEIFPIVENITSQLVNQTDYRSNELLYLVLKSFKYSCLNNLPKYFADLDKLN
FT                   AWIQLHLFICQKPLPAEVLELDPSDRSLDKRVKVNKWGFGNLTRFLYRYSRSTKVITPE
FT                   FVNYVFTKIVPEIIQEYFKFIESWSNKSLWLGEASLYYMVQFLEKCMITNELFPLLEPH
FT                   LNVVLQHLIFPCLCATEESVELLYEDPEEYTRRYFDLNKDGSMADFASSDFVYMLGTVR
FT                   PDKLNEVLVFINEVFTNFSQHKGDKEWSFKQEGAMRMISTLFSLFQNPQDLEGMFSNYI
FT                   VNFLADDSHHFLVARALETVASYPYDINDMGTLSKLFEQTYGHFLNSDCLPIQVEAADA
FT                   LKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVENFADELTPFAKD
FT                   LAVNLAEQFLNLGRSIVESTNGAYSTGDQDQETQACALLATMTTMVMSMNKVSLVEQFA
FT                   PVVKFVIVHAQISFITEIVDLMDSLALSSKALFNQFTPEIWEMFHDVMDSFQTYALDYF
FT                   ESYLVFFETIVLQGFPQDQTFVEPFLSLLSVKLESEIDYDVEGVMNLLTCFALSMKETP
FT                   FLEKALSRAMDEEFGLDDKQVIKMVLAYLFVKPIETLQVMESSGVTLNILKRWFDLKFK
FT                   SVFAIKLQILAIMSILKLPELPSCVSGYLKEFSNKLVTLVEQLPVAIRNREALNKGEEL
FT                   SGGADGTDLLDPQEEDEYLEEYDDDLKESILDQVNAFQEVSVFLTSLQSENPQRYQDII
FT                   SGMSDDKKESLQVILEFVSNN"
FT   gene            complement(<174378..>175595)
FT                   /locus_tag="CAGL0M01518g"
FT                   /old_locus_tag="CAGL-IPF6332"
FT                   /old_locus_tag="CAGL-CDS2737.1"
FT   CDS_pept        complement(174378..175595)
FT                   /locus_tag="CAGL0M01518g"
FT                   /old_locus_tag="CAGL-IPF6332"
FT                   /old_locus_tag="CAGL-CDS2737.1"
FT                   /note="similar to uniprot|Q04172 Saccharomyces cerevisiae
FT                   YDR393w SHE9P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62387"
FT                   /db_xref="GOA:Q6FK33"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK33"
FT                   /inference="similar to AA sequence:UniProtKB:Q04172"
FT                   /protein_id="CAG62387.1"
FT                   /translation="MYSYRYLRPVSRSGRAILIQRQAYLRNITFTHFRCEENKSSASKR
FT                   PTGNALNTKLNELNGSLNNLWNKFLEGRGVFQHHAKNIRKSIQEANKKIAEQEKESKDA
FT                   KINYKKDELTNEEIKDLPSERELHRKKWSRKLEFYLDSLQETLFTATKALNDVTGYSSI
FT                   QKLKNSINLINEKLDATRKARTDLKLQYTKAIESRTLSQKQLNELLQRKSSWSPSDLEN
FT                   FTKLYKDDAINQQTEKELKEKVRDIEKKEEQLTDDLYRAILTRYHEEQIWSDKIRRTST
FT                   WGTFILMGFNLVLFIIFQLLLEPWKRRRLTGSFEGKVRHALELHSQEQETKIRDFLEEI
FT                   KTKESNNIANEQKTITKLSFWDKLRNTFQNSTGLSLTQFNMLELTVTAINSFLVGILFT
FT                   LLLHAL"
FT   gene            complement(<175916..>176896)
FT                   /locus_tag="CAGL0M01540g"
FT                   /old_locus_tag="CAGL-IPF6333"
FT                   /old_locus_tag="CAGL-CDS3355.1"
FT   CDS_pept        complement(175916..176896)
FT                   /locus_tag="CAGL0M01540g"
FT                   /old_locus_tag="CAGL-IPF6333"
FT                   /old_locus_tag="CAGL-CDS3355.1"
FT                   /note="highly similar to uniprot|P06844 Saccharomyces
FT                   cerevisiae YDR392w SPT3 general transcriptional adaptor or
FT                   co-activator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62388"
FT                   /db_xref="GOA:Q6FK32"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK32"
FT                   /protein_id="CAG62388.1"
FT                   /translation="MDKHKYRVEIQQMMFVSGETTEPPLETTSLIEDIVRGQVVEILMQ
FT                   ANKTAQSRGVKSILPEDVIFLIRHDKAKVNRLRSYLSWKDLRKNAKDQDSNAPAGGGAE
FT                   EEDLGKKAGDKDEKDSSANMKVKKSQIKLPWELQFMFNEQPLENNEDADDIDEDEREAN
FT                   IATLKRLKMNDDRTRNMTREEYVHWSDCRQASFTFRKSKRFKDWSGITQLTDGKPHDDV
FT                   IDILGFLTFEIVCSLTETALKIKKREQILQNQKQQSQNIHQDVSLDKSAITRKKRLFDN
FT                   LDDEVNPLKPNHVEEAWRVLQMIDKKHRALTNFRGGRLSSRPIIL"
FT   gene            <177667..>178320
FT                   /locus_tag="CAGL0M01562g"
FT                   /old_locus_tag="CAGL-IPF6334"
FT                   /old_locus_tag="CAGL-CDS4281.1"
FT   CDS_pept        177667..178320
FT                   /locus_tag="CAGL0M01562g"
FT                   /old_locus_tag="CAGL-IPF6334"
FT                   /old_locus_tag="CAGL-CDS4281.1"
FT                   /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
FT                   YDR391c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62389"
FT                   /db_xref="GOA:Q6FK31"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK31"
FT                   /inference="similar to AA sequence:UniProtKB:Q04170"
FT                   /protein_id="CAG62389.1"
FT                   /translation="MSEVKLNITRDVVRASETLYKAFDDSHAFDYITKKFFNLPVDEYV
FT                   SKDRINAITHYYVACYHDSNGEVVEANDYDAVAVFSLPNQHLPKSLTNDPHFNQVFFHD
FT                   LKSRLAEVIPEDIHYYYLFMIGKDLTRKDTKGSVRKIFEEYKKRADAENCAIVLEAIAE
FT                   HARSVYEYFGFKNYKTFHYGVGEVNEQGQPDPNGKGFTGYLMIYHKDGDKVLRE"
FT   gene            <178619..>178690
FT                   /gene="tRNA-Gly (CCC)"
FT                   /locus_tag="CAGL0M01584r"
FT   tRNA            178619..178690
FT                   /gene="tRNA-Gly (CCC)"
FT                   /locus_tag="CAGL0M01584r"
FT                   /product="transfer RNA-Gly"
FT   gene            <178971..>180869
FT                   /locus_tag="CAGL0M01606g"
FT                   /old_locus_tag="CAGL-IPF6335"
FT                   /old_locus_tag="CAGL-CDS1338.1"
FT   CDS_pept        178971..180869
FT                   /locus_tag="CAGL0M01606g"
FT                   /old_locus_tag="CAGL-IPF6335"
FT                   /old_locus_tag="CAGL-CDS1338.1"
FT                   /note="highly similar to uniprot|P52488 Saccharomyces
FT                   cerevisiae YDR390c UBA2 E1-like (ubiquitin-activating)
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62390"
FT                   /db_xref="GOA:Q6FK30"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030661"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK30"
FT                   /protein_id="CAG62390.1"
FT                   /translation="MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLME
FT                   VGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAIAVNAVQSFSNSKLVPYQDNIMDTN
FT                   VFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGKTEC
FT                   FDCTKKETPKTFPVCTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQDWGT
FT                   DDVEEINRIKNETNELKELQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWKTRAKP
FT                   VALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQITSKLMDRYNTESAIDFDKDDQ
FT                   DTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLMSLRVLNL
FT                   LKYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGVFKVTKNQM
FT                   EKHSFMDFINALTSTSKLSDDISILDATTQRLLYDYDFEDLAEKKLVDLSLKNGSVLLI
FT                   TDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIPSETADENGGGDMLQND
FT                   SLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIEDDDELVILD"
FT   gene            complement(<181274..>183079)
FT                   /locus_tag="CAGL0M01628g"
FT                   /old_locus_tag="CAGL-IPF6336"
FT                   /old_locus_tag="CAGL-CDS1499.1"
FT   CDS_pept        complement(181274..183079)
FT                   /locus_tag="CAGL0M01628g"
FT                   /old_locus_tag="CAGL-IPF6336"
FT                   /old_locus_tag="CAGL-CDS1499.1"
FT                   /note="highly similar to uniprot|Q04163 Saccharomyces
FT                   cerevisiae YDR389w SAC7 suppressor of actin mutation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62391"
FT                   /db_xref="GOA:Q6FK29"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK29"
FT                   /protein_id="CAG62391.1"
FT                   /translation="MPNKHSISPSRHMPFWKNFVNNPKSVSSENLSTPSRPVYQRGHSY
FT                   NHTAPKTGSPIKNEVGAAERQDFRDYRDQFLSGRNGFSGRVFGVSLEESLSVASAEVIV
FT                   QSELVSFGRIPIVVAKCGAYLKSNGLSTSGVFRIAGNSKRIKELQYIFSTPPDYGAKFS
FT                   NWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRILKYMLNNEVSHPNAN
FT                   KENTLTMKLTESTKQDTDDRANDGDNENEDEQHITEEEAKRKQLRRKKKLSRCIRAAIK
FT                   EYEELFTDLLSDSKQLTIYLLDLLSLFARQSQLNLMSGSNLAAIFQPSILSHPQHDLDP
FT                   KEYELSRLVVEFLIEYTYKLLPHLLKSTKDDQQKKISESVHQKSTTESTTNRDKTSSPL
FT                   PNIQIQTETTTIKGTPDNSKTTSTATSQQNNIHSKPEAKSPALQVPKYQRPHSRSIGSA
FT                   PMVPDVIASNKRRSRLFPWLHKPGILSDTGDTATDGEGDDLLNDDENVDPHLSSPVHSS
FT                   NHRQHLLSIPKVQRSVSGRSITSNSSGRPLSLILNRSEDNLPKNGSSSTEKFERPRSPI
FT                   AYSQESIESKAKKRESWFARLTSRN"
FT   gene            complement(<184085..>185485)
FT                   /locus_tag="CAGL0M01650g"
FT                   /old_locus_tag="CAGL-IPF6338"
FT                   /old_locus_tag="CAGL-CDS2279.1"
FT   CDS_pept        complement(184085..185485)
FT                   /locus_tag="CAGL0M01650g"
FT                   /old_locus_tag="CAGL-IPF6338"
FT                   /old_locus_tag="CAGL-CDS2279.1"
FT                   /note="highly similar to uniprot|P39743 Saccharomyces
FT                   cerevisiae YDR388w RVS167"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62392"
FT                   /db_xref="GOA:Q6FK28"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK28"
FT                   /protein_id="CAG62392.1"
FT                   /translation="MSFKGFTKVVTRAPQSFRQKFKMGEQTEDPVYEDAERRFKELEQE
FT                   TKKLSEESKRYSSAVNGMLNHQIGFAKAMEEIFLPISGKMSDPNATIPEDNPEGIEASE
FT                   QYRALVAELQQTLKPDLALVEEKVVKPCQELLKIITYIRKMATKRNHKKLDLDRHLNTY
FT                   TKYEKKSEKPDAKPKVEEKMYKAQVDMETAQQEYDYYNDMLKEQLPILFSLEAQFVQPL
FT                   FVSFYYMQLNIFYTLYNKFQDMKIPYFDLNSDIIEAFIAKRGNIEEQTDSLTITHFKIG
FT                   YSKTKLEMTRRRYGKDTDSASPTPGAYGAVGSTTPGYGQMQSPNATGYGGMQSPPATGY
FT                   GVQQPAMGPGAVGAVGAVGAVGAGAVGAGAMGYQQQAAPPAYTAMGAGAAVPQPPQQPM
FT                   AAPAPAGAPVETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVF
FT                   PGNYVQLN"
FT   gene            <186088..>187731
FT                   /locus_tag="CAGL0M01672g"
FT                   /old_locus_tag="CAGL-IPF6342"
FT                   /old_locus_tag="CAGL-CDS1789.1"
FT   CDS_pept        186088..187731
FT                   /locus_tag="CAGL0M01672g"
FT                   /old_locus_tag="CAGL-IPF6342"
FT                   /old_locus_tag="CAGL-CDS1789.1"
FT                   /note="similar to uniprot|Q04162 Saccharomyces cerevisiae
FT                   YDR387c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62393"
FT                   /db_xref="GOA:Q6FK27"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK27"
FT                   /inference="similar to AA sequence:UniProtKB:Q04162"
FT                   /protein_id="CAG62393.1"
FT                   /translation="MVDENSNNENGLDQEEEIDVYSDLYSTYTQVTSLTTNDVDNTTYP
FT                   MTWKTVALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCLGC
FT                   FVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQ
FT                   CTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILFGLSAVPAI
FT                   IFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQ
FT                   DEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTK
FT                   RALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLV
FT                   DLVGRRSMLLNTIWIMTVGLLLSTIGFQHENVVVLLFAVSIFVAAYASAMGTIPWSSVE
FT                   FLPLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSVMAWFFVYFW
FT                   YPEVKGLSLEEIGKVFENGIDVHYVYRNYY"
FT   gene            complement(<187841..>190675)
FT                   /locus_tag="CAGL0M01694g"
FT                   /old_locus_tag="CAGL-IPF6343"
FT                   /old_locus_tag="CAGL-CDS0527.1"
FT   CDS_pept        complement(187841..190675)
FT                   /locus_tag="CAGL0M01694g"
FT                   /old_locus_tag="CAGL-IPF6343"
FT                   /old_locus_tag="CAGL-CDS0527.1"
FT                   /note="highly similar to uniprot|P09440 Saccharomyces
FT                   cerevisiae YBR084w MIS1 C1-tetrahydrofolate synthase
FT                   precursor or uniprot|P07245 Saccharomyces cerevisiae
FT                   YGR204w ADE3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62394"
FT                   /db_xref="GOA:Q6FK26"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK26"
FT                   /protein_id="CAG62394.1"
FT                   /translation="MLKFLRTNRYYHLLSGTKLSQKIIEQCRNEIDTIRKNHKFLPTLK
FT                   ILQVGNRLDSSAYVNMKLKKSEQSGVKCIVEKLPESITEFELLSKIEAINNDTSIHGLL
FT                   IQLPLPKHLDETTITSSVSVDKDVDGFHIYNAGELTKKNGHPKFIPCTPNGCIELLKEH
FT                   NITIAGKNAVVIGRSSIVGTPITSLLKNLDATVTQCHSKTVNLPEIVKTADIVIAACGQ
FT                   ANMIKGEWLKEGAVVIDVGINHVPDNTKKSGHRLVGDVDFDSASKKASYITPVPGGVGQ
FT                   MTVAMLVSNVVLAAKRSLANFEKVPEIKPLPLKLEKPVPSDFEISKSQEPKHIDNLAKE
FT                   LGIFQDELELHGHYKGKISTSILDRLESKKNGRYVLVAGITPTPLGEGKSTTTMGLVQA
FT                   LTGHLGKPSIANVRQPSMGPTFGVKGGAAGGGYAQVIPMDQFNLHLTGDIHAVGVANNL
FT                   LAAAIDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRRLERLGINKTNPDELTAE
FT                   EINKFVRLNINPDTINIKRVVDVNDRMLRKITIGQAATEKGRTRETGFDITVASELMAI
FT                   LALSTSLQDMKRRVSKLVVASDINGKPVTVDDIGCSGAIVALMTDTIKPNLMQTLEGSP
FT                   VLVHAGPFANISIGASSVMADKIALKLMGTCLDSQEPGYVVTEAGFDFSMGGERFFNIK
FT                   CRSSGLVPDTVVLVATVRAIKSHGGAPDVKPGQALPQEYIEENIEFVKKGVANLVKQIE
FT                   NVKKFGVPVVVAINKFSTDTENETKAIEESCKAAGANNVVVSNHWEEGGKGAIDLANAV
FT                   VQSCEEPKSFQFLYDTDLPIKEKLETIVKEMYGGAGIELSEKAQKQIALYTEQGFDKLP
FT                   ICIAKTQYSLSHDPKLKGVPQDFIVPIRDIRASIGAGYLYALAAEIQTIPGLSVHAGYL
FT                   NVEVDDKGNINGLF"
FT   gene            complement(<192389..>193696)
FT                   /locus_tag="CAGL0M01716g"
FT                   /old_locus_tag="CAGL-IPF6344"
FT                   /old_locus_tag="CAGL-CDS2514.1"
FT   CDS_pept        complement(192389..193696)
FT                   /locus_tag="CAGL0M01716g"
FT                   /old_locus_tag="CAGL-IPF6344"
FT                   /old_locus_tag="CAGL-CDS2514.1"
FT                   /note="similar to uniprot|P18412 Saccharomyces cerevisiae
FT                   YBR083w TEC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62395"
FT                   /db_xref="GOA:Q6FK25"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR038096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK25"
FT                   /inference="similar to AA sequence:UniProtKB:P18412"
FT                   /protein_id="CAG62395.1"
FT                   /translation="MTVSNDSSVSDRYNMNNSTSTSNVSSSNSTGSSNSSGHTQTTGSD
FT                   NKWPMDIESAFVEALGLIIKNGTSKIKIRDRNYGRNELISMYIWYRIGKYRTKKQISSH
FT                   IQVWKKSLLTKKKTGTLTNSNEIYVLDLIENGPQQTDESTRYFYTFFESIISTIMGNYP
FT                   AFAITHRPVLCPPNSTLPLPLPTGQQWFYAPQEGYYYQNQNSNSINYAGHQMTPNNGGN
FT                   QNQMDYMANDRNNIEINNMKLKSGSGMPMNTFNQRQQNVQQLPYPMISTQQGQNSHQFL
FT                   YHNGSNVDHKVPMSNTGNSANFNGNISSPQFNNSSNTPGVNNMHSNGSGFGMLYQYQQY
FT                   PNQSYYMQQSSLPIPPSIVQNSYTNNNTTNITTTPMSLPNVMSQFGQNGQSKTTNNLPP
FT                   PIRQPDILNKENKPLVKNEEINPYNEKKEVQGIQSN"
FT   gene            <197743..>201900
FT                   /locus_tag="CAGL0M01738g"
FT                   /old_locus_tag="CAGL-IPF6348"
FT                   /old_locus_tag="CAGL-CDS0148.1"
FT   CDS_pept        197743..201900
FT                   /locus_tag="CAGL0M01738g"
FT                   /old_locus_tag="CAGL-IPF6348"
FT                   /old_locus_tag="CAGL-CDS0148.1"
FT                   /note="similar to uniprot|P35177 Saccharomyces cerevisiae
FT                   YBR081c SPT7 Transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62396"
FT                   /db_xref="GOA:Q6FK24"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037782"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK24"
FT                   /inference="similar to AA sequence:UniProtKB:P35177"
FT                   /protein_id="CAG62396.1"
FT                   /translation="MTIGNIYDLNFLLKLTNKLFENHTFDSYLTNQQLIVLNHILKHNE
FT                   LNSEIWPDFMSGNLRLKVKIDQTVEDKANQEQLQTTDGVAGSPKSTHIKKEDDFETNTI
FT                   NDDDEFTRSYDDEDLSKLDLDALKEQIDGAYFVGNLSLKVRYVLSQFGIENNLTDYLEE
FT                   GIDNTDKVESYGGESPTNANTEDNLFTSTDANEDGEDDDYDFDEDDEPNKEAESNDNAT
FT                   EEVVESDRTFKDSTTQCLTLEITISKNTLATYLNPNDIEEKILENSDKFFHSLENDRET
FT                   MLKKLKLQRSDQKITTDSDTIDLNGNNSDDNKGSIDDDDDDATIRVPKRQRNRDVTGDD
FT                   DDEEDDDDESKKDKEGNSPKKLKTLPTGLGIENLSLKHLLSRIQSNKNKLNISDYELKH
FT                   LLTEVRKNRSKWTSDERIGQEELYEACERVVMELRNYTEHSTPFLNKVSKKDAPNYHLV
FT                   IKKSMDLNTVLKKLKALQYNSKQEFVDDIMLIWKNCLTYNSDPSHFLRAHAIAMQKKSL
FT                   QLIPLIPNITIRNRADVERELEELEKDKDYKDNDDKEDAEEEVAGSGRKGLTMGAHKLA
FT                   KDSSATNNATNTDTNEETTKVINKMDIEVQKGEGEEKEGEVMPESDQSLSQDKGNDKII
FT                   ETETNFSKDDDKHLTPQSHNNTEEETKDQSEKMASESKTEIEEDSKINESSEENAGDKI
FT                   YSNASKTEQPQVTTVIEGETEDKGETEDKGEAEVPADEEEDDEEDDEDEEAQTFVVEKD
FT                   DDKDDVELSVWKSITANIRADICLKRSEYFKTGQLNSELDALLKDPERMKPFFQLYKEF
FT                   KDQKELEMFRLKMEQNSIMKNGFGTALVKQEDYSSIGGATNPSENQEGNDAYGKTYEGM
FT                   DLDSSTLLKEYDTMNYLPEFAYGGQDQQMLDQNEEDAVNRILELGMTKKSALLDNVGKG
FT                   LTPKVNSNISLIQEIRHICHKISLIRMLQNPYSTQFNKANPGQILNAHQYRYEKVNDDI
FT                   DIDPISQLHNHDYKHDKNVMWKVMHKNVSKIAMSNGFETTQPTAIDILTEIAGNYLSNL
FT                   TRSLKIHKETNSVNRMKPEEMLEAVLLENGINKPDDLYSYMESEFEKKTKKLKDVKAKL
FT                   ENFLKDLLRPTLQDLSERNFEDESQSFVTGDFASNLNGEDFFGFRELGLEQEFGILSNS
FT                   VPISLLSFQFQATDSETKEQVMKLQAEEIKDIVYEKVSKKDLQSDRFSPIVLSLLTQSY
FT                   EKTKSAIPKINKVVTAEAEKDNDDVTEEEPKTKPLEDNDDLLVMEDDELPVKTKMGSRL
FT                   RLPPTGKISTTYKKRPLADAFILPEEDPIDEINVNNDSDQVKVEDVPENNGTPMDNDRE
FT                   LDLQISENPLFDSPDIDNNSFGLNLEDNDIAVSNSSLNLKLG"
FT   gene            <203616..>208115
FT                   /locus_tag="CAGL0M01760g"
FT                   /old_locus_tag="CAGL-IPF6352"
FT                   /old_locus_tag="CAGL-CDS0106.1"
FT   CDS_pept        203616..208115
FT                   /locus_tag="CAGL0M01760g"
FT                   /old_locus_tag="CAGL-IPF6352"
FT                   /old_locus_tag="CAGL-CDS0106.1"
FT                   /note="highly similar to uniprot|P33302 Saccharomyces
FT                   cerevisiae YOR153w PDR5 or uniprot|Q04182 Saccharomyces
FT                   cerevisiae YDR406w PDR15 or uniprot|P51533 Saccharomyces
FT                   cerevisiae YOR328w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62397"
FT                   /db_xref="GOA:Q6FK23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK23"
FT                   /protein_id="CAG62397.1"
FT                   /translation="MSLASDKKDADVASTTTTAQDDDNLSTYHGFDHHVQDQVRQLART
FT                   LTQQSSLHQKKEHTLPEEGINPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISNSD
FT                   PDYYKPYSLGCYWKDLVATGESADIEYQANFLNGPYKGLKTVYNTVVPSTASSKDKNFK
FT                   ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRK
FT                   HFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVAMATFG
FT                   LSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRAL
FT                   KVQASISNAAATVAIYQCSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQKMGYVSPE
FT                   RQTTADFLTAVTSPSERIINQDYINRGIFVPQTPKEMWEYWRASEDHADLIKEIDSKLS
FT                   DNYDANLAEIKDAHVARQSKRARPSSPYTVSYGMQIKYLLIRNFWRIKQSSGVTLFMVI
FT                   GNSSMAFILGSMFYKVMKHNTTSTFYFRGAAMFFAVLFNAFSSLLEIFSLFEARPITEK
FT                   HRTYSLYHPSADAFASILSEVPAKLITAVCFNIIYYFLVNFRRNGGVFFFYFLINIVAV
FT                   FAMSHLFRCVGSVSKTLSAAMVPASMLLLGLSMYSGFAIPRTKILGWSKWIWYINPLAY
FT                   LFESLMINEFHDRKFPCSQYIPSGSVYNNVPADSRICSSVGAIRGNDYVLGDDFLRESY
FT                   SYLHKHKWRGFGIGLAYVIFFLVLYLILCEYNEGAKQKGEILVFPQNIVRRMKKERKLK
FT                   NVSSDNDVEIGDVSDISDKKILADSSDESEESGANIGLSQSEAIFHWRNLCYDVQIKKE
FT                   TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSF
FT                   ARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADA
FT                   VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHG
FT                   QAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFESHGSHKCPPDA
FT                   NPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEELEWMSNELPKKNTNNSETVHK
FT                   EFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFNNIFIGFTFFKADRSLQGLQNQ
FT                   MLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSRTFSWKAFIVSQILVEIPWNILA
FT                   GTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSCAFYVYIGSLALFCISFNQVAEAA
FT                   ANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVSPLTYLIDGMLSTGVANVAIKCSNY
FT                   ELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSATDTCELCPYSHTNDFLSSVSSKYSR
FT                   RWRNWGIFICYIAFNYIAGIFLYWLARVPKKSGKLAKK"
FT   gene            <208704..>210980
FT                   /locus_tag="CAGL0M01782g"
FT                   /old_locus_tag="CAGL-IPF6355"
FT                   /old_locus_tag="CAGL-CDS0913.1"
FT   CDS_pept        208704..210980
FT                   /locus_tag="CAGL0M01782g"
FT                   /old_locus_tag="CAGL-IPF6355"
FT                   /old_locus_tag="CAGL-CDS0913.1"
FT                   /note="highly similar to uniprot|P18759 Saccharomyces
FT                   cerevisiae YBR080c SEC18"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62398"
FT                   /db_xref="GOA:Q6FK22"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR039812"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK22"
FT                   /protein_id="CAG62398.1"
FT                   /translation="MFKLPGFGKASISHSPPDMSNVNIRPVTLCVTNCPNNTYALANVA
FT                   AVNPADLPDNIYIIVDNLFVFTTRHSNDVPAGTIGFNGNQRTWGGWSLNQDAQVKSFDL
FT                   FKYAGKASYLGTIDMEITFRSRNKAVATPFDQDELAAQFVANFESQIFSPTQYMIMEFK
FT                   GHYFDLKIRNLQAIDLGDIDSSAPVSSGIEVKGILTKQTQINFFKGRDGLVNLKSPNSL
FT                   RPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPAVIEKLGISHVKGLLLYG
FT                   PPGTGKTLIARKIGMMLNAKEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYKSKGEE
FT                   SSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDL
FT                   IDGALLRPGRFEVQVEIHLPDEAGRVQIFEIQTKKMRENNMMSPDVNLAELAALTKNFS
FT                   GAEIEGLVKSASSFAINKSVNIGQGATKIDPKNIAQLKVTRADFLNALSEVTPAFGISE
FT                   EDLKSCVEGGMFVYSERVNALLKHGARYVRQVRESEKSRLVSLLIHGPPGSGKTALSAA
FT                   IALKSEFPFIRMISPNELAGMSEAAKISYIDNTFRDAYKSPMNILVIDSIESLVDWVPI
FT                   GPRFSNNILQVLKVALKRKPPQDRRLLILTTTSAYSVLQQMDILSCFDNEIAVPNLSTL
FT                   DEFNNVMKEAQFLDDSGRMQVISQMQNAGTKINVGVKKVLTNIETARHDDDPVNELVEL
FT                   MTQSI"
FT   gene            <211439..>214294
FT                   /locus_tag="CAGL0M01804g"
FT                   /old_locus_tag="CAGL-IPF6358"
FT                   /old_locus_tag="CAGL-CDS0513.1"
FT   CDS_pept        211439..214294
FT                   /locus_tag="CAGL0M01804g"
FT                   /old_locus_tag="CAGL-IPF6358"
FT                   /old_locus_tag="CAGL-CDS0513.1"
FT                   /note="highly similar to uniprot|P38249 Saccharomyces
FT                   cerevisiae YBR079c RPG1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62399"
FT                   /db_xref="GOA:Q6FK21"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR027512"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK21"
FT                   /protein_id="CAG62399.1"
FT                   /translation="MAPPPLRPENALKRADELISVNEKPAALQSLYEFITARRIRYATP
FT                   SQVEPIVFKFLELGVELKKGKLIKDALYQYKKLVHGSAEGLVSVGAVLRKFIDYVETKL
FT                   ASEQAKAEEKQKEEVSDDLEGGVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWESYR
FT                   TALDLLRNNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYHQSKFGS
FT                   NQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTTRKPKSSTLAN
FT                   YFENLVQIFLVSGDQILHTLAWKKYFELYSTNPNATEEEFKKIASTIFLSALSIQLDDL
FT                   PNVRYNYQSRSYRLLDVETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIMEVEFDGES
FT                   FKGKFEAILPKLEGESYFANYSVSLRDVIIRRMFVFASQKYEDISLNDLYSSVTFSSSF
FT                   KLSEWDIEKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVEEEEEEEEEE
FT                   EEEEKEAEGAEGAEGDTEEGQEAVAEPEPVIKRNYYIRKRLSELYEKLLEDTDYNTVSY
FT                   LDKVRIAREALIKHTKDTIEDMKKNSEERAKMHQERRRQHMESAAMNAEKDAEQRQKRI
FT                   MEERASIEAKLEEEAHRRLIEKKKREFEEVKQREIRKLVDELNAKGNGTKVEYDEVKDM
FT                   DIPDITKYFVNRLSKNKDELEERMNFAVKRMDHLERAYRKVELPLLKKQADELRATDEV
FT                   NFGNMKKKIVDAAKAEYEAKMEDYNRVSSVFDDYKTLRDRMLAAHNEKFAAIRAENAAK
FT                   LEAAKKARIEEVRKQRYEELLARSEAEKKAAEEAERRAKLDEIARKQREMEEALERKSA
FT                   ARTFTQPRAPVVPNANLDEIARKQREMEEAIERKLAGKSAAPAPAPAPAASTPAASTPA
FT                   APGKMSFAERMRLKRQQQQQK"
FT   gene            complement(<215340..>216605)
FT                   /locus_tag="CAGL0M01826g"
FT                   /old_locus_tag="CAGL-IPF6362"
FT                   /old_locus_tag="CAGL-CDS2629.1"
FT   CDS_pept        complement(215340..216605)
FT                   /locus_tag="CAGL0M01826g"
FT                   /old_locus_tag="CAGL-IPF6362"
FT                   /old_locus_tag="CAGL-CDS2629.1"
FT                   /note="highly similar to uniprot|P38248 Saccharomyces
FT                   cerevisiae YBR078w ECM33 or uniprot|Q12355 Saccharomyces
FT                   cerevisiae YDR055w PST1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62400"
FT                   /db_xref="GOA:Q6FK20"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK20"
FT                   /protein_id="CAG62400.1"
FT                   /translation="MKVTSLVYAAMATSVLGQNSTSDDVPSGCSLGSSATATAQSDLDK
FT                   YSGCETIVGNLTITGALGSAALAGVKKIDGSLRIYNATSLGSFAADSVKEITGALNMQD
FT                   LTILTTASFGALEEVDTINLITLPAISTFNTNLQSANNIVVSDTSLESVEGFGSLKEVN
FT                   VLNINNNRYLNSFKSSLESVSGALQFASNADETAVSFDNLIWANNITLRDVQNASFAKL
FT                   ESVNASLGFINNTISTLNLTHLSKVGQSLSVVSNDDLTQLSFLNLTSVGGGLVVANNTN
FT                   LKTIDGLKNVQTVGGAIDITGNFTTLDLSSLKSVRGGATFNTVSGNFSCSPLKSLQSKG
FT                   AIQGDSFVCKNGATSTSISMSSRSRSSSASSSASATVTARSNDTASTSSTKTKKSKGAA
FT                   AQEVFPAGSFFGAVAAVAVALL"
FT   gene            <217235..>217690
FT                   /locus_tag="CAGL0M01848g"
FT                   /old_locus_tag="CAGL-IPF14388"
FT   CDS_pept        217235..217690
FT                   /locus_tag="CAGL0M01848g"
FT                   /old_locus_tag="CAGL-IPF14388"
FT                   /note="similar to uniprot|P38247 Saccharomyces cerevisiae
FT                   YBR077c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62401"
FT                   /db_xref="GOA:Q6FK19"
FT                   /db_xref="InterPro:IPR020233"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK19"
FT                   /inference="similar to AA sequence:UniProtKB:P38247"
FT                   /protein_id="CAG62401.1"
FT                   /translation="MIHSRNVQALLDGMLGGCDVLEGTVPVPALHSVALLSADTGSIIS
FT                   FSKEHDLEHGPAEHDSLNNLRIMALLVKDKFSSDEKKSCEKGYDLDGGHRAYTYDVEDL
FT                   HASVTRIPDSDLLLMLLAHRDFPYGLLNMKLKACVKSFAQLYGYRLG"
FT   gene            complement(<219813..>220760)
FT                   /locus_tag="CAGL0M01870g"
FT                   /old_locus_tag="CAGL-IPF6366"
FT                   /old_locus_tag="CAGL-CDS3459.1"
FT   CDS_pept        complement(219813..220760)
FT                   /locus_tag="CAGL0M01870g"
FT                   /old_locus_tag="CAGL-IPF6366"
FT                   /old_locus_tag="CAGL-CDS3459.1"
FT                   /note="some similarities with uniprot|Q12145 Saccharomyces
FT                   cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
FT                   cerevisiae YPR015c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62402"
FT                   /db_xref="GOA:Q6FK18"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK18"
FT                   /protein_id="CAG62402.1"
FT                   /translation="MIFESNPLNSFMLDDEERFKIDDYLDCFNDMSLPAIQNTTVIQPF
FT                   SMYNESYEKLFNETDSIISDEPSSVFELDTNSRRDTLKSEGFISLEHPDMLQKRDSDSQ
FT                   YHFKNELPYPRDEVVKMAEAYPPSLQKVEESVSPKSSCIQPADDETSNAFDEKFSAQAE
FT                   INKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHY
FT                   KLHFKLSNGAYILPTGEICAEKPTAKQLLQSSKRTSSRVQKKRKTSNTTTSTYVSDGYP
FT                   SEVDVSGSATPLNNDVLCKPYLNVLHQGGEASSI"
FT   gene            complement(<228017..>229039)
FT                   /locus_tag="CAGL0M01892g"
FT                   /old_locus_tag="CAGL-IPF6368"
FT                   /old_locus_tag="CAGL-CDS3235.1"
FT   CDS_pept        complement(228017..229039)
FT                   /locus_tag="CAGL0M01892g"
FT                   /old_locus_tag="CAGL-IPF6368"
FT                   /old_locus_tag="CAGL-CDS3235.1"
FT                   /note="similar to uniprot|P38246 Saccharomyces cerevisiae
FT                   YBR076w ECM8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62403"
FT                   /db_xref="GOA:Q6FK17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK17"
FT                   /inference="similar to AA sequence:UniProtKB:P38246"
FT                   /protein_id="CAG62403.1"
FT                   /translation="MENWIENSSTLFNHNGNNLNLRQFRTYPEELLDTVEDDAHFFPSP
FT                   TNYTKKSSKYETLYLELDHLRPNCKHICGKNKLYLPRSFQHHKLTRMMRLSYESQSYEV
FT                   KKNFKCPPSACILESHLESDTSCNHYSSAGPIKRTDLINYRYLRSRDSRKEIMCRFCLG
FT                   VNWVDSTIYFKHLFLAHGIITRLDNTTDWYHINQKKNNITTIKLEDYMTFYVQEVKSSA
FT                   IQFTRNVLPHVVVRLLPIPSTYYSSIMGSGFRRTHVLCPNCNRYIRIGWCEHDEIIQRQ
FT                   YEDFESLNIQTFKEYSRISYIQTRNRQEIQGVYENYFVHYLECNFRDYDSTCLYIIFTD
FT                   "
FT   gene            <232780..>234810
FT                   /locus_tag="CAGL0M01914g"
FT                   /old_locus_tag="CAGL-IPF6371"
FT                   /old_locus_tag="CAGL-CDS1170.1"
FT   CDS_pept        232780..234810
FT                   /locus_tag="CAGL0M01914g"
FT                   /old_locus_tag="CAGL-IPF6371"
FT                   /old_locus_tag="CAGL-CDS1170.1"
FT                   /note="some similarities with uniprot|P14922 Saccharomyces
FT                   cerevisiae YBR112c CYC8 general repressor of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62404"
FT                   /db_xref="GOA:Q6FK16"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK16"
FT                   /protein_id="CAG62404.1"
FT                   /translation="MSEEFSSWYGDVTRKCGSLAIDLGLSTLAFDQLVKLLEQEKHIST
FT                   ILLLVRLYLKNKDYYNVVTFLVNGRDNEILSDYRVWKAIALSYFKLNNVQDSLNAVDYA
FT                   LKLKSDDQDTLLLKARIMSFLDDSSLKTQYEALISSYSDKSSKEYYQILVCYMQYSRNI
FT                   GDIPKCFEIFQAISQEFSRTQKKRSINFLQVFSYAYQLYASTIYLTEGNINEAGRKRKR
FT                   GYNNDSPLEVINEFLSISERNYNSSLSIQPLKILQGQISFIEGIDLRESINYLNLELQI
FT                   LNNHAATLSEEGVYHKSILNYMIARNMLKLNPHENAQVAYEYFQNSLSLTPNLPFIWIS
FT                   VASLYLTLGQLEDSLATYSQAISLAMSFENVLPPKELSYYKRFAAVAWHGISQVYTVTL
FT                   QLTNAIEALDHAISIVYQEHDVTTEQELTSLRNEYVKLNSQSTPHPNIVYSLPEVSMKL
FT                   LLEYETCRDSFLFQNIDDLEIIDKNNLNDGAIKNFAGQVTTLTTQPPTDQSTLRVLNTA
FT                   NGTNSIAYTQKPPGSEVYTRKQSVTGTPSSAHAQQYGRNPQLSSSMSQTLNAPIQDVRT
FT                   IQQPNGQNIVVGNQILQQQQQQQYTTKQPFVVFNHATQKQELVTPQIVSTENGRYQPQH
FT                   VSMIQGLPQPNPNAYYQVNDGNVVLKPIQSMNNNEFITKVL"
FT   gene            complement(<234892..>237735)
FT                   /locus_tag="CAGL0M01936g"
FT                   /old_locus_tag="CAGL-IPF6372"
FT                   /old_locus_tag="CAGL-CDS0518.1"
FT   CDS_pept        complement(234892..237735)
FT                   /locus_tag="CAGL0M01936g"
FT                   /old_locus_tag="CAGL-IPF6372"
FT                   /old_locus_tag="CAGL-CDS0518.1"
FT                   /note="similar to uniprot|P38244 Saccharomyces cerevisiae
FT                   YBR074w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62405"
FT                   /db_xref="GOA:Q6FK15"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK15"
FT                   /inference="similar to AA sequence:UniProtKB:P38244"
FT                   /protein_id="CAG62405.1"
FT                   /translation="MRFKALLRAIFRFRKTNFSILLIITYAIIIALLVFDRSRYKLDLP
FT                   NATSDKLRRNLLEQAWSDLQVITQSPHPYSSRNNDVVHDFLLQRVKNITRSNDNIYIDD
FT                   DYRNKSSILFHQPDVFNSTSKVSRVVYYESSNIIVKVVGSNNELPALLISGHFDSVPTS
FT                   YGATDDGKGIATMLSLLNHFSSSQPKRSVIFNFNNNEEFGLLGAYAFTYHPWIRDIEYF
FT                   INLEGMGAGDRAVLFRTSNVETAEIYKKAVKSRPFGNSIFQQGFNSRYIGSQTDYKVYD
FT                   EYGLKGWDISFYKPRDYYHTAKDSIQYTSKESLWSMLNQSLQLAIYISNEKLIKKSSSN
FT                   PAVFFDLLGLFFVVVDTKHLFYADIFMLIVGPILLMMKAHLDKRRRLERSRLVQLRLLL
FT                   SLGLSVVFLLLLTKSLNSFNPFVYSADYRTPLTGLFLLFVTVNYLIVTLAERLNPTESY
FT                   KTVAINQIFIIAWLMQLYITLRMAKSDFTLTGTYPLSIFSGCLIVALSLGLFGTKNKAV
FT                   NDAPNSSVRYASSQNDEDNPLPSQDRGENINQVRDTGNQEVTSNTNTDLHSNAEEVDER
FT                   MPLLSNNHIGDSGKMDKNSDFSKHYNWIVQFLCIVPISSFIFLFSLDYTLDAIHKMVQE
FT                   TTDDVQLICIIITIGVILLALPILPFISKLNYQSSVIIAIIGVLLFGKSLVMQPFSEIA
FT                   PLKVRFLQTVNQHDISKSSVSLFTAKDTPIKEMIYDLPSVKSQSTLVNCTVFGGSKICD
FT                   YYGLPPNLVDSEGNRQNKNLMKIEVLKNDNNDTQRSPYAPLSAEIKINVSENRVCSLAF
FT                   WSQSSKQSPVKKFSVIKSNNNNTNSVSNSIKYADGIDEVLIHKLDFNGAHHFSIEWLPN
FT                   IPFDLDYDPVIDGQGDNNIEITVACFTGEADSLSVVNGHPLKKIPAFDEVVKYSPKWYT
FT                   FTNRDRGLVVIKDKIQL"
FT   gene            complement(<238113..>240875)
FT                   /locus_tag="CAGL0M01958g"
FT                   /old_locus_tag="CAGL-IPF6374"
FT                   /old_locus_tag="CAGL-CDS0569.1"
FT   CDS_pept        complement(238113..240875)
FT                   /locus_tag="CAGL0M01958g"
FT                   /old_locus_tag="CAGL-IPF6374"
FT                   /old_locus_tag="CAGL-CDS0569.1"
FT                   /note="similar to uniprot|P38086 Saccharomyces cerevisiae
FT                   YBR073w RDH54"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62406"
FT                   /db_xref="GOA:Q6FK14"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK14"
FT                   /inference="similar to AA sequence:UniProtKB:P38086"
FT                   /protein_id="CAG62406.1"
FT                   /translation="MQLPRYENKPFKPPRRIIPSGTVPRPVRSVGGSTASTFGVKRTYA
FT                   QTAELQPARSNDTSDRSKTDTTRRYFTIMYRKYTTKKNKTWNGDGYAILILDAAIKLII
FT                   YNEQGKPLGSSTKVNIDTLFDSIYTTKGLEFQLDYEIFDTDEIRKVRILLGKEPDSNLI
FT                   PSQTSSSQQNAIDKGISSELPVSQLFTKSTKKFISPTLKTNPNARPISSMNKQIAKTNR
FT                   PENTVPTQKFRSLFDCNTIENPLIMNTFQGSEVDIIVDPLLCKMLRNHQRIGVKFMYDC
FT                   LLGLETNLTAESTDDKSCRLERDSDIKGCILADDMGLGKTLMTITLIWTLLKQTPFASK
FT                   VQCSQLGVPLSGMISKVVIVCPVTLIGNWKREFKKWLGLNRIGILTLNPKNNVDMDKIS
FT                   VRNFIKVNRTYQVLILGYEKVLTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKS
FT                   LDIDKKVILTGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNT
FT                   KVIEQGEEKSNQLIEFTKRFILRRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIEN
FT                   VRVDMNNITFNTSLGLINLMKKVCNSPSLLCNDPYYQSNVDSNIFTVSNKSNSSGKLTV
FT                   LLELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNT
FT                   FNNNPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYI
FT                   YRLITTGCIDEKILQRQLMKHNLTRKFLSSNTSDTGSANDDLFDKSDLKDLFTIHQNTK
FT                   SNTHDLICRCDGLGEEFDDDEEVLKAPALDGSFEQWSNALDAKRKMDVLESQRTQLEKK
FT                   LLKQCLLDYKHIDPDRSLDLYDDVATEVYKKGKKNITFAFIKVGNVIIE"
FT   gene            <241386..>243596
FT                   /locus_tag="CAGL0M01980g"
FT                   /old_locus_tag="CAGL-IPF6375"
FT                   /old_locus_tag="CAGL-CDS0979.1"
FT   CDS_pept        241386..243596
FT                   /locus_tag="CAGL0M01980g"
FT                   /old_locus_tag="CAGL-IPF6375"
FT                   /old_locus_tag="CAGL-CDS0979.1"
FT                   /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
FT                   YPL164c MLH3 insertion and deletion mismatch repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62407"
FT                   /db_xref="GOA:Q6FK13"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR028830"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK13"
FT                   /inference="similar to AA sequence:UniProtKB:Q12083"
FT                   /protein_id="CAG62407.1"
FT                   /translation="MIHVLPKETWQVLRADTQITGIDSVLRELLQNAVDAGASTVDVSF
FT                   SIKKNMCMVADDGCGMTRKDLDLLGRPHITSKIRNFRDLERFGNGNGTMGFRGEAIFAI
FT                   SQISELTMMTKHSDFRAHYWRDFPMTSVLTTEEDIRSSLHAQYLSTTPFYEDIWARSSG
FT                   TVVIVSDLFKYIPVRKKTLENVPVATITDSIREDFYQILVRNPNLKLNIFTFDDNYKNF
FT                   EFLNHVKEQYLHSLGSIPIHNAFIRVYGHVVPDPSIKIVKLSFREYNITGLISNCQVRS
FT                   KSFQFVFVNGRRYSNSEFLGKINRIFDQSTFATNAVEKDTRLGKRSARSYPLFVIKIDG
FT                   PAHVQDLIQSTSKDIIHLSDGKLINILILKVIYSFLKDQGFLTEIPTQLNDDNCDRIDQ
FT                   LGTLEEPIFMDNDFHRDFVIRNNVKMAKYNKVSHANISHPWKRQRLDYPVRRTSKWWKE
FT                   RSVNELHQSRISTKFAPIKKWAAYEKLHVFDYKDRFLSRSDDLKEVDVVNQVDQKFILL
FT                   RQKSARGNFELYIIDQHACDERIRLESFLKQYICDIMANALAVQKIFQSRIEIAISEKE
FT                   NFEQYRHEFSKWGIYYNVVHSNNNYSLDIFALPDMLADKIKANEELKDMMLQHIFDLKD
FT                   GSRSRIKTISSLDAQFLSGGWWSNVNKIPSFIRRFFDSKACRSAIMFGDTLNLQECRDL
FT                   VRRLNGCIQPNFCAHGRPSVVELIGHQHQWELKNFTADYDYD"
FT   gene            <243827..>244951
FT                   /locus_tag="CAGL0M02002g"
FT                   /old_locus_tag="CAGL-IPF6377"
FT                   /old_locus_tag="CAGL-CDS2944.1"
FT   CDS_pept        243827..244951
FT                   /locus_tag="CAGL0M02002g"
FT                   /old_locus_tag="CAGL-IPF6377"
FT                   /old_locus_tag="CAGL-CDS2944.1"
FT                   /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
FT                   YPL165c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62408"
FT                   /db_xref="GOA:Q6FK12"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK12"
FT                   /inference="similar to AA sequence:UniProtKB:Q12529"
FT                   /protein_id="CAG62408.1"
FT                   /translation="MTVTESYLQISEYFDINETSWGGRACFSKRDLNNGQVVLEVEDCM
FT                   GTSIDYDFRKEVCHYCYKYNNGKSMKVKISFNDLQDCLYEFPQLATYKAKFKGAGLWFC
FT                   CDTCRDKYLSIHNITELIESYEILLESFMRMIKNKSLLEEQEQDYNGITITKEYIDNTW
FT                   EDITTRWIPMVRKTKATKRAKFLPQISEDEYNCCRFVSETLFRIKHLDPGSDTLEAFHN
FT                   LQSNELSKIQKFPVLLNFQVLVFKTLFVLLPDNLKNSLTVQAFRHILGSEYGNAFGIWQ
FT                   DTEAVDSREYFGYWVFPKASYFNHSCDPNITKTRIDRKMVFTLNRDVACGEELNIDYSG
FT                   VLDLPVDRRQKFLFENWFFVCGCNRCNSDLKLVH"
FT   gene            complement(<244928..>245581)
FT                   /locus_tag="CAGL0M02013g"
FT                   /old_locus_tag="CAGL-IPF6378"
FT                   /old_locus_tag="CAGL-CDS4282.1"
FT   CDS_pept        complement(244928..245581)
FT                   /locus_tag="CAGL0M02013g"
FT                   /old_locus_tag="CAGL-IPF6378"
FT                   /old_locus_tag="CAGL-CDS4282.1"
FT                   /note="similar to uniprot|Q12092 Saccharomyces cerevisiae
FT                   YPL166w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02013g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62409"
FT                   /db_xref="GOA:Q6FK11"
FT                   /db_xref="InterPro:IPR039113"
FT                   /db_xref="InterPro:IPR039362"
FT                   /db_xref="InterPro:IPR040666"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK11"
FT                   /inference="similar to AA sequence:UniProtKB:Q12092"
FT                   /protein_id="CAG62409.1"
FT                   /translation="MNSKNTIVYVKVKGKRPDGFVDPPVFEWNIQKEKKLWSLLSQLND
FT                   PDKEIDWALLAEGLDAPIYFLKRRCYELFTKHFELLRQQIDRKNKNALTDRSETPERDS
FT                   TEEITKEVNFLNQLPVRTPGTIQEEFNEDNGPKDKNKTPDTTKKAIEQLKSSRILNFKG
FT                   NKLDYNNREVGLTRYDSTYEKEGVHTEETESELSSSLGVSKSTLEEALMDKLQI"
FT   gene            <245848..>250293
FT                   /locus_tag="CAGL0M02035g"
FT                   /old_locus_tag="CAGL-IPF6379"
FT                   /old_locus_tag="CAGL-CDS0112.1"
FT   CDS_pept        245848..250293
FT                   /locus_tag="CAGL0M02035g"
FT                   /old_locus_tag="CAGL-IPF6379"
FT                   /old_locus_tag="CAGL-CDS0112.1"
FT                   /note="similar to uniprot|P14284 Saccharomyces cerevisiae
FT                   YPL167c REV3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02035g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62410"
FT                   /db_xref="GOA:Q6FK10"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR030559"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK10"
FT                   /inference="similar to AA sequence:UniProtKB:P14284"
FT                   /protein_id="CAG62410.1"
FT                   /translation="MISGEETDSIQDGANEVEFDSFDLQLNNYDHYMAYPTSLDRTHGS
FT                   SLPLKKFHKVPVIRIFGCLRTGHQLLCHVHGIFPYFFVKYDGKEDDTSIIINEKCAKLH
FT                   QLLEQILRDKMKSKGSRNDKQDETNLNELVYIANVSVVKGVPFYGYHVGWTPFYKISLL
FT                   NPSLSEQVCNIIREQNVLQNGQNEVYESQFPYLLKFTADFNLFACSWINFKKVYFRAPV
FT                   LNEMLNMDEIMMTKELRVLLDRFHSKDTVLKKTMFPRIGNGLLEIDVIPQFIKNIDQIK
FT                   IRNIHHDLSEKKESVNYLDDGPYVSSTKNMLKDVEIQRKLYSLEEYKKAADISRNENDM
FT                   IWNSSHQFEMFLRKALSSVKVSDKDSNFLSGHFNANDFLKTPFEMIDELWPTKFESSID
FT                   LNDENERHDKNDQLLDVGEDFDKAEERDEDILGEPNEDDYIEKEMHSQDNGQFINVSTS
FT                   VISTTQSLDKLLTQSIVKNQRKLKIGNVLSDLGNVATNYHNYFPSNIKKYYRYKQCNIS
FT                   YSSMNEDLQDNGLPINDYMGPFFSDPCDLHKKDYQYAGKQFDITSTHLMKRYPLDFKED
FT                   LVRLTKQRLDNDVLFASWKYLKMPPSFNDVAESVTRKERARHSISQIKKPTATKSLGNT
FT                   SSIKRSESIHDNLTHFSLEIHVNTRGDLLPDPRKDEVSVIFWKVDSDTFPFSIDLQLEG
FT                   IMYTNKLERENLIETLESISGGVPIMEYEDEFSMFDALTDLILLFDPDLLSGYEIHNSS
FT                   WGYIFERSLSVHKFNIANEISRVNMGAQFKLRDSWGFKKSSGISITGRYVLNIWRLLRK
FT                   EIAVTQYSFENMVHLLLKIRLPKYSCSHLTSLWSNFKTGNELKTFLNYYLTRVRLNIGI
FT                   LKKISFTLNVMEEARLIGIDFQSVYNRGSQYKVESFLIRICKSENYILLSPSKVAVQKQ
FT                   KPLECVPLVMEPESAFYKSPLLVLDFQSLYPSIMSGYNYCYSTMMGRVRELDGTKRTLG
FT                   VTNFELKSELLKKLRDDIRIAPNGVIYAKEHLRKSTLSKMLSEILEIRFMIKKTISDLG
FT                   SDHQALKKLLESKQLALKLLANVTYGYTSASFSGRMPCSDLADSIVQTGRETLEKAVKM
FT                   IESTASWGAKVVYGDTDSLFVYLPGKTKEDAFRIGAEISNSITASNPKPITLKFEKVYF
FT                   PCILLSKKRYVGYSYLSSSQLNPHFDAKGIETVRRDGTPAQQKVVENALRILFETKDLS
FT                   KVKNYVVDTFTKIRSGNISIQDFCFAKEIKLGHYKSESTMPPGAVVAKRLKKQDSRAEP
FT                   QYKERLSYLVVKGKSGQILRERCVSVSEYFSNDHFALDSEYYITKTLIPPLDRLFNIVG
FT                   ISVSDWNQEGPMFVEGSIKPYTGADNIPTSTRCKACEQNTVSGDSYLCDNCVSNEKMAA
FT                   SKLIIKIQASASKLKVLNDICRICSRQYTGDMGLLSSNNALKCVSYDCPNYYSKLKAQR
FT                   LMQSKHYYSWNELLHNMDHW"
FT   gene            complement(<250402..>251271)
FT                   /locus_tag="CAGL0M02057g"
FT                   /old_locus_tag="CAGL-IPF6380"
FT                   /old_locus_tag="CAGL-CDS3692.1"
FT   CDS_pept        complement(250402..251271)
FT                   /locus_tag="CAGL0M02057g"
FT                   /old_locus_tag="CAGL-IPF6380"
FT                   /old_locus_tag="CAGL-CDS3692.1"
FT                   /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
FT                   YPL162c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02057g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62411"
FT                   /db_xref="GOA:Q6FK09"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK09"
FT                   /inference="similar to AA sequence:UniProtKB:Q12042"
FT                   /protein_id="CAG62411.1"
FT                   /translation="MGPIKPGMDNCQLLGPASLLVQCLMGISALALLLFKRNHEHPRRK
FT                   MEIWLFDIGKQIIGALGIHFINVGISVLKRHHEKKAYLFISIIGNLIESVSSTREDDGS
FT                   DEQCDWYFLNLLLDTTVGIPILWLAINCITYILQYLNIKNVESGNYFAEEENDIESQES
FT                   EQPLITAFFKQLGIFTSSLIVMKICVYLVLNYFEDLAYWFANLILSWSDRWPDLQVTLV
FT                   MFVFPIILNCFQYFCVDNVIKLHSDDVNNYNSKSFEPEEVIQEEYTNLISGAQKKDKNK
FT                   QSAYETIS"
FT   gene            complement(<251658..>253472)
FT                   /locus_tag="CAGL0M02079g"
FT                   /old_locus_tag="CAGL-IPF6381"
FT                   /old_locus_tag="CAGL-CDS1486.1"
FT   CDS_pept        complement(251658..253472)
FT                   /locus_tag="CAGL0M02079g"
FT                   /old_locus_tag="CAGL-IPF6381"
FT                   /old_locus_tag="CAGL-CDS1486.1"
FT                   /note="similar to uniprot|P39011 Saccharomyces cerevisiae
FT                   YPL161c BEM4 bud emergence protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02079g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62412"
FT                   /db_xref="GOA:Q6FK08"
FT                   /db_xref="InterPro:IPR040144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK08"
FT                   /inference="similar to AA sequence:UniProtKB:P39011"
FT                   /protein_id="CAG62412.1"
FT                   /translation="MDYETLLFELKPLLDIEQLKVANIDESNVQVYTSALEKCSQGARI
FT                   ESNRTIIGRSGLLDSLTESLAFLLEQEFTVDTQSNKNILLIISEIVRVLANSFADNDDN
FT                   RNIFFDKNRFLANPIIETYFAKVLALNLQQNDPDVIITLQMRLAAMVKNLIVDNRNYVT
FT                   HYAAFLCPTSYLRLDSINLTSENEVQMALFIAELIDAILEFDKKGATLDEMKIVSTLYY
FT                   QLSTYITSASVEIDDGDDEEPLIELLATLTNIAEIVFSIDGTFNFDKQQETKDIIQKNI
FT                   LQTIDNLEELKFHNKLIIMRRLVTTSGYIASDKSNTTHSEMNMCLNHLRNENPSPYTIG
FT                   AIFINITNAIRSTEESKELEQTLSIPDIICYSKKLSDPVQFQGVLDLLKKVLNLSNTLL
FT                   LPNDSLQGIANLLTYSNEQAQYFQGLIPLVNGLLNKLLTVIPSSKIEFIFQGNISEGFV
FT                   KLICKNGSISASLALDKLLLVKNPIKKDITDRLWECLFHFDQVAKENNTSESANVYLLF
FT                   QVAKTLGVYLRNTIDKPTEIQDFLLYQYEDQLVFLLSQILDLRDKNVRGSESAMNNGKF
FT                   VAGLIIDAKKSVRTTDDDRLLAICKQFF"
FT   gene            complement(<254024..>254827)
FT                   /locus_tag="CAGL0M02101g"
FT                   /old_locus_tag="CAGL-IPF6382"
FT                   /old_locus_tag="CAGL-CDS3851.1"
FT   CDS_pept        complement(254024..254827)
FT                   /locus_tag="CAGL0M02101g"
FT                   /old_locus_tag="CAGL-IPF6382"
FT                   /old_locus_tag="CAGL-CDS3851.1"
FT                   /note="some similarities with uniprot|Q99373 Saccharomyces
FT                   cerevisiae YPL159c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02101g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62413"
FT                   /db_xref="GOA:Q6FK07"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07"
FT                   /protein_id="CAG62413.1"
FT                   /translation="MSVSLVLCTWGGAARTARVYRVVKQAMIRTMFVRLRSAGQVRYQS
FT                   SFSFPSSQSLLQKGQLGKKKRSVRKLGLGISDKKQYNSGVTSAAQEAGGAVRDLKSEKA
FT                   QTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMK
FT                   LEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVVNSRKLNGATGENANDF
FT                   DEQGNFQKKAFFDKVQSILNRNGKGGRKRPGVTVLKHLKKLKEQN"
FT   gene            complement(<255200..>257236)
FT                   /locus_tag="CAGL0M02123g"
FT                   /old_locus_tag="CAGL-IPF6385"
FT                   /old_locus_tag="CAGL-CDS1161.1"
FT   CDS_pept        complement(255200..257236)
FT                   /locus_tag="CAGL0M02123g"
FT                   /old_locus_tag="CAGL-IPF6385"
FT                   /old_locus_tag="CAGL-CDS1161.1"
FT                   /note="similar to uniprot|Q99299 Saccharomyces cerevisiae
FT                   YPL158c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02123g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62414"
FT                   /db_xref="GOA:Q6FK06"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK06"
FT                   /inference="similar to AA sequence:UniProtKB:Q99299"
FT                   /protein_id="CAG62414.1"
FT                   /translation="MSGMIIRTPTRTKTKSFNGKQMDFTFPSPVRGSVDEHSLDNHRIV
FT                   NETLSLKPQEDIEVSSQMLSDYTSSASNANTYSGNSSNGYYSFANISDNTTASPKLHNH
FT                   NNMVSPILENTESSFQLQTVESLDPQRQRIRSTYEYGHMGSNQNLRQTREKSKTAESIS
FT                   TTIAQQTIPTADNISFDFSDISGYEDAVSNKSENKNHKPQNSVVKNQLRATSRAAISTN
FT                   DSPSLSNVYMSSLINSSLESTRKTSTASSSVRSSRSSLKRSNAVRCKGGLLQYFTKLGI
FT                   KIRKNCNKLRLVMRRKLFRFKKNSKSFSRSNSIRSGLEISKLPKVRHEKKLRQESSSIA
FT                   PHTLHQKRTHGFNNKLHKSMSLKSLQPALVSETVPEINNNLHDILESKEKTADVPAATK
FT                   TMKTTPSLRRTPSSIRRAASILTSNVATPKASANNRNSMIEYDTVENSRISSRNSSIKS
FT                   KGRLVRSSGSVGLSSIARQPSIVVKNKVIPLSMSRFSIKEEIKEEEEESEESTSDYYVE
FT                   TEPVEAAPRTLAGPKSYAPENFRYGANVDDIKTLYKHYLSTVISRRIKMRLEMAQGEHS
FT                   ATNEPALTHQSTASLKDPIASVLTEYDSEGSEGTNLFDDEDDSSASEEDDEVVLPPLKG
FT                   HNSTMSFVVQSPFTRQNSMASSSALLYLPVKRSLTLPIGMKIT"
FT   gene            <257734..>258735
FT                   /locus_tag="CAGL0M02145g"
FT                   /old_locus_tag="CAGL-IPF6387"
FT                   /old_locus_tag="CAGL-CDS3301.1"
FT   CDS_pept        257734..258735
FT                   /locus_tag="CAGL0M02145g"
FT                   /old_locus_tag="CAGL-IPF6387"
FT                   /old_locus_tag="CAGL-CDS3301.1"
FT                   /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
FT                   YPL157w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02145g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62415"
FT                   /db_xref="GOA:Q6FK05"
FT                   /db_xref="InterPro:IPR019012"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK05"
FT                   /inference="similar to AA sequence:UniProtKB:Q12052"
FT                   /protein_id="CAG62415.1"
FT                   /translation="MGPGLAVEIRRGLTATTMAHRKWLVRGSDLRKDILRKSSKRYRKY
FT                   GRSKKCFKELVQLLLKDEFLVDNNKPPSSKAGTQKELVKYWRKRRTLFSKVNSMPIYMT
FT                   SELWFSVTPERIARFLANFISACLPNAKRILDVFSGGGGNSIQFANVFDRVYCLDSNLE
FT                   HLYCSIKNGQSYGVSNKLWMCKGKWGEHTAKKFRKLNIDCIFGSPPWGGPEYIKDEKYD
FT                   LEKSLLPFGLYKLLKTFKIVSDNIILFLPKNSNLDQLSETTKEVFGPEAKCKVLYIKEQ
FT                   GYLKGMLCLWGSAFTNYQQDTASDSEEEEGEELNESDKSKNANIYINYDIDG"
FT   gene            complement(<259132..>259833)
FT                   /locus_tag="CAGL0M02167g"
FT                   /old_locus_tag="CAGL-IPF6389"
FT                   /old_locus_tag="CAGL-CDS4361.1"
FT   CDS_pept        complement(259132..259833)
FT                   /locus_tag="CAGL0M02167g"
FT                   /old_locus_tag="CAGL-IPF6389"
FT                   /old_locus_tag="CAGL-CDS4361.1"
FT                   /note="some similarities with uniprot|Q12498 Saccharomyces
FT                   cerevisiae YPL156c PRM4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02167g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62416"
FT                   /db_xref="GOA:Q6FK04"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK04"
FT                   /protein_id="CAG62416.1"
FT                   /translation="MSKEKADNIQWTRAKRGLGGTVFVLVLLLLTFGNVLGIFSTDIPI
FT                   QSIIASTDSLNSNALIGKASVNSIKKESNNLNSVAHTSMSSSSVAKDGTVIEYDPEKNF
FT                   KQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHK
FT                   IKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENI
FT                   VFNKRDLPSNS"
FT   gene            complement(<261290..>263308)
FT                   /locus_tag="CAGL0M02189g"
FT                   /old_locus_tag="CAGL-IPF6390"
FT                   /old_locus_tag="CAGL-CDS1189.1"
FT   CDS_pept        complement(261290..263308)
FT                   /locus_tag="CAGL0M02189g"
FT                   /old_locus_tag="CAGL-IPF6390"
FT                   /old_locus_tag="CAGL-CDS1189.1"
FT                   /note="similar to uniprot|P28743 Saccharomyces cerevisiae
FT                   YPL155c KIP2 kinesin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02189g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62417"
FT                   /db_xref="GOA:Q6FK03"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK03"
FT                   /inference="similar to AA sequence:UniProtKB:P28743"
FT                   /protein_id="CAG62417.1"
FT                   /translation="MSASRDSEKYRFETPRVMKSPSPSLDSAVSISSYARSRSSVTRGF
FT                   RNGSSSGSSSRSSSPLRPGSFGGDPYLQYGKIRNRSESSSYENGSGNLDKYTGTIKVVI
FT                   RPKPYPTEKIVSWKIHGDKVISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEG
FT                   YNATIFAYGMTGSGKTFTMSGTEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLE
FT                   IYNEKINDLLDVASGSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQKRCDT
FT                   SEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDLAG
FT                   SERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSS
FT                   GNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNVALDVS
FT                   RVYKRINRSAHPFSSPSKLDGGDDRSEQRIQELLIQLQTRDRELAKLREVSAGVASGTM
FT                   NGAQQNLHPDTQLLTKENLLLKNKLKHYESLLVEDGMGVSGASTRNTSNSSSSSTLVSS
FT                   SPALDNKGRYAGTNSTGVDAELEEIAQLLPSEVAVMLETKFDNLRRQLQSAHRYSESLE
FT                   KQLNDSHTETEQLKRSLQTKDKLIEALTSAKRLQQQQ"
FT   gene            complement(<264202..>265449)
FT                   /locus_tag="CAGL0M02211g"
FT                   /old_locus_tag="CAGL-IPF6391"
FT                   /old_locus_tag="CAGL-CDS2671.1"
FT   CDS_pept        complement(264202..265449)
FT                   /locus_tag="CAGL0M02211g"
FT                   /old_locus_tag="CAGL-IPF6391"
FT                   /old_locus_tag="CAGL-CDS2671.1"
FT                   /note="similar to uniprot|P07267 Saccharomyces cerevisiae
FT                   YPL154c PEP4 aspartyl protease Saccharopepsin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02211g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62418"
FT                   /db_xref="GOA:Q6FK02"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033819"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK02"
FT                   /inference="similar to AA sequence:UniProtKB:P07267"
FT                   /protein_id="CAG62418.1"
FT                   /translation="MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFEA
FT                   HVQQLGHKYVSQYEKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKF
FT                   KVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISE
FT                   DNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHL
FT                   LDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYWEVPLN
FT                   AIKLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQYTLECSTRAK
FT                   LPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVF
FT                   DLDANVVSLAEAVHSA"
FT   gene            complement(<267332..>269635)
FT                   /locus_tag="CAGL0M02233g"
FT                   /old_locus_tag="CAGL-IPF6625"
FT                   /old_locus_tag="CAGL-CDS0895.1"
FT   CDS_pept        complement(267332..269635)
FT                   /locus_tag="CAGL0M02233g"
FT                   /old_locus_tag="CAGL-IPF6625"
FT                   /old_locus_tag="CAGL-CDS0895.1"
FT                   /note="highly similar to uniprot|P22216 Saccharomyces
FT                   cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02233g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62419"
FT                   /db_xref="GOA:Q6FK01"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK01"
FT                   /protein_id="CAG62419.1"
FT                   /translation="MMETQPTQQATQATQKYLIDNFTQEQIKKNSVYRVICTSGQIPIK
FT                   DMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRDIS
FT                   TNGTWLNNQRIEKDRNHLLSQGDEITVGLGVSSDIISLVIFINEKFRDYLEEVRQELSS
FT                   QGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKIINKR
FT                   KVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAV
FT                   GEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS
FT                   IMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF
FT                   SGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIK
FT                   QCSSQFDANSMSSQVSLSQSMSQQKALESLDDAQYEFLKAQKKLQQDEPINDKLKDFKV
FT                   PTQPPTRFTQPKVINPIENIKKYTKSVKKKGSGKFMTFKPLPESVIQESFEIKQGINPF
FT                   FIGRSDDCNCRIDDNRLSRVHCFILKKRHPIGKSIYESPAQGLDDIWYCHSGSNDSYVN
FT                   DIRMTPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGLGIPNEERSVTSQ
FT                   TEDELKLVSRLAKIMAAQRSSTKEANETMDQNRNLLKKVHSVSLSQSITDPSRKVKRAK
FT                   LDQTDHNAENMQFF"
FT   gene            <270614..>271690
FT                   /locus_tag="CAGL0M02255g"
FT                   /old_locus_tag="CAGL-IPF6624"
FT                   /old_locus_tag="CAGL-CDS3095.1"
FT   CDS_pept        270614..271690
FT                   /locus_tag="CAGL0M02255g"
FT                   /old_locus_tag="CAGL-IPF6624"
FT                   /old_locus_tag="CAGL-CDS3095.1"
FT                   /note="highly similar to uniprot|Q12461 Saccharomyces
FT                   cerevisiae YPL152w RRD2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02255g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62420"
FT                   /db_xref="GOA:Q6FK00"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK00"
FT                   /protein_id="CAG62420.1"
FT                   /translation="MIPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVS
FT                   EPVSDSVQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHF
FT                   PALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVL
FT                   VLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNE
FT                   ELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKMYKAEV
FT                   LGKLPIMQHFYFSEFLVCPEGISEPRTHIHNGDEDDDQCCQDGAAHNTWGDCCGIKIPS
FT                   LYAANAMEKQSHKPIPFD"
FT   gene            complement(<271836..>273119)
FT                   /locus_tag="CAGL0M02277g"
FT                   /old_locus_tag="CAGL-IPF6623"
FT                   /old_locus_tag="CAGL-CDS2592.1"
FT   CDS_pept        complement(271836..273119)
FT                   /locus_tag="CAGL0M02277g"
FT                   /old_locus_tag="CAGL-IPF6623"
FT                   /old_locus_tag="CAGL-CDS2592.1"
FT                   /note="highly similar to uniprot|Q12417 Saccharomyces
FT                   cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02277g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62421"
FT                   /db_xref="GOA:Q6FJZ9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ9"
FT                   /protein_id="CAG62421.1"
FT                   /translation="MSIGDELVDADEVYRQARWKNQFEVLSKLPRVLQERVDAQKPVIE
FT                   ASGNSATPSNASRALVRHQQNPGDVGLVLNKKFADEQGHESVIERHDKLLNQTPRWHAP
FT                   WHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRD
FT                   LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDS
FT                   VVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLT
FT                   HHQRTVRDISVHPSEFSFASACTNDIRSWLLPKGELLTNFVSQDLDVINTVSINQDDVL
FT                   FAGSDNGSLTFFDYKSGHKYQTFKTKEAPGSPESERGILSSTFDGTGLRLLTGETDRTI
FT                   KIWKQDETASQDTHPNLPWNPKLDSQRL"
FT   gene            <273725..>276406
FT                   /locus_tag="CAGL0M02299g"
FT                   /old_locus_tag="CAGL-IPF6622"
FT                   /old_locus_tag="CAGL-CDS0612.1"
FT   CDS_pept        273725..276406
FT                   /locus_tag="CAGL0M02299g"
FT                   /old_locus_tag="CAGL-IPF6622"
FT                   /old_locus_tag="CAGL-CDS0612.1"
FT                   /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
FT                   YPL150w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02299g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62422"
FT                   /db_xref="GOA:Q6FJZ8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ8"
FT                   /inference="similar to AA sequence:UniProtKB:Q12152"
FT                   /protein_id="CAG62422.1"
FT                   /translation="MINAIQPPTKAEQNNIKAIIGNSYNRLYSQFSSSELTEVGNYKIQ
FT                   KQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYITKLYEVIVT
FT                   ETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLNCVHRDLKLEN
FT                   VLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVI
FT                   LYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSA
FT                   ILLHPFLQPYGTLILEQTNKIILKQKQGGSQFSSRLERRLIKKMKRIGYDTQAIRQSVI
FT                   KKKCDSLSGLWFLLAEKEKKIDDKNRPRRSRSLLSVRKVFDDSTQDLLTGDDGLLTTSL
FT                   EVTRVGSIGKILNKQAERVTSLAPMGVKKSIDFSTRSLNLTLTNTNQSQDNNTKNQESV
FT                   TFSKEQVRRVQSGTNASTQNEQSPKKTNIFKKMSKFFKEKKYFSNLNNEESASSTNTMR
FT                   RSLETSLGASSHNKESVSPEKGNSINEDENRNEKFDSTDKRKPIKQSEKATMVLLPEDR
FT                   HKLTITEPNVTRLKSSSVTSRQTSTDNDDSESMDNSRSGSAEIKKRNLVPTARPFSGLS
FT                   EISNDTYNSDYSTDGNTSSYRVNDPPLSQIMKTNSGGTSQYSGNSEKLTNGTGRRYIRR
FT                   NQSLISNASSASEKSSRTDSFYDITTASPPAFIDNRSKNNFGLKESILPRFGAHHSWGP
FT                   KRSYASNRVGSLGRRAQKRNYLKNNSSRTTQSIIKEEDSSDNDETDVSYHSYRYNNNKS
FT                   PLNAFRSGGTPEYGEDKLISSSPLQTFGNVEHTPPKSATDSPEAFNGIYAPVVSNRIPS
FT                   KNIVEDEELISAADLEDNFSDD"
FT   gene            complement(<276554..>277990)
FT                   /locus_tag="CAGL0M02321g"
FT                   /old_locus_tag="CAGL-IPF6620"
FT                   /old_locus_tag="CAGL-CDS2205.1"
FT   CDS_pept        complement(276554..277990)
FT                   /locus_tag="CAGL0M02321g"
FT                   /old_locus_tag="CAGL-IPF6620"
FT                   /old_locus_tag="CAGL-CDS2205.1"
FT                   /note="weakly similar to KLLA0F11341g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02321g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62423"
FT                   /db_xref="GOA:Q6FJZ7"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ7"
FT                   /protein_id="CAG62423.1"
FT                   /translation="MSVRRLDNVVDSKYLWQPVDGIESNSDAKLEDTYLCFGIFWLDIY
FT                   ADYQHQLEELQKHQVRIEQSLNDCNIHYPWSNIEGVAMEIRFLSEDKGKRPYLFGYHCV
FT                   EDNIEAEEGIVVSLLFEYLKESGPEVFMKICDTDGDFLIDKFEDLMPDVYAFPSANNRL
FT                   WLHEGKFKAIPASFKPGRGIESSECIEFLSKQMFKCEVLTKMQDAFEKEILNSFPHSYL
FT                   DELKLIKLAIPDDMCHSGLKLNPGLGSYLIKQSLENTDTAGGSVATIVEQAKQSPTTYD
FT                   LLVPASHLRILSTVQFNVTGKEKDCYDPHICGWILCNTFSRLIKTGKILYKPNSKRLTD
FT                   PDSIFANFPFKEVRKIKEVEKIFADMNENLYGAQTFNNKTKSKLAAKDYEVSKDDEARK
FT                   YFKSENVDIDEDDFFEYFLTEALGVSKKELDEYTTSNISNGLKEDGIPQTDDIGDDCDL
FT                   EMSDEILQKLLESFKMGNMQ"
FT   gene            <278407..>279219
FT                   /locus_tag="CAGL0M02343g"
FT                   /old_locus_tag="CAGL-IPF6619"
FT                   /old_locus_tag="CAGL-CDS3830.1"
FT   CDS_pept        278407..279219
FT                   /locus_tag="CAGL0M02343g"
FT                   /old_locus_tag="CAGL-IPF6619"
FT                   /old_locus_tag="CAGL-CDS3830.1"
FT                   /note="weakly similar to uniprot|Q12380 Saccharomyces
FT                   cerevisiae YPL149w APG5 involved in autophagy and nutrient
FT                   starvation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02343g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62424"
FT                   /db_xref="GOA:Q6FJZ6"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="InterPro:IPR042526"
FT                   /db_xref="InterPro:IPR042527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ6"
FT                   /protein_id="CAG62424.1"
FT                   /translation="MGDSKELVWNGSINVQIKLDSRLLVDGVPEGRRLVNIRVPRESHI
FT                   AIYTPLVLERLRNVLRSDIEELLPKVWYSYKDISLPWSIPFGTLFDIYNGAHKGISGSR
FT                   DNYINVWKLNLVTDEKFPINVIPIIEGQDQLRKFMMQSWKQCCFILNGSSKRVMSLSLQ
FT                   DSLEVWEGVTERDYAKYSGVIKRILPRTPRRIPVAIHAANGGPIVQTTEPTLTDTSFSQ
FT                   AVEGIVKADFVVCQGIVMYLRDFSDTSLYDVYDKLHSIDGYLHLIANL"
FT   gene            complement(<279263..>279721)
FT                   /locus_tag="CAGL0M02365g"
FT                   /old_locus_tag="CAGL-IPF6618"
FT                   /old_locus_tag="CAGL-CDS4816.1"
FT   CDS_pept        complement(279263..279721)
FT                   /locus_tag="CAGL0M02365g"
FT                   /old_locus_tag="CAGL-IPF6618"
FT                   /old_locus_tag="CAGL-CDS4816.1"
FT                   /note="weakly similar to uniprot|Q12036 Saccharomyces
FT                   cerevisiae YPL148c PPT2 phosphopantetheine protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02365g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62425"
FT                   /db_xref="GOA:Q6FJZ5"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR016614"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ5"
FT                   /protein_id="CAG62425.1"
FT                   /translation="MSVLGVGCDVVHLPRMHRLLTKYDAGSRGFQRVVSKFMHPTERIA
FT                   LGVDGASLSAGQIRYIAGTWALKEAALKALHCAAPLHTVLPPAMFIYTKLLYRQRRSNG
FT                   VPQLLLDNEALRLDQLQFLRQAKFLSTLSHDNEYLVAYTTLIDTKNLV"
FT   gene            <280372..>282942
FT                   /locus_tag="CAGL0M02387g"
FT                   /old_locus_tag="CAGL-IPF6617"
FT                   /old_locus_tag="CAGL-CDS0676.1"
FT   CDS_pept        280372..282942
FT                   /locus_tag="CAGL0M02387g"
FT                   /old_locus_tag="CAGL-IPF6617"
FT                   /old_locus_tag="CAGL-CDS0676.1"
FT                   /note="similar to uniprot|P41909 Saccharomyces cerevisiae
FT                   YPL147w PXA1 Peroxisomal long-chain fatty acid import
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02387g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62426"
FT                   /db_xref="GOA:Q6FJZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ4"
FT                   /inference="similar to AA sequence:UniProtKB:P41909"
FT                   /protein_id="CAG62426.1"
FT                   /translation="MDGIRVRNVLINVHRQCIGLDIERIAGKRYLGVLLKHLYYVARTG
FT                   STGYLDGHKRRARMILLVVVLMGVAGASGISWGVMRMLTRLRGWYLHSWKNRGRRPSMR
FT                   RTRSQTRLVDGGRIIYVPEDSIDGKPTSSKKNKKFLIPPTDNDIYEHDKFLFKNVESER
FT                   TRSSQLFYSKFLNQMSVISRILIPSFLDKNAILLSSQIFFLIMRTWLSLFVARLDGQIV
FT                   KDIIAGRGRRFLLDIGCWFLIAIPASYTNSAIKYLQRKLSLSFRTNLTRYIHDMYLDKR
FT                   LGFYKLLYDSKASTSVIKNIDNSITSDVTKFSDATCSVFANIAKPVIDLVFFSVYLRDN
FT                   LGTMGVAGIFVNYFITGYILKKYTPPLGELASSKSSAEGDYYNYQLNMINNNEEIAFYQ
FT                   GTEVEKTKVKELYENLMERTLLVDKRKFTYNMVEDYILKYTWSGLGYVFASIPIVVSTV
FT                   ASGINNEEVNMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLCVLHRVH
FT                   STDFNYGANIEDKLQEISDALSSSSTLPNKTKVDIIRGTIQRNFNGVRFENIDVIIPSP
FT                   SGREGVKLINKLAFQIPPHIDFNMSHSNSILDITGSKDVNLPFLQGPGSSLLILGPNSC
FT                   GKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQKPYFTRGGTLRDQLIYPMSSDEFF
FT                   DRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVNFARIMFHRP
FT                   LFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLLEISGKSSGSWH
FT                   LQTLGTDEAINSIEHEIEELEEKLENVKLWEIERDELIRKLSVV"
FT   gene            complement(<283059..>284402)
FT                   /locus_tag="CAGL0M02409g"
FT                   /old_locus_tag="CAGL-IPF6615"
FT                   /old_locus_tag="CAGL-CDS2423.1"
FT   CDS_pept        complement(283059..284402)
FT                   /locus_tag="CAGL0M02409g"
FT                   /old_locus_tag="CAGL-IPF6615"
FT                   /old_locus_tag="CAGL-CDS2423.1"
FT                   /note="similar to uniprot|Q12080 Saccharomyces cerevisiae
FT                   YPL146c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02409g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62427"
FT                   /db_xref="GOA:Q6FJZ3"
FT                   /db_xref="InterPro:IPR011687"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ3"
FT                   /inference="similar to AA sequence:UniProtKB:Q12080"
FT                   /protein_id="CAG62427.1"
FT                   /translation="MAPLKVNERPAQYKQSSRKGKKAWRKNIDLTDIEKSIETQKDLEI
FT                   THGTSDLASLQDTALFQVDEEGDIDLKKALIKRKQIKKNLKSKEILDSIKTASKIKSVI
FT                   HPRHQEHQTKEGGKVQGVSKKELKKLLSLAGKIQGESKLKNRSDKDGLVKSAAADLWNE
FT                   EESNKVKLPSGIEFKKKRDEIPEELIKYSTTSWSIAEVKPKTLEHKPVKVAEYEDLPHA
FT                   GKSYNPDSKHWNSLISKEYESEKKREDARNKIQEYQAKIQRLMEVLDDKEEESSSEEDE
FT                   EDEEDETEETTESTDVTLGLSINPVVKNKKKTKYQKNKAKRHEEKVKMHKEIKELKQQI
FT                   KELEKIEEIEQEVEKRHEEKDKKVKKEKKNKKGKLGTKYHILNEGLEVKFKDELSDSLR
FT                   KVRPEGSLLYDTVRKLQSSGKVEARIPRTKGRRYKQKITEKWTYKDFK"
FT   gene            complement(<285179..>286495)
FT                   /locus_tag="CAGL0M02431g"
FT                   /old_locus_tag="CAGL-IPF6614"
FT                   /old_locus_tag="CAGL-CDS2489.1"
FT   CDS_pept        complement(285179..286495)
FT                   /locus_tag="CAGL0M02431g"
FT                   /old_locus_tag="CAGL-IPF6614"
FT                   /old_locus_tag="CAGL-CDS2489.1"
FT                   /note="highly similar to uniprot|P35844 Saccharomyces
FT                   cerevisiae YPL145c KES1 or uniprot|P35843 Saccharomyces
FT                   cerevisiae YOR237w HES1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02431g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62428"
FT                   /db_xref="GOA:Q6FJZ2"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ2"
FT                   /protein_id="CAG62428.1"
FT                   /translation="MSGYASSSAWTSFLKSVSTFNGDLSSLVAPPFILSPVSLSEFSQY
FT                   WAEHPDLFLEPSFINEANFKTKCTEDPNVESPEMARMLSVTKWFISTLKSQYCSRDETM
FT                   GSEKKPLNPFLGELFVGKWDNKDHPEFGETVLLSEQVSHHPPITAYTIFNDKNKVKLQG
FT                   YNQVKTGFTKTLMLSVKQYGHTLLEVNKESYLITPPPLHIEGILMAAPFVELEGRSYLQ
FT                   SSTGLLCVVEFSGRGYFSGKKNSFKARIYKSAADSADKNKAIYTISGQWSGSSKISKLN
FT                   PATGYSDEIGTFYEAERVPVSHLSVKPIDKQHPLESRKAWKEVAEAIKAGDMDLITKTK
FT                   SDLEQKQRDLRKEEEAKGICWERRWFKDFDYSDAPGKDYLVPEKDDIFLQLAKAMDLSI
FT                   KNVPSGTLNGEKEDKKEDLTSIHWRFDRKLWDEEKEVVL"
FT   gene            <287732..>288094
FT                   /locus_tag="CAGL0M02453g"
FT                   /old_locus_tag="CAGL-IPF6610"
FT                   /old_locus_tag="CAGL-CDS5176.1"
FT   CDS_pept        287732..288094
FT                   /locus_tag="CAGL0M02453g"
FT                   /old_locus_tag="CAGL-IPF6610"
FT                   /old_locus_tag="CAGL-CDS5176.1"
FT                   /note="some similarities with uniprot|Q12245 Saccharomyces
FT                   cerevisiae YPL144w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02453g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62429"
FT                   /db_xref="GOA:Q6FJZ1"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ1"
FT                   /protein_id="CAG62429.1"
FT                   /translation="MSQIVVDGLSVRVDCDVEDGVKSPISLNLCLSGDEELKSSRLECY
FT                   YYTIMGRKDDVLGIPLRDTSSDWIRDLARLCATMITKKYNKPCYVTISTVGENNFQAST
FT                   IPLLAAVKEHVATLVN"
FT   gene            <289221..>290322
FT                   /locus_tag="CAGL0M02497g"
FT                   /old_locus_tag="CAGL-IPF40107"
FT   CDS_pept        join(289221..289239,290018..290322)
FT                   /locus_tag="CAGL0M02497g"
FT                   /old_locus_tag="CAGL-IPF40107"
FT                   /note="highly similar to uniprot|P41056 Saccharomyces
FT                   cerevisiae YOR234c RPL37B or uniprot|P05744 Saccharomyces
FT                   cerevisiae YPL143w RPL37A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02497g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62430"
FT                   /db_xref="GOA:Q6FJZ0"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ0"
FT                   /protein_id="CAG62430.1"
FT                   /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLLQIEGVANPQEAQFYL
FT                   GKRVAYVYRASKEVRGSKIRVMWGKITRTHGNSGVVRAKFRNNLPAKTFGASVRIFLYP
FT                   SNI"
FT   gene            complement(<290723..>292993)
FT                   /locus_tag="CAGL0M02519g"
FT                   /old_locus_tag="CAGL-IPF6607"
FT                   /old_locus_tag="CAGL-CDS0921.1"
FT   CDS_pept        complement(290723..292993)
FT                   /locus_tag="CAGL0M02519g"
FT                   /old_locus_tag="CAGL-IPF6607"
FT                   /old_locus_tag="CAGL-CDS0921.1"
FT                   /note="highly similar to uniprot|Q03002 Saccharomyces
FT                   cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
FT                   cerevisiae YOR233w KIN4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02519g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62432"
FT                   /db_xref="GOA:Q6FJY8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY8"
FT                   /protein_id="CAG62432.1"
FT                   /translation="MTASKRHTYYGGGSISYERTNNSEHDKTQRPQDHQGPKHRKHVTF
FT                   GPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI
FT                   TKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRR
FT                   LKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNG
FT                   MMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDI
FT                   SRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTFLSIT
FT                   PDEWDRLSNTKNIYRKSKPQFYPNKRPGSTYSNYSSGSKDNKRDSLIIDSALVSLPVPP
FT                   KEFQSHILARPSSLVVESRYSPLGKRNGHNRSNSAASAALQAVFDASERESLKSVDSKP
FT                   RSRSNDHKDIIEGIQPQKHAFVKPSRKVRPTSMQAPGSSYIHHGNFEGLHELMKRDNST
FT                   ASSHQTSISSEARIFDASPTLIPDLTKSPSSSTGNSPKLLPRKSFTVSKPLLDLKFASA
FT                   DIIKANESTDSLSKRIHDQIYEVEHPRQRRHSYRYSGIISDLIFGTLSEEGEINTFENK
FT                   DHKSDAEESEMTISESKLDSVSICSQQSNIHRNISKQASSVSLLRTTSNHSTNNLNVGS
FT                   RTYGRAELYDKRHLRQIPSNTLNQINAPGNTHRNSAIYSEDDKRKSTAKRVFEFFKRRS
FT                   MRV"
FT   gene            complement(<294348..>294479)
FT                   /locus_tag="CAGL0M02541g"
FT                   /old_locus_tag="CAGL-IPF14365"
FT   CDS_pept        complement(294348..294479)
FT                   /locus_tag="CAGL0M02541g"
FT                   /old_locus_tag="CAGL-IPF14365"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02541g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62433"
FT                   /db_xref="GOA:Q6FJY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY7"
FT                   /protein_id="CAG62433.1"
FT                   /translation="MLGAPISRDTPRKTRSKTQFFQGPIVSLITEKCTYEWGNPSIN"
FT   gene            complement(<295156..>296529)
FT                   /locus_tag="CAGL0M02563g"
FT                   /old_locus_tag="CAGL-IPF6604"
FT                   /old_locus_tag="CAGL-CDS2339.1"
FT   CDS_pept        complement(295156..296529)
FT                   /locus_tag="CAGL0M02563g"
FT                   /old_locus_tag="CAGL-IPF6604"
FT                   /old_locus_tag="CAGL-CDS2339.1"
FT                   /note="weakly similar to uniprot|Q03010 Saccharomyces
FT                   cerevisiae YPL139c UME1 or uniprot|Q12206 Saccharomyces
FT                   cerevisiae YOR229w WTM2 or uniprot|Q12363 Saccharomyces
FT                   cerevisiae YOR230w WTM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02563g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62434"
FT                   /db_xref="GOA:Q6FJY6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY6"
FT                   /protein_id="CAG62434.1"
FT                   /translation="MTVDTEIASNKLRNEEFKIWKKTIPLLYQHISTMKPKYANASKGT
FT                   IKDVPCCLTFSDEVIPNKANGTLSTVIYYGIGNEIYSLDCDLPLGLHLQKDTLQPNEKL
FT                   QLPQFDQIVSRIQSEDLSPKWRAAANCNIYKIKCVGNGKVVALLDSGAIVWFQESTESP
FT                   VSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDLSLNGEKIIVSQAVLNEDRTVIKVF
FT                   SNIDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATPIWKIEN
FT                   EHILSFAFSPLVETLLITGGANGIINFWDVKRLTVKTATTGGDKRQESLLSLSNHVEEP
FT                   ISSVEFSASSPSEFITVGISGSIYHWDVFNYFEKVSELFSEGGDQSAIDSLDTEEIQAE
FT                   SLTFYHTGGSRRHLGKSTKKNSVSVHPIIEGLIGTIDTDGLITVYKPFTGVLPEAEDS"
FT   gene            complement(<297048..>298130)
FT                   /locus_tag="CAGL0M02585g"
FT                   /old_locus_tag="CAGL-IPF6602"
FT                   /old_locus_tag="CAGL-CDS3079.1"
FT   CDS_pept        complement(297048..298130)
FT                   /locus_tag="CAGL0M02585g"
FT                   /old_locus_tag="CAGL-IPF6602"
FT                   /old_locus_tag="CAGL-CDS3079.1"
FT                   /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
FT                   YPL138c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02585g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62435"
FT                   /db_xref="GOA:Q6FJY5"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR037869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY5"
FT                   /inference="similar to AA sequence:UniProtKB:Q03012"
FT                   /protein_id="CAG62435.1"
FT                   /translation="MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCD
FT                   DWFHFECMKIPETYRNLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPC
FT                   ESGSKYCSKEHGKEYMSRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTF
FT                   GSSSFIDSDIDRVDRHGEIYDKIINDDKYYKDLLTEKDNITNNQIEGLKKKVEELDKYL
FT                   DWISSVNKLINGEDNTIEQEENVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAKIPCNP
FT                   EEFYNKYSEITTSTPDCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDL
FT                   SISTRKRQLNINYFEHIMRS"
FT   gene            complement(<298560..>302174)
FT                   /locus_tag="CAGL0M02607g"
FT                   /old_locus_tag="CAGL-IPF6601"
FT                   /old_locus_tag="CAGL-CDS0237.1"
FT   CDS_pept        complement(298560..302174)
FT                   /locus_tag="CAGL0M02607g"
FT                   /old_locus_tag="CAGL-IPF6601"
FT                   /old_locus_tag="CAGL-CDS0237.1"
FT                   /note="similar to uniprot|Q03016 Saccharomyces cerevisiae
FT                   YPL137c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02607g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62436"
FT                   /db_xref="GOA:Q6FJY4"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY4"
FT                   /inference="similar to AA sequence:UniProtKB:Q03016"
FT                   /protein_id="CAG62436.1"
FT                   /translation="MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTERSRS
FT                   LSISNASLSHGMYADPHAKRVSGTMAIPRAMAGAIAGAGAVAIEDDDEVDIRADGGPGA
FT                   RMPALTKTHSLNQETKDEVPVLTPPPTPTQSRNSPSLVSVKRSASTSSKPKKTSLFGSL
FT                   FGRSRSSSQSNDTEKKLDTAKRLAISTASEKKTYPQELLTPASPVSANSPSPDIRRSTS
FT                   ITKSAKEHRARNSDNTTTDKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKFETDPP
FT                   QQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNLGPQFTKDSIEYKRALEIHQI
FT                   ALKEAEKHQQEAHHAARRIAHEVSNFSNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDT
FT                   DINIDLSEKLNKTGIDLPIHMHEHHFDDPGSTLEGNQEITLDVVYTRCCHLREILPIPS
FT                   TLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVIS
FT                   SVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSM
FT                   DWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLA
FT                   NATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLN
FT                   STNIQSTNDMALLLKALSKLPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDN
FT                   ENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNF
FT                   SATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSFQLDELDSQDEL
FT                   LFDGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNL
FT                   FEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSEVLGENKIASSDSLVDHP
FT                   NLRHVVETDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTT
FT                   SLASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGESSAVSASTSQTTLPSIDSKEKK
FT                   IFTKLPSGPELRTAIIKAKGVSSIEELIQKINDYHCCDIESLYNILKQNELEGNGIVTS
FT                   ESDLTDNEREHLEGAVKNIYEQLLNNASMNRDVKKVNQ"
FT   gene            <303016..>303657
FT                   /locus_tag="CAGL0M02629g"
FT                   /old_locus_tag="CAGL-IPF6598"
FT                   /old_locus_tag="CAGL-CDS4322.1"
FT   CDS_pept        303016..303657
FT                   /locus_tag="CAGL0M02629g"
FT                   /old_locus_tag="CAGL-IPF6598"
FT                   /old_locus_tag="CAGL-CDS4322.1"
FT                   /note="some similarities with uniprot|Q03020 Saccharomyces
FT                   cerevisiae YPL135w ISU1 or uniprot|Q12056 Saccharomyces
FT                   cerevisiae YOR226c ISU2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02629g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62437"
FT                   /db_xref="GOA:Q6FJY3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJY3"
FT                   /protein_id="CAG62437.1"
FT                   /translation="MGVCVFFPLCLPCPGALTYIREAQFISSWTPADPRHKQLKMFLQR
FT                   FVTVGGAAIGARSTMGAMGAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDKTL
FT                   PNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTL
FT                   DDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTSTTTLH"
FT   gene            complement(<304583..>305971)
FT                   /locus_tag="CAGL0M02651g"
FT                   /old_locus_tag="CAGL-IPF6597"
FT                   /old_locus_tag="CAGL-CDS2307.1"
FT   CDS_pept        complement(304583..305971)
FT                   /locus_tag="CAGL0M02651g"
FT                   /old_locus_tag="CAGL-IPF6597"
FT                   /old_locus_tag="CAGL-CDS2307.1"
FT                   /note="similar to uniprot|P19541 Saccharomyces cerevisiae
FT                   YPL133c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02651g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62438"
FT                   /db_xref="GOA:Q6FJY2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY2"
FT                   /inference="similar to AA sequence:UniProtKB:P19541"
FT                   /protein_id="CAG62438.1"
FT                   /translation="MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV
FT                   ADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNN
FT                   NLLLPPQPNFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSI
FT                   ENTQEQTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNK
FT                   QESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYA
FT                   KGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSY
FT                   DRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE
FT                   KYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLSPTR
FT                   DHSN"
FT   gene            <306446..>307303
FT                   /locus_tag="CAGL0M02673g"
FT                   /old_locus_tag="CAGL-IPF6594"
FT                   /old_locus_tag="CAGL-CDS3718.1"
FT   CDS_pept        306446..307303
FT                   /locus_tag="CAGL0M02673g"
FT                   /old_locus_tag="CAGL-IPF6594"
FT                   /old_locus_tag="CAGL-CDS3718.1"
FT                   /note="similar to uniprot|P19516 Saccharomyces cerevisiae
FT                   YPL132w COX11 cytochrome-c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02673g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62439"
FT                   /db_xref="GOA:Q6FJY1"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY1"
FT                   /inference="similar to AA sequence:UniProtKB:P19516"
FT                   /protein_id="CAG62439.1"
FT                   /translation="MSYTVGLRMAARRSVLRMTPLSQMRMVPRVSHRWSSNGPSSSAKS
FT                   SSNGNIDFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLYRA
FT                   ICARTGFGGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVYVLP
FT                   GETALAFYKAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEIDMPVF
FT                   FFIDPDFASDPSMRNIDDLILHYTFFRAHYGDGSAVSEHQPVEDVNMANAQILTPQVID
FT                   ATKD"
FT   gene            <308170..>309063
FT                   /locus_tag="CAGL0M02695g"
FT                   /old_locus_tag="CAGL-IPF6591"
FT                   /old_locus_tag="CAGL-CDS3626.1"
FT   CDS_pept        308170..309063
FT                   /locus_tag="CAGL0M02695g"
FT                   /old_locus_tag="CAGL-IPF6591"
FT                   /old_locus_tag="CAGL-CDS3626.1"
FT                   /note="highly similar to uniprot|P26321 Saccharomyces
FT                   cerevisiae YPL131w RPL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02695g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62440"
FT                   /db_xref="GOA:Q6FJY0"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY0"
FT                   /protein_id="CAG62440.1"
FT                   /translation="MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYN
FT                   SPKYRLVVRFTNKDIICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLL
FT                   IARRALQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGAL
FT                   KGASDGGLYVPHSENRFPGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSEL
FT                   FKGYLADDIDADSIEDIYASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEE
FT                   RDARVAAKIAALAGQQ"
FT   gene            <309656..>310444
FT                   /locus_tag="CAGL0M02717g"
FT                   /old_locus_tag="CAGL-IPF6590"
FT                   /old_locus_tag="CAGL-CDS3903.1"
FT   CDS_pept        309656..310444
FT                   /locus_tag="CAGL0M02717g"
FT                   /old_locus_tag="CAGL-IPF6590"
FT                   /old_locus_tag="CAGL-CDS3903.1"
FT                   /note="some similarities with uniprot|Q03029 Saccharomyces
FT                   cerevisiae YPL130w SPO19"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02717g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62441"
FT                   /db_xref="GOA:Q6FJX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX9"
FT                   /protein_id="CAG62441.1"
FT                   /translation="MKRPFIFSSQILASFVVAEQFRAFLSTDEIGSDSIQRGTDDNPLV
FT                   IRIDKQSYSPELIDTLTKSTNIIFADLPDVPEFIKADKISDVDYQVVQNTWKHKDKKND
FT                   EEEKQDDNDKKEDKNKQENNDKNEETKSKTKPNSKTVEDHKTTLSTKTTTHSTIIYTSS
FT                   KPEKTKESEENSKDSRSGDKGKPYDDSEDNGDSDDELCDDEEEKESKNSNKLPSNHTEP
FT                   HLGDNEDEFFDNIGNHLNNRGHYQWLLYAILFALPFPNIL"
FT   gene            <310925..>311881
FT                   /locus_tag="CAGL0M02739g"
FT                   /old_locus_tag="CAGL-IPF6589"
FT                   /old_locus_tag="CAGL-CDS4480.1"
FT   CDS_pept        join(310925..310933,311165..311881)
FT                   /locus_tag="CAGL0M02739g"
FT                   /old_locus_tag="CAGL-IPF6589"
FT                   /old_locus_tag="CAGL-CDS4480.1"
FT                   /note="highly similar to uniprot|P35189 Saccharomyces
FT                   cerevisiae YPL129w ANC1 transcription initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02739g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62442"
FT                   /db_xref="GOA:Q6FJX8"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX8"
FT                   /protein_id="CAG62442.1"
FT                   /translation="MVASTKRTIRIKTEQHILPDVPPVENFPVRQWSIEIALLDEEGKE
FT                   MPATIFDKVVYHLHPTFANPNRTFNEPPFKIVEQGWGGFPLDISLYFLEKGGERKISHD
FT                   LNFLQESYEVDHVIQVPLNKPTLTAELAKSGFTEDTSSGSKRKMTGSNTGAESKTKKAK
FT                   TTTASTIKGNVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
FT                   SLPEGLLKSLWEYVKKNTE"
FT   gene            complement(<312153..>313730)
FT                   /locus_tag="CAGL0M02761g"
FT                   /old_locus_tag="CAGL-IPF6588"
FT                   /old_locus_tag="CAGL-CDS1937.1"
FT   CDS_pept        complement(312153..313730)
FT                   /locus_tag="CAGL0M02761g"
FT                   /old_locus_tag="CAGL-IPF6588"
FT                   /old_locus_tag="CAGL-CDS1937.1"
FT                   /note="similar to uniprot|Q02457 Saccharomyces cerevisiae
FT                   YPL128c TBF1 telomere TTAGGG repeat-binding factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02761g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62443"
FT                   /db_xref="GOA:Q6FJX7"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013867"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX7"
FT                   /inference="similar to AA sequence:UniProtKB:Q02457"
FT                   /protein_id="CAG62443.1"
FT                   /translation="MTGDIQMASSDTEDVNRFANIIEDLPVKTRLTLSTLSLLNDVSTQ
FT                   LLRFLISNAHTPNVIAVISNKENYISTGESEMFHTLVRIFKNIRDVYESRTPLLNVNNV
FT                   APGLWLLNMPPPTILKGHEAYIISTIRKANLVTFILTVINCLPYGFDFLQKVYLDVFCP
FT                   NTILTDQTNGDQVSKFLKPQAIIYLDLKTHAYISSIRDHLGANEQIPDAEKRILLDTIF
FT                   PDNIAMRLVNRKIVAPNEKKILTPSEKEFVGRCERRKETLIKFTNYTDLLNSYDWTFFV
FT                   KELLEYCGKNMNLIVWGKKGRSKTALLEFNPSDFDPQILFATGSHLTTDLAVNSHDPSP
FT                   IGNTFDTGNKEKLIDANELRPLTDAESESINNEIQSALQNESGQGMQKNFMDDAHMSGG
FT                   ENVHSQLVDSNNSILSDVISKSPSVKVVKAKRTWSKEEEKTLITGLIDLGPAWAKILDL
FT                   YGPGGKINENLKNRTQVQLKDKARNWKLHYLKTGKPLPEYLNRVTGNLDKIAKTKRRGS
FT                   KEGSIPPN"
FT   gene            complement(<314946..>315635)
FT                   /locus_tag="CAGL0M02783g"
FT                   /old_locus_tag="CAGL-IPF6587"
FT                   /old_locus_tag="CAGL-CDS4178.1"
FT   CDS_pept        complement(314946..315635)
FT                   /locus_tag="CAGL0M02783g"
FT                   /old_locus_tag="CAGL-IPF6587"
FT                   /old_locus_tag="CAGL-CDS4178.1"
FT                   /note="similar to uniprot|P53551 Saccharomyces cerevisiae
FT                   YPL127c HHO1 histone H1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02783g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62444"
FT                   /db_xref="GOA:Q6FJX6"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX6"
FT                   /inference="similar to AA sequence:UniProtKB:P53551"
FT                   /protein_id="CAG62444.1"
FT                   /translation="MAAKKVTKDTKPGYKNLIIEGLKALNNGKGASRVALKKYIKDNHS
FT                   DVASVSLFDSYFNNAIKKGIDSKEFHFPKGPSGVLKLVKPASTSTTTKAKTTDKKVTKK
FT                   STASKASEKKTPAKKTATATTKKVTKPKKDEKKKTTQKKSSAITYREMILTGVLSMNNG
FT                   KGASRMALKKFIKDKYPTNVEKVVNFDYLVNNAIKKGVESGELSQPSGPSGMVKILKKG
FT                   KESIKSI"
FT   gene            <317204..>319822
FT                   /locus_tag="CAGL0M02805g"
FT                   /old_locus_tag="CAGL-IPF6583"
FT                   /old_locus_tag="CAGL-CDS0645.1"
FT   CDS_pept        317204..319822
FT                   /locus_tag="CAGL0M02805g"
FT                   /old_locus_tag="CAGL-IPF6583"
FT                   /old_locus_tag="CAGL-CDS0645.1"
FT                   /note="similar to uniprot|Q02931 Saccharomyces cerevisiae
FT                   YPL126w NAN1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02805g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62445"
FT                   /db_xref="GOA:Q6FJX5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX5"
FT                   /inference="similar to AA sequence:UniProtKB:Q02931"
FT                   /protein_id="CAG62445.1"
FT                   /translation="MDIDKFHLSLVSGGKPSLARNVDTPDSKKNSTLLSDDLTHYVIPF
FT                   NNQIKIYSTETKHCVKTIKFPNHEVLNTVFMNDDVKIVHFAFGDMTKTNDTIDNELLSI
FT                   VTNTGSLLVLNLKGKLVEDPKHLNISAKLNDPKESISKILFGEATQQIKLITSKVNSDN
FT                   TLAYYLYDCSFEDNISLTCTHELQNVQNISWSNNNLYLSYLVEQPKSEGSSKTEKIFKC
FT                   ISIFDDSLNQEFDLSIILPSTTVSQSSNSKTVSTIAIDNNGIQLAVGFFSGVITIVDLA
FT                   DLQTRLLKWHIDSVLSLTFTDDGSYLLSGGWEKVLSFWQLATNMQQFLPRLNGVIVDID
FT                   TIGNGKFYSLTLQLTENVTSADYQILLLNAADLTSVLSITGPLAVFSSETKNSKQPLSS
FT                   MNTKTSESVSSSVVSKKKLKKKLLKNKRQDFTVPACINPVSKQIYFPHMSAIQVYDFYK
FT                   NEPIAYQYVTSAVAGAMGKVRTELNIQEPLITEVQFTKDGKWMITQETEFPPEDLPSSK
FT                   DLNYILKFWNKESGEGDWQLKTKVLNPHGLAVPITKILVAPSCINNSEGCLTADNNGGL
FT                   KYWSFEKHEKNWCLTKVSLPNFNHFSNSVSLAWSSDGSLIFHGFDDKLQVIEFDTLRKF
FT                   ESSFSELTFDFEIQALLLSNDKTLVVATKTTLYAFDILAGAITHSYDLFPYIDGVYKNT
FT                   NISRLLACNSKSGQIALVVNQQVEDESNNKTLNYKSSIIIFSADLSERVGSYSHDEYIS
FT                   CIEWNYESDFIFMDIQSRLGVVGATVSTEMSDEVNNEGVFDGLYHESGNSFHEELKKLS
FT                   SQKVEAENVDTEDKNDVDLEFINGNFANKAINMNSFTSMMDNIQNIQMESLFDRVMKVL
FT                   K"
FT   gene            complement(<320283..>321739)
FT                   /locus_tag="CAGL0M02849g"
FT                   /old_locus_tag="CAGL-IPF16297"
FT   CDS_pept        complement(join(320283..320948,321650..321739))
FT                   /locus_tag="CAGL0M02849g"
FT                   /old_locus_tag="CAGL-IPF16297"
FT                   /note="highly similar to uniprot|P46654 Saccharomyces
FT                   cerevisiae YLR048w NAB1B or uniprot|P32905 Saccharomyces
FT                   cerevisiae YGR214w NAB1A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02849g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62446"
FT                   /db_xref="GOA:Q6FJX4"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="InterPro:IPR027498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX4"
FT                   /protein_id="CAG62446.1"
FT                   /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGV
FT                   HVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTP
FT                   GSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCN
FT                   NRGKHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEIEQQTAEEAAQEA
FT                   GEEEAKEEVTEEQTEAAEWAQENADNVEW"
FT   gene            <324009..>325811
FT                   /locus_tag="CAGL0M02871g"
FT                   /old_locus_tag="CAGL-IPF6579"
FT                   /old_locus_tag="CAGL-CDS1507.1"
FT   CDS_pept        324009..325811
FT                   /locus_tag="CAGL0M02871g"
FT                   /old_locus_tag="CAGL-IPF6579"
FT                   /old_locus_tag="CAGL-CDS1507.1"
FT                   /note="similar to uniprot|P46982 Saccharomyces cerevisiae
FT                   YJL186w MNN5 or uniprot|P38069 Saccharomyces cerevisiae
FT                   YBR015c TTP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02871g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62447"
FT                   /db_xref="GOA:Q6FJX3"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX3"
FT                   /inference="similar to AA sequence:UniProtKB:P46982"
FT                   /protein_id="CAG62447.1"
FT                   /translation="MVSMRLLMNSLRKRKLLVAIQVVVLFLIFSHSFGTDYLIPYNSNT
FT                   EYASSAARVQPMQLPDPVAKKTLIGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDVSS
FT                   GGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKLYPN
FT                   EKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHNGRCV
FT                   MMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAF
FT                   KTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDL
FT                   KQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIYGPDLYY
FT                   YMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQ
FT                   DYQRHKQVLKELATEKPLEPVKYQLPNHFQDKMKNPDGTSLDIMFLHASFHKFDPADLA
FT                   KSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKSLKKHEGTEFW
FT                   TSMCSYFKQRVDFLTKTKPANAFI"
FT   gene            <326338..>328779
FT                   /locus_tag="CAGL0M02893g"
FT                   /old_locus_tag="CAGL-IPF6578"
FT                   /old_locus_tag="CAGL-CDS0776.1"
FT   CDS_pept        326338..328779
FT                   /locus_tag="CAGL0M02893g"
FT                   /old_locus_tag="CAGL-IPF6578"
FT                   /old_locus_tag="CAGL-CDS0776.1"
FT                   /note="similar to uniprot|P25623 Saccharomyces cerevisiae
FT                   YCR030c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02893g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62448"
FT                   /db_xref="GOA:Q6FJX2"
FT                   /db_xref="InterPro:IPR018808"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX2"
FT                   /inference="similar to AA sequence:UniProtKB:P25623"
FT                   /protein_id="CAG62448.1"
FT                   /translation="MNNHRSTYINQILERKDPYEATETLRIRLSQAKLLNTNLYLFLNQ
FT                   LADLRRNYNQQLRKIIIENEDLNSMLRKQMIENNVLTAEEMQHFTFNSLGEIEPLWNTL
FT                   VSELKLDLAANTKFSKVIEDEVILGIKNSVEKNSNWGTSKHLHSKLSKVAVSLKRNKDP
FT                   NTHAELQSEWDADKAKLFQIFETMDYERLYSVKDCLLKYQSGYTDYILKTTEKCDTYMT
FT                   QFLEFNPEKEIQRFANDASNYKFSQVQPGNNAKYAPSNMNTPNQERGSFNDKTSPSRFA
FT                   SASTVIKHDMGSEQPIMLEDSTTYKNMNKTQKLKSKMGSIFGKNKLKSKKSQQRLSSSP
FT                   EKPPLSKSFSSASASTNYSSRKSQMASTMQTPQVDIQNRESGITDQISSSNISTPKSFQ
FT                   QQPKIEQAPIASMSQPALIPNQKDKPLPDINQSKKERDIVSDQNAKSTPEIIQHKPLHI
FT                   TSPNSSKSQTPRQWSTSSAASTTNNEPPAYSPHLSNNDNMPNNTAANTLGSQQMMQPQL
FT                   TGELTALQAQTTGATGTSSANNSLFQHLPDDFSIFGLNASIAEVLNATFKDGVLTSSQL
FT                   VGEVALNYVKNTVMNTPLPIGLNLQVTNASTFNKVILNQAFMEKVADTEYKVNPQFIDG
FT                   RTLGAMKYSIDNTTVPVVIHPIWKFEPHQASVVLTVGLSNQIPESINELTLSDFTVMVN
FT                   IAGTESTSALSKPQGTFNREKNRITWKFKEPLTISRDGENVKLIGRFMTNGQGFEPSDG
FT                   VMLKFVIREQQGQQDASINIIGSKITLSVQEYDVENPFGGEWQPMRTNRTLASGNYIAT
FT                   S"
FT   gene            complement(<329147..>329923)
FT                   /locus_tag="CAGL0M02915g"
FT                   /old_locus_tag="CAGL-IPF6577"
FT                   /old_locus_tag="CAGL-CDS3942.1"
FT   CDS_pept        complement(329147..329923)
FT                   /locus_tag="CAGL0M02915g"
FT                   /old_locus_tag="CAGL-IPF6577"
FT                   /old_locus_tag="CAGL-CDS3942.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02915g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62449"
FT                   /db_xref="GOA:Q6FJX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX1"
FT                   /protein_id="CAG62449.1"
FT                   /translation="MIRFGMPHNQGSLPAIQASIAYGSSNLPSPEDDFDLRLSPSISGR
FT                   DTQTLLNYVSSSENDAIISSSRTDDELSGIHDNAENGSSDYYNNILSTSSSTSLGTYEH
FT                   VIISRTRSPIQEATSLTPNVSTQIDKWCLEIQLDRQRTPSLALADDQVDIDRNDLWTSH
FT                   ILADLDDSHLKRIKEFAAYFLPVLKESRRQQRELQKQTARRNTDTANTRKFRIPSLFNK
FT                   DLLSLSFENISIESDCSSYIEVLSSPYLNISYSDLT"
FT   gene            <331097..>332218
FT                   /locus_tag="CAGL0M02937g"
FT                   /old_locus_tag="CAGL-IPF6576"
FT                   /old_locus_tag="CAGL-CDS2955.1"
FT   CDS_pept        331097..332218
FT                   /locus_tag="CAGL0M02937g"
FT                   /old_locus_tag="CAGL-IPF6576"
FT                   /old_locus_tag="CAGL-CDS2955.1"
FT                   /note="highly similar to uniprot|P48510 Saccharomyces
FT                   cerevisiae YMR276w DSK2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02937g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62450"
FT                   /db_xref="GOA:Q6FJX0"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX0"
FT                   /protein_id="CAG62450.1"
FT                   /translation="MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLI
FT                   YSGKILKDDQTVESYNIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASG
FT                   QTGGFNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEM
FT                   LSNPEMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGM
FT                   PGADATDASAFPAPGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASN
FT                   PFAAMMGNMNNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLN
FT                   DMGFFDFDRNVAALRRSGGSVQGALDALLNGDV"
FT   gene            <332990..>335266
FT                   /locus_tag="CAGL0M02959g"
FT                   /old_locus_tag="CAGL-IPF6575"
FT                   /old_locus_tag="CAGL-CDS0914.1"
FT   CDS_pept        332990..335266
FT                   /locus_tag="CAGL0M02959g"
FT                   /old_locus_tag="CAGL-IPF6575"
FT                   /old_locus_tag="CAGL-CDS0914.1"
FT                   /note="similar to uniprot|Q03254 Saccharomyces cerevisiae
FT                   YMR277w FCP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02959g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62451"
FT                   /db_xref="GOA:Q6FJW9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW9"
FT                   /inference="similar to AA sequence:UniProtKB:Q03254"
FT                   /protein_id="CAG62451.1"
FT                   /translation="MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEI
FT                   ANSPDDNDIDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEI
FT                   KRPCNHDIVYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLK
FT                   NEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG
FT                   PKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDR
FT                   ILSRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS
FT                   NFLPKQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT
FT                   AEESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTL
FT                   AYIHKEFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIW
FT                   TSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDE
FT                   KPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDT
FT                   SWLNDDEDEVEFGSDDDNSDEDSLISEDTDNGLAANGNSSESSITNKVPEATEDVLNNP
FT                   SDTQNEEDQIPNGNGNHLPKRPIDDVSENAHEMASKKQLTSKDDDRSSDVESDFEEDLL
FT                   NALDD"
FT   gene            <335863..>337716
FT                   /locus_tag="CAGL0M02981g"
FT                   /old_locus_tag="CAGL-IPF6574"
FT                   /old_locus_tag="CAGL-CDS1419.1"
FT   CDS_pept        335863..337716
FT                   /locus_tag="CAGL0M02981g"
FT                   /old_locus_tag="CAGL-IPF6574"
FT                   /old_locus_tag="CAGL-CDS1419.1"
FT                   /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
FT                   YMR278w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M02981g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62452"
FT                   /db_xref="GOA:Q6FJW8"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW8"
FT                   /inference="similar to AA sequence:UniProtKB:Q03262"
FT                   /protein_id="CAG62452.1"
FT                   /translation="MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKR
FT                   FDSRIVFGTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHS
FT                   QEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNG
FT                   YKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTS
FT                   YLNSVVNQLIQRDFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQK
FT                   DPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQ
FT                   LTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLT
FT                   GFKWIGNEAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSS
FT                   NPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRV
FT                   TEFRDLTIGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKL
FT                   KVYIEGISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF"
FT   gene            complement(<337942..>339618)
FT                   /locus_tag="CAGL0M03003g"
FT                   /old_locus_tag="CAGL-IPF6573"
FT                   /old_locus_tag="CAGL-CDS1726.1"
FT   CDS_pept        complement(337942..339618)
FT                   /locus_tag="CAGL0M03003g"
FT                   /old_locus_tag="CAGL-IPF6573"
FT                   /old_locus_tag="CAGL-CDS1726.1"
FT                   /note="similar to uniprot|Q03263 Saccharomyces cerevisiae
FT                   YMR279c or uniprot|P13090 Saccharomyces cerevisiae YML116w
FT                   ATR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03003g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62453"
FT                   /db_xref="GOA:Q6FJW7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW7"
FT                   /inference="similar to AA sequence:UniProtKB:Q03263"
FT                   /protein_id="CAG62453.1"
FT                   /translation="MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDEC
FT                   QSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQT
FT                   QSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMT
FT                   LWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIG
FT                   CMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLN
FT                   MDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPL
FT                   LPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT
FT                   VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDL
FT                   SFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR
FT                   SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC"
FT   gene            complement(<341849..>345613)
FT                   /locus_tag="CAGL0M03025g"
FT                   /old_locus_tag="CAGL-IPF6571"
FT                   /old_locus_tag="CAGL-CDS0210.1"
FT   CDS_pept        complement(341849..345613)
FT                   /locus_tag="CAGL0M03025g"
FT                   /old_locus_tag="CAGL-IPF6571"
FT                   /old_locus_tag="CAGL-CDS0210.1"
FT                   /note="similar to uniprot|P39113 Saccharomyces cerevisiae
FT                   YMR280c CAT8 transcription factor involved in
FT                   gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03025g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62454"
FT                   /db_xref="GOA:Q6FJW6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW6"
FT                   /inference="similar to AA sequence:UniProtKB:P39113"
FT                   /protein_id="CAG62454.1"
FT                   /translation="MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSNT
FT                   GSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTE
FT                   TLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENM
FT                   ELQLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAE
FT                   REESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPT
FT                   PNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDD
FT                   LLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKI
FT                   NFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQD
FT                   MSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGST
FT                   MQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDF
FT                   SLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
FT                   LFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTS
FT                   ETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTAC
FT                   SAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTT
FT                   KMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNPIAKGELK
FT                   SDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA
FT                   PESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSF
FT                   AKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTL
FT                   YGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSRS
FT                   FTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAAT
FT                   SYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNNTLG
FT                   KDSLAMKTEINGGRNQGNLHDLFQWQNSK"
FT   gene            <346435..>347349
FT                   /locus_tag="CAGL0M03047g"
FT                   /old_locus_tag="CAGL-IPF6568"
FT                   /old_locus_tag="CAGL-CDS3575.1"
FT   CDS_pept        346435..347349
FT                   /locus_tag="CAGL0M03047g"
FT                   /old_locus_tag="CAGL-IPF6568"
FT                   /old_locus_tag="CAGL-CDS3575.1"
FT                   /note="weakly similar to uniprot|P23797 Saccharomyces
FT                   cerevisiae YMR281w GPI12 N-acetylglucosaminyl
FT                   phosphatidylinositol deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03047g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62455"
FT                   /db_xref="GOA:Q6FJW5"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR039516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW5"
FT                   /protein_id="CAG62455.1"
FT                   /translation="MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVED
FT                   LNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADG
FT                   LGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVK
FT                   QKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVV
FT                   PKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMV
FT                   WFRYLWWSFSRYVFVNDLSRITV"
FT   gene            complement(<347584..>349230)
FT                   /locus_tag="CAGL0M03069g"
FT                   /old_locus_tag="CAGL-IPF6567"
FT                   /old_locus_tag="CAGL-CDS1781.1"
FT   CDS_pept        complement(347584..349230)
FT                   /locus_tag="CAGL0M03069g"
FT                   /old_locus_tag="CAGL-IPF6567"
FT                   /old_locus_tag="CAGL-CDS1781.1"
FT                   /note="weakly similar to uniprot|P22136 Saccharomyces
FT                   cerevisiae YMR282c AEP2 required for the expression of
FT                   subunit-9 of atp synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03069g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62456"
FT                   /db_xref="GOA:Q6FJW4"
FT                   /db_xref="InterPro:IPR024319"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW4"
FT                   /protein_id="CAG62456.1"
FT                   /translation="MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKN
FT                   VEVSKYSHVELRSLNEQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSV
FT                   EDAIQLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVD
FT                   ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRS
FT                   GALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH
FT                   SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIV
FT                   SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTW
FT                   ELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNS
FT                   LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQ
FT                   KRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW"
FT   gene            complement(<349679..>352171)
FT                   /locus_tag="CAGL0M03091g"
FT                   /old_locus_tag="CAGL-IPF6566"
FT                   /old_locus_tag="CAGL-CDS0733.1"
FT   CDS_pept        complement(349679..352171)
FT                   /locus_tag="CAGL0M03091g"
FT                   /old_locus_tag="CAGL-IPF6566"
FT                   /old_locus_tag="CAGL-CDS0733.1"
FT                   /note="similar to uniprot|P09880 Saccharomyces cerevisiae
FT                   YJL087c TRL1 tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03091g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62457"
FT                   /db_xref="GOA:Q6FJW3"
FT                   /db_xref="InterPro:IPR012387"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW3"
FT                   /inference="similar to AA sequence:UniProtKB:P09880"
FT                   /protein_id="CAG62457.1"
FT                   /translation="MNLSRNVKDLVEKLEAASQLPGRGKAIKRICKLSNSDGQVVSWKF
FT                   NEWDYGKNNIKLPCCARGLFITDDSKNPQIVARGYDKFFNIDETPFTRWDTLESDTKGT
FT                   YNVTLKANGCIIFVSGMADGTLVVCSKHSTGPRDDVDRNHADAGEQFLLSQLKSIGIEP
FT                   QQLALELYQNNVTAVAEYCDDTFEEHILEYTNDDVGLYLHGINYNETTFRTWDMDSVSE
FT                   FARKYNFKQIKYENFNDFTLLKKFLEECSNSGTYHGQEVEGFVIRCKTRENGNDFFFKY
FT                   KFEEPYLMYRQWREVTKDYISTKSRVFKFKKHKFITNKYLDFVIPILDSSPALCEEYMK
FT                   GFGIIKLRNEFLKDFGMSGLEILNHEKVLELENANKIDYDTVDEHTKFLIIPVAVIGCG
FT                   KTTTAMTINNIYPESWGHVQNDNITGKDNSLLMKRSLELLAKPGIKCVVVDRNNHQARE
FT                   RKELFDWIDEYKEDYLPYDTNIKVICLSFTKRDDLENVREITTNRVFARGDDHQSIKLS
FT                   KYGEKKVMGIMSGFIKRFQPVNEDRMPDIMFDHVIDLTVTEKDSSLINAKRILNNLHDK
FT                   YPVLVPTVPTDEEIRAAFEKSLEYKPTTVKIINEKGSRRNKNKDKKHTSAPTMKKLKPV
FT                   YFFAELRDPTKLLRCIKAFIEENRSSIDNDSYIHIDRLFQDKKYQEKLHVTLIHLMQGK
FT                   KGTETQQQLWDDYLRSFDEYLTVNPETFDKNCDRIKTKYSIKVTVQSLYWDSKIATLTV
FT                   KPELVEVERDGSLNTLACCNDIPHITLGILEEGIKPVYSNELLKMMNQNDKESRPANSF
FT                   CLELAGLEVQIADVYIHL"
FT   gene            <352552..>354423
FT                   /locus_tag="CAGL0M03113g"
FT                   /old_locus_tag="CAGL-IPF6564"
FT                   /old_locus_tag="CAGL-CDS1383.1"
FT   CDS_pept        352552..354423
FT                   /locus_tag="CAGL0M03113g"
FT                   /old_locus_tag="CAGL-IPF6564"
FT                   /old_locus_tag="CAGL-CDS1383.1"
FT                   /note="highly similar to uniprot|P19658 Saccharomyces
FT                   cerevisiae YJL085w EXO70 exocyst component protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03113g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62458"
FT                   /db_xref="GOA:Q6FJW2"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW2"
FT                   /protein_id="CAG62458.1"
FT                   /translation="MNEIDVDEADILVLSQGLEKTSRLTHQVNKSLAKISKTSAQSSQL
FT                   FGPILARNNVLKTLQRNIDSTLNSVASVKDLANEASKHEVLLRKGIASLGLKPFTVELH
FT                   KLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELEFIQILKRIEPFDPQIN
FT                   MEKKIPFPYYSDEDISQMLIIFNYFYVKSEDSRMQDIFIRERGDQMLKSMAFMEPFAKK
FT                   VTSSKNAPYEKGSSGFINYTEAVLGFIANERSLIDDVFSQFAEIKPRVLRNILDPIVAA
FT                   FCKVLMSDLIFVKSNIDNAGLFSFELTECISGVQKSVKGMNLKNQMQLIDADKQVKDVT
FT                   RSLFKDTVDRIKSKTNQMTTIPSDNGVTEATVDTMSRLRKFSEYKTGCLAAMESISRDV
FT                   WLSKSFREKEYTIQSAAIADNETAASLLSCFLSDCIDTLVANLERRAQTILMPNQEPDV
FT                   ANPNSARNKFKQRIGFLVLMNMTLVEQIVEKSELSVMLGNLGKARIEKLKKRYVNYLVA
FT                   DWKDLTVNLMDTVVIDSVGKKSKDKEQIKEKFRRFNEGFEDLISRTKQYKLSDPALKRL
FT                   LKSEIVALLMPMYDRFYGRYKDSFKNPRKHIKYTPDDITNVISQTLR"
FT   gene            complement(<354638..>357859)
FT                   /locus_tag="CAGL0M03135g"
FT                   /old_locus_tag="CAGL-IPF6563"
FT                   /old_locus_tag="CAGL-CDS0349.1"
FT   CDS_pept        complement(354638..357859)
FT                   /locus_tag="CAGL0M03135g"
FT                   /old_locus_tag="CAGL-IPF6563"
FT                   /old_locus_tag="CAGL-CDS0349.1"
FT                   /note="similar to uniprot|P47029 Saccharomyces cerevisiae
FT                   YJL084c or uniprot|P36117 Saccharomyces cerevisiae YKR021w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03135g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62459"
FT                   /db_xref="GOA:Q6FJW1"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW1"
FT                   /inference="similar to AA sequence:UniProtKB:P47029"
FT                   /protein_id="CAG62459.1"
FT                   /translation="MPIADSNSPLFPIGKDLTIPTDAKPVASTASVQIYIKLAEPVVFL
FT                   QDFENLNHSDKPPGILRGSLILRILKPTKVKNLTLNFKGYARTEWIEGIPPKKQEFAEI
FT                   NDIINHTWPFYQSSEHHHSHHAHSSTASSSPAASNATSNNSGSNTRTGTPGNEDSPVYK
FT                   GTGAALYRPLPRSTSERALRTGATQSSTPTNFSPLKNNTVLRSKSKDNLDDFARKRVLS
FT                   RASSHSTLTNNSFNSSSNNNNGHTLNKTLSPMSFLRRATSSNSAHAFGVNDTPSASHRN
FT                   GASTPTHPAPTGSFISDILSGNFASPGDSTTHNHAGNSSHQVNSNNQSQQATADFDPVG
FT                   ENGTFQPGDYIYPFEQLIPQSYPETVKAEFGFVEYYLFVSLERHGPFKSNLTGRTPVNI
FT                   IRTQSDNSVEESEPIIISRDWENALFYDIVIGSKDIVLDAFLPINFRLSPMEKLTLHRI
FT                   RIYVTETMEYFCKNQKVHRIEPTKKFLLAEHKGPRVPGLPKDANYNKAKNMGNLLLDES
FT                   SGDLVNKEFQYQLFVPSKFNNHQKIHPDTTYDNIKANHWIKICLRLSRVVGDKRKHYEI
FT                   SIDSPMRVLHKLCSHANTLLPSYESHLIFNKQNFTDSSSQKNRESTNDNELGLYHDSNI
FT                   FFPKEVLMSPLLSPDVQALDVNTESIYNAPYRVIRHDEFDDSRHKSGNDPSANVFNSPT
FT                   LKSNIYQPDSIQRELASPQAVPLSPMLSSLSLTDFHQSNPPDFESLEDQLSAATTRSNS
FT                   PMILPKDPPTYKEATHNDPSGVVASASIPKIKLSHSQESLPINNKNLRIKGLTPFSDTA
FT                   SIDTLSNDSDIAAGFQFSSSPNLTHSLLRSHSPSMISLHTGENVKNTPRLDVSHDNMPS
FT                   TIRDDRHFFNDISQILGDEAEENENHLKLSRTHESSNGEASARSSFDMSAINFRKDSVT
FT                   AEPLLSNRNNSQISGIGNFAMPSKESLPLLGSPTDSSVDITALYDRNSAAWHPLQLEGE
FT                   IPLSPIVSNESHSNMLFKANQRPNDDATNTSHDDMLTRDVNPTDDSSGGLSDTDHRRTS
FT                   HIGEHEKPITNAAETHKNINAVDSI"
FT   gene            <358599..>361211
FT                   /locus_tag="CAGL0M03157g"
FT                   /old_locus_tag="CAGL-IPF9653"
FT   CDS_pept        358599..361211
FT                   /locus_tag="CAGL0M03157g"
FT                   /old_locus_tag="CAGL-IPF9653"
FT                   /note="some similarities with uniprot|P47030 Saccharomyces
FT                   cerevisiae YJL083w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03157g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62460"
FT                   /db_xref="GOA:Q6FJW0"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW0"
FT                   /protein_id="CAG62460.1"
FT                   /translation="MHMRLNKRRRNHVQEQMSELPQDAKNDSLAAAQVIFKRHADNANS
FT                   TPPSPVGLDSAGHLDKQADTAQRVHKVGTPSGTSSSHNSGNEGMHKVTKPLGENTATTA
FT                   PIAIKQPVRVVRASPTAIVSPTSHTPLDAATAAANVVAEKSKIRTTQQQLQDKKRRDIE
FT                   NAHHAASAAAVTSSNLAVGSPPSQYIPSVPTLNVTSPQMRNSSQNIDRRSKSNEEAHNG
FT                   HEKMMNSRSNSINSSTIKGSVSEPNTVTPLRQNSPSNMDDIIQKMEAVDIDEGRKNSFV
FT                   MNGSGDSVDSLKPNVVRRPMRTPSGRRVRPPSPIDKIGSIQEPHLESTGFNDQNDFSEM
FT                   SSLIDGSSSEDITKIRGSGIRERSPVDGVEHGGMSVNIPMQRSLSSDVLSPSQQAAMVA
FT                   ATKLSPSTQTLPVEELEYLASTGDVSAYKALNKINGTNMAYKGTIPDLIPSRARAQKTS
FT                   KLKFKIFGGGKNSDRRNNATPIGYDPVMNISTDFGGKKVVESNQNNVKFKTTMRSQKYL
FT                   GNDNLDDNDLRTQYIDDDDDDDDYDSAYEDLDYSRDDSEAMYKGDRESSNPRSNSLLQS
FT                   SSYSGKVGFNSNANSGTSINNSGNVSNLDYSLRDGVAEKKKSRRDKIKKKLKSTASVVP
FT                   YYPHYALTHLASGVSTVNSNLNNSNKNTKWFNEDKPWKSHKDVGFVTSQERKRYEAMWV
FT                   TNRYLYLNLLPWWPKEEVEKDEDDSASNLNSNASTNVGGVLSDGDNEEDDVTRFLLSLP
FT                   ADGLMLNLVAKDIWERSNLPNDLLKQIYDLVDTRKDGTLNRESFLVGMWLVDQCLYGRK
FT                   LPQELDPKIWDSVDRWVLNVVNSTMMTALERKQKKKMMKKELKNIKREQKQAIAEQHN"
FT   gene            <362253..>364484
FT                   /locus_tag="CAGL0M03179g"
FT                   /old_locus_tag="CAGL-IPF6835"
FT                   /old_locus_tag="CAGL-CDS0959.1"
FT   CDS_pept        362253..364484
FT                   /locus_tag="CAGL0M03179g"
FT                   /old_locus_tag="CAGL-IPF6835"
FT                   /old_locus_tag="CAGL-CDS0959.1"
FT                   /note="similar to uniprot|P47031 Saccharomyces cerevisiae
FT                   YJL082w IML2 and similar to uniprot|P36114 Saccharomyces
FT                   cerevisiae YKR018c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03179g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62461"
FT                   /db_xref="GOA:Q6FJV9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV9"
FT                   /inference="similar to AA sequence:UniProtKB:P47031"
FT                   /protein_id="CAG62461.1"
FT                   /translation="MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIALR
FT                   AMDYVLDDRTEEGLALLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASNTL
FT                   AKAEQLSWKSRTEAQKSGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAAKAL
FT                   LKLRKAYSMLHEIMEVVKKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQLSET
FT                   ESNDPELWAFAEKIYKMRKLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANSEQSVL
FT                   SDEAAERQATIDEFIHSGVNLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEGLRLIWK
FT                   ATKDRNVHGCIGLLGLMFYYDGPFQFTDVDFDIPPALSNTKTSDSDTDRDGSISIDEMD
FT                   GHALLHPGPILEEALLHARALFPNSALWLLNEARMLSSRGRLPEAIELLDSIDVESIHM
FT                   RQVKGLLVFDKAITLVHMQEYERAATNLLSLLKISDWSHAFYTYFAGCCYLENWRMAQM
FT                   GFIKDDKLEFYREKAEELIFSAPKLLGKKTFKSKNLPLDRFMLRKVEQFKATQKKLGVK
FT                   NILDAIGTSPIREITYFYNGYNRMSKSDLEIAQKMLTSYHNPAIDQHDPDQELIKNLLL
FT                   SLTMRRLGDVESGVKLLDEKVLPSIYYMQNGKVKYIKKTEDPWAYPTALYERALFTWKL
FT                   DGVDNLSECRHWLVTAQNYAGDYELSTRVGMKIKAALDRVEESLQHGTA"
FT   gene            complement(<364771..>366252)
FT                   /locus_tag="CAGL0M03201g"
FT                   /old_locus_tag="CAGL-IPF6834"
FT                   /old_locus_tag="CAGL-CDS2110.1"
FT   CDS_pept        complement(364771..366252)
FT                   /locus_tag="CAGL0M03201g"
FT                   /old_locus_tag="CAGL-IPF6834"
FT                   /old_locus_tag="CAGL-CDS2110.1"
FT                   /note="similar to uniprot|P80428 Saccharomyces cerevisiae
FT                   YJL081c ACT3 protein Actin-like protein ARP4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03201g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62462"
FT                   /db_xref="GOA:Q6FJV8"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV8"
FT                   /inference="similar to AA sequence:UniProtKB:P80428"
FT                   /protein_id="CAG62462.1"
FT                   /translation="MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFG
FT                   EIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSW
FT                   ALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATG
FT                   RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPLFEVE
FT                   QRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATSTGRTI
FT                   ESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMKRNKVGS
FT                   GNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISS
FT                   CDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWL
FT                   GGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR"
FT   gene            complement(<366828..>370457)
FT                   /locus_tag="CAGL0M03223g"
FT                   /old_locus_tag="CAGL-IPF6832"
FT                   /old_locus_tag="CAGL-CDS0233.1"
FT   CDS_pept        complement(366828..370457)
FT                   /locus_tag="CAGL0M03223g"
FT                   /old_locus_tag="CAGL-IPF6832"
FT                   /old_locus_tag="CAGL-CDS0233.1"
FT                   /note="similar to uniprot|P06105 Saccharomyces cerevisiae
FT                   YJL080c SCP160 required for maintenance of exact ploidy"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03223g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62463"
FT                   /db_xref="GOA:Q6FJV7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV7"
FT                   /inference="similar to AA sequence:UniProtKB:P06105"
FT                   /protein_id="CAG62463.1"
FT                   /translation="MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEESKPVEEAPKP
FT                   EPKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRMRS
FT                   NNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKE
FT                   AKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNE
FT                   DLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSD
FT                   DVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADE
FT                   VKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLD
FT                   HAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAAR
FT                   REIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLF
FT                   ATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVAL
FT                   KLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEV
FT                   PVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDI
FT                   ANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPS
FT                   RGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQ
FT                   KSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGA
FT                   GGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQN
FT                   SITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKA
FT                   EKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNR
FT                   TPVDIPYEKVAGAEGEKVKFTVEETGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEK
FT                   KEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKI
FT                   RESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSLKQ"
FT   gene            complement(<372122..>373810)
FT                   /locus_tag="CAGL0M03245g"
FT                   /old_locus_tag="CAGL-IPF6830"
FT                   /old_locus_tag="CAGL-CDS1713.1"
FT   CDS_pept        complement(372122..373810)
FT                   /locus_tag="CAGL0M03245g"
FT                   /old_locus_tag="CAGL-IPF6830"
FT                   /old_locus_tag="CAGL-CDS1713.1"
FT                   /note="similar to uniprot|P39994 Saccharomyces cerevisiae
FT                   YEL020c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03245g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62464"
FT                   /db_xref="GOA:Q6FJV6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV6"
FT                   /inference="similar to AA sequence:UniProtKB:P39994"
FT                   /protein_id="CAG62464.1"
FT                   /translation="MGKKVIHSRNIASLLKYQYDVDVVFGIVGIPVVEFAQELQSVGIR
FT                   FIGFRNEQAASYAASAYGYLTGKPGVLLVVGGPGVIHALAGVYNSMNNRWPLLIIAGSV
FT                   PRDEKYQGGFQELDQVSLLKPYLKFAGELTGTKKDANIVFNAWNSATQGTPGVSYIDFP
FT                   GDLITDVVEAIEFYKHETKRITTGPDPRSIAEVTSLIKEHQDKNILVVLGKGCINSSLA
FT                   LRHFIEEFNFPFLPTPMAKGILPDSHRLNVSAARSQALKSADLVLVFGARLNWILHYAS
FT                   PPKWNSNAKFVQVDIEPLTLGVNNPNGTSYCIWGDIQLTIENLRDTLHKLDFVKHKGLT
FT                   KELKEKIESNKHNLRVRLNPENYYGAKMLNYYSVYSMLKNLIDDRSSFIVSEGANTMDI
FT                   ARISFETDFPKRRLDAGTNATMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIET
FT                   AVRYRLGIIFIIMNNSGIYHGSDPSTITNETQLPPTMLSEKCRYDLVARGLGAKGYLVK
FT                   NLQELEYYYKKALVHTRERIPCLLNVIIEPGQNKKISFGWQKSKL"
FT   gene            complement(<374158..>374958)
FT                   /locus_tag="CAGL0M03267g"
FT                   /old_locus_tag="CAGL-IPF6829"
FT                   /old_locus_tag="CAGL-CDS3859.1"
FT   CDS_pept        complement(374158..374958)
FT                   /locus_tag="CAGL0M03267g"
FT                   /old_locus_tag="CAGL-IPF6829"
FT                   /old_locus_tag="CAGL-CDS3859.1"
FT                   /note="weakly similar to uniprot|P38632 Saccharomyces
FT                   cerevisiae YEL019c MMS2 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03267g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62465"
FT                   /db_xref="GOA:Q6FJV5"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR026846"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV5"
FT                   /protein_id="CAG62465.1"
FT                   /translation="MDSVALPEALPIHKDQRDNFHDLRECYISSELSTIEKQYEKTINQ
FT                   LTTYIDLLEEDQILQCVNKLTESYKDTLAQKEQADQLDNQLESLKQDYLRISDHSPATD
FT                   IDSFREYTNGTVGIDSFQKYFTEGIVDQKPTIPRNNVRRKPNTYEKLLKALPYIIRDPT
FT                   CVIPDEDQEEDDIQIEGGKIELNCPITCKPFENPMISKACNHVFDKVGIQMYFDTPDKK
FT                   KCPQGACGHELTARDFIPDNIMMLRCKINNRKKNDQARNMLDVL"
FT   gene            <375233..>375850
FT                   /locus_tag="CAGL0M03289g"
FT                   /old_locus_tag="CAGL-IPF6828"
FT                   /old_locus_tag="CAGL-CDS4407.1"
FT   CDS_pept        375233..375850
FT                   /locus_tag="CAGL0M03289g"
FT                   /old_locus_tag="CAGL-IPF6828"
FT                   /old_locus_tag="CAGL-CDS4407.1"
FT                   /note="some similarities with uniprot|P39995 Saccharomyces
FT                   cerevisiae YEL018w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03289g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62466"
FT                   /db_xref="GOA:Q6FJV4"
FT                   /db_xref="InterPro:IPR026226"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV4"
FT                   /protein_id="CAG62466.1"
FT                   /translation="MNEEIQTLLIYQICDSLRFQANMEDISVDDVMDVMQENIMVECLL
FT                   DGVIMDKADVQKIVIQYVTDGELGEEAIGDKMESMYSNSRKKLLKEIDDLDNTISTNRK
FT                   KDKLLNLYRDTVLNRLQNKKTVLDKLYHGMKEDSSVIRNRIYLERIKNETPNSIAELQL
FT                   MLQRSIADCIMSEPIGSEKYNIAKEIQINLEDTIRFMKRALE"
FT   gene            complement(<376045..>376164)
FT                   /locus_tag="CAGL0M03305g"
FT                   /old_locus_tag="CAGL-IPF14334"
FT   CDS_pept        complement(376045..376164)
FT                   /locus_tag="CAGL0M03305g"
FT                   /old_locus_tag="CAGL-IPF14334"
FT                   /note="highly similar to uniprot|P40975 Saccharomyces
FT                   cerevisiae YEL017ca PMP2 plasma membrane ATPase proteolipid
FT                   2 or uniprot|P32903 Saccharomyces cerevisiae YCR024ca PMP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03305g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58073"
FT                   /db_xref="GOA:B4UN57"
FT                   /db_xref="InterPro:IPR012589"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN57"
FT                   /protein_id="CAR58073.1"
FT                   /translation="MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF"
FT   gene            <377932..>378930
FT                   /locus_tag="CAGL0M03311g"
FT                   /old_locus_tag="CAGL-IPF6826"
FT                   /old_locus_tag="CAGL-CDS3310.1"
FT   CDS_pept        377932..378930
FT                   /locus_tag="CAGL0M03311g"
FT                   /old_locus_tag="CAGL-IPF6826"
FT                   /old_locus_tag="CAGL-CDS3310.1"
FT                   /note="similar to uniprot|P39996 Saccharomyces cerevisiae
FT                   YEL017w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03311g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62467"
FT                   /db_xref="GOA:Q6FJV3"
FT                   /db_xref="InterPro:IPR038872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV3"
FT                   /inference="similar to AA sequence:UniProtKB:P39996"
FT                   /protein_id="CAG62467.1"
FT                   /translation="MSTFARWRKAELFDLMNKLKITDVSNSTKKSDMIVLIEHYLENLS
FT                   APLDYMHDFPELQTYYEDKQQLKIESDIEDELDKISSTSEDMEYGEDIDMKEETSETSS
FT                   DSSAEETETVVEKKDYNNLDFSEEPTKLQDFKFNFDQILDDIIDRAYIINENVKDYLSS
FT                   ISAVESIFTIIELVLFSVHLFANYRTGETVLSAQHSIGYMDYYFRPEYYKREVVHFLNK
FT                   IGLPILTWFFLLRIVPCFVSYYINFIRYELLVDMDPMVYHLFKGIVEFLIITRFNDNQN
FT                   PIQGFLSSFSFSPLGHLHVDPCRDLREFNDALGYLPLCFSVVCTILTLYIL"
FT   gene            <379851..>381758
FT                   /locus_tag="CAGL0M03333g"
FT                   /old_locus_tag="CAGL-IPF6823"
FT                   /old_locus_tag="CAGL-CDS1332.1"
FT   CDS_pept        379851..381758
FT                   /locus_tag="CAGL0M03333g"
FT                   /old_locus_tag="CAGL-IPF6823"
FT                   /old_locus_tag="CAGL-CDS1332.1"
FT                   /note="similar to uniprot|P39998 Saccharomyces cerevisiae
FT                   YEL015w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03333g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62468"
FT                   /db_xref="GOA:Q6FJV2"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV2"
FT                   /inference="similar to AA sequence:UniProtKB:P39998"
FT                   /protein_id="CAG62468.1"
FT                   /translation="MSQFIGYGVKLELKDGKILEGKITKATSKGLVLSDVKFEDGGSSQ
FT                   LFKVRSSQLKDLKVVSVRQKNGKGNGSNGNAANKSSRNKSRNDYSMNSGSQTNGNTSHG
FT                   GSRHNNNNNNNSRYDSDWANDDVNQIKLQDDFDFQGNLNMFNKKDVFAQLKQQDDVAPE
FT                   LRLVAHNKKKDYEKPKNFNIDEMVIPNAKEDSWHKIDSERPQQQKSDGYLDFESGTDDD
FT                   DVDDHEDRQLSNTRDRKNNNQIKHNVEDDDDDDDEGLEFHDADELPITQAVNITHLLHK
FT                   AAKGSNSGKSKDGSQGNEQMLAKLEQMIIQQSKGSTRRNSSISSKKPTLLKIKDSSKQI
FT                   ATATPVQLLEIERIAQDHFGITAPILIENFAINLAQVIKQKLGGKARLRLENSNAEPLV
FT                   VILTSDSVRSGARALALGRQLCRTGHIRVITMFTTSVNEIQDSLVKEQLELFKKCGGKV
FT                   VNKVSSLESAVMSLNSPVEIVIDAMQGFDYNISDIFENIAEAEQADEDVNASDQNRRNN
FT                   TRNSVSKAETIEQRITDIINWCNNQRGSTKIWSLNVPSSFDSGSGVQNFPVAVQATGVI
FT                   CTGWPLSSLPNIKYTLSSLDDVVAVDMGFPRGVYTLQNSLRKFLSFDVFAIEGSIALEL
FT                   "
FT   gene            <382549..>384297
FT                   /locus_tag="CAGL0M03355g"
FT                   /old_locus_tag="CAGL-IPF6821"
FT                   /old_locus_tag="CAGL-CDS1606.1"
FT   CDS_pept        382549..384297
FT                   /locus_tag="CAGL0M03355g"
FT                   /old_locus_tag="CAGL-IPF6821"
FT                   /old_locus_tag="CAGL-CDS1606.1"
FT                   /note="highly similar to uniprot|P39968 Saccharomyces
FT                   cerevisiae YEL013w VAC8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03355g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62469"
FT                   /db_xref="GOA:Q6FJV1"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV1"
FT                   /protein_id="CAG62469.1"
FT                   /translation="MGGCCSCFRDSSDDVSVLPITDNEREAVTLLLGYLEDKDRLDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEVTEKYVRQVSRDVLEPILILLQSQDPQIQVA
FT                   ACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLATRDDNKHKI
FT                   ATSGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAVPVLVSLLSSNDP
FT                   DVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASD
FT                   TSYQLEIVRAGGLPHLVNLIQSESVPLILASVACIRNISIHPLNEGLIVDAGFLPPLVK
FT                   LLDYRDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISAC
FT                   FAILALADVSKQDLLDADILQALIPMTFSTNQEVSGNAAAALANLCSRIDNYSKIISSW
FT                   DQPKEGIRGFLKRFLQSNYATFEHIALWAILQLSESHNDKVIYLIKNDKEIINSVRKMA
FT                   DVTYDRLQKSGVDVNKNGNSEERGDNEDHQSNNDRNLANSTSSDQYEDASMELYNITQQ
FT                   ILQFLD"
FT   gene            complement(<385581..>387701)
FT                   /locus_tag="CAGL0M03377g"
FT                   /old_locus_tag="CAGL-IPF6818"
FT                   /old_locus_tag="CAGL-CDS1071.1"
FT   CDS_pept        complement(385581..387701)
FT                   /locus_tag="CAGL0M03377g"
FT                   /old_locus_tag="CAGL-IPF6818"
FT                   /old_locus_tag="CAGL-CDS1071.1"
FT                   /note="highly similar to uniprot|P32775 Saccharomyces
FT                   cerevisiae YEL011w GLC3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03377g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62470"
FT                   /db_xref="GOA:Q6FJV0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV0"
FT                   /protein_id="CAG62470.1"
FT                   /translation="MSLTKIPENVQGAVSIDPWLEPFADVLSERRYLADKWLYDIKHAT
FT                   PDGSEQSLVDFARNAYKTYGLHANQQTKEIVYREWAPNAQRAFLVGEFNNWNEESHEMK
FT                   HKDEFGVFSITLAPLENGDFAIPHDSKIKVMFVLPDGSKVYRIPAWITRATQPSKETAQ
FT                   KYGPTYEGRFWNPPNSYQFKHQRPKFNLANDSIKIYEAHIGISSPEPKVASYKEFTQNV
FT                   LPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRYGTPEDLKELIDTAHSMGIL
FT                   VLLDVIHSHASKNSEDGLNMFDGSDHQYFHSLTSGRGEHPLWDSRLFNYGSFEVQRFLL
FT                   ANLAYYIDVYQFDGFRFDGVTSMLYLHHGVGAGGAFSGDYNEYLSRDRSGVDHEALAYL
FT                   MLANDLVHDLLPESAVTIAEDVSGYPTLCLPRTAGGGGFDYRLAMALPDMWIKLLKTKQ
FT                   DDDWDMGHIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPT
FT                   LVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPRVGNNDSYHYARRQFNL
FT                   VDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFERNGHLFVFNFH
FT                   PTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLEWNNRRNFIQVYI
FT                   PSRTAIVLTRQM"
FT   gene            complement(<389650..>390294)
FT                   /locus_tag="CAGL0M03399g"
FT                   /old_locus_tag="CAGL-IPF6816"
FT                   /old_locus_tag="CAGL-CDS4315.1"
FT   CDS_pept        complement(389650..390294)
FT                   /locus_tag="CAGL0M03399g"
FT                   /old_locus_tag="CAGL-IPF6816"
FT                   /old_locus_tag="CAGL-CDS4315.1"
FT                   /note="highly similar to uniprot|P28263 Saccharomyces
FT                   cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03399g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62471"
FT                   /db_xref="GOA:Q6FJU9"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU9"
FT                   /protein_id="CAG62471.1"
FT                   /translation="MSGNSKRRIETDVMKLLMSDHEVELVEDSMQEFHVKFYGPKDTPY
FT                   EGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLNIV
FT                   EWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDKYATKERYESQFGTPEDD
FT                   EDDGDDAEMKDEDGDDDIDEPVSDLEDISDDNADPSEELSDISDIELSDED"
FT   gene            complement(<390927..>391586)
FT                   /locus_tag="CAGL0M03421g"
FT                   /old_locus_tag="CAGL-IPF6815"
FT                   /old_locus_tag="CAGL-CDS4257.1"
FT   CDS_pept        complement(390927..391586)
FT                   /locus_tag="CAGL0M03421g"
FT                   /old_locus_tag="CAGL-IPF6815"
FT                   /old_locus_tag="CAGL-CDS4257.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03421g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62472"
FT                   /db_xref="GOA:Q6FJU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU8"
FT                   /protein_id="CAG62472.1"
FT                   /translation="MFFVSSTGIDISDAGKEFSFSSVESKFAQRWFIGNCKHRNPSRKN
FT                   AINQFFKSNAYSETINYSRKLKQKKLKQKEMAAMQRQNTTLLTAGSQNQEQPENSSREI
FT                   TNLLTGNDIWRHKRDDQVVVDTVTVHKKTKSFWKSFKHMRKQIRKLRLQKKNVYKPQGC
FT                   TTHTQRQCSKKETLERINFLKPLPYLVGDSYSPEIIKQNILAITEHSEQNLLLTDY"
FT   gene            <392109..>392182
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CAGL0M03443r"
FT   tRNA            392109..392182
FT                   /gene="tRNA-Asn (GTT)"
FT                   /locus_tag="CAGL0M03443r"
FT                   /product="transfer RNA-Asn"
FT   gene            complement(<393154..>393990)
FT                   /locus_tag="CAGL0M03465g"
FT                   /old_locus_tag="CAGL-IPF6814"
FT                   /old_locus_tag="CAGL-CDS3771.1"
FT   CDS_pept        complement(393154..393990)
FT                   /locus_tag="CAGL0M03465g"
FT                   /old_locus_tag="CAGL-IPF6814"
FT                   /old_locus_tag="CAGL-CDS3771.1"
FT                   /note="highly similar to uniprot|P25613 Saccharomyces
FT                   cerevisiae YCR010c SPG2 or uniprot|P32907 Saccharomyces
FT                   cerevisiae YNR002c FUN34"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03465g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62473"
FT                   /db_xref="GOA:Q6FJU7"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU7"
FT                   /protein_id="CAG62473.1"
FT                   /translation="MSDKDQGSAQLAGDHQEYQNKNYDSDVENMAGGDHEIGKIYTSGA
FT                   NNEYIYIGRQKFLKTDLYEAFGGTLNPGLAPPSSHKFANPAPLGLSAFALTTFVLSMFN
FT                   AKAQGIVVPNVVVGLAMFYGGLVQLIAGIWEIALENTFGATALCSYGGFWLSFGAIYIP
FT                   WFGILEAYKDKESDLGNALGFYLLGWTIFTYGLTLCTLKSTVAFFALFFLLALVLLLLS
FT                   IGEFSGKVGCKRAGGVVGVVVAFIAWYNAYAGVASRQNSYIVAHPFPLPTNEKTLY"
FT   gene            complement(<396552..>397505)
FT                   /locus_tag="CAGL0M03487g"
FT                   /old_locus_tag="CAGL-IPF6806"
FT                   /old_locus_tag="CAGL-CDS3439.1"
FT   CDS_pept        complement(396552..397505)
FT                   /locus_tag="CAGL0M03487g"
FT                   /old_locus_tag="CAGL-IPF6806"
FT                   /old_locus_tag="CAGL-CDS3439.1"
FT                   /note="highly similar to uniprot|P32910 Saccharomyces
FT                   cerevisiae YNR003c RPC34"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03487g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62474"
FT                   /db_xref="GOA:Q6FJU6"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU6"
FT                   /protein_id="CAG62474.1"
FT                   /translation="MSDINNATIQLSDRAKELHNVMITKGSGALFTQQELSERSGLASL
FT                   SDLMSIVQELLDKNLLKLVKQNNELKFQAVDFFEAQKKSTMSAEEALVYSYIESSGREG
FT                   IWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKHPTRKIYMLYHLQPSIEVTGGP
FT                   WFTDSELDVEFINSLLTIVWRFVSECTYPGGFSNFQNGSQGALYAPGIKNYCSLEDILQ
FT                   FIEQAQVANVQLNLGDIRSLCEVLVYDDKLERVLHDHYRVTLSSVMQMNQVASVSQADD
FT                   ATDMYAESEYSIFDFHTVMAPSSMDKEAVYFDEWVL"
FT   gene            complement(<397755..>397826)
FT                   /locus_tag="CAGL0M03509r"
FT   tRNA            complement(397755..397826)
FT                   /locus_tag="CAGL0M03509r"
FT                   /note="tRNA-iMet (CAT)"
FT   gene            complement(<398183..>400981)
FT                   /locus_tag="CAGL0M03531g"
FT                   /old_locus_tag="CAGL-IPF6805"
FT                   /old_locus_tag="CAGL-CDS0549.1"
FT   CDS_pept        complement(398183..400981)
FT                   /locus_tag="CAGL0M03531g"
FT                   /old_locus_tag="CAGL-IPF6805"
FT                   /old_locus_tag="CAGL-CDS0549.1"
FT                   /note="highly similar to uniprot|P32074 Saccharomyces
FT                   cerevisiae YNL287w SEC21"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03531g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62475"
FT                   /db_xref="GOA:Q6FJU5"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="InterPro:IPR032154"
FT                   /db_xref="InterPro:IPR037067"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU5"
FT                   /protein_id="CAG62475.1"
FT                   /translation="MSTSTYKKFEQAGSSDLPDKMTIYQDCMNTFNETPVNPKRCRLLI
FT                   SRLLRLLAQGETFPRNEATALFFSISKLFQYPNDSLRQLVYLAIKEFSGISEDVLMATS
FT                   SIMKDVQNGSDLVKPNAIRSLTNVLDESTAFSAERLLKSALVSKHPSISSAALCTSYHL
FT                   LPISEVTVKRFTNETQEAVVDLKQFPSSSMNGEYYPNSTYITQYHALGLLYQLKKNDKM
FT                   ALLKLVRQFSEGNVLKNQLAKVELVRIVSELIQKDPQLFTQFKPLLNNWLSNKFESVQL
FT                   ETAKMITSFAIHNPRLVSPELYAAAISALQSLLSVPRVSTRFATLRILNRISMISPEKI
FT                   AICNPELESLVNDSNRNISTYAITTLLKTGTAKNISSLIHTITRFIHDVSDDFKIIIVD
FT                   AVRTLSLNFPQEWKSIVTFLIDVLKNSEGGFKYKNSIVEALIDIVSFVPQSKELALENL
FT                   CDFIEDCEYNEILVRILHLLGKEGPSTTNPSLYVRHIYNRVVLENSIIRSAAVVALSKF
FT                   ALTKNDSTLCESIISLLKRIVHDKDDEVRDRASIALKFIEAAKEKNDKVANDLIQSSSA
FT                   YDLSSLESKLSAYLSSNTDSFQTPFDSQSIPKYAEDELKAMELKKKQEKIFENKGDKTR
FT                   DSSKTESTSNSAGENFNAEAEYDDGKDDLLAAKYAEEMAAIPEINAFGSIVNTTKAVPL
FT                   TEPEAEFVVTGIKHLFADHVVIQFNIRNTLTDVILDNVSVSCVPEESGDVTLEEQFTIP
FT                   IDRLLPSAESSCYVAFKKPEAIVTETFMNSINFTTREVNPDTNEPFEGDEGFEDEYEID
FT                   PITLSGGDYVKSSFVGNFTSAFDELPHEEIAVYNIQEDISIQEVVDKVIQNTSCLPLGS
FT                   TQYVGGDSNSHTLKLFGKSALTGSKIGMLVKFIKSSKGVALKVQGKAEDATLCADLVNS
FT                   VI"
FT   gene            complement(<401779..>402873)
FT                   /locus_tag="CAGL0M03553g"
FT                   /old_locus_tag="CAGL-IPF6803"
FT                   /old_locus_tag="CAGL-CDS3035.1"
FT   CDS_pept        complement(401779..402873)
FT                   /locus_tag="CAGL0M03553g"
FT                   /old_locus_tag="CAGL-IPF6803"
FT                   /old_locus_tag="CAGL-CDS3035.1"
FT                   /note="highly similar to uniprot|P53829 Saccharomyces
FT                   cerevisiae YNL288w CAF40"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03553g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62476"
FT                   /db_xref="GOA:Q6FJU4"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU4"
FT                   /protein_id="CAG62476.1"
FT                   /translation="MNVGVHTVGALSLDDGVIPPPGLNPNMMGMGNMPMGVPPMGAGGN
FT                   AGNAGNAGNQNPNASAGGNAGSSNANAASANNNASSGNAPAGTAQHALDDPNVYHWICE
FT                   LTYGPQKEQALLELGRKREQFDDLAIVLWSSFGVMTSLLNEIISVYPMLQPQLLTSQLS
FT                   NRVCNALVLLQCVASHSETKHLFLQAHFPMFLFPFLNTTSRQRTFEYLRLTSLGVIGAL
FT                   VKNDSKDVIGFLLRTDIVPLCLRIMESSSELSKTVAIFILQKILLDDVGLQYICATLER
FT                   FYAVTNVLKDMVEHLTVHTPPGRLLKHIIRCYLRLSDDLEARRVLKVVLPNKLRDNTFT
FT                   EVLMDDVATKRCLAQLLLTLNEEN"
FT   gene            complement(<403738..>404733)
FT                   /locus_tag="CAGL0M03575g"
FT                   /old_locus_tag="CAGL-IPF6800"
FT                   /old_locus_tag="CAGL-CDS3318.1"
FT   CDS_pept        complement(403738..404733)
FT                   /locus_tag="CAGL0M03575g"
FT                   /old_locus_tag="CAGL-IPF6800"
FT                   /old_locus_tag="CAGL-CDS3318.1"
FT                   /note="highly similar to uniprot|P38629 Saccharomyces
FT                   cerevisiae YNL290w RFC3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03575g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62477"
FT                   /db_xref="GOA:Q6FJU3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU3"
FT                   /protein_id="CAG62477.1"
FT                   /translation="MMTEDRDNLPWVEKYRPQTLDDVYGQREVVGTVKKFVQEGKLPHL
FT                   LFYGPPGTGKTSTIVALAKDIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFS
FT                   KGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYSHKITPALLSRCTRFRFQ
FT                   PLPNDAVEKRMANVLVHEHLRISPAAKEALLELSNGDMRRVLNVLQASKATLESPEDEI
FT                   TDEVIYECCGAPRPQDIQTILKSILEDDWSTAYDTLTRIRSSNGLALIDLIESIVKILE
FT                   EYKLKKEETRISLLSQLGDIEYAISKGGNDKIQSSAVIGAIKSSFELELV"
FT   gene            <404993..>406768
FT                   /locus_tag="CAGL0M03597g"
FT                   /old_locus_tag="CAGL-IPF6799"
FT                   /old_locus_tag="CAGL-CDS1553.1"
FT   CDS_pept        404993..406768
FT                   /locus_tag="CAGL0M03597g"
FT                   /old_locus_tag="CAGL-IPF6799"
FT                   /old_locus_tag="CAGL-CDS1553.1"
FT                   /note="similar to uniprot|P41821 Saccharomyces cerevisiae
FT                   YNL291c MID1 involved in Ca2+ influx during mating"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03597g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62478"
FT                   /db_xref="GOA:Q6FJU2"
FT                   /db_xref="InterPro:IPR024338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU2"
FT                   /inference="similar to AA sequence:UniProtKB:P41821"
FT                   /protein_id="CAG62478.1"
FT                   /translation="MLLWVLFLYLLASGSAFRFGGNDSWWNRRDLAAGGSEVAVDMQLL
FT                   DIVNKADGGSTSTSSDVGASSSAQSNADDTNGDGDDDDGDDDDDDDGEDEPQIINSNLI
FT                   YEWTPIISKMTPGKVDNYMFNINPESTGLGFAPSYEILIFLSGNICQQPTNSTDLQIRV
FT                   YYSFDEKMLSNISLGNFETFSNGYLEALQISPVNHTSNGTTLNSKNLYVSVRLWDLIND
FT                   KEVDKDDPNIKNLTSTEWDYRLSISENDLVFQWDTRSWIDVLDTDSTSALISTGNVTDD
FT                   GQIYSNYTIYDPTLYDLYLYTYDEYQKFLNVSELSLCAIKNGPHLVSSEGASATNPPLE
FT                   MLQETGLKIQKRIAESSSGIAEQFYITGLTPNTTYAAFLTKKIGKGQSLSNVGGVLFDA
FT                   EIFTTQTSDACSLIFGMSFCSDNAYSVPSSEFTNGNKSDLAIEYDNIASALYSNFSKAL
FT                   QLVPCDADLDARYSPIRTCDDCATSYRDWICAVSIPRCSTTESSSYIYRSKTDNRNSYV
FT                   NKFIKPTEDYYEVLPCIDMCYAIVRDCPSVFNFKCPDQESEPELLFQSYNIFKQSSPFI
FT                   TCNFIGNASYLKIHK"
FT   gene            complement(<406841..>408055)
FT                   /locus_tag="CAGL0M03619g"
FT                   /old_locus_tag="CAGL-IPF6798"
FT                   /old_locus_tag="CAGL-CDS2744.1"
FT   CDS_pept        complement(406841..408055)
FT                   /locus_tag="CAGL0M03619g"
FT                   /old_locus_tag="CAGL-IPF6798"
FT                   /old_locus_tag="CAGL-CDS2744.1"
FT                   /note="highly similar to uniprot|P48567 Saccharomyces
FT                   cerevisiae YNL292w EXM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03619g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62479"
FT                   /db_xref="GOA:Q6FJU1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU1"
FT                   /protein_id="CAG62479.1"
FT                   /translation="MNGIFAIEKPSGISSNQFMMQVQKIFNNSAVFSKEIERATAERRK
FT                   QFEQQTGKKASKRKLRKVSKVKMGHGGTLDPLASGVLVLGVGTGTKQLSQYLSGTVKVY
FT                   ETEALFGISTTSGDSEGEILSRNSVKHLKLEDVKTVEEKFRGSLKQTPPIYSALKMNGK
FT                   SLHEYAREGKPLPRAIEPRQVTIYDLEILPKTLSKDHDYKLIETEDESNSQIVKDLNAN
FT                   MLFDTLYYSKEYVEKMNLPSEVAAIEPPIPLTDEEKQEIGELKDKYRAPLLHAKASVSS
FT                   GTYIRSLVSDIGKAMRTSCYMTKLIRIQQQEWSLEKNNVFKLEDFTDKDEQVWAKVLEI
FT                   VLEKGSSVNIVEELKNAESLYQQQIKDLKVKETEDLAGATGSTAQPVVEETEHNDLKRK
FT                   HEESL"
FT   gene            complement(<408582..>410747)
FT                   /locus_tag="CAGL0M03641g"
FT                   /old_locus_tag="CAGL-IPF6797"
FT                   /old_locus_tag="CAGL-CDS1025.1"
FT   CDS_pept        complement(408582..410747)
FT                   /locus_tag="CAGL0M03641g"
FT                   /old_locus_tag="CAGL-IPF6797"
FT                   /old_locus_tag="CAGL-CDS1025.1"
FT                   /note="similar to uniprot|P48566 Saccharomyces cerevisiae
FT                   YNL293w MSB3 and similar to uniprot|Q12317 Saccharomyces
FT                   cerevisiae YOL112w MSB4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03641g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62480"
FT                   /db_xref="GOA:Q6FJU0"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU0"
FT                   /inference="similar to AA sequence:UniProtKB:P48566"
FT                   /protein_id="CAG62480.1"
FT                   /translation="MSSENLIDDAGVVSETTQPQEVHGSTDAPARTQDSDDVPKSNRAV
FT                   LSTAGLRLTHASRSDLKKPVLGFPKKSPSLPNFHENVQSDNENNSDPTLSKLLDESKFV
FT                   HNSHRLNFSLLKDDQPIDESDDTSGIETKEVKIEVKSQLHVPKTHKRTATLGGVSMNED
FT                   DGNLSVIDMYGDEVESRVSKPQVPAEATQVDNDESQDEEVPPHAGSNTSENPGQHNTEK
FT                   ATTEAAMTQEMLREQQIKADRRQSTFHYDRYGFKKQTNYVSEAKYDSWWNEYSQYCIRR
FT                   KHKWKQLLEKSGLPVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQDLLNR
FT                   NKDRYDQLLERMEILLSSDKKKIQDLDIIERDLHRTFPDNLHFQHNSYHGDEPPLISSL
FT                   RRVLVAFSLYNPKIGYCQSMNFLAGMLLLFLDEERAFWMLVIITSRYLPGVHNVNLEGV
FT                   NIDQAVLMLCIKEYLPEIWPYINPELKTINKTSNSLGIKNGGSTGVKNEFLYKLPPITL
FT                   CTASWFMGCFVGVMPVETTLRVWDCMFYEESHFLFKISLAIFKLCENDLSKVRNNGSSL
FT                   LPNYMNGNHKSMSKDESDMEVFQIIQVFPKSLIDPNDIFDKIILKKRLSFNRLDQEEID
FT                   RCRKYVATQRQKYKKFHDNGKNATFSGVNEDVPPAGESGTRIASDTINEALSSEIYGFK
FT                   KGLTGVHWNNSIKEKVRQMRKKIDKDD"
FT   gene            <411533..>413152
FT                   /locus_tag="CAGL0M03663g"
FT                   /old_locus_tag="CAGL-IPF6796"
FT                   /old_locus_tag="CAGL-CDS1847.1"
FT   CDS_pept        411533..413152
FT                   /locus_tag="CAGL0M03663g"
FT                   /old_locus_tag="CAGL-IPF6796"
FT                   /old_locus_tag="CAGL-CDS1847.1"
FT                   /note="weakly similar to uniprot|P48565 Saccharomyces
FT                   cerevisiae YNL294c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03663g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62481"
FT                   /db_xref="GOA:Q6FJT9"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJT9"
FT                   /protein_id="CAG62481.1"
FT                   /translation="MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYA
FT                   KNVKWSSFCDYGVPLYLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILM
FT                   VYSTIFVITVALTVLSFLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQE
FT                   HYGVANGNVFGTLLNSNLVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIM
FT                   SIVSFIISAIVSYTDRVGIRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVS
FT                   HLQMWYLALLTIAIVLLSPAMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHI
FT                   LKKAAQVKSLLGQKIYEDEQEGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSN
FT                   VGSNLSSKESSSLPAQMNSTGISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSK
FT                   SIIQLRKRNSETVKNERSNEELSIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESEC
FT                   ESNNILNESIDSHFPENGAGSV"
FT   gene            complement(<413333..>414814)
FT                   /locus_tag="CAGL0M03685g"
FT                   /old_locus_tag="CAGL-IPF6795"
FT                   /old_locus_tag="CAGL-CDS2109.1"
FT   CDS_pept        complement(413333..414814)
FT                   /locus_tag="CAGL0M03685g"
FT                   /old_locus_tag="CAGL-IPF6795"
FT                   /old_locus_tag="CAGL-CDS2109.1"
FT                   /note="weakly similar to uniprot|P48564 Saccharomyces
FT                   cerevisiae YNL295w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03685g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62482"
FT                   /db_xref="GOA:Q6FJT8"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT8"
FT                   /protein_id="CAG62482.1"
FT                   /translation="MSLVNSRQYRIMRFVPRICRQYRQFSQGRRKSGAVLKEKENTEVK
FT                   LQDNTTALNGVVNDADLLEPSGGDKTSETKWKRELKKDISSAKKPTTLVPSVSSTDHLT
FT                   DQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNFRVINASDDGGEKSLDEFL
FT                   ESVKDNDWNIDNSEQKKVIPWQASISGIEYEDKSFSNIPKHVLSKLRPYKLIKLKMPKI
FT                   VNKQRRASMIKNLKFHNNKVNDELHLVDIFGKPHERDIAKHQLGAASAELDSNMSKEQI
FT                   SAKREHFKELMYYYHRYGFIKSDCDQYKTYVDKQSKLAQKEFQKVTGLVIKPGRSDFCL
FT                   PLHLYVNKRQNSKILLERYLRKKLYRDVISVMLNFSSNISDQSMIKRFKKKLYNIQEET
FT                   IRDLTNILPSTEFEALEADCCIMKSPVSGFKRMHWLKYSKRHNVMWGKNYSKEFNVSGN
FT                   SFALTRSGVRRMKYPVYINWTTYDSTFRAWNHYNM"
FT   gene            <415143..>420122
FT                   /locus_tag="CAGL0M03707g"
FT                   /old_locus_tag="CAGL-IPF6793"
FT                   /old_locus_tag="CAGL-CDS0072.1"
FT   CDS_pept        415143..420122
FT                   /locus_tag="CAGL0M03707g"
FT                   /old_locus_tag="CAGL-IPF6793"
FT                   /old_locus_tag="CAGL-CDS0072.1"
FT                   /note="similar to uniprot|P48563 Saccharomyces cerevisiae
FT                   YNL297c MON2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03707g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62483"
FT                   /db_xref="GOA:Q6FJT7"
FT                   /db_xref="InterPro:IPR026829"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR032817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT7"
FT                   /inference="similar to AA sequence:UniProtKB:P48563"
FT                   /protein_id="CAG62483.1"
FT                   /translation="MRRVRNCDVFCVYIDLETSGQSTNGIENMMSRAGASFAVFNKQLD
FT                   ADLHALVAEARRRNSEVKEASHKSIEILKTIKTINDLENHPDFVVPFALACKTKNAKMT
FT                   TIAMQCLQNMASTRCIPEKRMDMILDAFIEATQLAMDIQLKVLQLVPIFFKTYSSYLKG
FT                   GLCKKLLYCCTSLLRVPNKAPIVAGTASATLQQLMDEIFDRLSDKTLESNNDEDEDFEV
FT                   LVNNNDFIKVNAFRYDANLVFSNLCSIVDTKSTEKTDNSLLDITDISTDLALEILESIL
FT                   QNGKQFLIEYEDLQFVLRIKTIPLLLRCMSNSKQFSTVLRCFRCIRLLIDKEFLMIIEL
FT                   ELEVMLSMIIHNLSLDSSILPWQRVLSLEIFNEISQNPTMLNDLYDIYDKYEDKKPILH
FT                   NFLTQSYHILLSDDFKDYIGYSSVIEKIEMPLISNNSFQTKNQYMQMLDKNTAPNVNIT
FT                   YIIWLIVNCTNCWSEKLSSQAVALTEIENKSLRNTTKDQLHVTLNGLFENLFNIHTLLL
FT                   QSSTIDTTIFHNIVRAFQKLTHCAGMLGEVSKVDRCLDYFRKAIITVEHASNTEKDLKV
FT                   NAPSHIRKSSGSAMLSTLSESIVGPDLNKDIQKENDNIQLYPQSINSKQVSLFRALTSL
FT                   AISLGPNFSAKSWYFLFTAWNWVYYFIYGPSNDILNSLNIDEEFISHDLSRNDLASIEN
FT                   TIHSFHDATKSYPLQTLIIMLTELEKLSDLTLNLNPKDQVGYQPFFNNSEFSVAIYNPS
FT                   FFISEIAELTSSNMSRILASTKTSSYWDKFIDYMVSQMADRKRTFALRLYCSHVIASVY
FT                   KTCTNEIYEIEDTNLRKTCFTKYEQIFTSSLNRIMASIEVLEVNKLNILNENLNTEGDI
FT                   IFQVLNTLKEQLNEFGDMISDSWVTVFSIINSPFRWIDSNISTLLQDDSDDLSLIDGII
FT                   MKQKNMIQVSFDVFKLITDDFLKNLHLNVIPDVIDTIVAFVNQEKILNVSFSSISQFWL
FT                   VGDYLRSNYSADIEKFRTECDDYFTHPSENNAEFIRAIKSPESTISQKYYGIWLYLLKN
FT                   LLFCSLDKRNEVSVGAIQTFFRIIDSHSSTFPSWQAIFNNVLYPFLNTERSDEQLQTNL
FT                   DCLNVTLKGLVQLFSQKFSDFDEYNKNAAEWSALLQLFIKLLQCPSTGVRYVTIKNYGT
FT                   IVTELCTKENIPTNLLDLCATIWTDYNIGYSDFGNSSQLSEKTDYDCISELLLSFPSLC
FT                   TMIDSVKDDNNVFYEKSMSLLLSAVKFPLLPEHSRDQAKPSTLQNAVLEGMSLIYTKLN
FT                   KNNIFVYFVHLSMISTLLFDTRDKIEKKLAPKLHENAISRIPTFEALSYKSLQMLEKQL
FT                   SELKSAEQPRNKYVLKIIRNLREIIVSKSLIDLSTDGSRPLWVLASSCYRSFLACIDNV
FT                   SDCFANDSEGQQEFIEIFMSIFLTPLRRRDTKVDSMTEKSDLSEFDQYSQLFKNKSLMP
FT                   LFTSDHYDLLVRNIWDASLIYEFDDIQKAILQDSGGPKNCEKILSHLNDLEVFGLTRTQ
FT                   DTLSKVSCSKRCLQELISFALLDDKDMSELKYLTFPYIVSRISLLLGKYISDEFLSGSA
FT                   PIPKLRGEEMNILLNGLLKLLDNLLRSKVPISKEVESLAHLYPLVLRTIPVSHKLTGLQ
FT                   NTVLELSLSFTKLISASSHQP"
FT   gene            complement(<420316..>422901)
FT                   /locus_tag="CAGL0M03729g"
FT                   /old_locus_tag="CAGL-IPF6790"
FT                   /old_locus_tag="CAGL-CDS0666.1"
FT   CDS_pept        complement(420316..422901)
FT                   /locus_tag="CAGL0M03729g"
FT                   /old_locus_tag="CAGL-IPF6790"
FT                   /old_locus_tag="CAGL-CDS0666.1"
FT                   /note="similar to uniprot|P48562 Saccharomyces cerevisiae
FT                   YNL298w CLA4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03729g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62484"
FT                   /db_xref="GOA:Q6FJT6"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT6"
FT                   /inference="similar to AA sequence:UniProtKB:P48562"
FT                   /protein_id="CAG62484.1"
FT                   /translation="MSLSAAAAKISDSDFQSIGPAPRPPVSAGGAAFNKTQPITRYMSQ
FT                   LDLNSGRANRSNSNVRRKSGWVSYKDDGLLSFLWQKRFMVLNDSALTLYKNEKVTEDPV
FT                   LKIPLTVIVSVSKNQLKQYCFELTRVSERNSSNGGQSGNTDSMAKKTIYIATKTETDLI
FT                   SWLDSIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWN
FT                   NDSAAVIQVLNFYQEYNNGEGSTYGAGSTTSVSSGSTNSSQINLLKDTNTSTNSSDKVS
FT                   PISQANSMVPQRRAPSPPKQSSTVNSVNSVNVVPSQNSSQQAINMPNRSNTPIRQGSSP
FT                   YQNNISSKNNMAPRMQAPSPAGGNKIQNSLPKLATHNNYNQQQGFVNKYPSPGSSPGSS
FT                   QPPSPINGYRPHHNMSNPYANKGPGSPLNARPNQQTTIQNQVPFNQRNGSQQQSNYPMK
FT                   VYPTIPVLKQPQQGGGYPNQNVIQNQTSVNAANMAMRQQQQQQNKINQNNPPAALQPVR
FT                   QAPKKPAGVSKDGAEKAKKTSKPTMSNAEIMSKLKQVTLDADPSTLFKMIEKAGQGASG
FT                   SVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRKELIVNEIMVMND
FT                   SRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVR
FT                   ETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYW
FT                   MAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQS
FT                   LSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNIACEPEDLTSLLENKK"
FT   gene            complement(<423750..>425630)
FT                   /locus_tag="CAGL0M03751g"
FT                   /old_locus_tag="CAGL-IPF6788"
FT                   /old_locus_tag="CAGL-CDS1369.1"
FT   CDS_pept        complement(423750..425630)
FT                   /locus_tag="CAGL0M03751g"
FT                   /old_locus_tag="CAGL-IPF6788"
FT                   /old_locus_tag="CAGL-CDS1369.1"
FT                   /note="similar to uniprot|P48561 Saccharomyces cerevisiae
FT                   YNL299w TRF5 nuclear division protein or uniprot|P53632
FT                   Saccharomyces cerevisiae YOL115w TRF4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03751g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62485"
FT                   /db_xref="GOA:Q6FJT5"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT5"
FT                   /inference="similar to AA sequence:UniProtKB:P48561"
FT                   /protein_id="CAG62485.1"
FT                   /translation="MRGDRSKRKVAKYQKKESARVKRLRRSSFNALQRNIEVFNDNKEF
FT                   LNKYENLELDLSDPENRTHLLSEYNDDLTQSDGESKADNHNDSYDTIPVIDIDSGDEGI
FT                   VSDIKISGGKLEDNDDFIAFSSSSEDENSGAENNESEDYLSSGNTSSDDELAGRRNAER
FT                   ELNADFPWLLNHDHSKQKEISDWLTAEIRDFVAYISPSREEIETRNKTIAKIRRSVKRL
FT                   WTDADLQVFGSYATDMYLPGSDIDCVVNSKSGDKENRQYLYELARHLKNDGLATRVEVI
FT                   AKSRVPIIKFVEPESDIHIDVSFERSNGLEAAKLIREWIGDTPGLRELTLVVKQFLHAR
FT                   RLNDVHTGGLGGFSIICLVFSFLRLHPRIITGDIDPLDNLGVLLIEFFELYGKNFAYDD
FT                   VAICVDDSRATYKPKTSCRFYPPARTSFTLAIQDPGDPTNNLSRGSFNVRDIKKSFSGA
FT                   FDLLVNKCFELDAATFKNRVGKSILGNVIKYRGAPRDFNDERALVENRAIIENEHYHRK
FT                   RARVVHADDEDTSDEDDMFINISANEEETEEMYKVEKVEKVVKKRKIAKADTNTKTKTK
FT                   TKAKARNHTSIDQLMGIPEDEEPPVIQEREKKSLSMQDKRDYWLSKGQAL"
FT   gene            complement(<426518..>427099)
FT                   /locus_tag="CAGL0M03773g"
FT                   /old_locus_tag="CAGL-IPF6786"
FT                   /old_locus_tag="CAGL-CDS4503.1"
FT   CDS_pept        complement(426518..427099)
FT                   /locus_tag="CAGL0M03773g"
FT                   /old_locus_tag="CAGL-IPF6786"
FT                   /old_locus_tag="CAGL-CDS4503.1"
FT                   /note="similar to uniprot|P48560 Saccharomyces cerevisiae
FT                   YNL300w TOS6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03773g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62486"
FT                   /db_xref="GOA:Q6FJT4"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT4"
FT                   /inference="similar to AA sequence:UniProtKB:P48560"
FT                   /protein_id="CAG62486.1"
FT                   /translation="MKFSTASILAIAASVASAGTVVSDGVTYVDITTTPVVTTSAVSTV
FT                   KTTSTPYTTTTVSTKPASVSSSANSASAAKGNAAVISQIGDGQIQATTATPAKPSSAAP
FT                   AKPSSAAPVSPASSSKASPSSVAPASPSIEQQKSSTLSTSAVKTNPAVVSQIHDGQIQA
FT                   STLQQQLTNAAGKNSATFGAALLAAVAMLL"
FT   gene            complement(<428607..>430148)
FT                   /locus_tag="CAGL0M03795g"
FT                   /old_locus_tag="CAGL-IPF6785"
FT                   /old_locus_tag="CAGL-CDS1995.1"
FT   CDS_pept        complement(428607..430148)
FT                   /locus_tag="CAGL0M03795g"
FT                   /old_locus_tag="CAGL-IPF6785"
FT                   /old_locus_tag="CAGL-CDS1995.1"
FT                   /note="highly similar to uniprot|Q99383 Saccharomyces
FT                   cerevisiae YOL123w HRP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03795g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62487"
FT                   /db_xref="GOA:Q6FJT3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034155"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT3"
FT                   /protein_id="CAG62487.1"
FT                   /translation="MSSDEEDFNDIYGDEHQDQQQTVSNESKPVDSTTAPSTESASVPM
FT                   DPLAALQALSSNLNNSNNTDNNNDKDTSSGSQTTADGNAVSSEQNGSNVSSEPQVSNQT
FT                   QNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVELKIMK
FT                   DPNTGRSRGFGFLSFDAPSSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGKIFVGGLG
FT                   TDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAAEKVCESRYREFKG
FT                   KQIEIKRAEPRHQQKQAGQQAVSPPVAGMGMNPMSNPMANPMAGMYQNPMMGGFNPMFN
FT                   PQAMQDYYQKMQEYYQQLQQQTGMDYSQMFQQQMSMMMPGFQMPPMNADGSGSPLNNAG
FT                   SENTPSGDDHNGSDNSSSSNVQTIGGDSNDSNSASNERNEDGSNRMKKNSLPKNIPRGP
FT                   RGPSERNDRGSYHRDRSGGSRHGGYHGSSNGSYRRERGGYNGGRRSNGYHPYNRS"
FT   gene            complement(<431237..>432664)
FT                   /locus_tag="CAGL0M03817g"
FT                   /old_locus_tag="CAGL-IPF6783"
FT                   /old_locus_tag="CAGL-CDS2230.1"
FT   CDS_pept        complement(431237..432664)
FT                   /locus_tag="CAGL0M03817g"
FT                   /old_locus_tag="CAGL-IPF6783"
FT                   /old_locus_tag="CAGL-CDS2230.1"
FT                   /note="weakly similar to uniprot|P48559 Saccharomyces
FT                   cerevisiae YNL304w YPT11"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03817g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62488"
FT                   /db_xref="GOA:Q6FJT2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT2"
FT                   /protein_id="CAG62488.1"
FT                   /translation="MADGRRKRYSLNVVVSPSPSERRFSGMDFTEASGTSPWNSPFGGG
FT                   STESFHFDKSNRNSRHSFYRTLSSSNSLSGGSVYRNSSVGLGLSSSAYMNDVMCSRESL
FT                   SMSAIESNAANIKVLFIGDAGVGKTAMILNYCRELPTRAQWEHIIGLSPTPNRAGSSNR
FT                   SGRNQMVRRSLTARAYERKSDIMQDQRKRYSSTDYDDYKENDFMAQRDFKIVKDVESES
FT                   SSLNYDPEELIVDTKTTIGVDIKTNIINIDNRIFNCILWDTAGQERYRNAIMPSLYKKS
FT                   NAIILSYDITDKCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQREVTHED
FT                   VIAAIEEIESRYGLVIAGNFEVTCKNFDSLNEAMNNITVDLVNNGCYEEKAEQELEGTA
FT                   VLEEDEEMKESTTLNEQYDDEVVSTSNDEDSGEDSDGSLEPVIRKRTTAKTRIIDISKP
FT                   KNQPNILDTSHKMSCCT"
FT   gene            <433214..>434101
FT                   /locus_tag="CAGL0M03839g"
FT                   /old_locus_tag="CAGL-IPF6780"
FT                   /old_locus_tag="CAGL-CDS3646.1"
FT   CDS_pept        433214..434101
FT                   /locus_tag="CAGL0M03839g"
FT                   /old_locus_tag="CAGL-IPF6780"
FT                   /old_locus_tag="CAGL-CDS3646.1"
FT                   /note="similar to uniprot|P48558 Saccharomyces cerevisiae
FT                   YNL305c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03839g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62489"
FT                   /db_xref="GOA:Q6FJT1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT1"
FT                   /inference="similar to AA sequence:UniProtKB:P48558"
FT                   /protein_id="CAG62489.1"
FT                   /translation="MSVNKNSYVPLPNESAPPPYQEEDPAPNLYNVPDDFKWSTNVSAC
FT                   EPLVRQQFLHRVYSILSTQLLATLSMGYLTYKWEPLREFTNSNTWLVILASIGSILTCI
FT                   WLAFAPSVDDYVPEDEANYTGETETNNELRPAKAPWYYLSKRGQYAVLSVFTICEAYSL
FT                   STITLAYDPQIILSAVLITTVVIVGVSLVALSERFQFLTESATTIYFWLNWGLLLLFGM
FT                   VLTGVFFGFSSKMNIFYAWFGAALFTIYLLMDTQMIFRKVRPDEEVKCAMILYVDIINL
FT                   FLHILRILSSRENE"
FT   gene            complement(<434549..>435578)
FT                   /locus_tag="CAGL0M03861g"
FT                   /old_locus_tag="CAGL-IPF6779"
FT                   /old_locus_tag="CAGL-CDS4869.1"
FT   CDS_pept        complement(join(434549..434964,435566..435578))
FT                   /locus_tag="CAGL0M03861g"
FT                   /old_locus_tag="CAGL-IPF6779"
FT                   /old_locus_tag="CAGL-CDS4869.1"
FT                   /note="highly similar to uniprot|P04456 Saccharomyces
FT                   cerevisiae YOL127w RPL25"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03861g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62490"
FT                   /db_xref="GOA:Q6FJT0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT0"
FT                   /protein_id="CAG62490.1"
FT                   /translation="MAPSAKASAAKKAVVKGTNGKKALKTRTSATFRLPKTLKLARSPK
FT                   YASKSVPHYNRLDSYKVIEHPITSETAMKKVEDGNILVFQVSLKANKHQIKKAVKELYE
FT                   VDVMKVNTLITAKGNKKAFVRLTADYDALDIANRIGYI"
FT   gene            complement(<436916..>437539)
FT                   /locus_tag="CAGL0M03883g"
FT                   /old_locus_tag="CAGL-IPF6775"
FT                   /old_locus_tag="CAGL-CDS4390.1"
FT   CDS_pept        complement(436916..437539)
FT                   /locus_tag="CAGL0M03883g"
FT                   /old_locus_tag="CAGL-IPF6775"
FT                   /old_locus_tag="CAGL-CDS4390.1"
FT                   /note="similar to uniprot|P42847 Saccharomyces cerevisiae
FT                   YNL306w MRPS18"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03883g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62491"
FT                   /db_xref="GOA:Q6FJS9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS9"
FT                   /inference="similar to AA sequence:UniProtKB:P42847"
FT                   /protein_id="CAG62491.1"
FT                   /translation="MLRSLGSKWLLAGRRLNSSVADGGRISFAGAVKDLTRKDEVANIS
FT                   NPYGEKRAMKGKSLEVPLKYKLNCVFRKNNTHFTYSAVVEDKNYLVNNPELSYNEKYLY
FT                   YLRLPQKVKFAISTGCLGFRKALRGEYEAAFQTTTKVFQMIKEKGLMDKDIEIIMDDFG
FT                   KGRTAFIAALNGKEGNEIRRKVTRISDKTALKFGGVRSPRMRRL"
FT   gene            <437944..>439704
FT                   /locus_tag="CAGL0M03905g"
FT                   /old_locus_tag="CAGL-IPF6773"
FT                   /old_locus_tag="CAGL-CDS1577.1"
FT   CDS_pept        437944..439704
FT                   /locus_tag="CAGL0M03905g"
FT                   /old_locus_tag="CAGL-IPF6773"
FT                   /old_locus_tag="CAGL-CDS1577.1"
FT                   /note="similar to uniprot|P42846 Saccharomyces cerevisiae
FT                   YNL308c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03905g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62492"
FT                   /db_xref="GOA:Q6FJS8"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="InterPro:IPR024626"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS8"
FT                   /inference="similar to AA sequence:UniProtKB:P42846"
FT                   /protein_id="CAG62492.1"
FT                   /translation="MPRKKSAAKKAREAAAKTQGEVPEQKISEEVEAKPLDANDEHEDA
FT                   SDESSSEEEDDYGELLTEEVEDGIKNVLTAIRNNEKDKLLNPEVKFFEDPEKAAEKMEV
FT                   SEKHKPVYLKDYHRMNILSGNALKDDDELDEDELETVDGKQSFVSQQREERQQLLNEIN
FT                   NAFDGDDQKSEEENDDEDDDGFLKKKEKKMEVSKTDPLREIDPNKDEDKFLEEFVNQHA
FT                   WIPKKGDKIISLDGGMDMEEDDEEFDDAVEQFENAYNFRYEDPNAAEIVSYARTQATLR
FT                   RSKTSSRRRKREEEKSHKEEEKKEKEEKIQKKKVKKVNKVTDILTQIKKEYGADISEEM
FT                   VEKITSTLMNNDYKEDEWDNVVAELFNEEFYAQEGKPEWDEDDEIMADFYKEGEEVNDG
FT                   QEPPELDTNDTTETNDQDNAGRSKKKSKIEEKKSKKKEKKQLQEMVETAIEKNKMAIID
FT                   EVEEERGRSREKEELKFRYREVSPESFGLSTREILAADDTDLNEFIGLKKFAPYRPKEL
FT                   RAKDKRKVTKSRRLREWKKKVFNNESGLTEEQFIALMEKEGSSEPPMKKHKKSHDKDKK
FT                   NKNSHKKNKK"
FT   gene            complement(<440211..>441497)
FT                   /locus_tag="CAGL0M03927g"
FT                   /old_locus_tag="CAGL-IPF6772"
FT                   /old_locus_tag="CAGL-CDS2581.1"
FT   CDS_pept        complement(440211..441497)
FT                   /locus_tag="CAGL0M03927g"
FT                   /old_locus_tag="CAGL-IPF6772"
FT                   /old_locus_tag="CAGL-CDS2581.1"
FT                   /note="weakly similar to uniprot|P42845 Saccharomyces
FT                   cerevisiae YNL309w STB1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03927g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62493"
FT                   /db_xref="GOA:Q6FJS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS7"
FT                   /protein_id="CAG62493.1"
FT                   /translation="MADISREKEDELASKILERAQLAQMRRQLKIGLSKVPSETRDDEQ
FT                   YEENHTKADITDDSTDNYTLGSAYSATPRSRASMVSPRKRQSGDPREMSAIMNASPLKK
FT                   VLLDGIKDGESSENVSPVSRRFVRPSTPPKTASRPASVHIPQKSSYDNRTPTTPKLTNA
FT                   HTAFTNSLNSAEKNAMTKADTATLTKVPSTPKRGNSSQKKQAGVNKNNTDDSTGADLLM
FT                   YLATSPYSSARAHNTTYNRKNSVSSVTKVPTTPYTSLYMSHSHTQEMNDDAVRFSALKA
FT                   SLNSPQSTFKVPHVVGSQANNGQWFPDILMDSPSLYLGSALSPSANKKKLASPGPGSGS
FT                   GHAVSTHLPVPSTPSRELHHQTNTNLLKTPNFNMGDYLQNIFSPSPQVSLNDLGNSHMT
FT                   EMQAKSALAVGPVEGGSVHSSPTRIASDV"
FT   gene            <441978..>442553
FT                   /locus_tag="CAGL0M03949g"
FT                   /old_locus_tag="CAGL-IPF6771"
FT                   /old_locus_tag="CAGL-CDS4517.1"
FT   CDS_pept        441978..442553
FT                   /locus_tag="CAGL0M03949g"
FT                   /old_locus_tag="CAGL-IPF6771"
FT                   /old_locus_tag="CAGL-CDS4517.1"
FT                   /note="similar to uniprot|P42844 Saccharomyces cerevisiae
FT                   YNL310c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03949g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62494"
FT                   /db_xref="GOA:Q6FJS6"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="InterPro:IPR024158"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS6"
FT                   /inference="similar to AA sequence:UniProtKB:P42844"
FT                   /protein_id="CAG62494.1"
FT                   /translation="MLRLLRGTGAVRALRYTNARSLNRAMAGAVVSGRHLGGRAAPLCR
FT                   ASQFSTTVAKLQSQDNDKTYPLGSFKVDQPQIMIAFTCKKCDTRSSHTMSKQAYTGGTV
FT                   LITCPGCKNRHLIADHLKIFSDDRITIEDILNAKGESVSQSTDDLVFEDIPESLKETIG
FT                   HYASDAPESYKKRLDNEKVHTLPHPEEK"
FT   gene            <442995..>445340
FT                   /locus_tag="CAGL0M03971g"
FT                   /old_locus_tag="CAGL-IPF6770"
FT                   /old_locus_tag="CAGL-CDS0855.1"
FT   CDS_pept        442995..445340
FT                   /locus_tag="CAGL0M03971g"
FT                   /old_locus_tag="CAGL-IPF6770"
FT                   /old_locus_tag="CAGL-CDS0855.1"
FT                   /note="similar to uniprot|P42843 Saccharomyces cerevisiae
FT                   YNL311c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03971g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62495"
FT                   /db_xref="GOA:Q6FJS5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS5"
FT                   /inference="similar to AA sequence:UniProtKB:P42843"
FT                   /protein_id="CAG62495.1"
FT                   /translation="MRKLQLFGGSKYFSLSQKEGKPVHKNINNQEKVEDEVEDETDDQL
FT                   SLLSLPPKILRRILSHLDSASLIALTHVHSKLYKIISNEFLFSNIVLDSKISLLKFSAM
FT                   IHSEFHTSNALVNGTRGSTSPQENKSQNVRFLVRSVEFVNPQSHDSLLKYSKFHKKNDT
FT                   GSLIGGSYNFNTSSEIPISKLPTSPKAEDRPKSSSLAQTSFGGKLDTHENTRSSSRTRS
FT                   TNHYKCYKLMEKFEHKFSGYTYIELMLDIIDYLPNVTHVKLSNVDPSFKVPLWYSVFND
FT                   GSRDFFKKIIKGQQSITNDDLRTFELSKEFVREYEKKFYHLPLLKSLEISAAIDKKQTK
FT                   PVVFRPNLICCFGVIQELTLENITLDKESFETPMEFVPLHLRLEETNDLHVNGKPTSLE
FT                   LYNLHSPVSSLTLRACTIIQGNGILRLIHNYFKDVKNLQLLELSSKYDLFLCNCFSSLS
FT                   NLTIDCNSACFTNEMTVNDDYYLKEITLSNEDETNCDDNISVTETLLESSSRVVIQAPP
FT                   PTSAVVVSLNLDYISKTSGSNAQENPLPSDSKKPALITKSQGDYFRQLRIPTFHYFYHY
FT                   YKSIWERIPHKNVNINIINIPFTNVYPMSPKGLAESMIVSSDANDQETLIAYRPSGYSA
FT                   HDVPTSSIIHVSEEAREFNSTQYYWENGVRRCYLDAIQELRESSSYYQSMTQHEILDMI
FT                   DYEAINGYQNFKFYKDIPNVNLWCFLKSLSKFKSVKINLLRTWLYCTPRSRYDWELLLK
FT                   PVLNVNVPVIVTDRDGYVVYSYGQHKMH"
FT   gene            complement(<445590..>446429)
FT                   /locus_tag="CAGL0M03993g"
FT                   /old_locus_tag="CAGL-IPF6769"
FT                   /old_locus_tag="CAGL-CDS3762.1"
FT   CDS_pept        complement(445590..446429)
FT                   /locus_tag="CAGL0M03993g"
FT                   /old_locus_tag="CAGL-IPF6769"
FT                   /old_locus_tag="CAGL-CDS3762.1"
FT                   /note="highly similar to uniprot|P26754 Saccharomyces
FT                   cerevisiae YNL312w RFA2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M03993g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62496"
FT                   /db_xref="GOA:Q6FJS4"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014646"
FT                   /db_xref="InterPro:IPR014892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040260"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS4"
FT                   /protein_id="CAG62496.1"
FT                   /translation="MATYQPYNEFSSVTGGGFENSDSRPNTMDSGTGSNTNTLTPVTIK
FT                   QILDSQQAIQDGPFITHNQELHHVCFVGVVRNITDHTSNIYLTLEDGTGQIEVRKWSDD
FT                   SSDVAQGTDGDDGFGEMKGGESQIAQQYQIGTYVKVFGALKEFGGKKNIQYAVIKNVDS
FT                   FNDVIAHHLEAIKCHAIANGKMQGSSLASGDNEGAGQSLFVQDDEGAGNKNPLQRILEF
FT                   CKQQCVGKDANTFAVPIPLISQSLDIDETTVRNCCTTLTEQGFIYPTLDDNHFFAVD"
FT   gene            complement(<447059..>447889)
FT                   /locus_tag="CAGL0M04015g"
FT                   /old_locus_tag="CAGL-IPF6767"
FT                   /old_locus_tag="CAGL-CDS3787.1"
FT   CDS_pept        complement(447059..447889)
FT                   /locus_tag="CAGL0M04015g"
FT                   /old_locus_tag="CAGL-IPF6767"
FT                   /old_locus_tag="CAGL-CDS3787.1"
FT                   /note="some similarities with uniprot|P21705 Saccharomyces
FT                   cerevisiae YNL314w DAL82"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04015g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62497"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS3"
FT                   /protein_id="CAG62497.1"
FT                   /translation="MRVESQQSAIVLLELMDKYKPHLKPYAYRLHSWERVLADYNSRLH
FT                   TKYRQIRTIKNKFERLKYMYLQDRGSEQFKGYSEAELVLLERLISESDGVSVKDPIVRD
FT                   NGMSQGALASGGRPPEPALVPRLPMLGGQLLKQSTINNIIEPTPPPLDTISIGMPKNAK
FT                   KPSIQDTGLAGQPTMEDSTVTAGTPLDTSIFDGDTRIPTRKNSLDVHTIQDLVRKLSDQ
FT                   QKQEDQLMIMKEAELSKKYMTQADFLSYKKQNRAIQLQILNVITSLLETPTKES"
FT   gene            <448125..>449054
FT                   /locus_tag="CAGL0M04037g"
FT                   /old_locus_tag="CAGL-IPF6763"
FT                   /old_locus_tag="CAGL-CDS3531.1"
FT   CDS_pept        448125..449054
FT                   /locus_tag="CAGL0M04037g"
FT                   /old_locus_tag="CAGL-IPF6763"
FT                   /old_locus_tag="CAGL-CDS3531.1"
FT                   /note="similar to uniprot|P32453 Saccharomyces cerevisiae
FT                   YNL315c ATP11"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04037g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62498"
FT                   /db_xref="GOA:Q6FJS2"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="PDB:2P4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS2"
FT                   /inference="similar to AA sequence:UniProtKB:P32453"
FT                   /protein_id="CAG62498.1"
FT                   /translation="MLTRSLVPALRRRITVVARQYSIEDRYKEKLLQKAKAEGVESIEE
FT                   LKKRLADQIEEKKKELNKIDPLRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNVLP
FT                   KDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKYAVK
FT                   NPLFVLPLPRENAADGNKADKDSVPVELQYVQWQFAGPNTVHCLITSLAEYKLHQDFAK
FT                   PHTTIQFHLDLANDKDMVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETSIAKER
FT                   IQLLEDFNKGSQNFDINKLIQLAQSMEN"
FT   gene            <449398..>450450
FT                   /locus_tag="CAGL0M04059g"
FT                   /old_locus_tag="CAGL-IPF6761"
FT                   /old_locus_tag="CAGL-CDS3155.1"
FT   CDS_pept        449398..450450
FT                   /locus_tag="CAGL0M04059g"
FT                   /old_locus_tag="CAGL-IPF6761"
FT                   /old_locus_tag="CAGL-CDS3155.1"
FT                   /note="similar to uniprot|P32452 Saccharomyces cerevisiae
FT                   YNL316c PHA2 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04059g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62499"
FT                   /db_xref="GOA:Q6FJS1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS1"
FT                   /inference="similar to AA sequence:UniProtKB:P32452"
FT                   /protein_id="CAG62499.1"
FT                   /translation="MTVKVLFLGPEGTYSHQAAIQQFSHLVDYNVVYEAVDSIPSCVDK
FT                   LIEHDNDIEDVDLYSVVPLENSTNGQVVFTYDILRNLMQGSNGTNMRIRENQVVAPITI
FT                   VGEQYVSILHCLISPDPSIGIESLQNYDTLKIYSHPQVWGQVSKYLVELQKRFPNLKLE
FT                   RINCNSTSEAVLQAAEEQSSSQSSGILNLAIASEIAASIYQCYIIQHSINDILGNTTRF
FT                   LVFKKKSNHRRLLAPPSATPQRVSLLTFTIKQDDPGSLVEVLSVLKDFSLNMCSISSRP
FT                   YLLRSEQISQQGENFRRRNWQYIFFIEFYIEQDKEFDKDKFCDRIDALCGDWCHWGRFP
FT                   RDICYYKNTA"
FT   gene            complement(<450572..>451939)
FT                   /locus_tag="CAGL0M04081g"
FT                   /old_locus_tag="CAGL-IPF6759"
FT                   /old_locus_tag="CAGL-CDS2350.1"
FT   CDS_pept        complement(450572..451939)
FT                   /locus_tag="CAGL0M04081g"
FT                   /old_locus_tag="CAGL-IPF6759"
FT                   /old_locus_tag="CAGL-CDS2350.1"
FT                   /note="highly similar to uniprot|P42841 Saccharomyces
FT                   cerevisiae YNL317w PFS2 polyadenylation factor I"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04081g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62500"
FT                   /db_xref="GOA:Q6FJS0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJS0"
FT                   /protein_id="CAG62500.1"
FT                   /translation="MDQSAAVEGVPQKKYLTLRRSVDVSSSYNRLYYLKKHGLSLPPIE
FT                   PETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATFSG
FT                   EFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDR
FT                   IHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGL
FT                   IVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR
FT                   ASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEK
FT                   CISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINNDIN
FT                   AVREKSEYGAAPPPASTAFPQQTQYNNNISRVPEIKEPTPTTDKEQRTSILPGLSI"
FT   gene            <452677..>454272
FT                   /locus_tag="CAGL0M04103g"
FT                   /old_locus_tag="CAGL-IPF8278"
FT                   /old_locus_tag="CAGL-CDS1897.1"
FT   CDS_pept        452677..454272
FT                   /locus_tag="CAGL0M04103g"
FT                   /old_locus_tag="CAGL-IPF8278"
FT                   /old_locus_tag="CAGL-CDS1897.1"
FT                   /note="similar to uniprot|P42833 Saccharomyces cerevisiae
FT                   YNL318c HXT1 hexose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04103g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62501"
FT                   /db_xref="GOA:Q6FJR9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR9"
FT                   /inference="similar to AA sequence:UniProtKB:P42833"
FT                   /protein_id="CAG62501.1"
FT                   /translation="MEQVTIGVISLDSSPTENYTLNTAETRQSFQLSGKSEVNTIPGEK
FT                   YEELKMKYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSA
FT                   KELSNMKRGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGN
FT                   FILLLASRFVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNILNYM
FT                   TNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESAKISYS
FT                   IMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHKFEFLYGKPKYGKRLLIGIMVMAFQ
FT                   QLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRRSTLIYGS
FT                   FGMFICMIFYASFGTLSLRKDLLSFVLIIVTCLFISIFAITIGPVSFVVVAELFPTRTR
FT                   SVSMSICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKT
FT                   EEEIDYMFQNNLKS"
FT   gene            complement(<454489..>455361)
FT                   /locus_tag="CAGL0M04125g"
FT                   /old_locus_tag="CAGL-IPF8279"
FT                   /old_locus_tag="CAGL-CDS3689.1"
FT   CDS_pept        complement(454489..455361)
FT                   /locus_tag="CAGL0M04125g"
FT                   /old_locus_tag="CAGL-IPF8279"
FT                   /old_locus_tag="CAGL-CDS3689.1"
FT                   /note="highly similar to uniprot|P42840 Saccharomyces
FT                   cerevisiae YNL320w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04125g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62502"
FT                   /db_xref="GOA:Q6FJR8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR8"
FT                   /protein_id="CAG62502.1"
FT                   /translation="MLYRTFKMIFGGVLALGTISVTAVYLVQNKLVYPSWAQGAREYVD
FT                   TPASKNIPYKEVTLTTKDGIELQAWDIRNEETKSKSTVLILCPNAGNIGYFIPIIDIFY
FT                   SQFGLNVFIYSYRGYGYSKGTPSEEGLKIDADRVMSYLATDDFHKTKKLILYGRSLGGA
FT                   NAIYIASKFSQLCDAVILENTFLSIRKVIPYIFPWISRFAFMCHEVWNSEEDMPHCNSE
FT                   IPYLFLSGLEDEIVPPEHMKDLYDICPSGSKQIYEFPFGTHNTTIIQDGYWEIVRKFLE
FT                   DNKFIEPAQ"
FT   gene            complement(<455977..>458901)
FT                   /locus_tag="CAGL0M04147g"
FT                   /old_locus_tag="CAGL-IPF8282"
FT                   /old_locus_tag="CAGL-CDS0479.1"
FT   CDS_pept        complement(455977..458901)
FT                   /locus_tag="CAGL0M04147g"
FT                   /old_locus_tag="CAGL-IPF8282"
FT                   /old_locus_tag="CAGL-CDS0479.1"
FT                   /note="similar to uniprot|P42839 Saccharomyces cerevisiae
FT                   YNL321w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04147g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62503"
FT                   /db_xref="GOA:Q6FJR7"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR7"
FT                   /inference="similar to AA sequence:UniProtKB:P42839"
FT                   /protein_id="CAG62503.1"
FT                   /translation="MSLRPTVSKDKSRPVLVKRVFSVDDDANEVQNDIRYFENLADGVK
FT                   IVLPGSENNIQDSAALSTGGNVAVPVPQGLRDEALVPVDSLRSLSTPDLMESITNLQQK
FT                   LVTPRINGVAAHGNVGSPRFIIHDHTHTHPGDKKSATHHDLYIEELPAQRSNSSQALPA
FT                   GSVAGGNGTSSLTDIPPVDLEASNLGETERLDPDNASRASSIESYTLRERQDAINETHP
FT                   FGIRIWKPALYKKKRSVEKAADEDIHETKLKKITWAVKATNWIWVATCGLFLFTVFASA
FT                   SITVLIAGLFTKSARDYSRLMLRLARYLLYPFGKVVYLIQDKQYLEEDRDEGISVQQFY
FT                   NWVTSYKSRLFFHESQTRPTESDALGNNMHHTSYGSIQKVVGEQTNTESNNPMLDNNGY
FT                   TELPHSTSFQNPSNDHQNSAATQRRLFGRGKWSLGRIVFYAIFHIVLQPIVLFLSLLTW
FT                   LAVFTIPMSNILWNLMYHCRRHPLALGFKSIKNSSNQIIEHYDDKNILLCTFRCAGWHY
FT                   YKFTIDGTNVIVVNLIAMVFFTIFDFYALKEFFNIDLWITSESTVFILCLASIIPLAFY
FT                   IGQAVASISAQTSMGLGAVINAFFSTIVEIFLYCVALQQKKGLLVEGSMIGSILGAVLL
FT                   LPGLSMCGGALNRKTQRYNPRSAGVSSALLIFSMIVMFVPTLLYMMYSGYDVICDDLDA
FT                   TLPLDLYSAYKVMSTSKCHFSHPPLKFDKLYTHVIEPMSIVCAFVLFLAYTIGLWFTLR
FT                   THAATIWQLPIADPPREIVNTEANGIDGILSHEEDHNDEGGGHDAPNWSRSKSTLILLL
FT                   ATLLYAIIAEILVSCVDSVLEDFPSLSPKFLGLTIFALVPNTTEFLNAISFAMHGNIAL
FT                   SMEIGSAYALQVCLLQIPALVLFSVITAIGVDKALISIRDQMFPLVFPTWDLVASMASI
FT                   FVFTYLYAEGKSNYFKGSILILLYVIIIMGFYYQGLIAEWGIIT"
FT   gene            <459618..>460739
FT                   /locus_tag="CAGL0M04169g"
FT                   /old_locus_tag="CAGL-IPF8285"
FT                   /old_locus_tag="CAGL-CDS2957.1"
FT   CDS_pept        459618..460739
FT                   /locus_tag="CAGL0M04169g"
FT                   /old_locus_tag="CAGL-IPF8285"
FT                   /old_locus_tag="CAGL-CDS2957.1"
FT                   /note="weakly similar to uniprot|P17260 Saccharomyces
FT                   cerevisiae YNL322c KRE1 cell wall protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04169g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62504"
FT                   /db_xref="GOA:Q6FJR6"
FT                   /db_xref="InterPro:IPR031452"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR6"
FT                   /protein_id="CAG62504.1"
FT                   /translation="MRISRLLLIAGVAQAAIVTDFIITTLADGTLSTVTSIYDNAKPKT
FT                   DTDTDTDTDTDTDTNTATGTTKATTTNTNTNTNTNTGTNTGVKLITTSTVVTDAAGVIK
FT                   TVPTVITSGVKQTGTTTGTTTGTTTGTTTGTTGTKKSYVSTITTVDAAGRPVTLTTTIT
FT                   GTNTNTNTNTNTGTANTPYVTTITTTNINGVTVTLTQTVTPTKAAVDPAAANGALTAFV
FT                   VKSKPSDLVGTAPDGRPDPSLVSFTEVPATPVTTVPIDTYITITEGTTRTYTTLRVPTS
FT                   IWVTITNAAGQTVTFQTTYMQRFSSQYLEVASPSSGSIGLGSLQGEVGVVKSVMVMSQS
FT                   ANAAHNNARAGTPVTSICMSLAMAFLTMFTWFM"
FT   gene            complement(<461446..>463251)
FT                   /locus_tag="CAGL0M04191g"
FT                   /old_locus_tag="CAGL-IPF8287"
FT                   /old_locus_tag="CAGL-CDS1500.1"
FT   CDS_pept        complement(461446..463251)
FT                   /locus_tag="CAGL0M04191g"
FT                   /old_locus_tag="CAGL-IPF8287"
FT                   /old_locus_tag="CAGL-CDS1500.1"
FT                   /note="similar to uniprot|P32329 Saccharomyces cerevisiae
FT                   YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
FT                   YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
FT                   YLR121c YPS3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04191g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62505"
FT                   /db_xref="GOA:Q6FJR5"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR5"
FT                   /inference="similar to AA sequence:UniProtKB:P32329"
FT                   /protein_id="CAG62505.1"
FT                   /translation="MKFSSLCMLASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAKR
FT                   GRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDN
FT                   PYCRGSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSDGLL
FT                   GGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDS
FT                   TFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRP
FT                   YQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLYTIPMVNTYA
FT                   SQGYKNPIQFEVTLNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQ
FT                   ATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDSCILGIMPQSGGG
FT                   IILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSSVPGAVRAPGFSSTWSTL
FT                   ATSFNTQGDIFTVQAAATVSGSATNTGTGRATATGNSNSTRSTTSRSRTSATSTRSDSQ
FT                   KKNDASRTSFTSTLLFVAGLLVSFI"
FT   gene            complement(<463756..>464523)
FT                   /locus_tag="CAGL0M04213g"
FT                   /old_locus_tag="CAGL-IPF8290"
FT                   /old_locus_tag="CAGL-CDS3964.1"
FT   CDS_pept        complement(463756..464523)
FT                   /locus_tag="CAGL0M04213g"
FT                   /old_locus_tag="CAGL-IPF8290"
FT                   /old_locus_tag="CAGL-CDS3964.1"
FT                   /note="similar to uniprot|Q12288 Saccharomyces cerevisiae
FT                   YLR126c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04213g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62506"
FT                   /db_xref="GOA:Q6FJR4"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR4"
FT                   /inference="similar to AA sequence:UniProtKB:Q12288"
FT                   /protein_id="CAG62506.1"
FT                   /translation="MTVAARKVAIFYTDHPNEWSRDDGTFATMAVELLEQAKEHEPYVG
FT                   AEGGIEYRVFDVYNGELPSVDELSSGDYLGLYITGSRYDSFDTETQWIVDLRKLLYRLV
FT                   NETTLPIVGICFGHQVLARSLGAQVGRNPKGLEAGVHGVQLNATGKTLFSRDRLYLSEL
FT                   HSDHVEEVPPGYENWGHTEKSHCQGLYKPQRVLTFQGHPEFTTQLAIKSTQHKHQTGQL
FT                   SDEEYAETIQRCHSNNDGVHAARNIWKLYHGKI"
FT   gene            complement(<464973..>467324)
FT                   /locus_tag="CAGL0M04235g"
FT                   /old_locus_tag="CAGL-IPF8291"
FT                   /old_locus_tag="CAGL-CDS0853.1"
FT   CDS_pept        complement(464973..467324)
FT                   /locus_tag="CAGL0M04235g"
FT                   /old_locus_tag="CAGL-IPF8291"
FT                   /old_locus_tag="CAGL-CDS0853.1"
FT                   /note="similar to uniprot|Q12440 Saccharomyces cerevisiae
FT                   YLR127c APC2 component of the anaphase promoting complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04235g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62507"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR3"
FT                   /inference="similar to AA sequence:UniProtKB:Q12440"
FT                   /protein_id="CAG62507.1"
FT                   /translation="MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNH
FT                   QLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIER
FT                   HVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEI
FT                   VDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSL
FT                   LFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFN
FT                   CVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQR
FT                   KDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMI
FT                   GSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLDLFDILLELLESKETLVIE
FT                   FKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIY
FT                   KSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRF
FT                   YSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEG
FT                   LTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLE
FT                   ESVVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQ
FT                   KQLQDYLDTLVEEGVLSSASNDSYKLPQIR"
FT   gene            <467785..>468606
FT                   /locus_tag="CAGL0M04257g"
FT                   /old_locus_tag="CAGL-IPF8292"
FT                   /old_locus_tag="CAGL-CDS3811.1"
FT   CDS_pept        467785..468606
FT                   /locus_tag="CAGL0M04257g"
FT                   /old_locus_tag="CAGL-IPF8292"
FT                   /old_locus_tag="CAGL-CDS3811.1"
FT                   /note="similar to uniprot|Q12395 Saccharomyces cerevisiae
FT                   YLR128w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04257g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62508"
FT                   /db_xref="GOA:Q6FJR2"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJR2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12395"
FT                   /protein_id="CAG62508.1"
FT                   /translation="MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYD
FT                   KEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLED
FT                   LVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTT
FT                   IYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHK
FT                   KLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL"
FT   gene            <469040..>471862
FT                   /locus_tag="CAGL0M04279g"
FT                   /old_locus_tag="CAGL-IPF8294"
FT                   /old_locus_tag="CAGL-CDS0537.1"
FT   CDS_pept        469040..471862
FT                   /locus_tag="CAGL0M04279g"
FT                   /old_locus_tag="CAGL-IPF8294"
FT                   /old_locus_tag="CAGL-CDS0537.1"
FT                   /note="highly similar to uniprot|Q12220 Saccharomyces
FT                   cerevisiae YLR129w DIP2 DOM34P-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04279g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62509"
FT                   /db_xref="GOA:Q6FJR1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR1"
FT                   /protein_id="CAG62509.1"
FT                   /translation="MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGG
FT                   LENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK
FT                   IWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK
FT                   DAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA
FT                   DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEI
FT                   YRLRKEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQW
FT                   TVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDD
FT                   NKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIAS
FT                   STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPML
FT                   QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSM
FT                   DISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT
FT                   VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER
FT                   EKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEAL
FT                   EIGVNDIIAMEEFNEQLNAWKKSKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPS
FT                   QIEDALMVMPFSYILKFLKFIDVVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNA
FT                   NLKLQITRVKDNLRKSLKSNVDELGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKH
FT                   SKKRVFGTLA"
FT   gene            complement(<472227..>473396)
FT                   /locus_tag="CAGL0M04301g"
FT                   /old_locus_tag="CAGL-IPF8295"
FT                   /old_locus_tag="CAGL-CDS2834.1"
FT   CDS_pept        complement(472227..473396)
FT                   /locus_tag="CAGL0M04301g"
FT                   /old_locus_tag="CAGL-IPF8295"
FT                   /old_locus_tag="CAGL-CDS2834.1"
FT                   /note="similar to uniprot|Q12436 Saccharomyces cerevisiae
FT                   YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
FT                   YGL255w ZRT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04301g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62510"
FT                   /db_xref="GOA:Q6FJR0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR0"
FT                   /inference="similar to AA sequence:UniProtKB:Q12436"
FT                   /protein_id="CAG62510.1"
FT                   /translation="MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPI
FT                   LSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFG
FT                   ICLMSLFMLFLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNC
FT                   AGHQDSLQDSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKF
FT                   SADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIA
FT                   ETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGIL
FT                   IYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA"
FT   gene            complement(<474158..>476269)
FT                   /locus_tag="CAGL0M04323g"
FT                   /old_locus_tag="CAGL-IPF8296"
FT                   /old_locus_tag="CAGL-CDS1088.1"
FT   CDS_pept        complement(474158..476269)
FT                   /locus_tag="CAGL0M04323g"
FT                   /old_locus_tag="CAGL-IPF8296"
FT                   /old_locus_tag="CAGL-CDS1088.1"
FT                   /note="similar to uniprot|P21192 Saccharomyces cerevisiae
FT                   YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
FT                   YDR146c SWI5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04323g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62511"
FT                   /db_xref="GOA:Q6FJQ9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ9"
FT                   /inference="similar to AA sequence:UniProtKB:P21192"
FT                   /protein_id="CAG62511.1"
FT                   /translation="MNTFQADWGEIPQMPKDQVFTPQDQLTNYNDNMMDNLLDFNYNDV
FT                   DALLSEELKDLDIPLAPSPRDLNMNAEQSLNWMQDIQGHRSNKPSMSHKRGMSGTAIFG
FT                   FKNHNKTLSIASFSKNTDIINEAENENVKGNTDNQNGFVLSQVLLKQQEELRLALEKQK
FT                   EVNRNLERQLRENRLQQEHIQRVLHDQEAVTSQLTAQNVTESPSKQRSPTKYQGDDAII
FT                   VTKNSSSGGYVFPPPPRVTLNNEAVTPPLSFSRFSNIDQMESSDPLNYLQPNADFTEAY
FT                   ASHKTPESSFGKEHASVLSTSEFLRPTNAARESSSKAMYSSPNSMISPHRKKDSVLSTV
FT                   STILQPQDDYQNTASPPSQMLNLEEANLENEQKNNGKMLRAPVEIMPTIPGSKNNTPMT
FT                   ANKSGFMPQKHTFQHTPVKAKNNVDMNERSLVRPELSGTPLNKSVQNGMHFREEDDSNI
FT                   LHHISEIPQGSTSHNNTTAGDDSNVSNRLQFSNTESSPSRQRKKPTTLPPGYIDRYVKE
FT                   LPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKT
FT                   HDKHFSCPCGKKFSSEQSMMKHKNRHNCTGPARVPDSKMVSKSPRKQSSPTKLSSAIMN
FT                   SPIKENYLKENTNLHIDQLRMDPKMRNALEDGGLLKPVERTEAMAFPSPLSGYSDLGSP
FT                   FRDLGTIEE"
FT   gene            complement(<477731..>478693)
FT                   /locus_tag="CAGL0M04345g"
FT                   /old_locus_tag="CAGL-IPF8297"
FT                   /old_locus_tag="CAGL-CDS3408.1"
FT   CDS_pept        complement(477731..478693)
FT                   /locus_tag="CAGL0M04345g"
FT                   /old_locus_tag="CAGL-IPF8297"
FT                   /old_locus_tag="CAGL-CDS3408.1"
FT                   /note="weakly similar to uniprot|Q12208 Saccharomyces
FT                   cerevisiae YLR132c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04345g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62512"
FT                   /db_xref="GOA:Q6FJQ8"
FT                   /db_xref="InterPro:IPR027521"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ8"
FT                   /protein_id="CAG62512.1"
FT                   /translation="MNILAEYSSESEFESEENLKSQNSEEVIPPIENWEKSGEVSNLEE
FT                   WQRTHRDDIDTVIKLPPIPSSVYDKYQIPPNTDKYIERTDNGMSLGAIKGSDVFKRNIG
FT                   KWSCFLYIEYRPSSTEREMISKTLSQFNQSWQKKFPGTDIFEPLHYTTLGVPVPLHISL
FT                   TKNIPFDSETQRDRFYNILVPKVAQLRQHLVQFEDTLRFYGSPQTTSVFLGYNVAQSVK
FT                   DNIIKDITDNIESALIDSGLSESDKMVTVPSFSHMSIAKLSNAPKDILDKVGYADSNQM
FT                   AKQIQDYVEISPNQQPVFYVSSIKMNKNRELLTIPFATP"
FT   gene            <479260..>481074
FT                   /locus_tag="CAGL0M04367g"
FT                   /old_locus_tag="CAGL-IPF8299"
FT                   /old_locus_tag="CAGL-CDS1487.1"
FT   CDS_pept        479260..481074
FT                   /locus_tag="CAGL0M04367g"
FT                   /old_locus_tag="CAGL-IPF8299"
FT                   /old_locus_tag="CAGL-CDS1487.1"
FT                   /note="similar to uniprot|P20485 Saccharomyces cerevisiae
FT                   YLR133w CKI1 Choline kinase or uniprot|Q03764 Saccharomyces
FT                   cerevisiae YDR147w EKI1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04367g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62513"
FT                   /db_xref="GOA:Q6FJQ7"
FT                   /db_xref="InterPro:IPR007521"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ7"
FT                   /inference="similar to AA sequence:UniProtKB:P20485"
FT                   /protein_id="CAG62513.1"
FT                   /translation="MPLSEIEPHSPSAKKASGHRRSRRHSSIGSSSRKPSLTRNRSTLR
FT                   LMRTISIESLNNDTFSASGGEDEDNSNSDYNDVSGTNQDLEDKIGNLSIKSGISQSSSD
FT                   IKTTPAKKGSGGVSASSTDNSIEVPFVKVALDITLPQDYFKKDVANMIQSLKVPRWYAR
FT                   GLVESPLKMESLRLTKIAGAMTNAIFKVEYPALPSLLLRVYGSNNDMIIDREYELQVLA
FT                   RLSVQHIGPSLYGCFLNGRFEQFLENATTLTKDDIRDWKTSQRIARRMKELHTGVPLLR
FT                   FEKEQGSMAWNKIDQWLKEIEMNGGDWISNDDNVQQVFGAPNWKEFKESIRKYREWLFE
FT                   NSKSPYVFCHNDAQYGNLLFSAPVINSEKNDLKKSLDESNLSTSSLFPSDSRVSLKEII
FT                   NPTKQEQSQDSKLVVIDFEYAGANVAAYDLSNHFSEWMYDYNSSTPHKCFSDQYPTTEQ
FT                   MLNFVYSYVSHLRGGVKTDIDDDARLLYNDIKKWRGTVQLFWSLWALIQSGKIQFQEQE
FT                   STKVDEGLVGEKYIIKTEDTAIDELVDDIDTNDVIEAPEGVSIDTFDYLGYCTDKISVF
FT                   WGDIIGFNIITKSECIENKVKYLSTDLL"
FT   gene            <481522..>483702
FT                   /locus_tag="CAGL0M04389g"
FT                   /old_locus_tag="CAGL-IPF8300"
FT                   /old_locus_tag="CAGL-CDS1002.1"
FT   CDS_pept        481522..483702
FT                   /locus_tag="CAGL0M04389g"
FT                   /old_locus_tag="CAGL-IPF8300"
FT                   /old_locus_tag="CAGL-CDS1002.1"
FT                   /note="weakly similar to uniprot|Q12098 Saccharomyces
FT                   cerevisiae YLR135w subunit of SLX1P/Ybr228p-SLX4P complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04389g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62514"
FT                   /db_xref="GOA:Q6FJQ6"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="InterPro:IPR027784"
FT                   /db_xref="PDB:4XLG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ6"
FT                   /protein_id="CAG62514.1"
FT                   /translation="MDFERAQKNFDAFVINGETDETPNDELRHESQHSDFDTCGTQVPE
FT                   MNFSDDDNSDCGNNEIDRLAHNATETTDKEGDDSIIVTQERIAENRNNSVIEIEDEDQI
FT                   DLSVVNSKEEDNIFLNTQIQSRLDDHEKDLQQKAVLKSFNFEYVDKDESPNMMGSRYIR
FT                   KKSPKKRNSRKNTEEAIQASKSISKRQNNANSLLQILSGKKSKVNAIIKNQRFKYESKT
FT                   GVLKRASQVSNSTSTTYGKEEWKQIKNVLRTRYSKLENSDDRELENFINYLSEQLEKEP
FT                   NLWTSSQIAISTNENNESYRQDSIGSLLTLSQVMGDKSAILESDDEYPDVRPNGESFFK
FT                   CADDSQQLKDDLNIVSQTNSNTNVSGVESVHGLEGKNLYSMGEKEEVTNKMTDFVSKEV
FT                   EQSQVPLLSIHRRGRNNGSYFIFDSSDEYKTIIEIDSSIRQPMDNSNEPSITNHRRTPV
FT                   FSKSQSILDQECDSIEDISLSQGSFKAVTTLISPVKDGSTAQNSQAMDIPTQFSGIPRL
FT                   LDLKTVPKLPFESFNENSKDYRIIISKKKLLELKQAIKRLANIELTEEHEVLGNIDGQP
FT                   GEELFAVVLSISNNLELLSSPGVDTHTKEKSPSLAELRKDLDKIGLKPVRLKSQIIENL
FT                   ASASQVVTVDESNQKKVGVTSKSEVFEFLTHLVKQEPDLLTRIYCFQPITMNDLINKLR
FT                   NKDSFVDLIDDGTIREWTDKLGICIRSNNLKD"
FT   gene            <483972..>485030
FT                   /locus_tag="CAGL0M04411g"
FT                   /old_locus_tag="CAGL-IPF8301"
FT                   /old_locus_tag="CAGL-CDS3143.1"
FT   CDS_pept        483972..485030
FT                   /locus_tag="CAGL0M04411g"
FT                   /old_locus_tag="CAGL-IPF8301"
FT                   /old_locus_tag="CAGL-CDS3143.1"
FT                   /note="similar to uniprot|Q12367 Saccharomyces cerevisiae
FT                   YLR137w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04411g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62515"
FT                   /db_xref="GOA:Q6FJQ5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12367"
FT                   /protein_id="CAG62515.1"
FT                   /translation="MPFSLVRIDEDDVLEYVFERYTAINSDADSIRQDLGIQDSKSTTL
FT                   NIEIAPPKSLINDTNITKKGKKKKGNKSSSDYDFYSFEIKQNVTSLHSTRDNDNSTTGY
FT                   VLWSLTPVFCEWLLYNEQASPLHRAQMVNICSLEKKIIHDIEFPSLLNEDTTVIELGSG
FT                   ISSVLPILCSNFVGTYICTDQRGILNGLKQNIANNLDLVNKRTIVSETLDISNIQEQPT
FT                   NSDDETIPIKPTTQLEVAILDWETFPKSIKSGSSNILTDFVKPHGTIFLLALDVIYNEY
FT                   LINPFLHTLHSIMFYYKNQREIVALVGIHLRSDDIVQEFLEKVTTEFPFKLHVVDDPQW
FT                   SHSRYDIYYITL"
FT   gene            <485936..>488773
FT                   /locus_tag="CAGL0M04433g"
FT                   /old_locus_tag="CAGL-IPF8303"
FT                   /old_locus_tag="CAGL-CDS0525.1"
FT   CDS_pept        485936..488773
FT                   /locus_tag="CAGL0M04433g"
FT                   /old_locus_tag="CAGL-IPF8303"
FT                   /old_locus_tag="CAGL-CDS0525.1"
FT                   /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
FT                   YLR138w NHA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04433g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62516"
FT                   /db_xref="GOA:Q6FJQ4"
FT                   /db_xref="InterPro:IPR004712"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ4"
FT                   /inference="similar to AA sequence:UniProtKB:Q99271"
FT                   /protein_id="CAG62516.1"
FT                   /translation="MAVWEQLEVSKAHVAYACVGVFSSIFSLVSLFVKEKLYIGESTVA
FT                   GIFGLIVGPVCLDWFNPLEWGNSDVITLEITRIVLCLQIFAVAVELPRKYMKKHWLSVT
FT                   MLLVPVMTAGWLIIGLFVWIIIPHINFPAALLVSACITATDPILAQSVVSGKFAKKVPG
FT                   HLRNLLSAESGCNDGMAFPFIYLSLNLVLHPGRGGLIVKDWICITILYECLFGCILGVV
FT                   IGYVGRISIRFAEEKNIIDRESFLAFYVVLAFICAGFGSLLGVDDLLVSFAAGAAFAWD
FT                   GWFSQKTEESNVSTVIDVLLNYAYFIYFGAIIPWDQFNNGDIGLNVWRLIVLAIIVIFL
FT                   RRIPAVMILKPVIPDIKSWREALFVGHFGPIGVGAIFAAILARGELEHEFLEEPTPLNV
FT                   VPPEVETEHWQLIAILWPTICFFIITSIIVHGSSVAVITLGRHLNTVTLTKTFTTHTTN
FT                   GNGKSSWMQRLPSLDKSGRSFSLHRVDTSATNETIHHETEPDELKQNDTMEDYSGVTTS
FT                   GKPVRAAGGMRRRVTRKKKKSRGRKHAERLMRKTEKLNPMFGGYDDELNDLGREKLQLE
FT                   KEAEAGTFALGRKNWPNADNDDDADGSPHTVIGTSISGSDQYDEEKVDSRHSLESTQSE
FT                   KERKLAELKEQEETPHVAYAEGNKIIFENKQGEIIDEAKLNSPSDEEAQQSFRSPSSLK
FT                   KTRSNDSTSRSMTSMNSLKRIITPPSVKKVHSLIDRSHPKYIAYKIDNQLIIEDDEGEV
FT                   LRRYKINTHDKEESKTSPKVQTRNERSSSIVSRALSAVGLRNGSKTTLASDEVTGVAEG
FT                   ERQFVLTPVPTHMYDQNENQINEEDEEGTSYSGSENDNEEENSQSDDSYEYDSNQLSGE
FT                   ESNERSEDEESEDYDEDSDNYSETQIERDRRLNALGHISLPAEADDEEPAPYIPQLDQN
FT                   NSRNKMKSTFARFKK"
FT   gene            complement(<489048..>491183)
FT                   /locus_tag="CAGL0M04455g"
FT                   /old_locus_tag="CAGL-IPF8304"
FT                   /old_locus_tag="CAGL-CDS1056.1"
FT   CDS_pept        complement(489048..491183)
FT                   /locus_tag="CAGL0M04455g"
FT                   /old_locus_tag="CAGL-IPF8304"
FT                   /old_locus_tag="CAGL-CDS1056.1"
FT                   /note="weakly similar to uniprot|P42900 Saccharomyces
FT                   cerevisiae YLR139c SLS1 suppresses lethality of SSM4
FT                   deletion"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04455g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62517"
FT                   /db_xref="GOA:Q6FJQ3"
FT                   /db_xref="InterPro:IPR032741"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ3"
FT                   /protein_id="CAG62517.1"
FT                   /translation="MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQ
FT                   KIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGI
FT                   STNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRY
FT                   EQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEKDDL
FT                   IIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEIS
FT                   LNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEK
FT                   QYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWL
FT                   DKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTR
FT                   QHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQ
FT                   LKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFD
FT                   FKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPT
FT                   EEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRIDLICDDNPDYN
FT                   DFSNFIQQSLEFGKKKI"
FT   gene            <491638..>493329
FT                   /locus_tag="CAGL0M04477g"
FT                   /old_locus_tag="CAGL-IPF8305"
FT                   /old_locus_tag="CAGL-CDS1712.1"
FT   CDS_pept        491638..493329
FT                   /locus_tag="CAGL0M04477g"
FT                   /old_locus_tag="CAGL-IPF8305"
FT                   /old_locus_tag="CAGL-CDS1712.1"
FT                   /note="some similarities with uniprot|Q02983 Saccharomyces
FT                   cerevisiae YLR141w RRN5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04477g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62518"
FT                   /db_xref="GOA:Q6FJQ2"
FT                   /db_xref="InterPro:IPR039601"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ2"
FT                   /protein_id="CAG62518.1"
FT                   /translation="MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEEL
FT                   TRSKVHVNSRVRCLEPDHFSGQVLRRDDYDDYDDDNDEEHDDSESDGDYTTDDEVEPAE
FT                   DDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKT
FT                   TRYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIE
FT                   KWNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESA
FT                   RISKAALLGRQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITL
FT                   KQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQSVLSNLVSSHQRHHNA
FT                   EDDSALALTGELATRYYDGISYMDRKYMSRMNRLLTSTYADSELWHVTESTTASQGPPD
FT                   LFVQYYSHSVPTPHENNVTEKLALQLHDTQLANAVLDNPCEVALACEESRRLDLEDLAR
FT                   SRKHENMLLRYLVGVSERAQPMRVITDQTRSTAVSNKLLQWFQVSP"
FT   gene            <494202..>495611
FT                   /locus_tag="CAGL0M04499g"
FT                   /old_locus_tag="CAGL-IPF8308"
FT                   /old_locus_tag="CAGL-CDS2263.1"
FT   CDS_pept        494202..495611
FT                   /locus_tag="CAGL0M04499g"
FT                   /old_locus_tag="CAGL-IPF8308"
FT                   /old_locus_tag="CAGL-CDS2263.1"
FT                   /note="highly similar to uniprot|P09368 Saccharomyces
FT                   cerevisiae YLR142w PUT1 Proline oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04499g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62519"
FT                   /db_xref="GOA:Q6FJQ1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ1"
FT                   /protein_id="CAG62519.1"
FT                   /translation="MLRIYRPRVMAIARRYVSQTAQTSNAMVADTTDPMMNPMQPKLSS
FT                   HSQLPPSSVAYLKTLSRAEVFSLGMIGLATTSKPVLNLVIKLFPYVPMPLIKMFVSRLY
FT                   CGGDNINEVKTFGEKLQKRGISNMMLSLTIEDSEGTKNIDINYIVEETIKSVHGVLKPN
FT                   LVNQLEKCGNDAKKINEIAPGYIALKPSALVSNPHDVLMNFNNPDPHWVAQREKLIDNC
FT                   SRIAQEIYDLNNDLLKKYPSRTAPFCVATIDAEKYDLQNSGVYELQRILFQKFNKLSSP
FT                   MVSVIGTWQLYLVDSAAQLAREHARAMKEGYKLGVKLVRGAYIHSETKRDSIIFKTKEG
FT                   TDENYDAVMTTVIQDLLKNGTKSYYGHLVVASHNYGSQMLATKILKDAPENVGKANIVL
FT                   GQLLGMSDNVTHDLITKHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVKSDNGFPLV
FT                   KAVIKSLFSRA"
FT   gene            <496157..>498223
FT                   /locus_tag="CAGL0M04521g"
FT                   /old_locus_tag="CAGL-IPF8310"
FT                   /old_locus_tag="CAGL-CDS1134.1"
FT   CDS_pept        496157..498223
FT                   /locus_tag="CAGL0M04521g"
FT                   /old_locus_tag="CAGL-IPF8310"
FT                   /old_locus_tag="CAGL-CDS1134.1"
FT                   /note="similar to uniprot|Q12429 Saccharomyces cerevisiae
FT                   YLR143w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04521g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62520"
FT                   /db_xref="GOA:Q6FJQ0"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ0"
FT                   /inference="similar to AA sequence:UniProtKB:Q12429"
FT                   /protein_id="CAG62520.1"
FT                   /translation="MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDS
FT                   FMFQTVGHDIVSLYENCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQ
FT                   SIPDLQAVSVGAILSSYQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDEL
FT                   NTSESCKLDARIIKVAAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVL
FT                   DAPFFRKGFLKLEEVIDTTDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFD
FT                   PAWNELYELIDNENFEDTKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQ
FT                   VKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARA
FT                   CIESNIINDGSALQLSVVVKYADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIW
FT                   LSNDLNQLSYLSGQIALEPSQMEMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCF
FT                   ISNNSIVPLLTQTWAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGG
FT                   IAAKSLEVEHDDHDLTAELRKLNLDGGINIINHHDLTLRRFKTTFANTAEQLITQIRGV
FT                   TSKNTHCIIFFSEYLCVDKLQDTSAEFIPVEKVYNYKGEEVKFAAHIVNHTKF"
FT   gene            <498691..>499533
FT                   /locus_tag="CAGL0M04543g"
FT                   /old_locus_tag="CAGL-IPF8311"
FT                   /old_locus_tag="CAGL-CDS3755.1"
FT   CDS_pept        498691..499533
FT                   /locus_tag="CAGL0M04543g"
FT                   /old_locus_tag="CAGL-IPF8311"
FT                   /old_locus_tag="CAGL-CDS3755.1"
FT                   /note="weakly similar to uniprot|P25623 Saccharomyces
FT                   cerevisiae YCR030c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04543g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62521"
FT                   /db_xref="GOA:Q6FJP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP9"
FT                   /protein_id="CAG62521.1"
FT                   /translation="MDFTSQARRIIKFAEKALQDETLDSDTVQRAIIERNLRIEFRRQN
FT                   IVSNALKDCHYHQITDEELQSNLTNYPFMASIQARVAWRSILSSPTDPDKDYHNQTSTS
FT                   INRKRSIYNSGHIPNKRLRNEKDRVDKLNQMVRDIENNTKVVETLLNESDITTSVDRPA
FT                   INVHPFVEDEAPPPTITMDDLEIVSNATKNISNTNTVEKPYVSVSSNSRNEYETRHLKY
FT                   DSTISRFGKIDHRRHSKENILIRNDNETHTIRRNSKSNKNPKSIRKMRAVAKKYHLEE"
FT   gene            complement(<499618..>501930)
FT                   /locus_tag="CAGL0M04565g"
FT                   /old_locus_tag="CAGL-IPF8313"
FT                   /old_locus_tag="CAGL-CDS0888.1"
FT   CDS_pept        complement(499618..501930)
FT                   /locus_tag="CAGL0M04565g"
FT                   /old_locus_tag="CAGL-IPF8313"
FT                   /old_locus_tag="CAGL-CDS0888.1"
FT                   /note="similar to uniprot|Q12168 Saccharomyces cerevisiae
FT                   YLR144c ACF2 or uniprot|P53753 Saccharomyces cerevisiae
FT                   YNR067c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04565g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62522"
FT                   /db_xref="GOA:Q6FJP8"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR040451"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP8"
FT                   /inference="similar to AA sequence:UniProtKB:Q12168"
FT                   /protein_id="CAG62522.1"
FT                   /translation="MSYNRPPMPLPKDANPNRSTSGLFYPNEPIMPPRNEEPDSMISSL
FT                   VLDTATPTIDAMNSINITNDMVQEAEYVTVNDLPINTSAPPAMFTRTGHEIPIPDGVER
FT                   NGRPVATNKFYGNFLLGSQTCATWTHPYSVWISKDNAFPGFAANHVRASQRVFGDGNPA
FT                   PFFFSPIGIRSFVFGANELPSFESMSLRFTDLSHMSIHVWLKKSESEHIRFPIVQGMGF
FT                   ITANYSNLTPRLQSAVGFRNLNSMASPRTDMQKYQVLLENDVKWTIYVKLDSKCNNFQL
FT                   FIANGNTIQANQRVSSATIQVVADTVEAIDQAAGCYPVNCDVVNAVNKDKGIYRLAYKT
FT                   EGYSNKGTTLLYGLRHHMVSMTIPTALTSINSELDSTVMGVMRGFITNTLEMQVQIPAN
FT                   VDFIPATTIPGRRVLYSHEVLEKVRDAARKEVNGDVINESNVNSMYFSGKVLAKYAWIL
FT                   FCCQYIVNDRGLVDILLPKLKEAFARFSQNQQQLPLRYDTTWGGVISSGTSGDDFGNSY
FT                   YNDHHFHYSYHIIAAAILTKVDRDIGNGSWFTENREWVETLIRDYANPSENDPYFPMYR
FT                   SFDWFTGHSWAKGLFESGDGKDEESSSEDVNSCYALKLWGMVSGNVALVNRSNVQLGIL
FT                   NTSLNQYFLYDDANKTEPPQFIGNKVSGILFENKIDHTTYFGNYLQYIQMIHAIPITPM
FT                   SSFIRHPSYVEQEWIQKLQGIVNDVNDGWKGIMMLNLALFNPRASFEFFSSPNFSGNFL
FT                   DNGQSLTWSLAYSGAFI"
FT   gene            <502567..>503199
FT                   /locus_tag="CAGL0M04587g"
FT                   /old_locus_tag="CAGL-IPF8316"
FT                   /old_locus_tag="CAGL-CDS4366.1"
FT   CDS_pept        502567..503199
FT                   /locus_tag="CAGL0M04587g"
FT                   /old_locus_tag="CAGL-IPF8316"
FT                   /old_locus_tag="CAGL-CDS4366.1"
FT                   /note="similar to uniprot|Q12530 Saccharomyces cerevisiae
FT                   YLR145w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04587g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62523"
FT                   /db_xref="GOA:Q6FJP7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP7"
FT                   /inference="similar to AA sequence:UniProtKB:Q12530"
FT                   /protein_id="CAG62523.1"
FT                   /translation="MSLVVDKYIQLHQEYRILHLLNHRNKNQHRVATWWKWFNMLRRSV
FT                   GDVVEILQPLGRRKNQKLKDKKDGRFLYRTLHKFFQMESKLYYSFNNIIKLGQFITLGV
FT                   VLVGILGRVHSIYHEIFELYKEQFISMGCLRVPKKNAQIEEAHVTNNDNEELGELINDA
FT                   DVLIEPSALLKQDVILSKNIKNESKSSKDKKKKKKKKKGSAIDDLFG"
FT   gene            complement(<503641..>504537)
FT                   /locus_tag="CAGL0M04609g"
FT                   /old_locus_tag="CAGL-IPF8317"
FT                   /old_locus_tag="CAGL-CDS3617.1"
FT   CDS_pept        complement(503641..504537)
FT                   /locus_tag="CAGL0M04609g"
FT                   /old_locus_tag="CAGL-IPF8317"
FT                   /old_locus_tag="CAGL-CDS3617.1"
FT                   /note="similar to uniprot|Q12455 Saccharomyces cerevisiae
FT                   YLR146c SPE4 or uniprot|Q12074 Saccharomyces cerevisiae
FT                   YPR069c SPE3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04609g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62524"
FT                   /db_xref="GOA:Q6FJP6"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR030668"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP6"
FT                   /inference="similar to AA sequence:UniProtKB:Q12455"
FT                   /protein_id="CAG62524.1"
FT                   /translation="MAEQKYIKDGWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDILV
FT                   FESTNHGVCLVLDGIIQCSERDEFAYQEMIAHIPLYCHANPKKVLVIGGGDGGVVREVV
FT                   KHDKVESVTMVEIDKTVIELAKKYLPGMSCAMDHPKLKLNLCDGFKFLKEASMLSNDDK
FT                   YDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDGIVIAQASENVWLDINYLASLRKTA
FT                   NEVFTNTMISYTTVPTYTSGQLGLIVCTNSNDYDLTTPQRQPSVSEQNQLRYYNSQIHS
FT                   ASFVLPNWADMLIYDKK"
FT   gene            complement(<505301..>505600)
FT                   /locus_tag="CAGL0M04631g"
FT                   /old_locus_tag="CAGL-IPF8319"
FT                   /old_locus_tag="CAGL-CDS5596.1"
FT   CDS_pept        complement(505301..505600)
FT                   /locus_tag="CAGL0M04631g"
FT                   /old_locus_tag="CAGL-IPF8319"
FT                   /old_locus_tag="CAGL-CDS5596.1"
FT                   /note="highly similar to uniprot|P43321 Saccharomyces
FT                   cerevisiae YLR147c SMD3 spliceosomal snRNA"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04631g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62525"
FT                   /db_xref="GOA:Q6FJP5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="InterPro:IPR034099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP5"
FT                   /protein_id="CAG62525.1"
FT                   /translation="MSNIPVKLLSEAQGHVVTIELNNGDTYRGKLVESEDNMNVQLRDV
FT                   MVTSSTQKLSRMDHVFVRGSHIRFFVVPDMLKNAPLFKKNQSRQPPPVRGPRRR"
FT   gene            <505982..>508861
FT                   /locus_tag="CAGL0M04653g"
FT                   /old_locus_tag="CAGL-IPF9371"
FT   CDS_pept        505982..508861
FT                   /locus_tag="CAGL0M04653g"
FT                   /old_locus_tag="CAGL-IPF9371"
FT                   /note="similar to uniprot|P27801 Saccharomyces cerevisiae
FT                   YLR148w PEP3 vacuolar membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04653g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62526"
FT                   /db_xref="GOA:Q6FJP4"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP4"
FT                   /inference="similar to AA sequence:UniProtKB:P27801"
FT                   /protein_id="CAG62526.1"
FT                   /translation="MEVEIEHVELGFINELNKNICGLQVEGNLMCFALRTGSLFLIDLD
FT                   TPSNVIRCQIPLVRDGGVNAEKVLKIWLNPSRSLILVKTNFAKYYLCDVDVIVKTNGES
FT                   MTQNAIASVKQLSKKNCDVRSVAWVRNAKATGMHDKFNLLIGTARGQVYYIEINSKLSE
FT                   QNATLLYESPDSIDGIYWNDANGDIIIASKNKLIYWDGLQSSSNNNKNDREISPKITLS
FT                   KKRKSNEVEEYEHMHMEYTNKFAVYKNSFAWVTESGIVFSNVEQVKKSNKKVLGSSKVI
FT                   LNVELPNSKKPIRDIILSDYHILILRESSITIVNQLDNSVIYNQSIWSNDNEHILGFAS
FT                   DVHYKQATFWCFSASNIFEIILKKESNSVWRLLCDQQRYDDALNLQDLSLFEQSSIQYL
FT                   KGMHLLEENVYSDAAKCFGKSDTVSIPEIALKLLDGDDGMLKIGEQKLNALQFFLSEKL
FT                   LNYRHKDSLKYTIILDWIMWNYVRLFCLIDEKACSEREPDRLKYWDQRKEEISASVKKL
FT                   IDDNINLLERGTFYQLLEKSGRRIELLYLAEKLNDHQYLMNYWIRNENWYESLKVLQKA
FT                   KDPQLAYKHANILLVNCSQSTINTWMTMENLNPVFLIDAILTYFSIYQKSTKGSKVLQE
FT                   NYALTYLKWYVGNNDVNDKIIYNTIVYMMITTPIIQEGNDAMQTDHNNDNDVIEFMENY
FT                   SSKSHLEFVLRLSLKFERIKVAIYLLKLSDQYEDAVDLALSNGLVDEAKEIANMESLAK
FT                   DFTIKRKHWIKIAQVVLSQHLEKPDIKQNIRSIIRESEGTVKINDLLPFFNEFTTVANL
FT                   KDELVRSLEEHNHEIITIRDKIKHSLELKKDIIHETEKFKERYRILEPGKSCDQCQKML
FT                   QTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGKIENFQKRLNKDRKSVNPKELEELMA
FT                   TKCCLCSDIAINKIDEATIDDKERSQWVI"
FT   gene            <509383..>509799
FT                   /locus_tag="CAGL0M04675g"
FT                   /old_locus_tag="CAGL-IPF9372"
FT                   /old_locus_tag="CAGL-CDS4955.1"
FT   CDS_pept        509383..509799
FT                   /locus_tag="CAGL0M04675g"
FT                   /old_locus_tag="CAGL-IPF9372"
FT                   /old_locus_tag="CAGL-CDS4955.1"
FT                   /note="similar to uniprot|Q12305 Saccharomyces cerevisiae
FT                   YOR285w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04675g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62527"
FT                   /db_xref="GOA:Q6FJP3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP3"
FT                   /inference="similar to AA sequence:UniProtKB:Q12305"
FT                   /protein_id="CAG62527.1"
FT                   /translation="MWKRIVDAWNGNATSPSTPGVNTYDFEGMKKVAMQHDPSTVLVDV
FT                   REPSEFSVVHIPGSINVPYRSHPEGFSLDPVTFKQTFGYEKPPVSNHLIFYCASGRRGS
FT                   MAREVAAKNGYTNLSEYPGSMNDWVAKGGDRLAL"
FT   gene            <510203..>510664
FT                   /locus_tag="CAGL0M04697g"
FT                   /old_locus_tag="CAGL-IPF9373"
FT                   /old_locus_tag="CAGL-CDS4807.1"
FT   CDS_pept        510203..510664
FT                   /locus_tag="CAGL0M04697g"
FT                   /old_locus_tag="CAGL-IPF9373"
FT                   /old_locus_tag="CAGL-CDS4807.1"
FT                   /note="similar to uniprot|Q08742 Saccharomyces cerevisiae
FT                   YOR286w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04697g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62528"
FT                   /db_xref="GOA:Q6FJP2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP2"
FT                   /inference="similar to AA sequence:UniProtKB:Q08742"
FT                   /protein_id="CAG62528.1"
FT                   /translation="MFKRVVSISRGRVSPIRLVGLNRSANMIRYLSTNGPKAYNFEDIK
FT                   QLVQHPDPKKVLVDVREPEELKECKLPNSINIPLKSAPGALGLPEEEFQELFHIEKPPK
FT                   DKELIFFCALGVRAKTSEELARSYGYESTGVWEGSMKEWKEKGGDKIKV"
FT   gene            complement(<510921..>511862)
FT                   /locus_tag="CAGL0M04719g"
FT                   /old_locus_tag="CAGL-IPF9374"
FT                   /old_locus_tag="CAGL-CDS3489.1"
FT   CDS_pept        complement(510921..511862)
FT                   /locus_tag="CAGL0M04719g"
FT                   /old_locus_tag="CAGL-IPF9374"
FT                   /old_locus_tag="CAGL-CDS3489.1"
FT                   /note="similar to uniprot|Q12481 Saccharomyces cerevisiae
FT                   YOR287c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04719g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62529"
FT                   /db_xref="GOA:Q6FJP1"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJP1"
FT                   /inference="similar to AA sequence:UniProtKB:Q12481"
FT                   /protein_id="CAG62529.1"
FT                   /translation="MSYYFKNIKPSYDDDSDEVSDEQDLDAILASKMRGRAESDDESSE
FT                   EEDDGLSKLSFGSLKKAEDQLEEEERGELRKKRKPQHSKPINDEPEVRHKVYKEEEQEE
FT                   SDSESGSDDGAFFEEDERDNHSRPKNKNSKKRKHAPTEHSSKKRVSKIRDIPGLEIARQ
FT                   AKSGIYQDVRFTKATGEATDFSVIRRRYKFLDEYREKEIEEMERLLNDKKFVNKAESRE
FT                   IENMKEKVRSMKSRLQSVKNRELEQQIVKDYEGKLNEGNKNRFHLKKAEKRKVIQKWKF
FT                   DHMKAKQREKVMERKRKKKLGKEFKQFEFHNR"
FT   gene            complement(<512229..>513143)
FT                   /locus_tag="CAGL0M04741g"
FT                   /old_locus_tag="CAGL-IPF9375"
FT                   /old_locus_tag="CAGL-CDS3576.1"
FT   CDS_pept        complement(512229..513143)
FT                   /locus_tag="CAGL0M04741g"
FT                   /old_locus_tag="CAGL-IPF9375"
FT                   /old_locus_tag="CAGL-CDS3576.1"
FT                   /note="similar to uniprot|Q12404 Saccharomyces cerevisiae
FT                   YOR288c MPD1 disulfide isomerase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04741g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62530"
FT                   /db_xref="GOA:Q6FJP0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP0"
FT                   /inference="similar to AA sequence:UniProtKB:Q12404"
FT                   /protein_id="CAG62530.1"
FT                   /translation="MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTN
FT                   YTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGFPT
FT                   LKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLVNSQ
FT                   SSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIG
FT                   PLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSK
FT                   RDDYLAKLKLNKKKKTQVQNDEL"
FT   gene            <513555..>514259
FT                   /locus_tag="CAGL0M04763g"
FT                   /old_locus_tag="CAGL-IPF9376"
FT                   /old_locus_tag="CAGL-CDS4131.1"
FT   CDS_pept        513555..514259
FT                   /locus_tag="CAGL0M04763g"
FT                   /old_locus_tag="CAGL-IPF9376"
FT                   /old_locus_tag="CAGL-CDS4131.1"
FT                   /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
FT                   YOR289w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04763g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62531"
FT                   /db_xref="GOA:Q6FJN9"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN9"
FT                   /inference="similar to AA sequence:UniProtKB:Q12012"
FT                   /protein_id="CAG62531.1"
FT                   /translation="MVGKNNELYAFYAFLQLYKHMGHVQRDYSLRQVAEALYDTTLIIK
FT                   EDTSLFITWKRLDSQKTSIDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDSRF
FT                   TPISERELKTLKCSCNILRHFEKIYSSGDDHGDIDNWEIGKNGIELLFKHPKSGKTCSA
FT                   TFLPDVMVEQGWDKKETFLNLIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEITYDA
FT                   FISGFEKLETLV"
FT   gene            complement(<514590..>514662)
FT                   /gene="tRNA-Ala (TGC)"
FT                   /locus_tag="CAGL0M04785r"
FT   tRNA            complement(514590..514662)
FT                   /gene="tRNA-Ala (TGC)"
FT                   /locus_tag="CAGL0M04785r"
FT                   /product="transfer RNA-Ala"
FT   gene            complement(<514847..>520039)
FT                   /locus_tag="CAGL0M04807g"
FT                   /old_locus_tag="CAGL-IPF9378"
FT                   /old_locus_tag="CAGL-CDS0056.1"
FT   CDS_pept        complement(514847..520039)
FT                   /locus_tag="CAGL0M04807g"
FT                   /old_locus_tag="CAGL-IPF9378"
FT                   /old_locus_tag="CAGL-CDS0056.1"
FT                   /note="similar to uniprot|P22082 Saccharomyces cerevisiae
FT                   YOR290c SNF2 or uniprot|P32597 Saccharomyces cerevisiae
FT                   YIL126w STH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04807g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62532"
FT                   /db_xref="GOA:Q6FJN8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014978"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029295"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN8"
FT                   /inference="similar to AA sequence:UniProtKB:P22082"
FT                   /protein_id="CAG62532.1"
FT                   /translation="MDVPMPQRQLTKEEINRCYLKWQQLRNEHGKNAANVPEFIHLTKI
FT                   LHVAAKQQQEQKQKLQQQQQQQQQQQQVHVGTPQNDNKNNSEPWRVDNPNGSTFSHNKE
FT                   QLETSTDQRPPNFTMNGTEGSASSASPATNPQVQFYKKENSNNGASQRDNFQSRTISDN
FT                   SNSPATSPKSQVVTQNMPVRNNSQPNKSINSPHTINKPNDRQTQPAPLNPTQQRPVPQN
FT                   SIFTPQQSELLRAQISALKSLVNNQPVPQEYQKVIQQSINNPPDFKRMLLSLSDFVKKK
FT                   QLNQQSGSPASEIPEPQPQAQPPVQPPTEPQVQPQATPQAQSQPHAQSQQQDKNSTSDN
FT                   AKIDTNTASANTSMTEEKPIIKTGTNTPNVTHEQIPPVGVQGTSSNTLREETHKTDTPS
FT                   PRTIPGSVTHQIATPNLNKQENQNPETQNQYALKPPTERVPDPLVDGELKPAQQLPPVP
FT                   IQKFVEKYPYVKNVVSIEDPDLMVDTFSIPTIPEEPVDYYSLFPNTANPKLVMEPGMLP
FT                   AGVDIHTATDIYQTLIALNLDTSVNECISDMLDDSKDENTKEETLYDYFALQLLPLQKA
FT                   VRGHVLQYEWYQNSLLTNAHPNFLSKIRNINFNDVLLTIELYRKREVIRQEEESKRYQQ
FT                   KLTRIRNSVVNTFNHKVHRRNKRIKLGHKLVATHANIEKEEQKRAERKAKERLQALKAN
FT                   DEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKDQQKYTKDMLNQHLMEKKEESAE
FT                   PVVYNDDQMLTMSMNDDDDDEENIDYYNVAHRIKEEVRQQPSILVGGTLKEYQIKGLQW
FT                   MVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIKGPFLIIVPLSTLPNWSSEFA
FT                   KWAPKLRTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVHMIIDE
FT                   GHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSFDE
FT                   WFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKC
FT                   KMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLMQLKKICNHPFVFEEVEDHI
FT                   NPTRDTNMNIWRVAGKFELLERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYL
FT                   RLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQD
FT                   LQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEE
FT                   QEALLRSLLEAEEGRRRRREAGIEEEEELRDNEINEILARSEDDLALFSKLDTEREEAD
FT                   KAMHINSRLMTLDELPEIYHRNIDEELKKEESESAETYGRGTRERKQMIYSDNMSEEQW
FT                   LKQFEVSDSEDKDPNKIMELKDDETDVNSNTIKTESNEAIRSSSISIPSSPTQTMNNTP
FT                   ETNDLDSDSGEYAKKRKAPSTRPRGRPKKIKTDDGENNPTESITGDVGDNTEDVVKRAG
FT                   KTSIKSANTSSRGRGRGRGRGKPRGRAGMRGRGRPPKSKNGMVYVRMLPEDPVSEEERK
FT                   GIAEQATKLYDFALNYVNSDERRLSDIFLVKPSKHLYPDYYLIIKYPIAFDTIKDAIDR
FT                   LQYNSITEVMEDFHLMFANARVYNTEGSIIYEDAIELEDAMLQKYVEITNDTATLDFTE
FT                   FDAKYGTKPLHIQEPETHSTNENTPQDSSKDII"
FT   gene            complement(<524685..>529805)
FT                   /locus_tag="CAGL0M04829g"
FT                   /old_locus_tag="CAGL-IPF7211"
FT                   /old_locus_tag="CAGL-CDS0060.1"
FT   CDS_pept        complement(524685..529805)
FT                   /locus_tag="CAGL0M04829g"
FT                   /old_locus_tag="CAGL-IPF7211"
FT                   /old_locus_tag="CAGL-CDS0060.1"
FT                   /note="similar to uniprot|Q05022 Saccharomyces cerevisiae
FT                   YMR229c RRP5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04829g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62533"
FT                   /db_xref="GOA:Q6FJN7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN7"
FT                   /inference="similar to AA sequence:UniProtKB:Q05022"
FT                   /protein_id="CAG62533.1"
FT                   /translation="MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLEL
FT                   KHVANEAAHDVLFGNEKRPLTEDDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLN
FT                   FNNVKEGTILLGQIDSITKNDLRITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSK
FT                   EDDAEYESSDDESEQKSLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPS
FT                   VVNNFDVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFI
FT                   SCITKKTDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSI
FT                   SAFIGKPHLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTL
FT                   GSIESLEAFPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVI
FT                   GYDVADCIFELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAF
FT                   VPPLHISDIRLIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESF
FT                   ETAKSIKNKNEKTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQT
FT                   VQVKVLEVDEERRRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEI
FT                   PDVGIRGVIYVGHISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMK
FT                   DAQNKRLPTTFAEITKFKKTDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVD
FT                   IEKAFYSNQSVTAYLLRTDDDNERFLLTLKAPKVEKAAETISAENIIDTSIKSVKDIKL
FT                   GKILDAKIKGVKKNQLNIILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVK
FT                   IIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNN
FT                   YQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQ
FT                   VTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQ
FT                   VFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTD
FT                   KGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETE
FT                   VNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDI
FT                   QSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTNETITEKAESQPQPRKIDEDQDEL
FT                   MDDEVVYNSESEASDDEEAHSSKSTTVISNDGGLSLSAGFDWTTSILDQANASSDSESD
FT                   EEDFMESKRSKNKKKKSKNLVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAF
FT                   QLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQY
FT                   MDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVG
FT                   TILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQ
FT                   EIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESNNDEKMTDYVKAKASEYV
FT                   EKHTQKDEQ"
FT   gene            <532127..>532318
FT                   /locus_tag="CAGL0M04851g"
FT                   /old_locus_tag="CAGL-IPF14284"
FT   CDS_pept        532127..532318
FT                   /locus_tag="CAGL0M04851g"
FT                   /old_locus_tag="CAGL-IPF14284"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04851g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62534"
FT                   /db_xref="GOA:Q6FJN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN6"
FT                   /protein_id="CAG62534.1"
FT                   /translation="MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENY
FT                   RRVQDYKILVLHYFCKQR"
FT   gene            <532872..>533189
FT                   /locus_tag="CAGL0M04873g"
FT                   /old_locus_tag="CAGL-IPF14283"
FT   CDS_pept        532872..533189
FT                   /locus_tag="CAGL0M04873g"
FT                   /old_locus_tag="CAGL-IPF14283"
FT                   /note="highly similar to uniprot|P46784 Saccharomyces
FT                   cerevisiae YMR230w RPS10B or uniprot|Q08745 Saccharomyces
FT                   cerevisiae YOR293w RPS10A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04873g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62535"
FT                   /db_xref="GOA:Q6FJN5"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN5"
FT                   /protein_id="CAG62535.1"
FT                   /translation="MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKA
FT                   LQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPNRR
FT                   Y"
FT   gene            <534252..>537362
FT                   /locus_tag="CAGL0M04895g"
FT                   /old_locus_tag="CAGL-IPF7207"
FT                   /old_locus_tag="CAGL-CDS0393.1"
FT   CDS_pept        534252..537362
FT                   /locus_tag="CAGL0M04895g"
FT                   /old_locus_tag="CAGL-IPF7207"
FT                   /old_locus_tag="CAGL-CDS0393.1"
FT                   /note="similar to uniprot|P12868 Saccharomyces cerevisiae
FT                   YMR231w PEP5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04895g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62536"
FT                   /db_xref="GOA:Q6FJN4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="InterPro:IPR024763"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN4"
FT                   /inference="similar to AA sequence:UniProtKB:P12868"
FT                   /protein_id="CAG62536.1"
FT                   /translation="MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLF
FT                   FIAVRSNYIRHFSLKKAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLF
FT                   KINDLPTNEFHYHSLVEIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDR
FT                   GSQQRILYEDSTGDPITSLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGV
FT                   ALNCASFSKFTNENICCMNDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEE
FT                   RQKTTSIEYESGASNNICKAIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTA
FT                   EGLMYKVSKKSLDERLSIVMNKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLH
FT                   TEAAQQYMKCIDILDISDIITKLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLL
FT                   SVLIKLKDEDGLKRFVSYFRRSGKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDS
FT                   KLNQLCYQFVFKFSKDPIMITDVLLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLY
FT                   LSPNETNLLLIEVFTGKYRPSSYVSDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLA
FT                   DASVLDASENGDRLDVDRPTYHPPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKN
FT                   DRQEILTTLYDLYLTLSKQDVGERKSEWTEKANLVLNESNELANELDQNSNNNLNKVDN
FT                   SLMKLIAHMNGLNVADISSPINENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEE
FT                   HSKNNIDLFPMALSYFISKKEILEFIGGEDQLVKKIIKPIIENNIMSILDLLQILSSRD
FT                   FITYGCVKDILLDRMKEEDAVAKRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKD
FT                   KKCDLCHITLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRIS
FT                   KERELASRKELLDLAFKEEGNNSDRFRIVSDFIGRGALENSYITIES"
FT   gene            <537760..>539520
FT                   /locus_tag="CAGL0M04917g"
FT                   /old_locus_tag="CAGL-IPF7206"
FT                   /old_locus_tag="CAGL-CDS1578.1"
FT   CDS_pept        537760..539520
FT                   /locus_tag="CAGL0M04917g"
FT                   /old_locus_tag="CAGL-IPF7206"
FT                   /old_locus_tag="CAGL-CDS1578.1"
FT                   /note="weakly similar to uniprot|Q05670 Saccharomyces
FT                   cerevisiae YMR232w FUS2 required for cell fusion during
FT                   mating"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04917g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62537"
FT                   /db_xref="GOA:Q6FJN3"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN3"
FT                   /protein_id="CAG62537.1"
FT                   /translation="MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGAR
FT                   ASYSDSIGGDLDTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEK
FT                   ALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNP
FT                   SSIDVIYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYD
FT                   DARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDN
FT                   EDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSP
FT                   KISLDEKPCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTS
FT                   LLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMK
FT                   TVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQ
FT                   FMVLFLLSFNAYLRDALDILISVQADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKS
FT                   NNNIVLRRLF"
FT   gene            <539988..>540689
FT                   /locus_tag="CAGL0M04939g"
FT                   /old_locus_tag="CAGL-IPF7205"
FT                   /old_locus_tag="CAGL-CDS4143.1"
FT   CDS_pept        539988..540689
FT                   /locus_tag="CAGL0M04939g"
FT                   /old_locus_tag="CAGL-IPF7205"
FT                   /old_locus_tag="CAGL-CDS4143.1"
FT                   /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
FT                   YMR233w and similar to uniprot|Q08747 Saccharomyces
FT                   cerevisiae YOR295w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04939g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62538"
FT                   /db_xref="GOA:Q6FJN2"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN2"
FT                   /inference="similar to AA sequence:UniProtKB:Q05024"
FT                   /protein_id="CAG62538.1"
FT                   /translation="MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLEN
FT                   KKKEVNELIVARFQILQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSK
FT                   KTRIQVKKKKSKKSSKDGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQV
FT                   WDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSR
FT                   LSVKLEDGTQA"
FT   gene            complement(<540950..>542158)
FT                   /locus_tag="CAGL0M04961g"
FT                   /old_locus_tag="CAGL-IPF7204"
FT                   /old_locus_tag="CAGL-CDS2757.1"
FT   CDS_pept        complement(540950..542158)
FT                   /locus_tag="CAGL0M04961g"
FT                   /old_locus_tag="CAGL-IPF7204"
FT                   /old_locus_tag="CAGL-CDS2757.1"
FT                   /note="highly similar to uniprot|P11745 Saccharomyces
FT                   cerevisiae YMR235c RNA1 GTPase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04961g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62539"
FT                   /db_xref="GOA:Q6FJN1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN1"
FT                   /protein_id="CAG62539.1"
FT                   /translation="MATLHFTPKYEDDEVFSIAGKALKLTTKEDIQPHLDDLAKLKKCK
FT                   KLDFSGNTIGTEASKALADFLGSTESVRDVVEEINFADMYTSRLVDEVVDSLKALLPVL
FT                   LKCNKLTILNLSDNAFGLRTIDYLENYIANAVHLKHLILSNNGMGPFAGERIGKALFYL
FT                   AQNKTKAKESMLETFICGRNRLENGSALYLALGLKSHGDGLKVVKLYQNGIRPKGVATL
FT                   IHYGLKYNTKLEIIDLQDNTFTTAASLVLAKNLPLWKNTLVELNLNDCLLKAKGSKEVF
FT                   KVFEDNTFENLETLRFEYNEMEQDTLETVFLPAIEDNKFPKLKNLEINGNRFEEDSDPV
FT                   NALMDHFEDLELDDLEEPDSEEEEEEEEEEEKMEEIETSKIENELIELQIDNLAQELSK
FT                   ASI"
FT   gene            complement(<542562..>543017)
FT                   /locus_tag="CAGL0M04983g"
FT                   /old_locus_tag="CAGL-IPF7203"
FT                   /old_locus_tag="CAGL-CDS4825.1"
FT   CDS_pept        complement(542562..543017)
FT                   /locus_tag="CAGL0M04983g"
FT                   /old_locus_tag="CAGL-IPF7203"
FT                   /old_locus_tag="CAGL-CDS4825.1"
FT                   /note="highly similar to uniprot|O14467 Saccharomyces
FT                   cerevisiae YOR298ca MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M04983g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62540"
FT                   /db_xref="GOA:Q6FJN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJN0"
FT                   /protein_id="CAG62540.1"
FT                   /translation="MSDWESHTVIGQKARAGGSGPRANVARTQGQINAARRQGLVLSVD
FT                   KKYGTANTKGDAEGQRLTKVDRETDIVKPKKLDANVGKTIARVRTEKKMSQKDLATKIN
FT                   EKPTVINDYEAGRAIPNQQVLGKMERALGVKLRGKAIGEPLGGPKKK"
FT   gene            <543281..>543781
FT                   /locus_tag="CAGL0M05005g"
FT                   /old_locus_tag="CAGL-IPF7202"
FT                   /old_locus_tag="CAGL-CDS4688.1"
FT   CDS_pept        543281..543781
FT                   /locus_tag="CAGL0M05005g"
FT                   /old_locus_tag="CAGL-IPF7202"
FT                   /old_locus_tag="CAGL-CDS4688.1"
FT                   /note="similar to uniprot|Q05027 Saccharomyces cerevisiae
FT                   YMR236w TAF17"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05005g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62541"
FT                   /db_xref="GOA:Q6FJM9"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM9"
FT                   /inference="similar to AA sequence:UniProtKB:Q05027"
FT                   /protein_id="CAG62541.1"
FT                   /translation="MEEVDSQGDLPRDVRLLHLLLASQSIQQYEDRVPLQLMDFAHRYT
FT                   RGVLMDAMVYNDYASENAPGGSNAAANATNAKNAPKANTLGSGMTSNGGKNINVEDVRL
FT                   AIAARTQYMFKPTAPKELLLQLAAERNKKALPQVMGSWGVRLPPEKYCLTAKSWDLDEK
FT                   EEK"
FT   gene            <544448..>546676
FT                   /locus_tag="CAGL0M05027g"
FT                   /old_locus_tag="CAGL-IPF7201"
FT                   /old_locus_tag="CAGL-CDS0965.1"
FT   CDS_pept        544448..546676
FT                   /locus_tag="CAGL0M05027g"
FT                   /old_locus_tag="CAGL-IPF7201"
FT                   /old_locus_tag="CAGL-CDS0965.1"
FT                   /note="similar to uniprot|Q05029 Saccharomyces cerevisiae
FT                   YMR237w and similar to uniprot|Q08754 Saccharomyces
FT                   cerevisiae YOR299w BUD7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05027g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62542"
FT                   /db_xref="GOA:Q6FJM8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM8"
FT                   /inference="similar to AA sequence:UniProtKB:Q05029"
FT                   /protein_id="CAG62542.1"
FT                   /translation="MITQASIPEVREDVIGFALGERKAILPQCQDLGPPDLITMVKYVP
FT                   TPNSNATAGTTSGNGAGGANNGTAGAANGNNSLSTADPAALLAEIHSHDKLKGAIGTFF
FT                   YTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDVNVI
FT                   VHIPGAVQTYVLDSNGEHLPVSGNQTTPTVASTASANPIDQASEMDVIWAETFISGVIR
FT                   SIMFMKDNADDGEAQPLVETLILNPLTAGKLDDVANTFIKLFPTVYERGVLTEAPCHVL
FT                   VPTRTNNYLVDTLVELVRLTKSVDICRPMLEELIKSYPDASIVLARVLMACDYEIDAID
FT                   IINRELLPHGEEDDTISPIFRAELLCLQTQFLMNVKNDYKLALEVALSAVKFSPSEFIP
FT                   WFLLTKIYIKLNDIENALLALNSCPMAQSHERYVLKRAVPIGSEDNLHLPLPENIGVDE
FT                   ILQLNPSDVNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWETLLKCRSKIF
FT                   VMEDEYQISTDEVSLTNQSNRNEDTPSELNMRTKRLCDRWLDNLFMLLYEDLKIYTLWQ
FT                   TEQLYFEAQNSKYKKLTYEWEAFGLCAQRLGHLPEAASAFQRGLSQRFAPMSARMLLNY
FT                   YIQEHHRVRNQSLSPNSELTSSQIISRINDLDSRIIDLCVKLCCWNHRWYIEFSIQLID
FT                   ALSVAVQDMGIMKVINEIASRYPDAVVSIMKENFLDFLENYTNGFFDA"
FT   gene            <547489..>548850
FT                   /locus_tag="CAGL0M05049g"
FT                   /old_locus_tag="CAGL-IPF7200"
FT                   /old_locus_tag="CAGL-CDS2365.1"
FT   CDS_pept        547489..548850
FT                   /locus_tag="CAGL0M05049g"
FT                   /old_locus_tag="CAGL-IPF7200"
FT                   /old_locus_tag="CAGL-CDS2365.1"
FT                   /note="similar to uniprot|P36091 Saccharomyces cerevisiae
FT                   YKL046c or uniprot|Q05031 Saccharomyces cerevisiae YMR238w
FT                   DFG5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05049g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62543"
FT                   /db_xref="GOA:Q6FJM7"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM7"
FT                   /inference="similar to AA sequence:UniProtKB:P36091"
FT                   /protein_id="CAG62543.1"
FT                   /translation="MKLLFSLQLWVLIGTLFPDAGAINLQDNKDSICAATALIQGGMLD
FT                   YYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
FT                   YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQS
FT                   CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGY
FT                   IVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVL
FT                   GGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKA
FT                   SAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADN
FT                   GGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF"
FT   gene            complement(<549092..>549163)
FT                   /gene="tRNA-Asp (GTC)"
FT                   /locus_tag="CAGL0M05071r"
FT   tRNA            complement(549092..549163)
FT                   /gene="tRNA-Asp (GTC)"
FT                   /locus_tag="CAGL0M05071r"
FT                   /product="transfer RNA-Asp"
FT   gene            complement(<549525..>549596)
FT                   /gene="tRNA-Arg (TCT)"
FT                   /locus_tag="CAGL0M05093r"
FT   tRNA            complement(549525..549596)
FT                   /gene="tRNA-Arg (TCT)"
FT                   /locus_tag="CAGL0M05093r"
FT                   /product="transfer RNA-Arg"
FT   gene            <549946..>551247
FT                   /locus_tag="CAGL0M05115g"
FT                   /old_locus_tag="CAGL-IPF7199"
FT                   /old_locus_tag="CAGL-CDS2532.1"
FT   CDS_pept        549946..551247
FT                   /locus_tag="CAGL0M05115g"
FT                   /old_locus_tag="CAGL-IPF7199"
FT                   /old_locus_tag="CAGL-CDS2532.1"
FT                   /note="weakly similar to uniprot|O42838 Saccharomyces
FT                   paradoxus retrotransposon Ty5-6p"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05115g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62544"
FT                   /db_xref="GOA:Q6FJM6"
FT                   /db_xref="InterPro:IPR035179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM6"
FT                   /protein_id="CAG62544.1"
FT                   /translation="MELVYPLLCQTIANGELASLKQQVMSLAANTYDASTTIKLTEVGD
FT                   YKKWIQMLESTLTMAHSAWSEFYHAGPYDVKTISDPTVKIQLSFLNDALVCLIKKRVSD
FT                   DAVKNINKIILSLTNFSNSAFKILDYLKGRYDRNNSRTSFKQNYGWITNYQSMTHEDLF
FT                   REITSMMEALLNYDEYELALLNTIPKDDQAKFIVRKENLIKQSAAGMMLGYLPEHLREG
FT                   YFKQWGHTAEFQTYEIVDIVVGSNVNNSQSVNHGSLANAENKNYKKQNRDKKPHFRKQK
FT                   TKPKCLYCGKPHKLSECKILFQDNPDAEVFKTFGPPSIDEELSGAYEYTIQEKPETLIW
FT                   NSGASTHMCCNKQFFIEYKDLKAHTSEISQYPTTSCREAREASIHAYKEPASRHHDQDH
FT                   TQNPARGLKELDSVAIIKSGGSTTYSVQAVWRGC"
FT   gene            <552160..>556215
FT                   /locus_tag="CAGL0M05137g"
FT                   /old_locus_tag="CAGL-IPF7198"
FT                   /old_locus_tag="CAGL-CDS0161.1"
FT   CDS_pept        552160..556215
FT                   /locus_tag="CAGL0M05137g"
FT                   /old_locus_tag="CAGL-IPF7198"
FT                   /old_locus_tag="CAGL-CDS0161.1"
FT                   /note="weakly similar to uniprot|P21827 Saccharomyces
FT                   cerevisiae YGL097w SRM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05137g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62545"
FT                   /db_xref="GOA:Q6FJM5"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM5"
FT                   /protein_id="CAG62545.1"
FT                   /translation="MPKSYNENDIWKIRDVFGRDLSYISSCLPSLEDYKQINLNSSDLE
FT                   SGYSPLHVTLRERLLQKSFLLYKRWVDDEKQMSYKIGQHILARKDREGLTPMDLYNIEF
FT                   QRALKVKPQLLEYTIDNGNLKPKVIFEKVNHLDSEGIATTKSCSNNELLRSTSFLEIPQ
FT                   NYSDMAKIRNLGGSHLLTFGSNVNAQLGTGNKDDRQHFHETDYQQLGGDLPLDPKKFSI
FT                   KEVLMSRYHCLVINSFGEVFTCGNSNRGRLGNGETNTTVSVFTKIATFETGVRHVSISN
FT                   HHNLLVDGNGYIYSWGWNQYYQLGYTSSNKQGDSKHTLCKSSPKRIPYFDNINIKYVAC
FT                   SKVHSCALSQDNKLYLWGLNLGQMGNKKPLHVNLDISHDHNNGYIIESPLVIDLSHLQV
FT                   EQVLALELVTFIRCSGNTLIVLTDFCMRTFKISTPKPKNPTRIDIFSHYTPKTISADVV
FT                   DMKCSNKVGNHLFFKYASGRVGYLSLKKENVESWSKLSNELPISFSWKPNFARNNCTDF
FT                   AVGYNGDIIICTYGGEIFISRNHAEFERIYSNKLITGRAVKISSDTSLGSVAIIKQDYL
FT                   FMPAKYLKDTFDFDLAIYSPIYQNVGDTLSLGSLGLQCHVKETDSQLFLSSKSNISNLR
FT                   YSEINGSSVNENQIKCSSYDVILNNDRGIIECYSFKSLFSLRCSKFLNAILNDGKFTVN
FT                   NELFFTANETANGILQIKTHDLTTSAVYYKISVDLVHFLLTDVKPANQQRSIAILSITD
FT                   NYAHGTTLRNALSSYLLGMLTNDTDENRIKSPGNHLLGDTILRLKDKTLIVDSFLLSAR
FT                   SNYFKGLLSNSVFCEKDNDGKYLINLEIYSYKQFDIILKYLYGVDFSDLHPHYESEDGG
FT                   LTNFLESLVLADELCLEPLKCYMQVLLSQFIDGNSIIPLFIYSVRSNAEMLCLLCSTFI
FT                   AIHIGVLFVKDNVQLISQNFDDSHWKILQNNISYITSEQLNHELWYNNSTDNWRSLFKN
FT                   DINKFNSKFISPKDKFSPIFDIKDTLEVSSKKTSTDRRRSSTSTRPIKFKNTTMNNTSD
FT                   NPHRRQSNGSVSIAEKLSASNSSDEDSQFIEVTRKPKRKSVSNIQESQTPVPKLHPPKP
FT                   NILIHRKLSGDEKLLPSLISNEPIVEIPNQKKNQSEIGPKKPISFKKTSQKERIKTTTQ
FT                   ADKQKENKTKESAWTNQKQNSSLSNPKDNQTSKLAALPSLNDSKLQKQDLKPNKKSKKK
FT                   ANNKQSAEFISSGNFAGLTPYLSTVHKESVTTDTTPSWTASTVSDFKQKVEAQEFEKWF
FT                   QEESKRVQLELERRGSSHHDELKVLYDSSQNIPGFVIDSNVKKAGRKIKGKFKAKLKNK
FT                   DENINSIQ"
FT   gene            complement(<556347..>557696)
FT                   /locus_tag="CAGL0M05159g"
FT                   /old_locus_tag="CAGL-IPF7196"
FT                   /old_locus_tag="CAGL-CDS2404.1"
FT   CDS_pept        complement(556347..557696)
FT                   /locus_tag="CAGL0M05159g"
FT                   /old_locus_tag="CAGL-IPF7196"
FT                   /old_locus_tag="CAGL-CDS2404.1"
FT                   /note="similar to uniprot|Q02555 Saccharomyces cerevisiae
FT                   YMR239c RNT1 double-stranded ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05159g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62546"
FT                   /db_xref="GOA:Q6FJM4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="InterPro:IPR040540"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM4"
FT                   /inference="similar to AA sequence:UniProtKB:Q02555"
FT                   /protein_id="CAG62546.1"
FT                   /translation="MGKIGKVGKASKKKSRLTSELVDLYEKNSTEQVGTYQYSNAIQIE
FT                   HAVHKLVEAYQRILKLSPNIVQYYETLNSLSDPEKVPPQLISLFTRYPLKLAAEIKTLH
FT                   DLNKSTLLDDISGYEAKFDASNREPVLGDLELSDLQDLEDDDIGRLDLDLSVAKSSESS
FT                   ECITSKEKSSKWPPEMPEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLEFLGD
FT                   SILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELPKQLKSNLSPDVDL
FT                   STSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDM
FT                   NAKRKLYSLIGYAALKLHYHTVQRPTNENPVTIVQCRTGDGTILGVGKARNIKLAGVKA
FT                   AEDVLRKEDVIEKYAKLRASIPREQSVSKNEQPRTTNKEQGEKDICELSG"
FT   gene            complement(<558426..>559691)
FT                   /locus_tag="CAGL0M05181g"
FT                   /old_locus_tag="CAGL-IPF7194"
FT                   /old_locus_tag="CAGL-CDS2630.1"
FT   CDS_pept        complement(558426..559691)
FT                   /locus_tag="CAGL0M05181g"
FT                   /old_locus_tag="CAGL-IPF7194"
FT                   /old_locus_tag="CAGL-CDS2630.1"
FT                   /note="similar to uniprot|Q02554 Saccharomyces cerevisiae
FT                   YMR240c CUS1U2 snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05181g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62547"
FT                   /db_xref="GOA:Q6FJM3"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM3"
FT                   /inference="similar to AA sequence:UniProtKB:Q02554"
FT                   /protein_id="CAG62547.1"
FT                   /translation="MARSKRKRSGVSDVKASIIDAIETTHKQPAKKKKRVNATPNLESE
FT                   YRELFKKFNGVEERDVEEDRNPKVASHEPTLRDDHVADAKSADAKSADAKSADAIPQPL
FT                   SNRKARLMNKPTLAELKSSVLTPQLIEKHDCDAKEPYFLASVKTSFNVVQVPSHWQSKR
FT                   DYLSGRSLLEKKPFELPDLIKQTGVDSMRNTLPEDEEQEKLKEQTRNAVRPKLGKLDLD
FT                   YKKLYDVFFKLGKKWKPDTMLPYGDVYYENRNLQGEARWRKLVKDRIPGRLSDDLRHAL
FT                   GLQPGQLPPWCLRMKDLGMPPSYPNMKIAGLNWDISNFKDNKYGKVSKSNWTNTPLFGA
FT                   ILQFDDHQQAPEVEVPEVEVEVEVPVPEVPVPEEVKKPEPVTSIPESHSAKPVNTIRGS
FT                   VEHGGIQDNVESAQDELANYKF"
FT   gene            <560321..>562494
FT                   /locus_tag="CAGL0M05203g"
FT                   /old_locus_tag="CAGL-IPF7192"
FT                   /old_locus_tag="CAGL-CDS1791.1"
FT   CDS_pept        join(560321..560506,560842..562494)
FT                   /locus_tag="CAGL0M05203g"
FT                   /old_locus_tag="CAGL-IPF7192"
FT                   /old_locus_tag="CAGL-CDS1791.1"
FT                   /note="highly similar to uniprot|P36070 Saccharomyces
FT                   cerevisiae YKL125w RRN3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05203g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62548"
FT                   /db_xref="GOA:Q6FJM2"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM2"
FT                   /protein_id="CAG62548.2"
FT                   /translation="MMVFESNNKRPATEELPDIESKKPRVDIVGSTEIYVEAGNDAHFS
FT                   DEMYRKFIKNALDELEKNDPMQINAITSQISLSAKNPDRISTKNFTILLEVLSNNINKV
FT                   DSSKGLPLIQCIINFEKWWELPDPALGKYIFFIKVLCSSIPKWWQDVAMIMISSFILSS
FT                   EKTTQHHELLKYFLRMIPSSMSYIDSYLIRYFPNKNDSKKNIVNYISNVLMLTSYCQEL
FT                   KFQAWSLIMERVISIDVELQNELDELDDDIDDEMVDDDGDDSDEDEDDEDEDHSGAEDD
FT                   AEDDEDEDDGDDFDDADGQEEYNIDLTQGIKELSNKLDAILSLLSSEIIKDMTPEKLES
FT                   GEGIGTFNTLTTLFKTHILPTYYTRSVQYIMFHLSQQQLELMDSYLVTLIDISFAANET
FT                   SEKRIKSLQYLGSYIARAKKLSRTQIVFVASYLTSWLNRYVIEREEEVNQPGGMDRFKH
FT                   FYAAFQALCYIFCFRHKDLRDVDGSWECELDKFFTRMVISKFNPLKYCNENVMLMFARI
FT                   AQEEDVAYCFSIIENNNNELLRGIMGKADSSRGGTPTPMGPATSWSLATRQQFIDLQSY
FT                   FPYDPLFLKNYKNMMKEYYIEWSEAGGEYESDGSDE"
FT   gene            <563163..>564308
FT                   /locus_tag="CAGL0M05225g"
FT                   /old_locus_tag="CAGL-IPF7191"
FT                   /old_locus_tag="CAGL-CDS2891.1"
FT   CDS_pept        563163..564308
FT                   /locus_tag="CAGL0M05225g"
FT                   /old_locus_tag="CAGL-IPF7191"
FT                   /old_locus_tag="CAGL-CDS2891.1"
FT                   /note="highly similar to uniprot|P38127 Saccharomyces
FT                   cerevisiae YBR192w RIM2 mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05225g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62549"
FT                   /db_xref="GOA:Q6FJM1"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM1"
FT                   /protein_id="CAG62549.1"
FT                   /translation="MPKRTLEEWEEDAMESVPYLASDEKGSNYREATQPVILEDSKIVQ
FT                   PKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNT
FT                   TRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGT
FT                   TKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSY
FT                   DCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTM
FT                   TTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVI
FT                   IKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI"
FT   gene            complement(<564780..>565481)
FT                   /locus_tag="CAGL0M05247g"
FT                   /old_locus_tag="CAGL-IPF7190"
FT                   /old_locus_tag="CAGL-CDS4142.1"
FT   CDS_pept        complement(564780..565481)
FT                   /locus_tag="CAGL0M05247g"
FT                   /old_locus_tag="CAGL-IPF7190"
FT                   /old_locus_tag="CAGL-CDS4142.1"
FT                   /note="similar to uniprot|P38304 Saccharomyces cerevisiae
FT                   YBR193c MED8 transcriptional regulation mediator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05247g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62550"
FT                   /db_xref="GOA:Q6FJM0"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJM0"
FT                   /inference="similar to AA sequence:UniProtKB:P38304"
FT                   /protein_id="CAG62550.1"
FT                   /translation="MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDDL
FT                   SRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLTTL
FT                   LRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEKRES
FT                   NGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLSTNNE
FT                   QSGDKDIIMAD"
FT   gene            <565772..>566170
FT                   /locus_tag="CAGL0M05269g"
FT                   /old_locus_tag="CAGL-IPF7189"
FT                   /old_locus_tag="CAGL-CDS5023.1"
FT   CDS_pept        565772..566170
FT                   /locus_tag="CAGL0M05269g"
FT                   /old_locus_tag="CAGL-IPF7189"
FT                   /old_locus_tag="CAGL-CDS5023.1"
FT                   /note="similar to uniprot|P38305 Saccharomyces cerevisiae
FT                   YBR194w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05269g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62551"
FT                   /db_xref="GOA:Q6FJL9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL9"
FT                   /inference="similar to AA sequence:UniProtKB:P38305"
FT                   /protein_id="CAG62551.1"
FT                   /translation="MVHSDNNIIKDPKRNGEKPVEMILNGNRKESKRYNEQLSSLEERK
FT                   QKKKLKVVQEDSAYMDQSANQTSSAGLDKDTNELGPKSIFYDPDWNPKGEAPDGFRNVP
FT                   YNPKTFKRLHNQIEEDLGSLSGKLKYPE"
FT   gene            complement(<566250..>567509)
FT                   /locus_tag="CAGL0M05291g"
FT                   /old_locus_tag="CAGL-IPF7188"
FT                   /old_locus_tag="CAGL-CDS2646.1"
FT   CDS_pept        complement(566250..567509)
FT                   /locus_tag="CAGL0M05291g"
FT                   /old_locus_tag="CAGL-IPF7188"
FT                   /old_locus_tag="CAGL-CDS2646.1"
FT                   /note="similar to uniprot|P13712 Saccharomyces cerevisiae
FT                   YBR195c MSI1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05291g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62552"
FT                   /db_xref="GOA:Q6FJL8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL8"
FT                   /inference="similar to AA sequence:UniProtKB:P13712"
FT                   /protein_id="CAG62552.1"
FT                   /translation="MDADNIEDIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTK
FT                   WPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMD
FT                   EMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTK
FT                   HGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIW
FT                   DVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEK
FT                   EVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQEPISTMQHGSSIS
FT                   TIEWNPNIGVVFASAGQEDGLVKLWDASVGKEIFVHGGHMLGVNDISWDMHDPWLMASV
FT                   SNDNTIQIWRPAKNIVSKPS"
FT   gene            complement(<567906..>568646)
FT                   /locus_tag="CAGL0M05313g"
FT                   /old_locus_tag="CAGL-IPF7187"
FT                   /old_locus_tag="CAGL-CDS4042.1"
FT   CDS_pept        complement(567906..568646)
FT                   /locus_tag="CAGL0M05313g"
FT                   /old_locus_tag="CAGL-IPF7187"
FT                   /old_locus_tag="CAGL-CDS4042.1"
FT                   /note="weakly similar to uniprot|P38306 Saccharomyces
FT                   cerevisiae YBR197c or uniprot|Q02831 Saccharomyces
FT                   cerevisiae YPL077c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05313g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62553"
FT                   /db_xref="GOA:Q6FJL7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL7"
FT                   /protein_id="CAG62553.1"
FT                   /translation="MDIEFGSPLKPSKSEDLERAAKQPEDVKNEFHAPVKSFPDLKNIA
FT                   AEADAAMVADLKKKLKGKTKKLKHKDKDRAKRIDQPTLSTATSYSTIHGFSNRRGNMED
FT                   QTSSHRSGSPPFFNNSLSSRGDLQSRQSHKPDSKWTEIDMLDDVRRMAKDKFFEGGFPE
FT                   EFEENLTKNRMSQAKLFQIMRDRNEKLAKTKRRTIRASHVDTRSQSHVEDEGMEPFDQD
FT                   ELESTKQEEKAYVKEIIDTISSLR"
FT   gene            complement(<569132..>571552)
FT                   /locus_tag="CAGL0M05335g"
FT                   /old_locus_tag="CAGL-IPF7186"
FT                   /old_locus_tag="CAGL-CDS0797.1"
FT   CDS_pept        complement(569132..571552)
FT                   /locus_tag="CAGL0M05335g"
FT                   /old_locus_tag="CAGL-IPF7186"
FT                   /old_locus_tag="CAGL-CDS0797.1"
FT                   /note="similar to uniprot|P38129 Saccharomyces cerevisiae
FT                   YBR198c Transcription initiation factor TFIID 90"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05335g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62554"
FT                   /db_xref="GOA:Q6FJL6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037264"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL6"
FT                   /inference="similar to AA sequence:UniProtKB:P38129"
FT                   /protein_id="CAG62554.1"
FT                   /translation="MSGKEKDQKNVKGAAAGAKSGAKAPANGSRPSGQFSASDLNRIVL
FT                   EYLNKKGYHRTEAMLRAESSRTATPVNKNSPANTKDGSLPEPSTVPPAQDANAKPVSNP
FT                   VDSASAKRDASGEVVLKDKVRQDMSPEHYIRAYTMLKNWVDSSLDIYRSELSYIMYPVF
FT                   IYLFLYLVSKDPIYARRFFDKFSSDFRVKHGSEINRLFSVNSVDHIKENEVAKAFNGNR
FT                   YRVTISRAAFYLMLYFLTDNEGVGGSLIIGIINDHIQPNVMDTVRSKDRISDGVEIAAD
FT                   TAGTDGLAEINNAPVTLGPFPKDEEFVKEIETELKIKDDQEKKQIEQSKKGDGSKEGSV
FT                   ASEDVAKEPTADLDDTNDRPTLLQEYRKMNGDESSATPQEESDAAADKQDGKSGDSTKV
FT                   KSEDKKTAVAVVKTEEVAAMMSSPSKDTLPLPPKTALDIKIEIQKVKESRDAIKLDNLQ
FT                   AALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQF
FT                   DRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH
FT                   PVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTG
FT                   SSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRI
FT                   KQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDI
FT                   TASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLALAGGAIRE"
FT   gene            <572309..>573982
FT                   /locus_tag="CAGL0M05357g"
FT                   /old_locus_tag="CAGL-IPF7183"
FT                   /old_locus_tag="CAGL-CDS1731.1"
FT   CDS_pept        572309..573982
FT                   /locus_tag="CAGL0M05357g"
FT                   /old_locus_tag="CAGL-IPF7183"
FT                   /old_locus_tag="CAGL-CDS1731.1"
FT                   /note="similar to uniprot|P29366 Saccharomyces cerevisiae
FT                   YBR200w BEM1 bud emergence mediator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05357g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62555"
FT                   /db_xref="GOA:Q6FJL5"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR030507"
FT                   /db_xref="InterPro:IPR035549"
FT                   /db_xref="InterPro:IPR035550"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL5"
FT                   /inference="similar to AA sequence:UniProtKB:P29366"
FT                   /protein_id="CAG62555.1"
FT                   /translation="MLKNFKLGKEKHSRITSADISTPRQDGNNVIKHVKTVPVQVLNQR
FT                   STPSRHASNSSRPQMQSPEKVIKARDSYKAKRANELSFNKGEFFYVTGEDTSYYKASDP
FT                   SAGKNGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDE
FT                   LDTFVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIIDIGTGYATGNDVKEDIA
FT                   SVNLPTVQEWKSNIAKYKASNINLGAVEVPPNGEFGTRQKIQQQIMEEERLRQQQIEAQ
FT                   MTPKVPEPPEIIYASVDAYGLENEKYWYTVSCILDNGRARRLKRYYQDFYDLQVQLLDA
FT                   FPAESGKLRDANGNWTRRIMPYIPGPVPYVTDTITKKRREDLNIYVADLIRLPKYITSS
FT                   RMIQNIFRVKNNGYDTEFDKKDASIHTDNSSTHSKSRTSKIHDKDSTLTGEELNLYEKM
FT                   SELSVSTPGSRPHSRPPSSLPPQLKSIKVKFYYKDDIFALMLPQHISLDELKNKIGPRI
FT                   DTEDFILNIKLKDGLGEEIKTDDQVSYIIQSKQKIAVTDA"
FT   gene            <574752..>575390
FT                   /locus_tag="CAGL0M05379g"
FT                   /old_locus_tag="CAGL-IPF7182"
FT                   /old_locus_tag="CAGL-CDS4336.1"
FT   CDS_pept        574752..575390
FT                   /locus_tag="CAGL0M05379g"
FT                   /old_locus_tag="CAGL-IPF7182"
FT                   /old_locus_tag="CAGL-CDS4336.1"
FT                   /note="highly similar to uniprot|P38307 Saccharomyces
FT                   cerevisiae YBR201w DER1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05379g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62556"
FT                   /db_xref="GOA:Q6FJL4"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL4"
FT                   /protein_id="CAG62556.1"
FT                   /translation="MDAVLLNIVNDVPVVTRYWTMGCIAVSALVRFNMINSIKMLYSYE
FT                   IVFQKGHYERILYSLFDYGLFNWMSLMNIVIAANHLSFLENSFSLKRRYVWILFLTLCS
FT                   LLGMSYFGQPVASLGVLLQENLSYYYLKKNNEQMNIRLFGNIAVSPLLVPFYLNCLLLF
FT                   VYHMDVVEVAMFFLPGHIMFYMDDMLKRIYGVDLTKTPYDWWLGLKETQ"
FT   gene            complement(<575740..>575952)
FT                   /locus_tag="CAGL0M05401g"
FT                   /old_locus_tag="CAGL-IPF7181"
FT   CDS_pept        complement(575740..575952)
FT                   /locus_tag="CAGL0M05401g"
FT                   /old_locus_tag="CAGL-IPF7181"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05401g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62557"
FT                   /db_xref="GOA:Q6FJL3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL3"
FT                   /protein_id="CAG62557.1"
FT                   /translation="MSLLKFSANQKLQTALQFTYLGLCLVGPFMMPAKQANTGFLALSK
FT                   SLLSEDHMNSHSLVKGKRHPRAYFR"
FT   gene            <577097..>579535
FT                   /locus_tag="CAGL0M05423g"
FT                   /old_locus_tag="CAGL-IPF7178"
FT                   /old_locus_tag="CAGL-CDS0781.1"
FT   CDS_pept        577097..579535
FT                   /locus_tag="CAGL0M05423g"
FT                   /old_locus_tag="CAGL-IPF7178"
FT                   /old_locus_tag="CAGL-CDS0781.1"
FT                   /note="highly similar to uniprot|P38132 Saccharomyces
FT                   cerevisiae YBR202w CDC47"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05423g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62558"
FT                   /db_xref="GOA:Q6FJL2"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL2"
FT                   /protein_id="CAG62558.1"
FT                   /translation="MSTALPSIQLSVDYQTLLSEISDFLQHFKVDEVGAADDSATIDAD
FT                   VNIDDAEELMKRGPKYMYLLQQIANRERDTIEIELNDVLRFQNEKFLEGGVAQDLVALI
FT                   QKNANHFIDLFSRCIDSVMPLPTKEISYKDDVLDVILNQRRLRNERMLSDRTNEIRSEM
FT                   DTDTTSNDIMRELAQDETETFPANLTRRYTVYFRPLTRSYAVRYNSKKYLTGSIPLSVR
FT                   QIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTSR
FT                   ECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG
FT                   DIVDIAGIFLPSPYTGFKALKAGLLTETYLEAHHVRQHKKKFASFQMTPQVRSNVDALA
FT                   QSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINICLMGDPGV
FT                   AKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCI
FT                   DEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLE
FT                   NINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVHMYNKQPDLDFEPIEPTMMREF
FT                   IAYARTMRPVMTAEINDHVVSAYIRLRQDSKREMDSKFSFGQATPRTLLAIIRLSQALA
FT                   KLRLSETVDIDDVEEALRLIRVSKESLYQENRKRDEDSNPTTKIFTIIKKMSQEGDYKG
FT                   SLPYDSIVKTVRSRGFTMLQLNNCIQEYSFLNVWHLINEGNTLKFVDDEDQSSQDIEMA
FT                   "
FT   gene            <580648..>583446
FT                   /locus_tag="CAGL0M05445g"
FT                   /old_locus_tag="CAGL-IPF7177"
FT                   /old_locus_tag="CAGL-CDS0550.1"
FT   CDS_pept        580648..583446
FT                   /locus_tag="CAGL0M05445g"
FT                   /old_locus_tag="CAGL-IPF7177"
FT                   /old_locus_tag="CAGL-CDS0550.1"
FT                   /note="similar to uniprot|P38308 Saccharomyces cerevisiae
FT                   YBR203w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05445g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62559"
FT                   /db_xref="GOA:Q6FJL1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL1"
FT                   /inference="similar to AA sequence:UniProtKB:P38308"
FT                   /protein_id="CAG62559.1"
FT                   /translation="MQSVNIVSTNYSRYGVSVYDRLYRKDKNVSAKHRPSSTGVYGHDA
FT                   STVDHASRSNNNLNLTRSTSAISESDDVATISTNNSRRSVIKRKYKSLITASSKKLITK
FT                   LYEHGSNSDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKEISDLPDEVLRNILSN
FT                   VKDDQRTLVNCLYVNKAFYNATKPTLYERPKFTSTYRVAQFVTSIRTNPQNGLYVRELD
FT                   LSKLKNGSLNGKSTSNTGVVADSPDVDEYNPMRTRTGSVTSFTSVTSTANSNTALSITT
FT                   NNKDVALAGWRDWRYRHDPLYSSPVLNSYNAKRTVSRAPSIKSSHSSSSLTLFPGLKSK
FT                   ESFAQLSEGKSSDNGNNGKRQRSNSSVSSITNSLMSSLYNGSHISLNTTLSGSDNNSSK
FT                   TQSKGKSSSSPGNPNDSSGEQDSIISSSSQIDTNTFGMTSSKSTSSTSNWFRMKLHGNG
FT                   TRKLRLRSNKAISSKKDEQQNEESAQTAQKIETPIIKRTEPFSTPHPYTNKFLLKYAQY
FT                   KDLPLGYILHILDHCPYLYILDLSNLTLCTDFEIIEGRRYKGRKQRFGSSRALPVVQES
FT                   VISTDVPNDLDVIYLTDSSKTYEYYDRLRNTNKHKRSSSSNNLWSIPNQGWSDAPAPIG
FT                   SHKNDLRRTHSQTIGRSNVELRKLNASEIFEHIATNQKSAYNTHLRVYMKNVLWCTQDM
FT                   VKSFVLENFDQQAENLGEDKSSEMFIHDMNFSFENSGLNRNFVWTCEGNLQEFIAMVVL
FT                   DEVNRKDDLEIENLFNIKAERILTPTNGPERAPEVHYISNVFTVSYGFQSNKKREMKFR
FT                   VTILKTDTPMYFSIKKLADDYTSVVIKLQTNKNVALHGSETADIITTDQGSVLPEDVPE
FT                   DNNADDTNNGENTIAQPFSNDPKERIERITQEIVARLKDLRGSDLRRNIGENNYVRERF
FT                   LL"
FT   gene            complement(<583722..>584786)
FT                   /locus_tag="CAGL0M05467g"
FT                   /old_locus_tag="CAGL-IPF7175"
FT                   /old_locus_tag="CAGL-CDS3123.1"
FT   CDS_pept        complement(583722..584786)
FT                   /locus_tag="CAGL0M05467g"
FT                   /old_locus_tag="CAGL-IPF7175"
FT                   /old_locus_tag="CAGL-CDS3123.1"
FT                   /note="weakly similar to uniprot|P38139 Saccharomyces
FT                   cerevisiae YBR204c peroxisomal serine-active lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05467g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62560"
FT                   /db_xref="GOA:Q6FJL0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL0"
FT                   /protein_id="CAG62560.1"
FT                   /translation="MEVLREACSLEGELVNGRVDDILAKYEQVPQRELSRVIDSRDFEV
FT                   RFLKERTRVVTLDGIDMRCFDNIRDGERRDSVFLLIHGLGGSMDQFQPLMKLLTLLKYR
FT                   VIALDLPGFGQSGSSTNGYDMLYVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIASHF
FT                   VQMYHEEYNIDKLVLTCPPPPSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVWFDQSKG
FT                   LNSSGIMNFFSANTETFQDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFLGWKFPDWE
FT                   DLDNIINTNNVELVVIYAEHDKITPKQDAQLIFDAFKNVAATKKKLLEITNCGHNIFFN
FT                   CPEKACKLFQEQVF"
FT   gene            <585392..>586672
FT                   /locus_tag="CAGL0M05489g"
FT                   /old_locus_tag="CAGL-IPF7173"
FT                   /old_locus_tag="CAGL-CDS2598.1"
FT   CDS_pept        585392..586672
FT                   /locus_tag="CAGL0M05489g"
FT                   /old_locus_tag="CAGL-IPF7173"
FT                   /old_locus_tag="CAGL-CDS2598.1"
FT                   /note="similar to uniprot|P38130 Saccharomyces cerevisiae
FT                   YBR205w KTR3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05489g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62561"
FT                   /db_xref="GOA:Q6FJK9"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK9"
FT                   /inference="similar to AA sequence:UniProtKB:P38130"
FT                   /protein_id="CAG62561.1"
FT                   /translation="MGAVKKKLMPKSAMFVRKYEKTIRVGFASFLMALTVLFLMHKPDA
FT                   GTTAMAPQQTMAGFTSVVKNGQPGYVIPASDLLQDVKEHPLDDGVKEKAAFITLARNGD
FT                   LWSLVNTIRHVEDRLNHRYHYDWVFLNDKGFTDEFIRLTSALVSGKAKYGKVPKEHWEV
FT                   PSHIDKEKYEISRRKMVLDKVPYGDSTPYRHMCRYQSGLFYRHELVQEYDYYWRVDTDI
FT                   TVFCNFQYDIFKFLRQNKKKYGFVISLTEYEETIPTLWATVKEFMKKYPQHIHKNNFLN
FT                   FISDDGGETYNGCHFWTNFEVGDLNFWRSQAYTDFFNFLDQKGGFYYERWGDAPVHSIA
FT                   AALLLDKDEIHFFDGFGYHHPDFQSCPHEEEVRLQNKCTCNFSKDKIWMTYYFCNLRYF
FT                   EAKEIGLPPKIEANLDEEYKKKLKVSS"
FT   gene            <587202..>588509
FT                   /locus_tag="CAGL0M05511g"
FT                   /old_locus_tag="CAGL-IPF7172"
FT                   /old_locus_tag="CAGL-CDS2516.1"
FT   CDS_pept        587202..588509
FT                   /locus_tag="CAGL0M05511g"
FT                   /old_locus_tag="CAGL-IPF7172"
FT                   /old_locus_tag="CAGL-CDS2516.1"
FT                   /note="similar to uniprot|P38310 Saccharomyces cerevisiae
FT                   YBR207w FTH1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05511g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62562"
FT                   /db_xref="GOA:Q6FJK8"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK8"
FT                   /inference="similar to AA sequence:UniProtKB:P38310"
FT                   /protein_id="CAG62562.1"
FT                   /translation="MAFEDYFSFQVFFIFLRESLEIAVIISILLTIVKQGLSVGDDSED
FT                   TGNQISHGIDDGIPINDVNAERIPLTVEEEEEAFNIEGESMVPSTDESLSYADNLKLYK
FT                   KLKIQIVSGGALGLIICAFIGGAFIAVFYHIGTDLWTMSEHYYEGILSLVASVIISVMG
FT                   LFFLRMGKLREKFRVKLASIIYSDRGGMISKVNSSKAVSFSEKYAFFILPFVTSLREGL
FT                   EAVVFIGGVGLDQPMSAIMVSMACAVCISGVFGVFFFRYSSSLSLKICLVVTTCFMYLI
FT                   ASGLFSKGVWQLELQDYVNKCNGQDMSEVGSGPGSYDISRSVWHVNCCNGETDGGWMIL
FT                   TAIFGWTNSATYGSVLSYIIYWLILIGCLKLLTLEEQYGYIPGLPVSWQKKRIIKRLKI
FT                   AHASLKLKQNIGSTSMSNGVQSQRVSKDSTTPLISH"
FT   gene            complement(<588667..>594171)
FT                   /locus_tag="CAGL0M05533g"
FT                   /old_locus_tag="CAGL-IPF7171"
FT                   /old_locus_tag="CAGL-CDS0049.1"
FT   CDS_pept        complement(588667..594171)
FT                   /locus_tag="CAGL0M05533g"
FT                   /old_locus_tag="CAGL-IPF7171"
FT                   /old_locus_tag="CAGL-CDS0049.1"
FT                   /note="similar to uniprot|P32528 Saccharomyces cerevisiae
FT                   YBR208c DUR1 urea amidolyase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05533g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62563"
FT                   /db_xref="GOA:Q6FJK7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK7"
FT                   /inference="similar to AA sequence:UniProtKB:P32528"
FT                   /protein_id="CAG62563.1"
FT                   /translation="MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPE
FT                   DPAWISVATESLLEQQWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYM
FT                   PTRDSTVVELLKQAGAIIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSA
FT                   SVVARGIVPIALGTDTAGSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSM
FT                   NLSDAEKCLKIMTKLDIENDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYD
FT                   RAIDNFKQLGAQIKIIDFEPLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVY
FT                   GIIKSATKFDAADAFEYEYKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILV
FT                   NSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYP
FT                   SGTRPYGMFLDRYVGLKDDSLEGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFIC
FT                   STKTAKKYELYALPKNGPVLKPGLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLG
FT                   IGSVELENGKWVKSFICEESGYNSTGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLV
FT                   ANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKI
FT                   ISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKS
FT                   AGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVK
FT                   HQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPA
FT                   PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEM
FT                   VTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFP
FT                   NDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYL
FT                   KSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTIQDYPGRVNYWRIGVPPCGP
FT                   MDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSIAGGEVCCKLDEKKIPMFE
FT                   PISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFTMGNLGGFNGRALKRGDV
FT                   LSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLAGPHGAPDIFESEGMME
FT                   FFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDYVYSLGAINFTGDEPV
FT                   IITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSARNLKENQDVIINDM
FT                   SSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYILIEYGDDIFELNLC
FT                   YRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLIAYEEQLPQEKNW
FT                   SVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNNLTHDDIRQLIY
FT                   TTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGGSYMCIYAADS
FT                   PGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTDEWDNGNYKI
FT                   DVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQTTTEVIEQ
FT                   NILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFL
FT                   FKNGDMVDAGDPVAIIQCL"
FT   gene            complement(<595677..>595748)
FT                   /gene="tRNA-Cys (GCA)"
FT                   /locus_tag="CAGL0M05555r"
FT   tRNA            complement(595677..595748)
FT                   /gene="tRNA-Cys (GCA)"
FT                   /locus_tag="CAGL0M05555r"
FT                   /product="transfer RNA-Cys"
FT   gene            complement(<596196..>597707)
FT                   /locus_tag="CAGL0M05577g"
FT                   /old_locus_tag="CAGL-IPF7168"
FT                   /old_locus_tag="CAGL-CDS2062.1"
FT   CDS_pept        complement(596196..597707)
FT                   /locus_tag="CAGL0M05577g"
FT                   /old_locus_tag="CAGL-IPF7168"
FT                   /old_locus_tag="CAGL-CDS2062.1"
FT                   /note="some similarities with uniprot|P38289 Saccharomyces
FT                   cerevisiae YBR163w DEM1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05577g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62564"
FT                   /db_xref="GOA:Q6FJK6"
FT                   /db_xref="InterPro:IPR016610"
FT                   /db_xref="InterPro:IPR019190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJK6"
FT                   /protein_id="CAG62564.1"
FT                   /translation="MTLRDVEKLRLWRLKIFRNQQPILRAKPPHASRKTQYLFQKIDNV
FT                   KSQFGTDGKGDLLWQRDGMNPYHDLYDPGDLKTHRLSVTKLLTKSWCELRFAYDLYSRL
FT                   PLFREAHLAAGERTHQKLENSEHTPVIRPQDIPQFSETVEIVEDDLHVLAASWAETITR
FT                   LIHLFSSGDAREILCHGYLNKETNQLYDPMETEVWDPSQHILISGIIDHLTLTSKNGNL
FT                   PLNNHHRSIDDSIAKLKNTRNEFAKNGLTIQISDVKTRTRKFIPPQESVQNATKLQLMY
FT                   YRHFLLSLGTDSDNTYEMLLYNARIRGVDVDQPLNPANCLLIMIQMDGFVGDFVKLQNG
FT                   DGFQFPKFDNAPISHSFTLADAKHHQFLQNINSHELAGQLLNGTFAKPITLRYFAMRLA
FT                   QMYSMLTPLISEKLKVEYYHNNECFQEVEFVNDKKSLGESCRSASSFWFGKRAIEPVEA
FT                   TTFNYNQYCKHCDYRDHCAWIKDSLAKSTKLGDELTQIARRIHNI"
FT   gene            complement(<598033..>598227)
FT                   /locus_tag="CAGL0M05593g"
FT                   /old_locus_tag="CAGL-IPF14261"
FT   CDS_pept        complement(598033..598227)
FT                   /locus_tag="CAGL0M05593g"
FT                   /old_locus_tag="CAGL-IPF14261"
FT                   /note="highly similar to uniprot|P38374 Saccharomyces
FT                   cerevisiae YBR162wa YSY6"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05593g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58074"
FT                   /db_xref="GOA:B4UN58"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN58"
FT                   /protein_id="CAR58074.1"
FT                   /translation="MAVQTPKQRLANEKFNKNVEKQRKFGKKKQDKQKTELPISKSWVY
FT                   FILFLLIGGGVLELFSLLF"
FT   gene            <599520..>600860
FT                   /locus_tag="CAGL0M05599g"
FT                   /old_locus_tag="CAGL-IPF7164"
FT                   /old_locus_tag="CAGL-CDS2435.1"
FT   CDS_pept        599520..600860
FT                   /locus_tag="CAGL0M05599g"
FT                   /old_locus_tag="CAGL-IPF7164"
FT                   /old_locus_tag="CAGL-CDS2435.1"
FT                   /note="similar to uniprot|P38288 Saccharomyces cerevisiae
FT                   YBR162c TOS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05599g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62565"
FT                   /db_xref="GOA:Q6FJK5"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK5"
FT                   /inference="similar to AA sequence:UniProtKB:P38288"
FT                   /protein_id="CAG62565.1"
FT                   /translation="MFQLLTLLLPLVSKVSADCQMIAGNYYCSKTDAAIYSNVGFSGSY
FT                   QDVTSMDEQSCVCSQQPFSFGGALAPFDEELSVHFRGPLKLSQFAVYYPASSNSKRAVA
FT                   EEDCDSVVAKPVHKHKRDVAVEVIEVTETVFIDENGNTVTASGTSTSMSTPTPSNPSQV
FT                   QSSQAPSQAPVSSSNKGTTTLSSTSKNTPSSSSSFQAASSSAAPIQDGGDWSRVAYFSP
FT                   GTASGCTFMNHQGGTAGSGVWSSCFGNSISFANSDGVTGAGSPQPLGDVTIKSGQEYMI
FT                   FSSTQCSANNAECGYYREGIPAYKGFGGNRKIFYFEFSMPSDTNGNGYNQDMPAIWLLN
FT                   AKIPRTLQYGLSTCSCWATGCGELDLFEVLSPGSDKMITHIHDGQGGGTQDFFQRPTDG
FT                   IFRAVVIFNASDKTIHLVQVDSAPAGGLSNDQVQQWLNKAGSAAALP"
FT   gene            complement(<601941..>603266)
FT                   /locus_tag="CAGL0M05621g"
FT                   /old_locus_tag="CAGL-IPF7163"
FT                   /old_locus_tag="CAGL-CDS2468.1"
FT   CDS_pept        complement(601941..603266)
FT                   /locus_tag="CAGL0M05621g"
FT                   /old_locus_tag="CAGL-IPF7163"
FT                   /old_locus_tag="CAGL-CDS2468.1"
FT                   /note="similar to uniprot|P33300 Saccharomyces cerevisiae
FT                   YPL057c SUR1 or uniprot|P38287 Saccharomyces cerevisiae
FT                   YBR161w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05621g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62566"
FT                   /db_xref="GOA:Q6FJK4"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK4"
FT                   /inference="similar to AA sequence:UniProtKB:P33300"
FT                   /protein_id="CAG62566.1"
FT                   /translation="MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFELN
FT                   PPRDRVTGLEVHDGKPELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTDEM
FT                   ALKFIKEEYAWFLDTFENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVP
FT                   AFVRKTSPLGVSNNVMGSVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFVSVIW
FT                   KQYKRWGVPENGVVRIMQPADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHILSCVVA
FT                   GFIVGFIILYGEYVFYCWLCASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQGHGSIFL
FT                   GTSISPLRKLNKSLFSTLYTKLVPSSSSSSASACSVSEKYSTPKLSRSVAEYYSLRKEN
FT                   SVHFNSPTPKGKRSRKDSNVRFTNFLLSDIEKLDPNVEDLTN"
FT   gene            <603919..>604449
FT                   /locus_tag="CAGL0M05643g"
FT                   /old_locus_tag="CAGL-IPF7160"
FT                   /old_locus_tag="CAGL-CDS4628.1"
FT   CDS_pept        603919..604449
FT                   /locus_tag="CAGL0M05643g"
FT                   /old_locus_tag="CAGL-IPF7160"
FT                   /old_locus_tag="CAGL-CDS4628.1"
FT                   /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
FT                   YDL120w YFH1 regulates mitochondrial iron accumulation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05643g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62567"
FT                   /db_xref="GOA:Q6FJK3"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK3"
FT                   /inference="similar to AA sequence:UniProtKB:Q07540"
FT                   /protein_id="CAG62567.1"
FT                   /translation="MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNEG
FT                   GPAMTNGVQIPKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMS
FT                   LTVAGVGTYVINKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDA
FT                   LPNDAEFKVESDQ"
FT   gene            <604987..>605217
FT                   /locus_tag="CAGL0M05665g"
FT                   /old_locus_tag="CAGL-IPF7159"
FT                   /old_locus_tag="CAGL-CDS5733.1"
FT   CDS_pept        604987..605217
FT                   /locus_tag="CAGL0M05665g"
FT                   /old_locus_tag="CAGL-IPF7159"
FT                   /old_locus_tag="CAGL-CDS5733.1"
FT                   /note="similar to uniprot|P01095 Saccharomyces cerevisiae
FT                   YNL015w PBI2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05665g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62568"
FT                   /db_xref="GOA:Q6FJK2"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK2"
FT                   /inference="similar to AA sequence:UniProtKB:P01095"
FT                   /protein_id="CAG62568.1"
FT                   /translation="MANSFIVTLKKSVPEREVKEFIDSVNGVGGQIVHEFSLIKGYTIK
FT                   MPEKVSLSSFKDKHNNVIESVEEDKEVKIAK"
FT   gene            <605540..>606652
FT                   /locus_tag="CAGL0M05687g"
FT                   /old_locus_tag="CAGL-IPF7158"
FT                   /old_locus_tag="CAGL-CDS2985.1"
FT   CDS_pept        605540..606652
FT                   /locus_tag="CAGL0M05687g"
FT                   /old_locus_tag="CAGL-IPF7158"
FT                   /old_locus_tag="CAGL-CDS2985.1"
FT                   /note="similar to uniprot|P53164 Saccharomyces cerevisiae
FT                   YGL067w NPY1 NADH pyrophosphatase I of the Nudix family of
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05687g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62569"
FT                   /db_xref="GOA:Q6FJK1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK1"
FT                   /inference="similar to AA sequence:UniProtKB:P53164"
FT                   /protein_id="CAG62569.1"
FT                   /translation="MSTFFGDVGLNRVSFLREDTEFIKLAFTSSEAKFIVFVNGEAFYD
FT                   ISSDGKPQLHIETSTSLKGIITTLSPLLETKDLRVDVSGVSITFLGLDDRIDGFSYKGK
FT                   YKGAPYFGLEFKVDDKTLLTPKDIEFTTSLQRMDRESLFMIDNHSATLYSHAKMYLDWL
FT                   NKYKFCPGCGSVIYPVHGGTKLQCSSAPEVNCNVRNARVNNVCFPRSDPVIIIAMANED
FT                   YSKICLARSFRKHGNFVMYSTIAGFMEPGESIENACAREIWEETGVHCDVDNVKIISSQ
FT                   PWPYPANLMIGCLGIVKFNNKDEIIDLGNDPELMDAQWFDTNEVRAAMDSYKTGWLVPF
FT                   KDEINFPGETAIAHHLIRHVCKQHQRLQKL"
FT   gene            <607368..>608978
FT                   /locus_tag="CAGL0M05709g"
FT                   /old_locus_tag="CAGL-IPF7156"
FT                   /old_locus_tag="CAGL-CDS1863.1"
FT   CDS_pept        607368..608978
FT                   /locus_tag="CAGL0M05709g"
FT                   /old_locus_tag="CAGL-IPF7156"
FT                   /old_locus_tag="CAGL-CDS1863.1"
FT                   /note="similar to uniprot|P53165 Saccharomyces cerevisiae
FT                   YGL066w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05709g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62570"
FT                   /db_xref="GOA:Q6FJK0"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="InterPro:IPR037804"
FT                   /db_xref="InterPro:IPR041251"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK0"
FT                   /inference="similar to AA sequence:UniProtKB:P53165"
FT                   /protein_id="CAG62570.1"
FT                   /translation="MEVQAQIKGIKESYIRDLNSGTSWKDLIDVAKNNPQEYSSDINSE
FT                   TVSKYFEPNTRIIIDALDKQTNFRVCKGCGKPILLEAIVDHIENHCSNSRDQKEGTVGD
FT                   MDSFSESLINSPTNGSIDGSLQTKENLKRSLDNESSDIMSSPGKQDAKKMKSETPGNSN
FT                   RKPKKVKQRNPTDKHLIDFDKQCGVKLPEGGYCARSLTCKSHSMGDKRSVVGRTEPFDT
FT                   LLAEYHRKHQTKIGAAAEKRAKQQEMQKMQKQTQRDHKDQKKTTQTKTDKRKKASTTTN
FT                   KTVRGTGSNRGKNSSTQNTMNYPVLTPEEETTQVLNGVSRSFPLPLESRVLSSVRYRTK
FT                   YVRMREMFASAFSVKPGFSNPGYGAIHSRVGCIDIDRTTDYKYRIRTPQPVNQQGTQNL
FT                   TPQQIQKMQQQRMIQNQMLQQKQAQNAQQMGFNNNNNNNQNIGSPGANMVNSPSINNQD
FT                   QLLRQTKQTNSNDLNHIGGQHPIPNVQGPSSPENNLINGVGVGSPVNNPQSPGMGNLQM
FT                   GTQMVGKDSSPSQFGGRVN"
FT   gene            complement(<609160..>610536)
FT                   /locus_tag="CAGL0M05731g"
FT                   /old_locus_tag="CAGL-IPF7155"
FT                   /old_locus_tag="CAGL-CDS2331.1"
FT   CDS_pept        complement(609160..610536)
FT                   /locus_tag="CAGL0M05731g"
FT                   /old_locus_tag="CAGL-IPF7155"
FT                   /old_locus_tag="CAGL-CDS2331.1"
FT                   /note="similar to uniprot|P43636 Saccharomyces cerevisiae
FT                   YGL065c ALG2 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05731g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62571"
FT                   /db_xref="GOA:Q6FJJ9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR027054"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ9"
FT                   /inference="similar to AA sequence:UniProtKB:P43636"
FT                   /protein_id="CAG62571.1"
FT                   /translation="MVPAKKLKIAFVHPDLGIGGAERLVVDAALGLQEAGHEVIIYTSH
FT                   CDKTHCFEEVKNGTLKVEVFGDFLPTDLGKRFFIVFANLRQLYLTAKVVLSGRSKDKDV
FT                   FIIDQLSTCVPFFKLANNKVLFYCHFPDQLLAIRTNWIKSLYRIPFDLLEQFTMYCSDE
FT                   VVVNSNFTKSMYKKTFKYLQKNPNVIYPCVDTDTETLINDRDMQIGNLLVGKCPNFYLS
FT                   INRYERKKNIELAIQAFAKASVENTNLVVCGGYDPRIHENVQYLQELTCLCKELDLSYT
FT                   VNHYSDFIEDSYSVNEIEKLFGAKVIFLTSISSSLKEFLIQNMQLLLYTPSYEHFGIVP
FT                   LEAMKYGKPVLAVNNGGPVETVVSYQKEDNEKSTTGWLRSADADEWASALIESKEVLNQ
FT                   NPELFKNNGPKRVIELFSRKAMTQEFETNIKLALRHTSNISIIYVVSIIFAVLLKVFVF
FT                   "
FT   gene            complement(<610837..>612543)
FT                   /locus_tag="CAGL0M05753g"
FT                   /old_locus_tag="CAGL-IPF9103"
FT                   /old_locus_tag="CAGL-CDS1673.1"
FT   CDS_pept        complement(610837..612543)
FT                   /locus_tag="CAGL0M05753g"
FT                   /old_locus_tag="CAGL-IPF9103"
FT                   /old_locus_tag="CAGL-CDS1673.1"
FT                   /note="similar to uniprot|P53166 Saccharomyces cerevisiae
FT                   YGL064c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05753g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62572"
FT                   /db_xref="GOA:Q6FJJ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ8"
FT                   /inference="similar to AA sequence:UniProtKB:P53166"
FT                   /protein_id="CAG62572.1"
FT                   /translation="MVSILAIRTFNPLGHFVSTQCVRAYAINSVRAGSKSSSVRAGSKN
FT                   DTTRASSKKNKAGKSKLQLSARFKQNANKSQKADKFKSQKQFKYGLYGGLKENENKFLE
FT                   TNANLVEKITEFEELKLLPEVRKHVINLIKKDSLNTTEEIHPSPIQTIAIKRLSKNLME
FT                   PKLQVHAIAAETGSGKTMAYCAPLLDYLKRQEIETPEKWESIKDKAIIRSVILVPTLEL
FT                   VDQIYTTLTCIPDTLGIHVHKWTTGVDYQQLLENLKSRTDILITTPSKLLSLQRVRMIS
FT                   RADLILKRIEFVVLDEADTLLDKSWLEDTHKALKAMSDVNHLVLCSATIPNEFDRTMTK
FT                   MFPNAIPLTTPRLHKLPKGINFRIINAAVSPYKGSKIKALAQTLYAIAYDGTDPGFEKR
FT                   CIVFINEKKNVDNVVQKLRNEYGHDVVGLTGDMEGRTRLELIRPFISPPEKLTEQEKQI
FT                   DKDLNDQETVNISGSNISIGNIENSNKASNFIPKLRVLVTTDLLARGLNFKGVRNVILY
FT                   DVPITAIDLVHRAGRTARMRQSGRVFMIIDKKTQSWAKAVPTILKKNKALT"
FT   gene            complement(<612846..>613391)
FT                   /locus_tag="CAGL0M05775g"
FT                   /old_locus_tag="CAGL-IPF9101"
FT                   /old_locus_tag="CAGL-CDS4596.1"
FT   CDS_pept        complement(612846..613391)
FT                   /locus_tag="CAGL0M05775g"
FT                   /old_locus_tag="CAGL-IPF9101"
FT                   /old_locus_tag="CAGL-CDS4596.1"
FT                   /note="highly similar to uniprot|Q08962 Saccharomyces
FT                   cerevisiae YPL211w NIP7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05775g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62573"
FT                   /db_xref="GOA:Q6FJJ7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ7"
FT                   /protein_id="CAG62573.1"
FT                   /translation="MRQLTEEETKVVFEKLAGYIGRNIAYLVDNKEVPHVFRLQKDRVY
FT                   YVPEYIAKLATSVARQNLMSVGICLGKFTKTGKFRLHITALSVLAKHAKYKIWIKPNGE
FT                   MPFLYGNHVLKAHVGKMTDDIPEHAGLIVFSMNDMPLGFGVSAKSTLESKNLQPTAIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   gene            <613807..>614760
FT                   /locus_tag="CAGL0M05797g"
FT                   /old_locus_tag="CAGL-IPF9100"
FT                   /old_locus_tag="CAGL-CDS3442.1"
FT   CDS_pept        613807..614760
FT                   /locus_tag="CAGL0M05797g"
FT                   /old_locus_tag="CAGL-IPF9100"
FT                   /old_locus_tag="CAGL-CDS3442.1"
FT                   /note="similar to uniprot|P53167 Saccharomyces cerevisiae
FT                   YGL063w PUS2 pseudouridine synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05797g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62574"
FT                   /db_xref="GOA:Q6FJJ6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041708"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ6"
FT                   /inference="similar to AA sequence:UniProtKB:P53167"
FT                   /protein_id="CAG62574.1"
FT                   /translation="MALVLGYLGTGYQGIQYNPPAHTIDNELFKALVATNCISQSNSDD
FT                   FSKSSFSRATRTDKGVHALTNLVALKMQRYEVPQQVKAELNEILPDDIRIWDVVPVKKK
FT                   FNARVMAGTRHYRYVIPTFLLQCGPHSDLSTSQLARFKNIWNMFLGTHNYYNFTPRRKD
FT                   TNADSPQNMRHMYSIQVSDPFTIAGSTQWLSIAIHGQSFLLHQIRKMVHYALSEYHRSS
FT                   SDTKSMELLETVDPDLTSATALDTPTEQYIPLAPAAGLYLHHPTFEGYNNQPAARRLQV
FT                   LDLSGYPACATFEDRIHTEIARSEHVFHEYMAVIRQ"
FT   gene            <615435..>615635
FT                   /locus_tag="CAGL0M05819g"
FT                   /old_locus_tag="CAGL-IPF14251"
FT   CDS_pept        615435..615635
FT                   /locus_tag="CAGL0M05819g"
FT                   /old_locus_tag="CAGL-IPF14251"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05819g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62575"
FT                   /db_xref="GOA:Q6FJJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ5"
FT                   /protein_id="CAG62575.1"
FT                   /translation="MQCQLERERDFFHAFMEYLYASLSANIPIAWDLEMYWAMKCRRLV
FT                   RTILWINGSELDTEAIFLDLA"
FT   gene            <615972..>617207
FT                   /locus_tag="CAGL0M05841g"
FT                   /old_locus_tag="CAGL-IPF9096"
FT                   /old_locus_tag="CAGL-CDS2695.1"
FT   CDS_pept        615972..617207
FT                   /locus_tag="CAGL0M05841g"
FT                   /old_locus_tag="CAGL-IPF9096"
FT                   /old_locus_tag="CAGL-CDS2695.1"
FT                   /note="similar to uniprot|P33550 Saccharomyces cerevisiae
FT                   YKR061w KTR2 mannosyltransferase or uniprot|P26725
FT                   Saccharomyces cerevisiae YJL139c YUR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05841g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62576"
FT                   /db_xref="GOA:Q6FJJ4"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ4"
FT                   /inference="similar to AA sequence:UniProtKB:P33550"
FT                   /protein_id="CAG62576.1"
FT                   /translation="MKEWLIWVVEVFIWWGQLWFCGDIDRNYFERSVAVKTKYDGVRRR
FT                   EYFVPLKLATNSYDDMAVFTELEYSPKRENATLLMLVRNWELSGALASMRSLEDRFNRK
FT                   YNYDWVFLNDVPFDEDFMLATSAMASGMTYYGMVPPHEWSTPTWINEDQYAQCLRDMEG
FT                   SGVIYGGSRSYRNMCRFYSGFFYKQDLLKNYDYYMRVEPNVEYFCDFPYDPFKVMRANK
FT                   YKYGFLMSLYEYENTIPHLWHAVEDYINEYGHKLNFENNSYSFLVDKDHFSPNTMGIIE
FT                   SHTDYNLCHFWSNFEVGDLSFFRSKEYEEFFDFMDQKGGFYYERWGDAPIHTIAASLLL
FT                   NTSEVIHFDELGYRHEPYLSCPRSLGIQLQQRCLCDVNSDVNLDISLASCLPRWWRNGS
FT                   GKTFVKPKQFTD"
FT   gene            <617997..>618944
FT                   /locus_tag="CAGL0M05863g"
FT                   /old_locus_tag="CAGL-IPF9094"
FT                   /old_locus_tag="CAGL-CDS3467.1"
FT   CDS_pept        617997..618944
FT                   /locus_tag="CAGL0M05863g"
FT                   /old_locus_tag="CAGL-IPF9094"
FT                   /old_locus_tag="CAGL-CDS3467.1"
FT                   /note="highly similar to uniprot|P36145 Saccharomyces
FT                   cerevisiae YKR062w TFA2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05863g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62577"
FT                   /db_xref="GOA:Q6FJJ3"
FT                   /db_xref="InterPro:IPR003166"
FT                   /db_xref="InterPro:IPR016656"
FT                   /db_xref="InterPro:IPR040501"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ3"
FT                   /protein_id="CAG62577.1"
FT                   /translation="MSKSNPLLANLKAFKSKVKSAPVLGVPRSNSNSRANSNTSVNNSD
FT                   NIVEIKDEDDTSATPKKRNRAATEDEVDLIDDDSDYDSSPSKRVKPGSLAAAALQASQA
FT                   DISKSHDSSKLLWATEYIQKKGKPVPLTELMDYLSMKRDDKVIGLLKKLERIEFDEKKS
FT                   TFKYLSTYDVHSAQELLTLLKNQVTFKGISFKDLKDGWPQCEETINDLEEESQILVLRT
FT                   KKDKTPRYVWYNRGGNLNCIDEEFVKVWENVQLPQFTELPRKLQELGLKPASIDPSSVK
FT                   RQTTRVEVKKKRNRRGKITNTHMAGILKDYSNKA"
FT   gene            complement(<620069..>621535)
FT                   /locus_tag="CAGL0M05885g"
FT                   /old_locus_tag="CAGL-IPF9092"
FT                   /old_locus_tag="CAGL-CDS2135.1"
FT   CDS_pept        complement(620069..621535)
FT                   /locus_tag="CAGL0M05885g"
FT                   /old_locus_tag="CAGL-IPF9092"
FT                   /old_locus_tag="CAGL-CDS2135.1"
FT                   /note="similar to uniprot|P36146 Saccharomyces cerevisiae
FT                   YKR063c LAS1 involved in cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05885g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62578"
FT                   /db_xref="GOA:Q6FJJ2"
FT                   /db_xref="InterPro:IPR007174"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ2"
FT                   /inference="similar to AA sequence:UniProtKB:P36146"
FT                   /protein_id="CAG62578.1"
FT                   /translation="MSHGRVVPWKDEKELDELKQWFYSVSDGNDLRLKAISRVKSYKLK
FT                   GSQYLPHVIDSTAQLTSAILADEKHGGSDDLFDKMNIRMTYTMAMIRFVNGVLDPSQQT
FT                   QFAIPLHTIARNVGLPSWFVDLRHWGTHERDLPNIDMLRMAAKDALQWLWKNYWDNDEL
FT                   DDSLNEDDALDEETIRQQEYLDRLRLKIELWKNNNTELRDNCNIWLEEKNSIISSDNFV
FT                   VDDGGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSLLVRKL
FT                   PGFDLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRFSKWIVLEKELLSPLVSLLNIRS
FT                   RISELSELFNPDMTFMQFKLLSLLVKKLEEDIGNHNWRRKKRRKDNNDTTAKLNDTQRQ
FT                   WNQLVADYLKSHVMLEEEKQFSMYGAKAKAVVKKAKEASVHNNELSDDLQKLKQRLLNL
FT                   KSKESVKPPSIETFNWDSHDDWQPKPFGIL"
FT   gene            <622029..>624704
FT                   /locus_tag="CAGL0M05907g"
FT                   /old_locus_tag="CAGL-IPF9089"
FT                   /old_locus_tag="CAGL-CDS0616.1"
FT   CDS_pept        622029..624704
FT                   /locus_tag="CAGL0M05907g"
FT                   /old_locus_tag="CAGL-IPF9089"
FT                   /old_locus_tag="CAGL-CDS0616.1"
FT                   /note="similar to uniprot|P36023 Saccharomyces cerevisiae
FT                   YKR064w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05907g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62579"
FT                   /db_xref="GOA:Q6FJJ1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ1"
FT                   /inference="similar to AA sequence:UniProtKB:P36023"
FT                   /protein_id="CAG62579.1"
FT                   /translation="MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDT
FT                   CTYLNDVPIGKKNNVPNTQVTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEINNN
FT                   IWGRNSPIFPDSSDHSPPTQVFGDGPNLKPKVIGHCRYSGENQYINMVPKGYLIEVKRS
FT                   SVTRYAMWTSTSVEYRDPYLSCMLMFKKGAVKATTEQMKKKMKFKNLPNSFALFTAFDN
FT                   ADDGKDKPNLNHAKIFNKFAEYRQQKSIGDLSEDHILDTKDLPRRQAVENCVLMFAKFH
FT                   LCPLLPLFNLPHLMEEVKIFYDNVEKTGKVSTKNGDNWIYCIILLLTKICKLAICMSNI
FT                   PGDDVSPIAQLDTTRFIPLVHKYIMNHNLFRKCTLHQLQVLLLLRFYNWCAPEDGDGQQ
FT                   GQQNSILMGMIISSAKELGIGWDLFTPGFPVGIDISDGSRPSAQHMNAEEYTTLYQKIW
FT                   CYILFWDRKMLLVNGQNCIIQRSRDTDYSLLEATFSKEDGSEFFRYFIHLDSLLLEIND
FT                   LISSNPTKVNITALNNCMTSLEEEFRNIHTIVNSREILQSNDDPRFFEVSWNIKIARAC
FT                   ILHAEVVSYEKECDFVRCHYAIQKLWEIVLSMCSDCMEYWSQRSEAFLGSLNNFYTNRI
FT                   VEIAADRLVHFVKAIILRLHRFHNVKAEDKQILVQFMHKFCSLYFTNFGREYFRCFKSL
FT                   FNLKMDYRVLSYSSVKDPWTVMLTFILHEMSYGEQPEGKLSLRDRLPLIAKLHDKLSYM
FT                   PSSFKNHDLILDAWQTSIYPICRYDEHFQLNLYISEIKKLDEHYKIDKDKNLFESFYNN
FT                   EVKLFGEEFGTQESCNSAFQKDSSEPPQETITLDEWGTLSGPYEGNDILLASETDSKAL
FT                   RYNDQLIQEIFNPKDFLPFL"
FT   gene            complement(<624997..>625557)
FT                   /locus_tag="CAGL0M05929g"
FT                   /old_locus_tag="CAGL-IPF9088"
FT                   /old_locus_tag="CAGL-CDS4552.1"
FT   CDS_pept        complement(624997..625557)
FT                   /locus_tag="CAGL0M05929g"
FT                   /old_locus_tag="CAGL-IPF9088"
FT                   /old_locus_tag="CAGL-CDS4552.1"
FT                   /note="some similarities with uniprot|P36147 Saccharomyces
FT                   cerevisiae YKR065c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05929g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62580"
FT                   /db_xref="GOA:Q6FJJ0"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ0"
FT                   /protein_id="CAG62580.1"
FT                   /translation="MLSITQGIVRRSVARPGLIRPLVKCNARYYSDKPEDSLTWTDFFQ
FT                   LRKQERRINVGSSVFTALVGANVSWAYLSTMEIDPTQMIFGFDPLVVVTAGLMASGALG
FT                   YLMGPAVGSQVFKLTKGNKLAQYNLKNKEFLKHVIQNRVDASSQSFSNPVPDYYGEKIG
FT                   SVKEYRQWLRDCHAYAKKAKEFL"
FT   gene            <626330..>626719
FT                   /locus_tag="CAGL0M05951g"
FT                   /old_locus_tag="CAGL-IPF9087"
FT                   /old_locus_tag="CAGL-CDS5064.1"
FT   CDS_pept        626330..626719
FT                   /locus_tag="CAGL0M05951g"
FT                   /old_locus_tag="CAGL-IPF9087"
FT                   /old_locus_tag="CAGL-CDS5064.1"
FT                   /note="similar to uniprot|P36141 Saccharomyces cerevisiae
FT                   YKR049c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05951g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62581"
FT                   /db_xref="GOA:Q6FJI9"
FT                   /db_xref="InterPro:IPR012882"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI9"
FT                   /inference="similar to AA sequence:UniProtKB:P36141"
FT                   /protein_id="CAG62581.1"
FT                   /translation="MSMFRTLQRQPRTISLFTHDLENSRPCLSILEYLKSHTTNRFDLE
FT                   LSTKFPTLDQVHYMNAINPMILRAQIPHLTKIMKLKSYDPLFGSQLSDCVTKGFWNKEA
FT                   PLWVDWEKKALGTDLQSIKELLEKD"
FT   gene            <627289..>628521
FT                   /locus_tag="CAGL0M05973g"
FT                   /old_locus_tag="CAGL-IPF9086"
FT                   /old_locus_tag="CAGL-CDS2702.1"
FT   CDS_pept        627289..628521
FT                   /locus_tag="CAGL0M05973g"
FT                   /old_locus_tag="CAGL-IPF9086"
FT                   /old_locus_tag="CAGL-CDS2702.1"
FT                   /note="highly similar to uniprot|P25293 Saccharomyces
FT                   cerevisiae YKR048c NAP1 nucleosome assembly protein I"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05973g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62582"
FT                   /db_xref="GOA:Q6FJI8"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI8"
FT                   /protein_id="CAG62582.1"
FT                   /translation="MSAPIKTKPKSSMKIDNAPTPHNTPASVLNNSYLKNGNPVGKSKP
FT                   PPTISEEDIQTALSSQQPLLLGAIQEKLGSLVGQDSGYVDSLPQVVRNRIFALKKLQSD
FT                   LFGIEKDFQVELFELEHKYLQKYAPLHARRSEIISGKQEPTSEEVAAGKEIQEKEEGEE
FT                   EEGEKPTDIQLTEEDIKGIPSFWLTALENLPIVSDTITDRDAEVLEYLQDVSIEYLTEG
FT                   KPGFLLKFKFSEENPYFKTPELTKTYYYQSELGYSGDFIYDHADGCSIDWVDNDSNVTI
FT                   AVEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKMAGDEEDEEDLEDLEERLALDYSI
FT                   GEQIKDKLIPRAVDWFTGAALEFEFNDAPEDEFDEFEDEDEDEDEDEEEDEDERDDFAN
FT                   KKEEPPECKQS"
FT   gene            <629453..>630400
FT                   /locus_tag="CAGL0M05995g"
FT                   /old_locus_tag="CAGL-IPF9085"
FT                   /old_locus_tag="CAGL-CDS3466.1"
FT   CDS_pept        629453..630400
FT                   /locus_tag="CAGL0M05995g"
FT                   /old_locus_tag="CAGL-IPF9085"
FT                   /old_locus_tag="CAGL-CDS3466.1"
FT                   /note="similar to uniprot|P36139 Saccharomyces cerevisiae
FT                   YKR046c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M05995g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62583"
FT                   /db_xref="GOA:Q6FJI7"
FT                   /db_xref="InterPro:IPR035294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI7"
FT                   /inference="similar to AA sequence:UniProtKB:P36139"
FT                   /protein_id="CAG62583.1"
FT                   /translation="MTEGNYAEVASNGQEKKVAKEELHSSLVTYSSPTLQHLHRYPVVD
FT                   KLIKRAVSVPVVSKAIAVSLLAVTGLKHKVWDSGKFPAVAKPVVSSSFKLLHKFDELVN
FT                   LLVFSEGIDALFYAAKEHKNRPGVWLVWFLLDYFANVFNIILKEFVLKPFKLGNVAIKD
FT                   ASDATHKVTDVKELPHVSELSDTTKRLSQDLQSKVSESYIQPTKESAMQKYDTYIKPTA
FT                   EKLHNVYAGNAKEKIDTYVKPKYDSYVKPGYDTAKETYKTITATYEQKLNKTESIPRAI
FT                   VDTGYEVGVTTIGKLRGSTPPKEQQRPQTTEVSS"
FT   gene            complement(<630670..>632010)
FT                   /locus_tag="CAGL0M06017g"
FT                   /old_locus_tag="CAGL-IPF6121"
FT                   /old_locus_tag="CAGL-CDS2432.1"
FT   CDS_pept        complement(630670..632010)
FT                   /locus_tag="CAGL0M06017g"
FT                   /old_locus_tag="CAGL-IPF6121"
FT                   /old_locus_tag="CAGL-CDS2432.1"
FT                   /note="highly similar to uniprot|P20049 Saccharomyces
FT                   cerevisiae YBR166c TYR1 prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06017g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62584"
FT                   /db_xref="GOA:Q6FJI6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012385"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI6"
FT                   /protein_id="CAG62584.1"
FT                   /translation="MMEEQWQANKVIGIIGLGDMGLLYATKFSSAGWKVVACDREELFD
FT                   SLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGGQT
FT                   SCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIESLVS
FT                   CLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGLENVK
FT                   VNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTERLNKAK
FT                   EFVFGNHTGLLLLDDTIFEKYSLSKDSASSDSKESTSLPNSHLSLLAIVDSWHQLGINP
FT                   YDHMICSTPLFRIFLGVSEFLFLSPDLLEKTIDAAIDDHSFRRDDLEFVVAAREWSSIV
FT                   TFGNFDLYKRQFEDVQKFFEPMLPEANQIGNEMIKTILMHSQDSKEA"
FT   gene            complement(<632430..>632798)
FT                   /locus_tag="CAGL0M06039g"
FT                   /old_locus_tag="CAGL-IPF6122"
FT                   /old_locus_tag="CAGL-CDS5155.1"
FT   CDS_pept        complement(632430..632798)
FT                   /locus_tag="CAGL0M06039g"
FT                   /old_locus_tag="CAGL-IPF6122"
FT                   /old_locus_tag="CAGL-CDS5155.1"
FT                   /note="similar to uniprot|P38291 Saccharomyces cerevisiae
FT                   YBR167c POP7 nuclear RNase P subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06039g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62585"
FT                   /db_xref="GOA:Q6FJI5"
FT                   /db_xref="InterPro:IPR014612"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI5"
FT                   /inference="similar to AA sequence:UniProtKB:P38291"
FT                   /protein_id="CAG62585.1"
FT                   /translation="MAEKLVRKLPTVKTMSHKKIKSTMYVKSGTPFKSATKRIDKLLNQ
FT                   CQRYVTVLGMGHSVTKTLAIATTYQEKLHKVQVMTKTIEVLDEVVEDTESIDDSDSDIE
FT                   TKLKKRLLSGVEVRIFKV"
FT   gene            <633324..>634628
FT                   /locus_tag="CAGL0M06061g"
FT                   /old_locus_tag="CAGL-IPF6123"
FT                   /old_locus_tag="CAGL-CDS2521.1"
FT   CDS_pept        633324..634628
FT                   /locus_tag="CAGL0M06061g"
FT                   /old_locus_tag="CAGL-IPF6123"
FT                   /old_locus_tag="CAGL-CDS2521.1"
FT                   /note="weakly similar to uniprot|P38292 Saccharomyces
FT                   cerevisiae YBR168w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06061g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62586"
FT                   /db_xref="GOA:Q6FJI4"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="InterPro:IPR029953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI4"
FT                   /protein_id="CAG62586.1"
FT                   /translation="MAYHAKFINSHGQKPSLTLVTPVMLSMSLAKIYPLLIIADAALDN
FT                   LMWICEDPNLPFLYVVLTYLSLSLYSWSWEYPVAGSQMANIILLWLELSSGVFLLFAAS
FT                   YFISSVYYNISTSEPPTVDDIILNLESLLDKLETLRNEIMFRRWFKKPISKVKMLQIFV
FT                   RLVLVLTPVHYVLMKVITVHNYSKLLILFALFYHSDWMQVVLRLCWRLLIVRRFYFRVF
FT                   NYIFGDEYTLLGNNSKFGLKTLNLQHIMHLTSNCYLQIPLPLNAVTKMKENHLLEILLL
FT                   RYLNKNSKALENDDNIIKEFDSKTTADVVPKENTTDESATTSYNSSKVKIKEIVVFENQ
FT                   RKWKYKGWISKMLPYERPQFTTNCNNKYNDPGAYITESPEQLDLQVPPDWSWIEKEWTV
FT                   SSWVYSDTDWNVTGTMDSLEGYTRSRIWKRKMFTL"
FT   gene            complement(<634963..>637047)
FT                   /locus_tag="CAGL0M06083g"
FT                   /old_locus_tag="CAGL-IPF6125"
FT                   /old_locus_tag="CAGL-CDS1116.1"
FT   CDS_pept        complement(634963..637047)
FT                   /locus_tag="CAGL0M06083g"
FT                   /old_locus_tag="CAGL-IPF6125"
FT                   /old_locus_tag="CAGL-CDS1116.1"
FT                   /note="highly similar to uniprot|P32589 Saccharomyces
FT                   cerevisiae YPL106c SSE1 or uniprot|P32590 Saccharomyces
FT                   cerevisiae YBR169c SSE2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06083g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62587"
FT                   /db_xref="GOA:Q6FJI3"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI3"
FT                   /protein_id="CAG62587.1"
FT                   /translation="MSTPFGLDFGNDNSVLAVARNRGIDIVVNEVSNRSTPSMVGFGQK
FT                   NRFLGESAKTKQTSNIKNTVGNLKRILGLDYDHPDFQEESKFFTSKLVKLEDGKIGTQV
FT                   RFAGESTTFSATQLNAMFINKVKQTVETETKANITDVCIAVPTWYTEEQRYAAADAARI
FT                   AGLNPVRIVNDITAAGVSYGVFKTDLPEGEEKPRIVAFIDIGHSSYTCSIMAFKKGELK
FT                   VLGTAWDKNFGGRNFDRAITEHFADEFKTKYKIDIRENPKAYNRVMTSAERLKKVLSAN
FT                   TAAPFSVENVMNDVDASSQLSREELEELVKPMLERVTEPVTKALAQAGLTKDDVDFVEI
FT                   IGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPFKFEDIHQ
FT                   FSVSYKWDKQVEDEDHLEVFPANSNFPSTKLITLHRSGDFSMEANYTNKEELPPHLDAN
FT                   IAKWDITGVQIPEGETSVPVKLKLRCDPSGLHIIEEAYSLEDIVVKEEVPLPEDAPEDA
FT                   VPEVKEVTKTVKKDTLEITAHTFTLADDKLNTLIEKENDMTAQDRLVAETEDRKNNLEE
FT                   YIYTLRGKLDEEYSDFASDAEKTKLKDMLAKAEEWLYEDGFDTIKAKYIAKYEELAAIG
FT                   NVIRGRYLAKEEEKKQALRAKQEAANLAALSEKLAAQRSADSEAKKDATPEGDAQMDLD
FT                   "
FT   gene            complement(<637479..>639221)
FT                   /locus_tag="CAGL0M06105g"
FT                   /old_locus_tag="CAGL-IPF6127"
FT                   /old_locus_tag="CAGL-CDS1614.1"
FT   CDS_pept        complement(637479..639221)
FT                   /locus_tag="CAGL0M06105g"
FT                   /old_locus_tag="CAGL-IPF6127"
FT                   /old_locus_tag="CAGL-CDS1614.1"
FT                   /note="similar to uniprot|P33755 Saccharomyces cerevisiae
FT                   YBR170c NPL4 nuclear protein localization factor and ER
FT                   translocation component"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06105g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62588"
FT                   /db_xref="GOA:Q6FJI2"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR016563"
FT                   /db_xref="InterPro:IPR024682"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI2"
FT                   /inference="similar to AA sequence:UniProtKB:P33755"
FT                   /protein_id="CAG62588.1"
FT                   /translation="MIIRFRSPVGMHRVRCEGSETLGQVLPQLQTILNEHGITPRAIEL
FT                   GKEANGKDKTNVESLLEKTIEALGFRHGDIVYVHYQVDSSETKGSANDNNGSVAVNIPN
FT                   NLVPGKSQKADELEVDKELEKLDGLIPRQKTKLCKHGDRGMCEYCSPLPPWDANYANEN
FT                   NIKHISFHAYLKKLNESTNKRESGSSYIAPLSQPNFKINKHCTNGHEPWPKGICSKCQP
FT                   SAITLQQQEFRMVDHVEFQSSELINQFIEFWRASGTQRFAYLYGKYEKYDATPLGIKAC
FT                   VHAIYEPPQHDEQDGITMDMEQVTQELNTIDLLAKEMGLLRVGMIFSDLTDAGNGDGTV
FT                   LCKRHKDSFFLSSLETIMAAQHQTRHPNVSKFSEQGIFSSKFVTCVVSGNLKEEIDIAS
FT                   YQVSIDAEALVSADMIGGSTHPSMAYINDTTEDRYVPEIFYMKKNEYGLTVKENAKPAF
FT                   PVDYLIVSLTHGFPKDEDTTTQLFNSVTGFPWSNRQAMGYSQDYHELKRYLHSTAASGN
FT                   FNDLHDKLANFHLLLYIHSLQILSQEEWELLVKGALSQDYQEPLYKLSASPGWQTLLMI
FT                   IESA"
FT   gene            <640057..>640749
FT                   /locus_tag="CAGL0M06127g"
FT                   /old_locus_tag="CAGL-IPF6128"
FT                   /old_locus_tag="CAGL-CDS4168.1"
FT   CDS_pept        640057..640749
FT                   /locus_tag="CAGL0M06127g"
FT                   /old_locus_tag="CAGL-IPF6128"
FT                   /old_locus_tag="CAGL-CDS4168.1"
FT                   /note="similar to uniprot|P33754 Saccharomyces cerevisiae
FT                   YBR171w SEC66 ER protein-translocation complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06127g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62589"
FT                   /db_xref="GOA:Q6FJI1"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI1"
FT                   /inference="similar to AA sequence:UniProtKB:P33754"
FT                   /protein_id="CAG62589.1"
FT                   /translation="MDQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGTFFEEPQVEMK
FT                   AVSFYTPLLYVSLLVISLFIFASQYRKNKIKKISELPSIFDESDAKDLYMDLLKLQKSG
FT                   DKKIHEKVLKAGLLNRCAEAIRRSLKLKEMAPQVEILYKNGSIGDDYWQRYQTEVKLVD
FT                   VEFKECIQESERLQPGWVPTFVPLAREICLNQALSRRYNAIATRREVCIEEWGLKLDKD
FT                   GKLISSKN"
FT   gene            complement(<640964..>642556)
FT                   /locus_tag="CAGL0M06149g"
FT                   /old_locus_tag="CAGL-IPF6129"
FT                   /old_locus_tag="CAGL-CDS1904.1"
FT   CDS_pept        complement(640964..642556)
FT                   /locus_tag="CAGL0M06149g"
FT                   /old_locus_tag="CAGL-IPF6129"
FT                   /old_locus_tag="CAGL-CDS1904.1"
FT                   /note="weakly similar to uniprot|P32909 Saccharomyces
FT                   cerevisiae YBR172c SMY2 kinesin-related protein and weakly
FT                   similar to uniprot|Q02875 Saccharomyces cerevisiae YPL105c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06149g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62590"
FT                   /db_xref="GOA:Q6FJI0"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI0"
FT                   /protein_id="CAG62590.1"
FT                   /translation="MDFSSSQKYIQTQTLLDNINGLQNLHVQDREGSKNNLTYAKNAAS
FT                   DVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSAHSSGNLNDLHAELSSPFYNIPT
FT                   IQNTTDMFDSHSHVSKTPLSIHQDVGTPTPTNKNSKVMETYGFVNTFLSPPVWRYIDIQ
FT                   GNTQGPFSSSDMTGWYLQGYFQPTLQLFRDSTSHDNSNSTSQMCNQLITLMDILNHTQN
FT                   YQDPFNKFDEMLMTKTPVTEMVNPIPNHINNNAVTLAEECSNKDVNIESQIVESSIQKE
FT                   DVQAIASKHNAIENTTLEKPKLPSLMESHTNSINNLNNTTKESSTTISIGGSNLNKQKS
FT                   FTSSNQSQLRNDEKYNGENTTRNSSNKWSEIAKKNAPQNNPVAPVQKKTIAVQKTSLTT
FT                   AKSTEIDEKKTLLSATEPISIVNEDPQLSVDEFFFWCRKQIKLNDGHSLKDVLELILSL
FT                   PTDSESESIISETIYASSDTMDGRRFTKEFNQKRRECEKSNSGIQLTELVSSYITDEDD
FT                   WDFQVVNRKGKKN"
FT   gene            complement(<643102..>643542)
FT                   /locus_tag="CAGL0M06171g"
FT                   /old_locus_tag="CAGL-IPF6130"
FT                   /old_locus_tag="CAGL-CDS4877.1"
FT   CDS_pept        complement(643102..643542)
FT                   /locus_tag="CAGL0M06171g"
FT                   /old_locus_tag="CAGL-IPF6130"
FT                   /old_locus_tag="CAGL-CDS4877.1"
FT                   /note="similar to uniprot|P38293 Saccharomyces cerevisiae
FT                   YBR173c UMP1 proteasome maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06171g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62591"
FT                   /db_xref="GOA:Q6FJH9"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH9"
FT                   /inference="similar to AA sequence:UniProtKB:P38293"
FT                   /protein_id="CAG62591.1"
FT                   /translation="MSIVPKGHQDRVSTSQGVTSNAASLPDTLRMQEGGAVPLSSQLND
FT                   RHPLMHRVQNWEETQHRRQLEQYRNIFGLAEPMRRMMEIGIVDATDFNPVSQGQSSIHR
FT                   DILMNKETSVDWEDIYPENNGLLSGNMVGDDVHTQIERKVGI"
FT   gene            <643917..>644867
FT                   /locus_tag="CAGL0M06193g"
FT                   /old_locus_tag="CAGL-IPF6131"
FT                   /old_locus_tag="CAGL-CDS3447.1"
FT   CDS_pept        643917..644867
FT                   /locus_tag="CAGL0M06193g"
FT                   /old_locus_tag="CAGL-IPF6131"
FT                   /old_locus_tag="CAGL-CDS3447.1"
FT                   /note="similar to uniprot|P38123 Saccharomyces cerevisiae
FT                   YBR175w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06193g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62592"
FT                   /db_xref="GOA:Q6FJH8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH8"
FT                   /inference="similar to AA sequence:UniProtKB:P38123"
FT                   /protein_id="CAG62592.1"
FT                   /translation="MMEVLKQIEIPGGGPSTCGVFSRDGQWLAVVRGIEVYIYETSGYQ
FT                   LRETLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCY
FT                   NNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLI
FT                   RIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKIWDSVSGD
FT                   VVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCWDSNTKAELQVLKIE
FT                   ECDSAIISIDCHNNLMCSLSLAGNCTIWKYVTETT"
FT   gene            <645200..>646153
FT                   /locus_tag="CAGL0M06215g"
FT                   /old_locus_tag="CAGL-IPF6132"
FT                   /old_locus_tag="CAGL-CDS3438.1"
FT   CDS_pept        645200..646153
FT                   /locus_tag="CAGL0M06215g"
FT                   /old_locus_tag="CAGL-IPF6132"
FT                   /old_locus_tag="CAGL-CDS3438.1"
FT                   /note="similar to uniprot|P38122 Saccharomyces cerevisiae
FT                   YBR176w ECM31"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06215g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62593"
FT                   /db_xref="GOA:Q6FJH7"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH7"
FT                   /inference="similar to AA sequence:UniProtKB:P38122"
FT                   /protein_id="CAG62593.1"
FT                   /translation="MMMLNRLKCLGKGPLRFYSVHSDTAGATKTILDLQRKYVERKPLT
FT                   MCTAYDFITASWVQKADTDILLIGDSMGMTSLGYDSTSSLTLDEFKYHVKSVCRAEGPS
FT                   FIVSDMPFGSFETSISQGIQTAIDLMRSSSKVKSMKIESGSCHSDHHTYKLIGELCSRG
FT                   IPVMGHIGLTPQRQHSLGGFKVQANKSVQEIHDLLASAKKLEELGCWGIVLECIPQRVA
FT                   GFITKALSIPTIGIGAGNQTSGQVLVVSDLLGFLDSTPPKFVKEYDNLGQRAIDSIKAY
FT                   NSDVTTKAFPETGKHNFKIKEDIWNQFLSEVKVDKT"
FT   gene            complement(<646413..>647774)
FT                   /locus_tag="CAGL0M06237g"
FT                   /old_locus_tag="CAGL-IPF6134"
FT                   /old_locus_tag="CAGL-CDS2364.1"
FT   CDS_pept        complement(646413..647774)
FT                   /locus_tag="CAGL0M06237g"
FT                   /old_locus_tag="CAGL-IPF6134"
FT                   /old_locus_tag="CAGL-CDS2364.1"
FT                   /note="highly similar to uniprot|P38295 Saccharomyces
FT                   cerevisiae YBR177c EHT1 or uniprot|Q02891 Saccharomyces
FT                   cerevisiae YPL095c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06237g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62594"
FT                   /db_xref="GOA:Q6FJH6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH6"
FT                   /protein_id="CAG62594.1"
FT                   /translation="MSVNTWPLINPFNWGYNGTIKHVTHDEGTVKLQLKNGEEPLQFEE
FT                   FLNKYVPELKNDAKFKLNPALFTGILQTMYLGSADYSREFQVFYGREIVKFSDGGVCTV
FT                   DYVMKDWENEYKLNETTKKFDVEKFKQDEADTHAEGWPRLQPRTRYLRDNELQEVHSDD
FT                   RPLVLVLHGLAGGSHEPVIRSLTQQLSRIGGGKFQVAVLNSRGCARSKITTRSLFTAFH
FT                   TGDTREFLQRVRNHHPNKKIYAVGFSFGATMLANYLGEEGENTPLSAACTLSNPWDMVM
FT                   SSVKTSNDWWSKNLFSANITQFLVRLVKVNMGELEVPEGTEPDHPPTVKNPSYYNFTKS
FT                   NLQKAFKFKTIADFDSTYTAPCLGFKSAMDYYKSASSINRLPNIKIPLLSINARDDPVV
FT                   GPEGVPFDLMKQNPHVVHCETDIGGHLAYLDLEWKPWVTKEIAQYFNVFDDHVE"
FT   gene            complement(<648689..>651244)
FT                   /locus_tag="CAGL0M06259g"
FT                   /old_locus_tag="CAGL-IPF6136"
FT                   /old_locus_tag="CAGL-CDS0686.1"
FT   CDS_pept        complement(648689..651244)
FT                   /locus_tag="CAGL0M06259g"
FT                   /old_locus_tag="CAGL-IPF6136"
FT                   /old_locus_tag="CAGL-CDS0686.1"
FT                   /note="similar to uniprot|P38297 Saccharomyces cerevisiae
FT                   YBR179c FZO1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06259g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62595"
FT                   /db_xref="GOA:Q6FJH5"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH5"
FT                   /inference="similar to AA sequence:UniProtKB:P38297"
FT                   /protein_id="CAG62595.1"
FT                   /translation="MSKQINFKGNGNKEEEEDPAKEILESLNNDDSYDSFVTPPPSQLT
FT                   YSRNDGQLILDEQDQDLSASHHRRASNENMLSAQLSQWTYNNNRATLQKAISHVSDLLD
FT                   KIDQENEERPMFLIQEDDVNKLNVLQPHLKLEGTYTVKHDKSFNLDKAALAKLFHSQVQ
FT                   VAKKHLSSLKIRLDDMSSKVFITGDVNTGKSAFCNSLLRRRLLPEDQLPCTNVFCEILE
FT                   SRDNNNLEEVHAIPLRLATTVKDVPAIYDIHNRTTYDIFPLSSLPELVQRNDKYVLLKI
FT                   YIKDDKVSPEKSLLRNGIVDISLMDSPGLNIDSLQTAEVMAKQEEIDLVIFVVNAENQL
FT                   TLSAKEFISLASTEKKFMFFVVKKFDKIRDKQRCKDLILKQIKDLSPESHKRANEFVHF
FT                   ISSPESDINSPRAGNGPDGDPDPGDDGGEYNSADPDFDHLQSSIRNFVLKKRSLSKLLP
FT                   VKTYIAKLLTDAEIISKANLKLFEEEDKQLDKELQELEPVLNEAQNKTGYLTMKIEHIA
FT                   ENAIYSCYEFTKSQINSSLELTYDELPSYQGVSRIHDFVFSTEQCIRDKIKSNVISSEQ
FT                   FARMQTEKTVNELESLGKQELGDEFMKERSFQSDLMFTKRIHTVSKKINVRMSIMDFFA
FT                   PSWSSFVSYIGWSLSVPLLTSGESQNTADKTGAVVKKTVPGILGLKEYPLVQYFSRPSL
FT                   LFTSRLPTMAIYSVGGSKLMSNIAYNGLRLTSVNSLKKIASPLLILASLLGVAYLIHDL
FT                   PRALPLNLLRKYKRKLKELDFVHQNAERISREVRVVLKVPIREIYTSCEAVVEKKRAIK
FT                   REIEDKRASNALSMTFFNRLLAKSQTQLTIVQNINLDID"
FT   gene            <651932..>653560
FT                   /locus_tag="CAGL0M06281g"
FT                   /old_locus_tag="CAGL-IPF6139"
FT                   /old_locus_tag="CAGL-CDS1824.1"
FT   CDS_pept        651932..653560
FT                   /locus_tag="CAGL0M06281g"
FT                   /old_locus_tag="CAGL-IPF6139"
FT                   /old_locus_tag="CAGL-CDS1824.1"
FT                   /note="similar to uniprot|P38125 Saccharomyces cerevisiae
FT                   YBR180w DTR1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06281g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62596"
FT                   /db_xref="GOA:Q6FJH4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH4"
FT                   /inference="similar to AA sequence:UniProtKB:P38125"
FT                   /protein_id="CAG62596.1"
FT                   /translation="MSTSSNTSGECSPFSITDSIVVQATDDNADKILQEVDLSDPNIDK
FT                   NDTFELRQQVSIKESPLYYLRDIPYSAYTSFQVSLIFLIVIYNGFLGPLAGNVFIPALP
FT                   LLQKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILYIISISLMVIINILLA
FT                   SVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGPNLGPILAP
FT                   IIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQWENWSQNEND
FT                   MSTQPVDFSSPISRWSFVSDIGFLNPITQDSIFKGLYPHPPKFSVWTYLRIMTFPPVIL
FT                   TSIANALLFCTYYSISVTLSHFLATEYSYSNLKIGACYVCPGVCMLLGSQIGGHLSDSM
FT                   RKSWKKENYNTEYPLEFRLILTVCGVLLAIGGSIGYGWCIQFHYHISAVLVFAGLMAFG
FT                   LTWCNNTIMTYLSELLSLRVSSAIAVSSFFRNIAAAISSALIAKLCQKMGIGFCFLGLG
FT                   LINLVSLFSILVLINNRNKWVKDSF"
FT   gene            complement(<654006..>655506)
FT                   /locus_tag="CAGL0M06303g"
FT                   /old_locus_tag="CAGL-IPF6141"
FT                   /old_locus_tag="CAGL-CDS4125.1"
FT   CDS_pept        complement(join(654006..654710,655501..655506))
FT                   /locus_tag="CAGL0M06303g"
FT                   /old_locus_tag="CAGL-IPF6141"
FT                   /old_locus_tag="CAGL-CDS4125.1"
FT                   /note="highly similar to uniprot|P02365 Saccharomyces
FT                   cerevisiae YPL090c RPS10B or uniprot|P02365 Saccharomyces
FT                   cerevisiae YBR181c RPS101"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06303g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62597"
FT                   /db_xref="GOA:Q6FJH3"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH3"
FT                   /protein_id="CAG62597.1"
FT                   /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDEF
FT                   KGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGP
FT                   DLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRREVT
FT                   KGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAERKAE
FT                   KAETRKRRASSLKA"
FT   gene            complement(<657290..>659269)
FT                   /locus_tag="CAGL0M06325g"
FT                   /old_locus_tag="CAGL-IPF6144"
FT                   /old_locus_tag="CAGL-CDS1238.1"
FT   CDS_pept        complement(657290..659269)
FT                   /locus_tag="CAGL0M06325g"
FT                   /old_locus_tag="CAGL-IPF6144"
FT                   /old_locus_tag="CAGL-CDS1238.1"
FT                   /note="some similarities with uniprot|Q12224 Saccharomyces
FT                   cerevisiae YPL089c RLM1 or uniprot|P38128 Saccharomyces
FT                   cerevisiae YBR182c SMP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06325g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62598"
FT                   /db_xref="GOA:Q6FJH2"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH2"
FT                   /protein_id="CAG62598.1"
FT                   /translation="MGRRKIEIEPITDSKTRGITFLKRKAGIFKKAHELSVLCNVDVAV
FT                   VVLGANGTFYEFSSVEMDELLRYYTDQNGMGLLHIKTEPSAYGDGYKKTPTVKYQGTRH
FT                   LKRGRRLAKTKSVDLNQIRRASVGAPDNSTVNASSETNKKRQIKDEEGNGVDDDLNNAA
FT                   VKLRKLTHARHHSTGNSLLPQMDSNVKLGSLAFDSHERDSDLKLTRTRSFPFVGDISTE
FT                   KVTQTNEQLEKAAPKFIVNSPPGSLNRESSHSNYMRPATNFNMGRSSTNGSTSKKLKPI
FT                   LKLNIPIDNTNAANGVRNYSNQHASNSAENDLPKHIIRTPFQGSNFRVSPNVKHEGSYF
FT                   KNENIIDSENGNSKLTFSYGNDKNIKNQFRPPFFGSMKGNNSAGGSNNIAGSPTNQYLI
FT                   TPLQQMNPNRVPLYKGAATTNSGSSLSTSLNMNGEVSTPNTANGNTASQRQLFGAFYSS
FT                   GADSGKLHKNDKPNMFSNNQGDENDDVEGQDDVGQETRSENTSMAMNRNIMPATTPIGP
FT                   ESSSQPLKMGPDFLGSTNSPNTSTMLFPDWNLSATGTNFSGQNFLNSAGPKSGNIFGFP
FT                   PLANYPFVGTGYGNSSNNSNNNNNNNGNNTNSNSNNQSINGGNPSKISGSELSPYLPHL
FT                   HTPYPGKIFQFNNNDTNESYQASK"
FT   gene            <660288..>661232
FT                   /locus_tag="CAGL0M06347g"
FT                   /old_locus_tag="CAGL-IPF6150"
FT                   /old_locus_tag="CAGL-CDS3477.1"
FT   CDS_pept        660288..661232
FT                   /locus_tag="CAGL0M06347g"
FT                   /old_locus_tag="CAGL-IPF6150"
FT                   /old_locus_tag="CAGL-CDS3477.1"
FT                   /note="similar to uniprot|P38298 Saccharomyces cerevisiae
FT                   YBR183w YPC1 or uniprot|Q02896 Saccharomyces cerevisiae
FT                   YPL087w YDC1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06347g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62599"
FT                   /db_xref="GOA:Q6FJH1"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH1"
FT                   /inference="similar to AA sequence:UniProtKB:P38298"
FT                   /protein_id="CAG62599.1"
FT                   /translation="MIRWEYPQAQDGYWGEITSTIDWCEENYVVSHYVAEWSNTFTNSI
FT                   FISTALYTIYCTRRNKLELRFLLIGLAYCLVGVGSWLFHMTLKYHFQLLDELPMIYAMC
FT                   VPCWSLITELIATFTGPTKNKHSNGKTNTLSSVKQVVIASLILLTASTVTVVYLIVKNA
FT                   TIHQAFFGCLIGVVAFSSAYMVMTFVKDPQHKKNLHNSMMMGAIFFMSGYAVWLMDIHL
FT                   CKLWRFIRREYLLLPLGLLLELHGWWHVLTGLGIYYYIVCLQYLRLITTDRLQHYKLIW
FT                   RWGLLPELVPADYNIGTPYSLTFRGPREKAKPE"
FT   gene            complement(<661547..>663220)
FT                   /locus_tag="CAGL0M06369g"
FT                   /old_locus_tag="CAGL-IPF6151"
FT                   /old_locus_tag="CAGL-CDS1729.1"
FT   CDS_pept        complement(661547..663220)
FT                   /locus_tag="CAGL0M06369g"
FT                   /old_locus_tag="CAGL-IPF6151"
FT                   /old_locus_tag="CAGL-CDS1729.1"
FT                   /note="highly similar to uniprot|Q02908 Saccharomyces
FT                   cerevisiae YPL086c ELP3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06369g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62600"
FT                   /db_xref="GOA:Q6FJH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH0"
FT                   /protein_id="CAG62600.1"
FT                   /translation="MGRHGKGPKTNKQKLAPEKERFLQCCTDITLELTNSLTSGTTREI
FT                   NLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCK
FT                   PHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQ
FT                   LKQLGHSIDKVEYVVMGGTFMSLPKDYREDFIVKLHNALSGYNGNDIDEAIRYSQQSLT
FT                   KCVGITIETRPDYCTETHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKAVTETFA
FT                   IAKDAGYKVVSHMMPDLPNVGMERDLQQFKEYFENPAFRTDGLKIYPTLVIRGTGLYEL
FT                   WKTGRYKSYNANALVDLVARIMAMVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALAR
FT                   MKDLGVTSRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKQDILIG
FT                   LLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPLHSRDPKKFQHQGFGTLLMEEAE
FT                   RIAKEEHGSSKISVISGVGVRNYYAKLGYELDGPYMSKKI"
FT   gene            complement(<663660..>664514)
FT                   /locus_tag="CAGL0M06391g"
FT                   /old_locus_tag="CAGL-IPF6152"
FT                   /old_locus_tag="CAGL-CDS3723.1"
FT   CDS_pept        complement(663660..664514)
FT                   /locus_tag="CAGL0M06391g"
FT                   /old_locus_tag="CAGL-IPF6152"
FT                   /old_locus_tag="CAGL-CDS3723.1"
FT                   /note="similar to uniprot|P38300 Saccharomyces cerevisiae
FT                   YBR185c MBA1 respiratory chain assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06391g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62601"
FT                   /db_xref="GOA:Q6FJG9"
FT                   /db_xref="InterPro:IPR012483"
FT                   /db_xref="InterPro:IPR024621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG9"
FT                   /inference="similar to AA sequence:UniProtKB:P38300"
FT                   /protein_id="CAG62601.1"
FT                   /translation="MIVGYRGVVVRRVGVSRLANVYNTRLFSSGVKLLDEAEQKQDTKK
FT                   IQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRFQT
FT                   GIKPAFLLWKNKAIETYVQVNANFASKSVEKLKPEVSVWVEEALNARSKQIPDNVKLDW
FT                   QLLKFNDVPKLISIQPMMIPGRPLEHIQLLYRFNTKQRLVKLNKTNNKVEKLDRDVVDY
FT                   MVFLCDATTNDLILMGSVFESKPDAKLPKNYDDNTEKAVRRMKECGDIYRVPSSSENPQ
FT                   ITN"
FT   gene            <664851..>667517
FT                   /locus_tag="CAGL0M06413g"
FT                   /old_locus_tag="CAGL-IPF6154"
FT                   /old_locus_tag="CAGL-CDS0621.1"
FT   CDS_pept        664851..667517
FT                   /locus_tag="CAGL0M06413g"
FT                   /old_locus_tag="CAGL-IPF6154"
FT                   /old_locus_tag="CAGL-CDS0621.1"
FT                   /note="similar to uniprot|P48582 Saccharomyces cerevisiae
FT                   YPL084w BRO1 required for normal response to nutrient
FT                   limitation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06413g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62602"
FT                   /db_xref="GOA:Q6FJG8"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG8"
FT                   /inference="similar to AA sequence:UniProtKB:P48582"
FT                   /protein_id="CAG62602.1"
FT                   /translation="MKPSVIGLKCKDTDKVDWKRGLSSYLKRIYGSRQWKEFYDEQLCV
FT                   EMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIGQFKLEFTWYDAEYGLVSS
FT                   PTKHTQKTLVFEKSCTLYNLGVALTEVANEKINEDFKTAMVHMAKAMECFRYLSENFFN
FT                   SPSADLQTENTKFLSDLSHAEAQEMFLINAINNGTSEKQASLISKLAYSGSNLYENCWE
FT                   FLRTEEGGLTPYGEARWNSIVSGKHHFFRSLAAYYNALALEQNNKYGEAIAFLKLATQC
FT                   LSSSLPYKYALNDNFDFDGFGETIKDKTKQLIKDNDYIFHDSIPQSVSLSSIKALDAIK
FT                   APKWEEQLKPFMEAIAHKCEKLYRGIVPMEVFEKESIYSEKKASMLRQCINDSETADME
FT                   YSSFIEFTHLPNLLSDLKRRYKSQNFSGTTDPQGDMMRDQIQSWIKSISQSKYKDPDEQ
FT                   LKLISSKKQEILTLLAGLPSEQKENVVKLKMALVEAAASDEKLFSLVQPYAAQLRLLKQ
FT                   PDELWKIFNMFSIDESNKQSLLDIDDSKNQEILAKISDIEQMAEDLRLLKEERGRTLKE
FT                   LKSQTNDDDITNTLLVNSKAESEELEVIFKKELDKFKPLTTRIEATIFKQESVVNEVKN
FT                   ELDNVFSLSGLENKTSEEEEKQKKRKEFFMQIEEAATKFLIFNNDLPKGLEFYDSLLKM
FT                   SKDLAVSVKVQNNASGSDNNSNNGYVSGNVIPPSLPPQPRNVGSSIDSQFQSMNLGSVP
FT                   TPQRFPQPPAPNSRPIVSMENYTSQFSVPPAHGDLPPAYNQVPLVPTRNYDQPHGSGNY
FT                   PGNVSSQHPVSSSPIPGAYDQVPMVPPKQPPAEGRSQISRQEQMEREERELQRDPTAFY
FT                   KKSSVFDESLYSRYSGK"
FT   gene            <668126..>669691
FT                   /locus_tag="CAGL0M06435g"
FT                   /old_locus_tag="CAGL-IPF6156"
FT                   /old_locus_tag="CAGL-CDS1951.1"
FT   CDS_pept        668126..669691
FT                   /locus_tag="CAGL0M06435g"
FT                   /old_locus_tag="CAGL-IPF6156"
FT                   /old_locus_tag="CAGL-CDS1951.1"
FT                   /note="similar to uniprot|P38126 Saccharomyces cerevisiae
FT                   YBR186w PCH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06435g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62603"
FT                   /db_xref="GOA:Q6FJG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG7"
FT                   /inference="similar to AA sequence:UniProtKB:P38126"
FT                   /protein_id="CAG62603.1"
FT                   /translation="MLVTVDACLRQSSINLVRQYMKNEEIRCNGNKYSTEDIFETVIKA
FT                   IRNAIQRRVGASQNCNGVLTFEDIFRDGKGSISIQDPPTQAQENIILSLIKVIFHSTST
FT                   DPQFFLKISTHDNMILSLFVKVVYLNKHDELDDLKLDNVGLHEINHMVNQILTNQVLKH
FT                   TQPIDKVNDNDRFEIYFYILAAENHNEQEKLLTTEFDKFSIVDSYSNDDESTYNEFSLD
FT                   QNSSYEKNARQTQSIAHKVILPCPELEGVWENLYYNKDIKIKLLNYSTASLRLAWYLET
FT                   TSSSTDVVNEMISANNKMILLHGPPGTGKTTLCKALCNKLAIRMAKTKNCVVIDQGSLL
FT                   YELSCSRVFSRWFGESSKNITQLFRDIEADIITANKHNNFVFLLIDEVETIATSRINLS
FT                   NKNEASDSVRVVNSLLTHLDKLKRYPNFLVLATSNLLETLDTAFVDRADGVFFIGNPTS
FT                   KELKYMINSSIDKLIKTGVIVDQDSYNLRKYDDVLQLLATFCEVCIKKTTHPTYLSNYC
FT                   CSYI"
FT   gene            <670483..>671286
FT                   /locus_tag="CAGL0M06457g"
FT                   /old_locus_tag="CAGL-IPF6157"
FT                   /old_locus_tag="CAGL-CDS3849.1"
FT   CDS_pept        670483..671286
FT                   /locus_tag="CAGL0M06457g"
FT                   /old_locus_tag="CAGL-IPF6157"
FT                   /old_locus_tag="CAGL-CDS3849.1"
FT                   /note="similar to uniprot|P38301 Saccharomyces cerevisiae
FT                   YBR187w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06457g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62604"
FT                   /db_xref="GOA:Q6FJG6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG6"
FT                   /inference="similar to AA sequence:UniProtKB:P38301"
FT                   /protein_id="CAG62604.1"
FT                   /translation="MTTIIAALALLPYVSATTTTTTNTTNDIPASHFGSFAMAVAMIGL
FT                   SEIGDKTFLIAALMAMRHARLLVFTAAAISLTIMTVLSGFLGHTFVSLIPESYTTFLAG
FT                   ILFLVFAYKLLIEGLEMSKDAGVEEEMTEVEEEIAISTMNEKMDDIEGGSGKGKYTDAA
FT                   SGPVNQVKQLFSKVFSPIWVSIFLMVFLGELGDRSQISIIAMATDNDYWYVIAGGVMGH
FT                   CICTGIAVLGGKLLATKISMRTITLSSAVLFLIFGIMYIYHAFHY"
FT   gene            complement(<671472..>671810)
FT                   /locus_tag="CAGL0M06479g"
FT                   /old_locus_tag="CAGL-IPF6158"
FT                   /old_locus_tag="CAGL-CDS5302.1"
FT   CDS_pept        complement(671472..671810)
FT                   /locus_tag="CAGL0M06479g"
FT                   /old_locus_tag="CAGL-IPF6158"
FT                   /old_locus_tag="CAGL-CDS5302.1"
FT                   /note="weakly similar to uniprot|P38302 Saccharomyces
FT                   cerevisiae YBR188c NTC20 splicing factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06479g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62605"
FT                   /db_xref="GOA:Q6FJG5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG5"
FT                   /protein_id="CAG62605.1"
FT                   /translation="MSLLKQQAEERQRRLDQLRNIATSNSILPRDEVIEQNVEDSQVKD
FT                   EGQLVEEVNSEQEELADDEQHILEQNGSETADFKAQLQPQLDLLKKKTDEAIKRILRRK
FT                   IMQDKLDD"
FT   gene            <672743..>674201
FT                   /locus_tag="CAGL0M06501g"
FT                   /old_locus_tag="CAGL-IPF6159"
FT                   /old_locus_tag="CAGL-CDS4453.1"
FT   CDS_pept        join(672743..672749,673624..674201)
FT                   /locus_tag="CAGL0M06501g"
FT                   /old_locus_tag="CAGL-IPF6159"
FT                   /old_locus_tag="CAGL-CDS4453.1"
FT                   /note="highly similar to uniprot|P05755 Saccharomyces
FT                   cerevisiae YBR189w SUP46 or uniprot|O13516 Saccharomyces
FT                   cerevisiae YPL081w RPS13B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06501g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62606"
FT                   /db_xref="GOA:Q6FJG4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG4"
FT                   /protein_id="CAG62606.1"
FT                   /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSP
FT                   FGGARPGRVARKNSGKASEGGDDAAEEADEE"
FT   gene            <675227..>676479
FT                   /locus_tag="CAGL0M06523g"
FT                   /old_locus_tag="CAGL-IPF6160"
FT                   /old_locus_tag="CAGL-CDS4867.1"
FT   CDS_pept        join(675227..675237,676008..676479)
FT                   /locus_tag="CAGL0M06523g"
FT                   /old_locus_tag="CAGL-IPF6160"
FT                   /old_locus_tag="CAGL-CDS4867.1"
FT                   /note="highly similar to uniprot|Q02753 Saccharomyces
FT                   cerevisiae YBR191w URP1A or uniprot|Q12672 Saccharomyces
FT                   cerevisiae YPL079w URP1B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06523g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62607"
FT                   /db_xref="GOA:Q6FJG3"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG3"
FT                   /protein_id="CAG62607.1"
FT                   /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKAN
FT                   GSIQKGMPHKFYQGKTGVVYNVTKSSVGVIVNKMVGNRYLEKRLNLRVEHVKHSKCRQE
FT                   FLDRVKSNAAKRAEAKAQGKAVQLKRQPAQPREARVVSTEGNVPQTLAPVAYETFI"
FT   gene            <677238..>679001
FT                   /locus_tag="CAGL0M06545g"
FT                   /old_locus_tag="CAGL-IPF6163"
FT                   /old_locus_tag="CAGL-CDS1574.1"
FT   CDS_pept        677238..679001
FT                   /locus_tag="CAGL0M06545g"
FT                   /old_locus_tag="CAGL-IPF6163"
FT                   /old_locus_tag="CAGL-CDS1574.1"
FT                   /note="similar to uniprot|P32343 Saccharomyces cerevisiae
FT                   YKL124w SSH4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06545g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62608"
FT                   /db_xref="GOA:Q6FJG2"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027713"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG2"
FT                   /inference="similar to AA sequence:UniProtKB:P32343"
FT                   /protein_id="CAG62608.1"
FT                   /translation="MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAVV
FT                   FSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDS
FT                   NFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDL
FT                   QMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYN
FT                   KKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF
FT                   PSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRT
FT                   YTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQ
FT                   TGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLF
FT                   GNLKIKSHIKNPLKEVSSNPSAPELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQP
FT                   SINPPVYEINDTRQSSPEITNETISNEETVSSSSKAEPALQHGQSNKTPNKRQNKKTKQ
FT                   RKNKKKGKKNK"
FT   gene            complement(<679126..>680325)
FT                   /locus_tag="CAGL0M06567g"
FT                   /old_locus_tag="CAGL-IPF6164"
FT                   /old_locus_tag="CAGL-CDS2774.1"
FT   CDS_pept        complement(679126..680325)
FT                   /locus_tag="CAGL0M06567g"
FT                   /old_locus_tag="CAGL-IPF6164"
FT                   /old_locus_tag="CAGL-CDS2774.1"
FT                   /note="highly similar to uniprot|Q12099 Saccharomyces
FT                   cerevisiae YDR021w FAL1 involved in maturation of 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06567g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62609"
FT                   /db_xref="GOA:Q6FJG1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG1"
FT                   /protein_id="CAG62609.1"
FT                   /translation="MSFNREHDLKLKFKSSKKLKISATFESMDLKEGLLRGIYSYGFEA
FT                   PSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKKHDLQALVLSPTRELA
FT                   AQIGKVVTNLGDYMNVKAYAMTGGKTMKDDLKKIQKHGCQVISGTPGRVLDMIKRRLIE
FT                   TRHVQILVLDEADELLSDTLGFKHQIYDIFTKLPRTSQVVVVSATMSPEILEITKKFMN
FT                   DPVKILVKRDEITLEGIKQYYVNVEKEEWKFDTLCDIYDSLTITQCVIFCNSKKKVDWL
FT                   AHKLKQSNFAVISMHGDMKQDERDRVMNEFRTGQSRVLISTDVWARGIDVQQVSLVINY
FT                   DLPEITENYVHRIGRSGRFGRKGVAINFLTKIDASRMKEIEKYYKIKVKPMPADLSELS
FT                   "
FT   gene            <680678..>681355
FT                   /locus_tag="CAGL0M06589g"
FT                   /old_locus_tag="CAGL-IPF6165"
FT                   /old_locus_tag="CAGL-CDS4207.1"
FT   CDS_pept        680678..681355
FT                   /locus_tag="CAGL0M06589g"
FT                   /old_locus_tag="CAGL-IPF6165"
FT                   /old_locus_tag="CAGL-CDS4207.1"
FT                   /note="weakly similar to uniprot|Q12084 Saccharomyces
FT                   cerevisiae YDR020c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06589g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62610"
FT                   /db_xref="GOA:Q6FJG0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG0"
FT                   /protein_id="CAG62610.1"
FT                   /translation="MDKRILLLIGGGHDTGVKSMSNELKTKFDSLFPESNIKVIDIDYE
FT                   QEYMISPARIKRSYSNEDYDFDVLYNTLTHQSEHKAEGEVDIIIVCGCYALYNQKINEL
FT                   ANLRVFVESDGDVRLINKIRSENIDNSEQLATTLQEYLQNLRPEMENYIEPTRVHAHLI
FT                   IPYANKDSGVAIIVDGMVKIVNEVSNSRSPDRQNSKEIARNQLYDFLGESMDNERSRYY
FT                   DLA"
FT   gene            complement(<681693..>683150)
FT                   /locus_tag="CAGL0M06611g"
FT                   /old_locus_tag="CAGL-IPF6168"
FT                   /old_locus_tag="CAGL-CDS2155.1"
FT   CDS_pept        complement(681693..683150)
FT                   /locus_tag="CAGL0M06611g"
FT                   /old_locus_tag="CAGL-IPF6168"
FT                   /old_locus_tag="CAGL-CDS2155.1"
FT                   /note="similar to uniprot|P40501 Saccharomyces cerevisiae
FT                   YIL088c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06611g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62611"
FT                   /db_xref="GOA:Q6FJF9"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF9"
FT                   /inference="similar to AA sequence:UniProtKB:P40501"
FT                   /protein_id="CAG62611.1"
FT                   /translation="MIDNPTATVGSSITNLVKTIVGAGLFAIPFAFKNDGVAVGLLLIF
FT                   LAAVTSSFGLILLAKCSKTLINPRNSSFFTICMLTYPSLAPLFDLAMVVQCFGVGLSYL
FT                   VLVGDFFPDLFGGERKYWILLSAILVVPLCCLKKLDNLKYSSIVGVIALLYLSLLIGFR
FT                   YLTDVAFAPEISFERGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMT
FT                   NVRKVVDSSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLI
FT                   LTFPLLFHPLRTAINNIVVWFIIKFEKSSLTPEISARDSEASNYVTAETHTSRPINLII
FT                   NDDEVNDCEELNEDLLDSNNVIYQEHGHEEEPPKGGLNGVEHDVPFPETRFYIITALLL
FT                   VSMYAMALNVKSFALVLSLVGATGSTSISFILPGLFGYKLIGTDALAIGHTMTKEDRLY
FT                   RRLSLLLIYFGFAVMFLSLYVTLKYQQ"
FT   gene            complement(<683660..>684133)
FT                   /locus_tag="CAGL0M06633g"
FT                   /old_locus_tag="CAGL-IPF6170"
FT                   /old_locus_tag="CAGL-CDS4758.1"
FT   CDS_pept        complement(683660..684133)
FT                   /locus_tag="CAGL0M06633g"
FT                   /old_locus_tag="CAGL-IPF6170"
FT                   /old_locus_tag="CAGL-CDS4758.1"
FT                   /note="some similarities with uniprot|P40502 Saccharomyces
FT                   cerevisiae YIL087c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06633g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62612"
FT                   /db_xref="GOA:Q6FJF8"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF8"
FT                   /protein_id="CAG62612.1"
FT                   /translation="MASVGKNESLSAQAYQLTATPYPAVVNGLALLATPMVSPQMSATA
FT                   GMTSPASSAKGVMKNVLSMPSSRNSTRTIGPSNKAAMLFGGAQLLGAYIINDGDLENGA
FT                   GFVTAWSALYMIVSGKGSVKALRYGRVWPLALSTLALGNTVLYGRRFLFSDFK"
FT   gene            complement(<684606..>685016)
FT                   /locus_tag="CAGL0M06655g"
FT                   /old_locus_tag="CAGL-IPF6171"
FT                   /old_locus_tag="CAGL-CDS4974.1"
FT   CDS_pept        complement(684606..685016)
FT                   /locus_tag="CAGL0M06655g"
FT                   /old_locus_tag="CAGL-IPF6171"
FT                   /old_locus_tag="CAGL-CDS4974.1"
FT                   /note="highly similar to uniprot|P05755 Saccharomyces
FT                   cerevisiae YNL031c HHT2 highly similar to uniprot|O13516
FT                   Saccharomyces cerevisiae YBR010w HHT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06655g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62613"
FT                   /db_xref="GOA:P61833"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61833"
FT                   /protein_id="CAG62613.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   gene            <685761..>686072
FT                   /locus_tag="CAGL0M06677g"
FT                   /old_locus_tag="CAGL-IPF6172"
FT                   /old_locus_tag="CAGL-CDS5519.1"
FT   CDS_pept        685761..686072
FT                   /locus_tag="CAGL0M06677g"
FT                   /old_locus_tag="CAGL-IPF6172"
FT                   /old_locus_tag="CAGL-CDS5519.1"
FT                   /note="highly similar to uniprot|P02309 Saccharomyces
FT                   cerevisiae YNL030w HHF2 histone H4 and highly similar to
FT                   uniprot|P02309 Saccharomyces cerevisiae YBR009c HHF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06677g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62614"
FT                   /db_xref="GOA:Q8NIG3"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIG3"
FT                   /protein_id="CAG62614.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   gene            complement(<686466..>687554)
FT                   /locus_tag="CAGL0M06699g"
FT                   /old_locus_tag="CAGL-IPF6173"
FT                   /old_locus_tag="CAGL-CDS3052.1"
FT   CDS_pept        complement(686466..687554)
FT                   /locus_tag="CAGL0M06699g"
FT                   /old_locus_tag="CAGL-IPF6173"
FT                   /old_locus_tag="CAGL-CDS3052.1"
FT                   /note="similar to uniprot|P40505 Saccharomyces cerevisiae
FT                   YIL084c SDS3 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06699g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62615"
FT                   /db_xref="GOA:Q6FJF5"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF5"
FT                   /inference="similar to AA sequence:UniProtKB:P40505"
FT                   /protein_id="CAG62615.1"
FT                   /translation="MEEMEVQKRLTSKDVPRKDKRRVNLENRVGKIQQSFILERDSYYR
FT                   DRLTSLQTDLTSLHQGNNELFMRKLRDLEEARDLELVRLRLYEEYRVYRSGIEFQEEIE
FT                   KTKEDHERLVKICKERLYQNIEMKTKKLQEERLLMDVANIHTYSMDYDRPHYQKNTRSH
FT                   TASGWESSSNDFGRDTANESATDTGLSGFGNERRSLRRRVVLGREGSGLEGGNGGNATS
FT                   GYTSGGINGDGYNYGKSYNTEDSDGGRYGANPYASPSGRGSQRQNNSGGYRTDMNSDTE
FT                   FLQSIGDSSELYNLLFGDKNVGGKDGNKSSSDKKKPRGTQRYSMKTAPPLQSLKTEEVS
FT                   EDIALIRELTGQPPAPFKVDKQ"
FT   gene            complement(<687902..>688978)
FT                   /locus_tag="CAGL0M06721g"
FT                   /old_locus_tag="CAGL-IPF6174"
FT                   /old_locus_tag="CAGL-CDS3094.1"
FT   CDS_pept        complement(687902..688978)
FT                   /locus_tag="CAGL0M06721g"
FT                   /old_locus_tag="CAGL-IPF6174"
FT                   /old_locus_tag="CAGL-CDS3094.1"
FT                   /note="highly similar to uniprot|P40506 Saccharomyces
FT                   cerevisiae YIL083c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06721g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62616"
FT                   /db_xref="GOA:Q6FJF4"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF4"
FT                   /protein_id="CAG62616.1"
FT                   /translation="MVPPYSNGRPNIHTSITEVEHAIDRSISENVFPVAQTSEEASFFH
FT                   NNPRPAYMDELIQDTREFIEYQHEQGRDKIVLVTSGGTTVPLENNTVRFIDNFSAGTRG
FT                   AASAEQFLKNGYSVIFLHREFSLTPYNRKFTHNLKNSFLDFIDKDGVVKPEFKEQVLEN
FT                   KRLYDLYVSEEKKLLLLPFTTVNQYLWSLKSVAKLLDSRGSLFYLAAAVSDFFVPHSRM
FT                   PQHKIQSRDYKLDGDSSSDDTTTTTADGKLIVNLDPVPKFLRRLVESWASQAMIVSFKL
FT                   ETDERILIHKAITALDRYNHQLVIGNLLQTRNKEVVFVSSTNRDGDWIRLDNSVKTIEE
FT                   LIVPEVIKRHDAWVAKNT"
FT   gene            complement(<689384..>689457)
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0M06743r"
FT   tRNA            complement(689384..689457)
FT                   /gene="tRNA-Ile (AAT)"
FT                   /locus_tag="CAGL0M06743r"
FT                   /product="transfer RNA-Ile"
FT   gene            <690036..>690878
FT                   /locus_tag="CAGL0M06765g"
FT                   /old_locus_tag="CAGL-IPF6176"
FT                   /old_locus_tag="CAGL-CDS3752.1"
FT   CDS_pept        690036..690878
FT                   /locus_tag="CAGL0M06765g"
FT                   /old_locus_tag="CAGL-IPF6176"
FT                   /old_locus_tag="CAGL-CDS3752.1"
FT                   /note="similar to uniprot|P53965 Saccharomyces cerevisiae
FT                   YNL032w SIW14"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06765g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62617"
FT                   /db_xref="GOA:Q6FJF3"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF3"
FT                   /inference="similar to AA sequence:UniProtKB:P53965"
FT                   /protein_id="CAG62617.1"
FT                   /translation="MSPGSGEESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLLM
FT                   DNGRVRNVHHLVDEDNLLREEFDKVLKQFHGNEDNELKIKGNEEDIDDLFDEEEHKKSS
FT                   TGLLLSCDSEVTPPENFSHVVGEIYRSSFPRTENFAFLQKRLKLKSILVLIPEEYPQEN
FT                   LDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGC
FT                   LIGCIRKLQSWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLPLQW"
FT   gene            complement(<691398..>692996)
FT                   /locus_tag="CAGL0M06787g"
FT                   /old_locus_tag="CAGL-IPF6177"
FT                   /old_locus_tag="CAGL-CDS1888.1"
FT   CDS_pept        complement(691398..692996)
FT                   /locus_tag="CAGL0M06787g"
FT                   /old_locus_tag="CAGL-IPF6177"
FT                   /old_locus_tag="CAGL-CDS1888.1"
FT                   /note="similar to uniprot|P53966 Saccharomyces cerevisiae
FT                   YNL029c KTR5 or uniprot|P40504 Saccharomyces cerevisiae
FT                   YIL085c KTR7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06787g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62618"
FT                   /db_xref="GOA:Q6FJF2"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF2"
FT                   /inference="similar to AA sequence:UniProtKB:P53966"
FT                   /protein_id="CAG62618.1"
FT                   /translation="MRVKVKRWVNDAVEEVLDWLLSTIAIYMYITAIICGTFLYFTYPS
FT                   RTDIRFYSEQDLGTERDAPFYYGCVNTEGYLQAPEYKKMNAAFVMLTRNNELKDVLSSM
FT                   NSIEAHFNQWFKYPYVFLNDEPFSEEFKKSIREATDADIEFGTLDESQWEFPEEVRNTF
FT                   EYQNAITDQGDRGILYGNMESYHKMCRFYSGIFYKHPLMQKYEWYWRLEPDVEFFCDLT
FT                   YDPFFEMHRRNKKYAFTMIIPEIYWTVPNLFRYTKAFIREYGVKVGTLWKLFATNYDIL
FT                   KTDKGRDEFTDYENMVRDDLHQWVKFGGDVEPKLSEKVAIDHLLESETADDDVGLMFLV
FT                   NRARSKVPLIEDEFEGEEYNLCHFWSNFEIARLDVFDNEVYNSYFQYLEASGGFWKERW
FT                   GDAPVHSIGLALTLDVDDIHYFRDIGYMHSILKHCPKNSPDLNEFQYKPANKKYKRSSW
FT                   TRYDTPIEGGSGCRCRCPSKPAEVEDTITFCFEKWMDVTHLKKGEVELYQLFNIEEKEE
FT                   MVRNDFERHHQQQNQ"
FT   gene            <693356..>694603
FT                   /locus_tag="CAGL0M06809g"
FT                   /old_locus_tag="CAGL-IPF6178"
FT                   /old_locus_tag="CAGL-CDS2669.1"
FT   CDS_pept        693356..694603
FT                   /locus_tag="CAGL0M06809g"
FT                   /old_locus_tag="CAGL-IPF6178"
FT                   /old_locus_tag="CAGL-CDS2669.1"
FT                   /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
FT                   YML005w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06809g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62619"
FT                   /db_xref="GOA:Q6FJF1"
FT                   /db_xref="InterPro:IPR026274"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF1"
FT                   /inference="similar to AA sequence:UniProtKB:Q04235"
FT                   /protein_id="CAG62619.1"
FT                   /translation="MVLELVVRDLKLLKPIKTILENEGLFVKPIYSEGEDKIIRTRISD
FT                   SNHQLLESLGTGVLIREIDGPVIQSHTKNDITEFTRHFFEGKLENATVIKLLEVLPVKY
FT                   TVFPPLLLFNYSKQRSFLNELWQQTVPSELMDQFYQAMLSAPFLANKKVSHIATNMPII
FT                   ESDVMRRPFNIVPLYGFKNSIPNEDKIWDSPSAQDFQDALWCQVNQNGIEQVWAPQFTM
FT                   FSRGNIKEKKRILDTFTDIEGNDVVDMYSGIGYFTLSYLTRNARTVFAFELNPWSVEGL
FT                   KRGLKANRIDQNRCHIFNESNANCLTRIKEYASIHGPPHIRHINLGLLPSSRDGWPLAV
FT                   QLYRYQLQFSTDRITIHIHENVHIDHIRDNSFIANTVAQLQEIDSELTYTPTHLEQIKT
FT                   FAPDVWHICLDVDIDH"
FT   gene            <695162..>697099
FT                   /locus_tag="CAGL0M06831g"
FT                   /old_locus_tag="CAGL-IPF6180"
FT                   /old_locus_tag="CAGL-CDS1292.1"
FT   CDS_pept        695162..697099
FT                   /locus_tag="CAGL0M06831g"
FT                   /old_locus_tag="CAGL-IPF6180"
FT                   /old_locus_tag="CAGL-CDS1292.1"
FT                   /note="weakly similar to uniprot|P53968 Saccharomyces
FT                   cerevisiae YNL027w CRZ1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06831g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62620"
FT                   /db_xref="GOA:Q6FJF0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF0"
FT                   /protein_id="CAG62620.1"
FT                   /translation="MGDNEEDRRKKFLNGLQLQPDQDNMFLDQYLDQAAELQRHLQGNN
FT                   SMNGDVYEQDNNNHNFSTGQNILSESTFSPSSDMSNPVSNLFNSKSINFSDMPYEMGVG
FT                   EETPNDDRDRQDSNQNNNNNLMNTPTLKIECFDEDGVFLPGDTTNDPFTQDSGPKYDSS
FT                   QNINAGIVSDMNNFENMDSNFLDFGGDNQVSKEDGTYLDLYDNNLKNASTEKIASSNNL
FT                   SVSRNSEDNLSRVSSTLNSPFMQPTDRSVSPILSPPVMYLGDHSHTDDNDDVVSILSNN
FT                   SNILLPVNSHGYKYVTDFNQLGQLIGGDPFELDFNGDNDIINSNDLKVDAETLLNSENV
FT                   HLQAPQPNNNSSNNNNVSSPSGSNKMPTTPIISIEEYDDNNKNSNDDEYAIDMDSSNAL
FT                   QENRGFLGISLLPAEDSDATHDEILQGRKQKLKNRRVSQSSSRRSSRSSMRSLTPEEKA
FT                   RSLSSNRNKLLEMADLLPKSPSSNNGSNNNSRRSSFYEESEDISMDTNISENNNTNNNT
FT                   GTDYVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKRHEDLHTGKKR
FT                   YVCGGKLKDGTFWGCGKKFARSDALGRHFKTSSGRKCITPLYEETARERNLPSIDDTNI
FT                   QATEMGVTLE"
FT   gene            <697615..>699015
FT                   /locus_tag="CAGL0M06853g"
FT                   /old_locus_tag="CAGL-IPF6181"
FT                   /old_locus_tag="CAGL-CDS2278.1"
FT   CDS_pept        697615..699015
FT                   /locus_tag="CAGL0M06853g"
FT                   /old_locus_tag="CAGL-IPF6181"
FT                   /old_locus_tag="CAGL-CDS2278.1"
FT                   /note="similar to uniprot|P53969 Saccharomyces cerevisiae
FT                   YNL026w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06853g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62621"
FT                   /db_xref="GOA:Q6FJE9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE9"
FT                   /inference="similar to AA sequence:UniProtKB:P53969"
FT                   /protein_id="CAG62621.1"
FT                   /translation="MMSASDDQLQAELQAELQRFQNFQNGLLNRNLNTPVSVTKVITNG
FT                   TETIKPQTLQTYLDNTILQATTLKQLVKNADFLSAKLVQHGLAQDVYQNFSTNEKVMSP
FT                   SAENPIPIIDVISQLNILPVKKFVAKTGTNVGNNEGEGYLEFQLRNVFGNGESLRLDML
FT                   RGTAKNSSMLASFVKPINPYHVLDLNIYKHSKNLGNICPLDLHFNGGKMSIKSELGNTQ
FT                   KRINQEWFYEGVTRTTKVTSDHASDTLLFQAGTDFKSSIGHTYAIDTRDSVMAPNRGNL
FT                   FKLNNEVALGKYWKSQFELSKVQSWFKNDFITTTTTLKGGYLGNFHPDKKTLHINDKFM
FT                   SGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKFEDSHFRLHWFFNGG
FT                   KLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLPLTVSTEDSLRKGFQ
FT                   FGLGMSFL"
FT   gene            complement(<699260..>700279)
FT                   /locus_tag="CAGL0M06875g"
FT                   /old_locus_tag="CAGL-IPF6182"
FT                   /old_locus_tag="CAGL-CDS3248.1"
FT   CDS_pept        complement(699260..700279)
FT                   /locus_tag="CAGL0M06875g"
FT                   /old_locus_tag="CAGL-IPF6182"
FT                   /old_locus_tag="CAGL-CDS3248.1"
FT                   /note="highly similar to uniprot|P47821 Saccharomyces
FT                   cerevisiae YNL025c SSN8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06875g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62622"
FT                   /db_xref="GOA:Q6FJE8"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJE8"
FT                   /protein_id="CAG62622.1"
FT                   /translation="MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVD
FT                   SKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLG
FT                   RRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEA
FT                   RSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDE
FT                   LQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSS
FT                   LTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLSA"
FT   gene            complement(<702211..>702957)
FT                   /locus_tag="CAGL0M06897g"
FT                   /old_locus_tag="CAGL-IPF6186"
FT                   /old_locus_tag="CAGL-CDS4021.1"
FT   CDS_pept        complement(702211..702957)
FT                   /locus_tag="CAGL0M06897g"
FT                   /old_locus_tag="CAGL-IPF6186"
FT                   /old_locus_tag="CAGL-CDS4021.1"
FT                   /note="similar to uniprot|P53970 Saccharomyces cerevisiae
FT                   YNL024c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06897g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62623"
FT                   /db_xref="GOA:Q6FJE7"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR033684"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE7"
FT                   /inference="similar to AA sequence:UniProtKB:P53970"
FT                   /protein_id="CAG62623.1"
FT                   /translation="MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGC
FT                   GGKVWIAGELLCEFILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKK
FT                   QSQRMVKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTS
FT                   SLDLVLAADCVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFN
FT                   VIVINDFKNYDQYLKQRTHLFQLVRK"
FT   gene            complement(<703702..>706572)
FT                   /locus_tag="CAGL0M06919g"
FT                   /old_locus_tag="CAGL-IPF6189"
FT                   /old_locus_tag="CAGL-CDS0503.1"
FT   CDS_pept        complement(703702..706572)
FT                   /locus_tag="CAGL0M06919g"
FT                   /old_locus_tag="CAGL-IPF6189"
FT                   /old_locus_tag="CAGL-CDS0503.1"
FT                   /note="similar to uniprot|P53971 Saccharomyces cerevisiae
FT                   YNL023c FAP1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06919g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62624"
FT                   /db_xref="GOA:Q6FJE6"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR034077"
FT                   /db_xref="InterPro:IPR034078"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE6"
FT                   /inference="similar to AA sequence:UniProtKB:P53971"
FT                   /protein_id="CAG62624.1"
FT                   /translation="MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELS
FT                   EELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYEC
FT                   IREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTC
FT                   NAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKL
FT                   LPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYS
FT                   KDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGK
FT                   NELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACE
FT                   QKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADE
FT                   STIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRC
FT                   GTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTV
FT                   CFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKF
FT                   EECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKE
FT                   AFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLN
FT                   KLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKP
FT                   ILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNV
FT                   GEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQ
FT                   HFDFLIKESLLAGGVELCNIENVLAE"
FT   gene            complement(<706878..>708356)
FT                   /locus_tag="CAGL0M06941g"
FT                   /old_locus_tag="CAGL-IPF6190"
FT                   /old_locus_tag="CAGL-CDS2114.1"
FT   CDS_pept        complement(706878..708356)
FT                   /locus_tag="CAGL0M06941g"
FT                   /old_locus_tag="CAGL-IPF6190"
FT                   /old_locus_tag="CAGL-CDS2114.1"
FT                   /note="similar to uniprot|P53972 Saccharomyces cerevisiae
FT                   YNL022c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06941g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62625"
FT                   /db_xref="GOA:Q6FJE5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE5"
FT                   /inference="similar to AA sequence:UniProtKB:P53972"
FT                   /protein_id="CAG62625.1"
FT                   /translation="MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNP
FT                   KHIYAIVSSCWKYKPYLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRI
FT                   QMGKHPIKNYVLKYKNALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLR
FT                   ISNHDTDQVLNELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQG
FT                   KIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF
FT                   EKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGR
FT                   KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAK
FT                   KIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTD
FT                   KTEQECQELADGCVRALPKEDGGIGFFAVCFVRD"
FT   gene            <709544..>710338
FT                   /locus_tag="CAGL0M06963g"
FT                   /old_locus_tag="CAGL-IPF6192"
FT                   /old_locus_tag="CAGL-CDS3884.1"
FT   CDS_pept        709544..710338
FT                   /locus_tag="CAGL0M06963g"
FT                   /old_locus_tag="CAGL-IPF6192"
FT                   /old_locus_tag="CAGL-CDS3884.1"
FT                   /note="similar to uniprot|P50278 Saccharomyces cerevisiae
FT                   YNR034w SOL1 or uniprot|P37262 Saccharomyces cerevisiae
FT                   YCR073wa SOL2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06963g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62626"
FT                   /db_xref="GOA:Q6FJE4"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE4"
FT                   /inference="similar to AA sequence:UniProtKB:P50278"
FT                   /protein_id="CAG62626.1"
FT                   /translation="MTTAAPKLIQFDDEREVACATTEQIIKSQNSKLRQPVKKRTRREN
FT                   RFRLAISGGQLMQTLLKALLYRKEEIEWEKWDIFFVDERLVPFNSNESNYGQLKRGLLD
FT                   PLKSINYPQPNVYHIEETEIDDANVVAQTYEKQLINIFASRDSVRLPTFDMILLGCAPD
FT                   GHIASLFPQCHHNLREEMAWVIPITDAPLEPTKRISMSVPVISNSNQIIFMVTGSNNAE
FT                   LMKMIIEKPSCELPSALISTCAPGRVSWYVENEALKEVMLLD"
FT   gene            complement(<710622..>711371)
FT                   /locus_tag="CAGL0M06985g"
FT                   /old_locus_tag="CAGL-IPF6193"
FT                   /old_locus_tag="CAGL-CDS4007.1"
FT   CDS_pept        complement(710622..711371)
FT                   /locus_tag="CAGL0M06985g"
FT                   /old_locus_tag="CAGL-IPF6193"
FT                   /old_locus_tag="CAGL-CDS4007.1"
FT                   /note="similar to uniprot|P17261 Saccharomyces cerevisiae
FT                   YCR075c ERS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M06985g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62627"
FT                   /db_xref="GOA:Q6FJE3"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE3"
FT                   /inference="similar to AA sequence:UniProtKB:P17261"
FT                   /protein_id="CAG62627.1"
FT                   /translation="MEFEDILGVIYVTAWSISMYPPLYINWKRKSARAISPDFVLLNLT
FT                   GYFYLVCSLTLQMYKWIPHLQSNIERPKLTGFDYCYCLHGFILTVLIASQLFMSRSVWR
FT                   FPDTHQFRMKPVYKKVLLLSIFLFGVLTLQFTYHNMQSGWDNERTLAYCNNLFLLKISM
FT                   SLIKYIPQVLHNFERKSMQGFAISGVFLDMTGGIASIVQLIFQILKESEINLSILISNF
FT                   GKIGLAMVTLIFNTIFISQWLLYEKKV"
FT   gene            <711794..>712030
FT                   /locus_tag="CAGL0M07001g"
FT                   /old_locus_tag="CAGL-IPF14224"
FT   CDS_pept        711794..712030
FT                   /locus_tag="CAGL0M07001g"
FT                   /old_locus_tag="CAGL-IPF14224"
FT                   /note="similar to uniprot|Q3E841 Saccharomyces cerevisiae
FT                   YNR034wa"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07001g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58075"
FT                   /db_xref="GOA:B4UN59"
FT                   /db_xref="InterPro:IPR021591"
FT                   /db_xref="InterPro:IPR035098"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN59"
FT                   /inference="similar to AA sequence:UniProtKB:Q3E841"
FT                   /protein_id="CAR58075.1"
FT                   /translation="MLSSKLQELLPGSVGVMTFDSNNNLVLADGVAKDKVNDIPELSEV
FT                   QCNAEGVAVLENGDYIVHVCKKDGNTLVVYTGK"
FT   gene            complement(<712268..>713125)
FT                   /locus_tag="CAGL0M07007g"
FT                   /old_locus_tag="CAGL-IPF6195"
FT                   /old_locus_tag="CAGL-CDS3716.1"
FT   CDS_pept        complement(712268..713125)
FT                   /locus_tag="CAGL0M07007g"
FT                   /old_locus_tag="CAGL-IPF6195"
FT                   /old_locus_tag="CAGL-CDS3716.1"
FT                   /note="weakly similar to uniprot|P25659 Saccharomyces
FT                   cerevisiae YCR076c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07007g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62628"
FT                   /db_xref="GOA:Q6FJE2"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE2"
FT                   /protein_id="CAG62628.1"
FT                   /translation="MMLVNTKLELAVKLVQEYFTEYATASVSFDNWFSNEVVKVEIVCK
FT                   KCEEQQILKLAAFETIKDKQCMISIYSGDEILSQSLFQYADDMQVVDAIKLPLDFEEYK
FT                   DRYSSKINEVLEGIGVKLNLKNYVNKLREDSAQDQNERAHPHDMHNNPLERYPQRVERT
FT                   SNRDDIPKFEDEYEINSRRTDPNCLEPPGGYGDRDLYPTGQKYPNLNNPNVMPHLPNNQ
FT                   GGMVFDPFGDRNHVRNPRDMPPGWIPGAKFDDPYGRPPSGFPGGPSSGPGGFGSGGFGS
FT                   NGFI"
FT   gene            complement(<713658..>716174)
FT                   /locus_tag="CAGL0M07029g"
FT                   /old_locus_tag="CAGL-IPF6197"
FT                   /old_locus_tag="CAGL-CDS0715.1"
FT   CDS_pept        complement(713658..716174)
FT                   /locus_tag="CAGL0M07029g"
FT                   /old_locus_tag="CAGL-IPF6197"
FT                   /old_locus_tag="CAGL-CDS0715.1"
FT                   /note="similar to uniprot|P25644 Saccharomyces cerevisiae
FT                   YCR077c PAT1 topoisomerase II-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07029g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62629"
FT                   /db_xref="GOA:Q6FJE1"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="InterPro:IPR039900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE1"
FT                   /inference="similar to AA sequence:UniProtKB:P25644"
FT                   /protein_id="CAG62629.1"
FT                   /translation="MSQRRRESALNFEETYNGFGEHELEENDYLNDETFGADIEVGTDF
FT                   DFGHPGKAATNNNVPAQASVMPQRSYVTAASSGINKPGQQNVDASMDLKPMESLWGGQT
FT                   EARPEEPVLSMEEIERQQRQMQQQQHQGPHGPMPPMPMMPPNMPPPNMAMPPPGYGPMP
FT                   GYQYPMNVNPSMFQGPPPPNMAMPPMQPSQGGQPMQPGQGGQPMQPPQRMPMPHQPEPP
FT                   VQSPMSAVQQSSGVSTPQQSVISSSASPANSNQAALHQEQGQQNLAFQQDEQSQQHQQQ
FT                   QQYYQRNRFNNQNNNRGNQRREPLSPEEKMRLQIRHAKVEKILKHAGLMTPRDKDFITR
FT                   YQLSQIVTEDPYNEDFYFQVYKLIQRGGVAAESNKGLIARAYLEHSGHRLGGRYKRADI
FT                   ALQRMQSQVEKAVTVAKERPQKNKDVDSVREGVLGKISTTMNSKAPRRQLAIPSHKSNE
FT                   DIAFSDDGKLSRDSTPALEEVTRNLDSVDLNAHSRTRRRSSYAFSSIDHNSVLSRSGGR
FT                   KFVLSLIETVYEEVLDLEANLRNDKETDSTALWETLHIDDEVYEVCPFISMLSFDKGVK
FT                   IIPRIFNFLSKQQKLKLLQKFFSELSHLNIIILSSYKTNPDPTESQLKKMDLFQTVFLK
FT                   IIVSFLSSSSSFIEIMGLLLYLIKNNNVSFISTSKIGLNLITVLISRAALIRQDSNRSN
FT                   VLSSPEISTWNEIYDKLFTALESKLSAVFPPKEYCDKVVKIQTANAGLSLAANPVSNKF
FT                   YDQAYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINTAEQLKKLPTEDQNGSLYRRE
FT                   KLYQDLNLFLNVMGLVSRDGEIMELK"
FT   gene            complement(<716775..>719546)
FT                   /locus_tag="CAGL0M07051g"
FT                   /old_locus_tag="CAGL-IPF6198"
FT                   /old_locus_tag="CAGL-CDS0563.1"
FT   CDS_pept        complement(716775..719546)
FT                   /locus_tag="CAGL0M07051g"
FT                   /old_locus_tag="CAGL-IPF6198"
FT                   /old_locus_tag="CAGL-CDS0563.1"
FT                   /note="similar to uniprot|P39112 Saccharomyces cerevisiae
FT                   YMR287c MSU1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07051g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62630"
FT                   /db_xref="GOA:Q6FJE0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:6F3H"
FT                   /db_xref="PDB:6F4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE0"
FT                   /inference="similar to AA sequence:UniProtKB:P39112"
FT                   /protein_id="CAG62630.1"
FT                   /translation="MKVRVQRRWFHCCRRLDNAPLENSVKNYLARTKGLEPDFEIRQLP
FT                   QIISGFNKRYRARYLEPSQRWFKADWKASDHGEDKATRLLRPEVFDKFIINSDFHRGNM
FT                   EQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAKKDGT
FT                   LVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQLIVS
FT                   FTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIKEATDAIN
FT                   GDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVL
FT                   PLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIE
FT                   ENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKSSG
FT                   ISSVEQKLYDTAMPTIVSDTDRYDFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHI
FT                   HIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHD
FT                   RKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSILNGDDNSLPSK
FT                   QKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTK
FT                   STLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPS
FT                   LKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPL
FT                   CFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHLEQSGTKTHDVIVTSVPQNGTVN
FT                   CLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTLTHVNRK"
FT   gene            <719729..>720319
FT                   /locus_tag="CAGL0M07073g"
FT                   /old_locus_tag="CAGL-IPF6199"
FT                   /old_locus_tag="CAGL-CDS4479.1"
FT   CDS_pept        719729..720319
FT                   /locus_tag="CAGL0M07073g"
FT                   /old_locus_tag="CAGL-IPF6199"
FT                   /old_locus_tag="CAGL-CDS4479.1"
FT                   /note="similar to uniprot|P38876 Saccharomyces cerevisiae
FT                   YHR189w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07073g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62631"
FT                   /db_xref="GOA:Q6FJD9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD9"
FT                   /inference="similar to AA sequence:UniProtKB:P38876"
FT                   /protein_id="CAG62631.1"
FT                   /translation="MKLEKSIKYGRAMNKARHLCLTGIGNPEPSYKGTRHNVGLTVLDL
FT                   LIKQLVPRDQHVFRREGKVHVLRTPTITFIRSDIGFMNLSGRSVVPMWQKLYTDHTDYA
FT                   VIHDELSLRTGALQLRQPQASLRGHNGLRDISAHWRHQYYKLAIGIDRPESRDPQAVAD
FT                   YVLSKVPQRDATYIENTTTSKALELLQRQFPYI"
FT   gene            <720613..>721944
FT                   /locus_tag="CAGL0M07095g"
FT                   /old_locus_tag="CAGL-IPF6200"
FT                   /old_locus_tag="CAGL-CDS2455.1"
FT   CDS_pept        720613..721944
FT                   /locus_tag="CAGL0M07095g"
FT                   /old_locus_tag="CAGL-IPF6200"
FT                   /old_locus_tag="CAGL-CDS2455.1"
FT                   /note="highly similar to uniprot|P29704 Saccharomyces
FT                   cerevisiae YHR190w ERG9 farnesyl-diphosphate
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07095g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62632"
FT                   /db_xref="GOA:Q9HGZ6"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGZ6"
FT                   /protein_id="CAG62632.1"
FT                   /translation="MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYEL
FT                   LNLTSRSFAAVIMELHPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLD
FT                   TTDWSFDGNDLKEKDRVVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDEN
FT                   FNLNGVQTVKDYDKYCHYVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMGLFLQ
FT                   KTNIIRDYAEDLDDGRSFWPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVI
FT                   DVLTYLSSIHEQSSFQFCAIPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRT
FT                   LKGCVDIFQYYLRDMKQRLPVEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMI
FT                   YLKVQERLKWDTQVIPRVQEEDYKFNMALSVVFCVLLSFYFFTK"
FT   gene            complement(<722174..>722575)
FT                   /locus_tag="CAGL0M07117g"
FT                   /old_locus_tag="CAGL-IPF6201"
FT                   /old_locus_tag="CAGL-CDS5018.1"
FT   CDS_pept        complement(722174..722575)
FT                   /locus_tag="CAGL0M07117g"
FT                   /old_locus_tag="CAGL-IPF6201"
FT                   /old_locus_tag="CAGL-CDS5018.1"
FT                   /note="similar to uniprot|P38877 Saccharomyces cerevisiae
FT                   YHR191c CFT8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07117g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62633"
FT                   /db_xref="GOA:Q6FJD7"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD7"
FT                   /inference="similar to AA sequence:UniProtKB:P38877"
FT                   /protein_id="CAG62633.1"
FT                   /translation="MPSVDINYDKLKELLSKDSSTDGGSATPANTIETPLGTIMVEIQG
FT                   SLELPTSIDEDSELSKKFDGVDAVKFGSLNIEDKKAVLYVGKKQRLLGKVVKLSTPLGI
FT                   LKFNEGKNVEMLDIIEYKVIFSDRPLPIM"
FT   gene            <722830..>723591
FT                   /locus_tag="CAGL0M07139g"
FT                   /old_locus_tag="CAGL-IPF6203"
FT                   /old_locus_tag="CAGL-CDS3974.1"
FT   CDS_pept        722830..723591
FT                   /locus_tag="CAGL0M07139g"
FT                   /old_locus_tag="CAGL-IPF6203"
FT                   /old_locus_tag="CAGL-CDS3974.1"
FT                   /note="similar to uniprot|P38878 Saccharomyces cerevisiae
FT                   YHR192w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07139g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62634"
FT                   /db_xref="GOA:Q6FJD6"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="InterPro:IPR040115"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD6"
FT                   /inference="similar to AA sequence:UniProtKB:P38878"
FT                   /protein_id="CAG62634.1"
FT                   /translation="MFWFRDKRTLVQRYTADLAQITTQIHDLDKSIKHGSKRVARLQRQ
FT                   VTYFGLSAITLLGSYMFLNYTPAITVIAMAGAVAIVVIVKLLLSRMYQVYHQYRIKKLS
FT                   QLRGLHQKKLDKLKEETNYNATSSIIQRFSSGETQSEDAVILMDEEISKKYNELTELQK
FT                   QLTELKQNEKKLMDPKERDVWFDKVLGVLSGGDEMAPKPIICTNCNEHCGAYRLLNRPL
FT                   KYVCPNCGIKIDETAKMEQAVNEEVNEDKTK"
FT   gene            complement(<723774..>724271)
FT                   /locus_tag="CAGL0M07161g"
FT                   /old_locus_tag="CAGL-IPF6204"
FT                   /old_locus_tag="CAGL-CDS4695.1"
FT   CDS_pept        complement(723774..724271)
FT                   /locus_tag="CAGL0M07161g"
FT                   /old_locus_tag="CAGL-IPF6204"
FT                   /old_locus_tag="CAGL-CDS4695.1"
FT                   /note="highly similar to uniprot|P38879 Saccharomyces
FT                   cerevisiae YHR193c EGD2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07161g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62635"
FT                   /db_xref="GOA:Q6FJD5"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD5"
FT                   /protein_id="CAG62635.1"
FT                   /translation="MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKDN
FT                   QIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQAA
FT                   AVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAIMSL
FT                   SK"
FT   gene            <724616..>726373
FT                   /locus_tag="CAGL0M07183g"
FT                   /old_locus_tag="CAGL-IPF6209"
FT                   /old_locus_tag="CAGL-CDS1582.1"
FT   CDS_pept        724616..726373
FT                   /locus_tag="CAGL0M07183g"
FT                   /old_locus_tag="CAGL-IPF6209"
FT                   /old_locus_tag="CAGL-CDS1582.1"
FT                   /note="similar to uniprot|P38880 Saccharomyces cerevisiae
FT                   YHR194w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07183g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62636"
FT                   /db_xref="GOA:Q6FJD4"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD4"
FT                   /inference="similar to AA sequence:UniProtKB:P38880"
FT                   /protein_id="CAG62636.1"
FT                   /translation="MMLRRWVCNASNASSARLRLPTRVPVWLPDGSPARLAHRAPNQLV
FT                   PGMSSFQIWSIQVRWASDKNAVRKSIKEKIAQYKFITERDRTLAQTSGLFAKLRINTRW
FT                   FLKRSLNRPFNTDDIGAFISWILVSNFIILLLWTTSFVSVIIYLLNTVYAQEYVAEKIG
FT                   NYLTRNTALSVVFESAVVPDWSSGKISFKNVFISRRPKTSHSFTKGSQKEAAQRAKLAL
FT                   SESLLVNREDFDHGNYTQFDLTLDQLDISLNLRKWINGKGFIDEVIINGLRGIVDRTHV
FT                   VWKANDDPRNYKNIAQPGDFEISNFKMNDVLFTLYQPQGFRPFQVSIFNCELPQLRKHW
FT                   LFYDILNANSMSGTYDNSMFTIHRKYNTLGDGSSESPVSPWRKVTRFRVDSLDVDHLNA
FT                   GIEGPFGWITEGKVNMIGDVLLPDKNADSLQLTELLTEISNRLIKQAKMYNIIPQNKSE
FT                   TPDIDPDDYFIMDFSLKLNHVKATVPLFAPGMTYINNALIRPIVGYINSHRTYIPIKCR
FT                   VVKKIDDFEGSWTVYDSYLMQDLSAEVYDAFAVYVADDQQRSQRIKKVGFWSLQVLLQL
FT                   ILLSLGSIA"
FT   gene            <726724..>727449
FT                   /locus_tag="CAGL0M07205g"
FT                   /old_locus_tag="CAGL-IPF6212"
FT                   /old_locus_tag="CAGL-CDS4077.1"
FT   CDS_pept        726724..727449
FT                   /locus_tag="CAGL0M07205g"
FT                   /old_locus_tag="CAGL-IPF6212"
FT                   /old_locus_tag="CAGL-CDS4077.1"
FT                   /note="weakly similar to uniprot|P38881 Saccharomyces
FT                   cerevisiae YHR195w NVJ1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07205g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62637"
FT                   /db_xref="GOA:Q6FJD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD3"
FT                   /protein_id="CAG62637.1"
FT                   /translation="MTRPPVLQYGIPFGVTVGAWKSLRKYLGHRMPYSSLHEPSQFEQW
FT                   ADDFFVPETLQEKIIEHIPEPVKHNKLSELFEQVTQRFFDMDTRLSIIMLIVIVLAPLL
FT                   SPSRKETHENCNDNENELQQSTAEERLKSAETTAVDLDEQEKEIHMEEIEDSTVVAVKL
FT                   PVATAEEVELMHETFGAVPALKREPNPSHTASSSSLDSANSKLSRESPRVPLQVSPAKA
FT                   CNSNAQINNFQAYSQPFTY"
FT   gene            <728096..>729724
FT                   /locus_tag="CAGL0M07227g"
FT                   /old_locus_tag="CAGL-IPF6213"
FT                   /old_locus_tag="CAGL-CDS1825.1"
FT   CDS_pept        728096..729724
FT                   /locus_tag="CAGL0M07227g"
FT                   /old_locus_tag="CAGL-IPF6213"
FT                   /old_locus_tag="CAGL-CDS1825.1"
FT                   /note="similar to uniprot|P38882 Saccharomyces cerevisiae
FT                   YHR196w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07227g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62638"
FT                   /db_xref="GOA:Q6FJD2"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD2"
FT                   /inference="similar to AA sequence:UniProtKB:P38882"
FT                   /protein_id="CAG62638.1"
FT                   /translation="MSQIACFSKDGLTFAYQADRSKKNTIDLYPLDPENNYMINSSLVN
FT                   NIDCESNDLKISELNFYGWCYNEIANGSTKTKRRNSDDAGVISTTSHENYFVNVYGTSK
FT                   IVVYTQTGKDIVNILKSKDSIIGMATDGPFIWVLDENMVAKKFHYNQSKQQKSFTFSEG
FT                   RDSNVKNFEVLYRDEKTFYIVIFTEDKVYLIDPSKRRAVTKLVLEIGYYSHAEFLNNGE
FT                   YLVLSNSENLLVVDFESGKEVFRWETEAAFKFKVIKDFVFVLTGNDNSIDVFKFGEKQP
FT                   TRKIVASSSTIIDFEHTSGDNLLVAWLNVNEPNFKKLSLGDINSAGSIIDVNTSQHDGT
FT                   DLSEDNISVAGNEDSSEKEITQRQKITKAGQDKISQELLTALIEGEDKEIIEILNLPTW
FT                   SSDRISNFLNNKIEENDQAVRLYQLVADEIEKDPWSDNATLPVWLKWILLIKGKDMNIS
FT                   NDKKTRKQTRHLKSALRTSSTTLPILLGIQGRLEMLKTQAKLRKELAGIQLEQDDSTTT
FT                   ENNITYADGESDSFVDAAEYVEAKQ"
FT   gene            <730042..>731235
FT                   /locus_tag="CAGL0M07249g"
FT                   /old_locus_tag="CAGL-IPF6214"
FT                   /old_locus_tag="CAGL-CDS2783.1"
FT   CDS_pept        730042..731235
FT                   /locus_tag="CAGL0M07249g"
FT                   /old_locus_tag="CAGL-IPF6214"
FT                   /old_locus_tag="CAGL-CDS2783.1"
FT                   /note="similar to uniprot|Q02783 Saccharomyces cerevisiae
FT                   YPL060w or uniprot|Q01926 Saccharomyces cerevisiae YOR334w
FT                   MRS2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07249g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62639"
FT                   /db_xref="GOA:Q6FJD1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD1"
FT                   /inference="similar to AA sequence:UniProtKB:Q02783"
FT                   /protein_id="CAG62639.1"
FT                   /translation="MLLVNRAITLNLVKRCCWRSTMFMTPKRFLGTSEEESTAALLLQK
FT                   NLIQRNNMLYGHGSGTIRCTVFDAGGNIVSPALDIKREELVAKHGLLPRDLRKIEKSRK
FT                   NDLVPSFLVRKNGILVSLATIKTLIKPDMVIVFDSFGSLNSTSHKAFLNSLKLRLQNLD
FT                   MVELKKDPLPYEFRALESIFISALSNLTSEMNVQVTICKGILQDLEYSITRDKLKFLLG
FT                   QNKKLSNFYKKTVLIRDMLDDLLEQSDVLCSMYLSDLKNGVEHKDDDHSEIEMLLETYH
FT                   NHLDEIVQITENIISNVKTTEEIINIILDSNRNQLMLLGIRFSIGMLSLGGPIFIGSLY
FT                   GMNLENFIEETDYGFIAASAIGMISLGALYFYSIKHLHKLQKMSLFNYTNYARDVKK"
FT   gene            <731627..>732076
FT                   /locus_tag="CAGL0M07271g"
FT                   /old_locus_tag="CAGL-IPF6215"
FT                   /old_locus_tag="CAGL-CDS4842.1"
FT   CDS_pept        731627..732076
FT                   /locus_tag="CAGL0M07271g"
FT                   /old_locus_tag="CAGL-IPF6215"
FT                   /old_locus_tag="CAGL-CDS4842.1"
FT                   /note="similar to uniprot|Q02784 Saccharomyces cerevisiae
FT                   YPL059w GRX5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07271g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62640"
FT                   /db_xref="GOA:Q6FJD0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD0"
FT                   /inference="similar to AA sequence:UniProtKB:Q02784"
FT                   /protein_id="CAG62640.1"
FT                   /translation="MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIASA
FT                   PVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLEDPELREGIKEFSNWPTI
FT                   PQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD"
FT   gene            complement(<733072..>737619)
FT                   /locus_tag="CAGL0M07293g"
FT                   /old_locus_tag="CAGL-IPF6218"
FT                   /old_locus_tag="CAGL-CDS0101.1"
FT   CDS_pept        complement(733072..737619)
FT                   /locus_tag="CAGL0M07293g"
FT                   /old_locus_tag="CAGL-IPF6218"
FT                   /old_locus_tag="CAGL-CDS0101.1"
FT                   /note="similar to uniprot|Q02785 Saccharomyces cerevisiae
FT                   YPL058c PDR12 or uniprot|P32568 Saccharomyces cerevisiae
FT                   YDR011w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07293g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62641"
FT                   /db_xref="GOA:Q6FJC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC9"
FT                   /inference="similar to AA sequence:UniProtKB:Q02785"
FT                   /protein_id="CAG62641.1"
FT                   /translation="MPASISSSIISKERKDDADTTSNSYADSVHSYENINRDDNEQQPV
FT                   STQLSRHLTQILSEEGGKERLESMARVISTKTKAEMDKFEVNDMDFDLRMLLNYLRNRQ
FT                   LEQGIEPGDSGVAFKNLTAVGIDASAAYGPSVEEMLRDTGKLPLTLINKLRRKKDSVPL
FT                   RNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMM
FT                   KNYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIRDMWCTVF
FT                   GLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQA
FT                   IRTATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIYFGPAKKAVQYFENMGWIKP
FT                   PRMTSAEFLTSVTVDFENRTLDIKPGYEDTIPKSGFEFEEYWLNSPEYQELLRHYDDYH
FT                   ARHPAEETRERFDTAKKQMLQSGQRESSRYVVNYWSQVWYCMIRGFQRVKGDSTYTKVY
FT                   LSSFLIKGLIVGSMFHKIDNKSQSTTAGAYSRGGLLFYVLLFASVTSLAEIANSFSTRP
FT                   IIVKHKSYSMYHISAESLQEIITELPTKFVAIIVLSLVTYWIPYLKFEAGAFFQYILYL
FT                   FTVQQCTSFIFKFVATITKDGVTAHAIGGLWVLMLCVYAGFVLPLGEMHHWIKWLHFLN
FT                   PLTYAFESLVSTEFHHREMLCSQLIPSGPGYENVSVANQICNAAGAIKGHMFVNGDTYI
FT                   DRQYHFAYRHAWRSWGVNIVWTFGYIVFNVILSEFIKPVSGGGDLLLYKRGHMPEFGTE
FT                   NADARVASREEMMETLNGPDVDLPKVIAAKDVFTWNHLNYTIPYDGATRQLLSDVFGYV
FT                   KPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNSQSLPASFNRSCGYVAQADN
FT                   HMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAEALVGKTGRGLNVE
FT                   QRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSA
FT                   TLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSGVKCGISENPAEYILNCIGA
FT                   GATASASADWHDLWQQSPECAAARAELDELHKNLLSRPVTEDPELVTKFAASYTTQMKC
FT                   VLRRTMIQFWRSPVYIRAKFLECVSCALFVGLSYIAVNHSVGGATEAFSSIFMLLLIAL
FT                   AMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHYVVETGWSTLCQFMCFICYYWPA
FT                   GYSGRASHAGFFFFFYVLIFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGIL
FT                   QPKEKMPGFWRGLMYNVSPFTYVVQALVGPLVHDKKVVCNKNEFAIMDPPAGQTCGEYL
FT                   RTYIGNNSGYLVNPQATSNCNYCPYSVQDEVVARFNVKWSYRWRNFGFMWVYICFNIFA
FT                   MLSCYYIMRVKVWSLKSVLDFKKWFNGPRKDRHEKDKSIFEKKPGDEEKVKQKF"
FT   gene            complement(<740469..>741557)
FT                   /locus_tag="CAGL0M07315g"
FT                   /old_locus_tag="CAGL-IPF6221"
FT                   /old_locus_tag="CAGL-CDS3053.1"
FT   CDS_pept        complement(740469..741557)
FT                   /locus_tag="CAGL0M07315g"
FT                   /old_locus_tag="CAGL-IPF6221"
FT                   /old_locus_tag="CAGL-CDS3053.1"
FT                   /note="highly similar to uniprot|P33300 Saccharomyces
FT                   cerevisiae YPL057c SUR1 or uniprot|P38287 Saccharomyces
FT                   cerevisiae YBR161w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07315g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62642"
FT                   /db_xref="GOA:Q6FJC8"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC8"
FT                   /protein_id="CAG62642.1"
FT                   /translation="MKREVAYLAITNAFLVFFILFYTFDLLTLCIDDTIHDTLTASDLN
FT                   SSVPREDELIPRIIHQTYKTEDIPKHWIEGQHRCQELHSDYQYIMWTDQMALDFITEHY
FT                   SWFLPTFVGYKRPIQRADAIRYFILYHYGGIYIDLDDKCERPLDNLLKLPAFVRKTSPL
FT                   GISNDVMGSMPGHPFFWKAIHNLNHYNKNWYVPYLTIMSSTGPLFISIVWKHYRRWKIF
FT                   TKNYVPVKIIQPQDYKGSSSSFFSIVKGSSWHTDDAKWMKSLENHILSCVVAGFIFAFF
FT                   ILYGEYIFYCWLCYKKPITLTNSDSGSKNSWSSKLLWVWNRIKFRSSSYTTTYPTTPTT
FT                   SPKRSRKDSNAVFDIEKRTVNV"
FT   gene            complement(<743020..>743961)
FT                   /locus_tag="CAGL0M07337g"
FT                   /old_locus_tag="CAGL-IPF6224"
FT                   /old_locus_tag="CAGL-CDS3485.1"
FT   CDS_pept        complement(743020..743961)
FT                   /locus_tag="CAGL0M07337g"
FT                   /old_locus_tag="CAGL-IPF6224"
FT                   /old_locus_tag="CAGL-CDS3485.1"
FT                   /note="some similarities with uniprot|Q02796 Saccharomyces
FT                   cerevisiae YPL055c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07337g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62643"
FT                   /db_xref="GOA:Q6FJC7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC7"
FT                   /protein_id="CAG62643.1"
FT                   /translation="MSDERYQSRYGRYDSGRGGRSGYYSNYQNSSHHRSNDGPNTNTHG
FT                   PSNGNGNSGGYYHGYYNRHGSMNGRAASSGRGYYGGHNTHITSAPHNNPNAYSRAPATG
FT                   NTSYTGSYYSRGGNSSGRGGYSSYNRGGYHASHQYNNGGYYHRNNNYNSSYTERQKSVS
FT                   GDSATSGGMKYTSSHRTTHVTHPAHPPITIQRSGSNGNGVAQGNASSGEVPTAPRRETT
FT                   AQNNGRDKREEQLKKYGISNMAQGYLEIMDQNSSSTTSVTQTEIELDEKLREMNSQVFR
FT                   TMCELALVENQYTRDTLNVQLTQEKLDTLLLS"
FT   gene            <744461..>744790
FT                   /locus_tag="CAGL0M07359g"
FT                   /old_locus_tag="CAGL-IPF6225"
FT                   /old_locus_tag="CAGL-CDS5364.1"
FT   CDS_pept        744461..744790
FT                   /locus_tag="CAGL0M07359g"
FT                   /old_locus_tag="CAGL-IPF6225"
FT                   /old_locus_tag="CAGL-CDS5364.1"
FT                   /note="some similarities with uniprot|Q02799 Saccharomyces
FT                   cerevisiae YPL054w LEE1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07359g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62644"
FT                   /db_xref="GOA:Q6FJC6"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR041367"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC6"
FT                   /protein_id="CAG62644.1"
FT                   /translation="MTNVDLSKFSAKQQQLILQCLAITNQVNQSKNIGSGSQNKYSRRK
FT                   DCSHIPCKFYMVGSCQAGQSCPFSHQTQTIERAYSTPCKYYQKGYCKFGDRCINLHIHE
FT                   DQNEK"
FT   gene            complement(<745077..>746510)
FT                   /locus_tag="CAGL0M07381g"
FT                   /old_locus_tag="CAGL-IPF6227"
FT                   /old_locus_tag="CAGL-CDS2213.1"
FT   CDS_pept        complement(745077..746510)
FT                   /locus_tag="CAGL0M07381g"
FT                   /old_locus_tag="CAGL-IPF6227"
FT                   /old_locus_tag="CAGL-CDS2213.1"
FT                   /note="some similarities with uniprot|P54070 Saccharomyces
FT                   cerevisiae YPL053c KTR6 mannosylphosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07381g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62645"
FT                   /db_xref="GOA:Q6FJC5"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC5"
FT                   /protein_id="CAG62645.1"
FT                   /translation="METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDIT
FT                   DKLVTFAGEENVKSLHAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMSLA
FT                   EMGELPIDAETIEEQKSIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSFVTG
FT                   NSELRKLLRTIESVQKKFNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDDVKTE
FT                   VEFGTVPPEHWGFPDFIDSTVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHHTLLKK
FT                   YDWYMRVSPGIRLNCEMEYDIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNLNFTAHN
FT                   REFYNPIEKSSLRSYIQVGRDTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYMDKAGGIF
FT                   YERWSDSIIQSMAYSTMVPAKMIQHISPMGYQNKETVVCPADDIMWREYKCECDQGSDI
FT                   SFNRDLTCTQRYKDTQGMF"
FT   gene            <747805..>748398
FT                   /locus_tag="CAGL0M07403g"
FT                   /old_locus_tag="CAGL-IPF9960"
FT                   /old_locus_tag="CAGL-CDS4472.1"
FT   CDS_pept        747805..748398
FT                   /locus_tag="CAGL0M07403g"
FT                   /old_locus_tag="CAGL-IPF9960"
FT                   /old_locus_tag="CAGL-CDS4472.1"
FT                   /note="similar to uniprot|Q02803 Saccharomyces cerevisiae
FT                   YPL052w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07403g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62646"
FT                   /db_xref="GOA:Q6FJC4"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC4"
FT                   /inference="similar to AA sequence:UniProtKB:Q02803"
FT                   /protein_id="CAG62646.1"
FT                   /translation="MSGARDIELGANTNELVTELLWDIIYLTEHQFLLPYYHGEHKKFQ
FT                   KKLVKRVGNHLNSLVNNSASKPTGSMTVNVRHVWRNVGDRYTLLYLPLYFKELIWCKAN
FT                   GSIFHVIIPHTKEHVIHEHKEWLLAILEMAGYWNLSHVRLYLPRDDLTNIQTLLKNLHW
FT                   IGANLLPNENRNECNENDDITLSDETYIILECEC"
FT   gene            complement(<748504..>749631)
FT                   /locus_tag="CAGL0M07425g"
FT                   /old_locus_tag="CAGL-IPF9561"
FT                   /old_locus_tag="CAGL-CDS2936.1"
FT   CDS_pept        complement(748504..749631)
FT                   /locus_tag="CAGL0M07425g"
FT                   /old_locus_tag="CAGL-IPF9561"
FT                   /old_locus_tag="CAGL-CDS2936.1"
FT                   /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
FT                   YMR028w TAP42 component of the Tor signaling pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07425g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62647"
FT                   /db_xref="GOA:Q6FJC3"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="InterPro:IPR038511"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC3"
FT                   /inference="similar to AA sequence:UniProtKB:Q04372"
FT                   /protein_id="CAG62647.1"
FT                   /translation="MSGTILEQFRGIQGTIDRKLLHTQLRQDSEEYQKLLTGTIQELLD
FT                   LKSKVYHKLSLFSSNETVEDIATSSLLYLSLDYYLGLLCSRKQATSNQLANPMDKNKMR
FT                   IMFLDKAIQLFMQYLSTLQDNEILDESISKKIDGFENTFMPTMDELYAVPKHKEDLSGA
FT                   QLRRQEKIEMHKQNTAVAQQLRILEGKVSEDQENDDDELLRKLYLQKLKLLSYETFDEI
FT                   EKILYEKELLSNFVRMAPQSDNEPHLAGNDQSKSSNDDPTGYTDKLETLNKPLLSKHGK
FT                   VLRNFTLVDKRSELKSKVKGYGQYGPTMSVEEFLEQEWEQGRVLQGGEEPTKEEIEALN
FT                   EDNMEWQDKETYKAREWDEFKEENPKGSGNTMNRG"
FT   gene            complement(<749980..>751392)
FT                   /locus_tag="CAGL0M07447g"
FT                   /old_locus_tag="CAGL-IPF9559"
FT                   /old_locus_tag="CAGL-CDS2252.1"
FT   CDS_pept        complement(749980..751392)
FT                   /locus_tag="CAGL0M07447g"
FT                   /old_locus_tag="CAGL-IPF9559"
FT                   /old_locus_tag="CAGL-CDS2252.1"
FT                   /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
FT                   YMR027w high level expression reduced Ty3 transposition"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07447g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62648"
FT                   /db_xref="GOA:Q6FJC2"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="InterPro:IPR039763"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC2"
FT                   /inference="similar to AA sequence:UniProtKB:Q04371"
FT                   /protein_id="CAG62648.1"
FT                   /translation="MSLPRRCMTSDKGTFGAYTAEERWPIIVQNAIDDVDAELKDIKDR
FT                   GDDSEQILEDGELLKKQLIEFREEILANTPLRKFTEQEIAIANIPLSFNETLDETADIN
FT                   KSWISSEWLFTEVYMYRRINVLFKSKKSPFWQEFDIFDRLKQSTFKASLHGVVELAIRY
FT                   KKLSHELQSLDLSSGESQEVLKILFKEFTEVSLWGNATDLSLLTSISLEDIKSIQGAKA
FT                   REASESKIVVNDTDKAWDALISSKPGNRRVDFVLDNSGFELYADFLMGAFLLRSKLASK
FT                   CIFHAKDMPYMVSDVMMKDFETLLKDLEDRDFFPVTSGSEDDLALNDLATDIRDFIKEG
FT                   SFEFRTDSFWTTELDYWNIDPSEKKYHGAEIHNDFTKSNLVIFKGDLNYRKLTGDRTWP
FT                   RTTSWEAAIGPLAHNGVPTLSLRTCKATVQVALPEGKDEELSAVWEKDHPGQGSWWCCS
FT                   GKWAVICFSDGK"
FT   gene            <752098..>753375
FT                   /locus_tag="CAGL0M07469g"
FT                   /old_locus_tag="CAGL-IPF9558"
FT                   /old_locus_tag="CAGL-CDS2607.1"
FT   CDS_pept        752098..753375
FT                   /locus_tag="CAGL0M07469g"
FT                   /old_locus_tag="CAGL-IPF9558"
FT                   /old_locus_tag="CAGL-CDS2607.1"
FT                   /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
FT                   YMR026c PEX12 required for biogenesis of peroxisomes
FT                   -peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07469g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62649"
FT                   /db_xref="GOA:Q6FJC1"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC1"
FT                   /inference="similar to AA sequence:UniProtKB:Q04370"
FT                   /protein_id="CAG62649.1"
FT                   /translation="MSFFSNLPATATSNSGEGVSSLFPTIFEIVSSQEIDELLPASIRY
FT                   ILTNYWISRYPSWTTLQVNNYFEEWFGVGVQGLVEWYHIDKYNSTFVDKFYGLQRFNNS
FT                   DPVLTQAQAIRQAREAGNPNLQWPKSLQLTNGQKRVVFLQKIILPYISHRLSEVYNKLK
FT                   SRIAMLSTELDDETGGADKKTKLKRFVIKWFVRLYPLWNSLTSLLNMVVKLAFLTGRTG
FT                   SMTFLEYLFKIEYTRMTLPLENGSISPSKTLKNNERPTRTNMSSIRGIFESAIGSLGGM
FT                   AGLTGSQLFPAFIFMLRVYQWWNTEDLTTKLQKKLNDIDKDIPRPPNAHISEEASNDSF
FT                   EDSEMSQISEKIGTKKSDICPICKDSIENPCVLETGYVTCYACALDYIPKHEGRCPVTG
FT                   KRLLGCQFDSESGEWKVVTGIRRLLV"
FT   gene            complement(<753496..>754350)
FT                   /locus_tag="CAGL0M07491g"
FT                   /old_locus_tag="CAGL-IPF9557"
FT                   /old_locus_tag="CAGL-CDS3726.1"
FT   CDS_pept        complement(753496..754350)
FT                   /locus_tag="CAGL0M07491g"
FT                   /old_locus_tag="CAGL-IPF9557"
FT                   /old_locus_tag="CAGL-CDS3726.1"
FT                   /note="weakly similar to uniprot|Q04368 Saccharomyces
FT                   cerevisiae YMR025w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07491g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62650"
FT                   /db_xref="GOA:Q6FJC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC0"
FT                   /protein_id="CAG62650.1"
FT                   /translation="MDNRVNEVLLNSNIILEANFHYEKLTMVNGLYNGKQPMLFLLLGT
FT                   INDDGVASASEALSVVLNVDSRTGHFSFDKEQLATRIELMKVTHKQDELIGFLTINSKY
FT                   YNYEETIRMILIDFMPQFVGSAIIFSYTPNESSSENKTQQKNTSHLDLSCQLIENYNID
FT                   TCDLKFQIEYNNIEIPVVSGSKSELELDEMPLQDEINYYHDRKKHIKQELSRVISYLGN
FT                   ASSVEQPLNAAILNRAAIITHLLNRNPTNDIETAISNMENEIRLLQTTLEQWEIVNMKD
FT                   NPS"
FT   gene            complement(<754838..>755914)
FT                   /locus_tag="CAGL0M07513g"
FT                   /old_locus_tag="CAGL-IPF9556"
FT                   /old_locus_tag="CAGL-CDS3098.1"
FT   CDS_pept        complement(754838..755914)
FT                   /locus_tag="CAGL0M07513g"
FT                   /old_locus_tag="CAGL-IPF9556"
FT                   /old_locus_tag="CAGL-CDS3098.1"
FT                   /note="similar to uniprot|P36516 Saccharomyces cerevisiae
FT                   YMR024w MRPL3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07513g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62651"
FT                   /db_xref="GOA:Q6FJB9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB9"
FT                   /inference="similar to AA sequence:UniProtKB:P36516"
FT                   /protein_id="CAG62651.1"
FT                   /translation="MMLCRVTRPITFRGFATFGRLQQAVDTAELDQYRSYYLGLKDVIG
FT                   KVPEEVAQRSPSLVALHRRLGLPREFTYSTLARCLTCRTSDLPAKIKNPFVTEASARYL
FT                   AGTANVVPASKKLDNHGLNIFGKNLLTYHVTQYLVKRYPRLPVVVLNAAVDSYLSQRVL
FT                   ASIGKSWGIESEDSPVVNRYLANEPYEITLGKLRFFNNTLKREDGLQLITSKNFSEEAA
FT                   YALAVRSIIAALWASTQNTAKPDSAIHFIKDHILSRKLDVTKIFQFENPTRELAVLCRR
FT                   ENLDLPVSKLIAESGRLSKAPVFIVGVFSGEEKLGEGYGSSLKEAKARAASDALLKWYC
FT                   YEPTEEQAAVIDHGAVIV"
FT   gene            <756146..>756218
FT                   /gene="tRNA-Ala (AGC)"
FT                   /locus_tag="CAGL0M07535r"
FT   tRNA            756146..756218
FT                   /gene="tRNA-Ala (AGC)"
FT                   /locus_tag="CAGL0M07535r"
FT                   /product="transfer RNA-Ala"
FT   gene            <756457..>757920
FT                   /locus_tag="CAGL0M07546g"
FT                   /old_locus_tag="CAGL-IPF9555"
FT                   /old_locus_tag="CAGL-CDS2140.1"
FT   CDS_pept        756457..757920
FT                   /locus_tag="CAGL0M07546g"
FT                   /old_locus_tag="CAGL-IPF9555"
FT                   /old_locus_tag="CAGL-CDS2140.1"
FT                   /note="similar to uniprot|P32559 Saccharomyces cerevisiae
FT                   YMR023c MSS1 mitochondrial GTPase involved in expression of
FT                   COX1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62652"
FT                   /db_xref="GOA:Q6FJB8"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB8"
FT                   /inference="similar to AA sequence:UniProtKB:P32559"
FT                   /protein_id="CAG62652.1"
FT                   /translation="MVGIRFLSHTRQRLPTIYSMVTPRAKSAVSVIRVSGDKAQYVYRK
FT                   LTRRDDVPRSRQACLRGLYNGDNELIDRALVLYFKSPGSFTGEDVVEFQVHGGRAVSES
FT                   VLSAIGSLNNRDQDVEIRMADRGEFSRRSFLNGKADLTGLEGINTLINADTEAQRRAAM
FT                   GSFTGKNKALFNRWRDIAIQNSAQLTAIIDFSEDSDFADEYTAVMAEVRQELMGLRTEI
FT                   GNFIARVTKASIVENGINMTLLGAPNVGKSSLLNQIASDDISIVSDIPGTTRDIVSSIV
FT                   NINGYKVNLFDTAGIRVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPLNVLDLL
FT                   KSSDLSGSEIIFVVNKIDIVDDSCKLSKIQQYIGNNLTGCKICFVSCLKSTGIDELVTV
FT                   LTGKFKTLTQNEENEDPIIVSDRVKEILEKDVLYGIDQFLQIQDDMHDIVIATEHLRYV
FT                   IDGIGKITGEVIGLEEVLDVVFSKFCVGK"
FT   gene            complement(<758110..>758607)
FT                   /locus_tag="CAGL0M07568g"
FT                   /old_locus_tag="CAGL-IPF9606"
FT                   /old_locus_tag="CAGL-CDS4696.1"
FT   CDS_pept        complement(758110..758607)
FT                   /locus_tag="CAGL0M07568g"
FT                   /old_locus_tag="CAGL-IPF9606"
FT                   /old_locus_tag="CAGL-CDS4696.1"
FT                   /note="highly similar to uniprot|Q02159 Saccharomyces
FT                   cerevisiae YMR022w E2 ubiquitin-conjugation enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62653"
FT                   /db_xref="GOA:Q6FJB7"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB7"
FT                   /protein_id="CAG62653.1"
FT                   /translation="MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPP
FT                   DTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE
FT                   SAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL
FT                   GF"
FT   gene            <758940..>760310
FT                   /locus_tag="CAGL0M07590g"
FT                   /old_locus_tag="CAGL-IPF9608"
FT                   /old_locus_tag="CAGL-CDS2347.1"
FT   CDS_pept        758940..760310
FT                   /locus_tag="CAGL0M07590g"
FT                   /old_locus_tag="CAGL-IPF9608"
FT                   /old_locus_tag="CAGL-CDS2347.1"
FT                   /note="weakly similar to uniprot|P35192 Saccharomyces
FT                   cerevisiae YMR021c metal binding activator"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62654"
FT                   /db_xref="GOA:Q6FJB6"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB6"
FT                   /protein_id="CAG62654.1"
FT                   /translation="MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVR
FT                   DAIVVGDIHRKRSCECASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVR
FT                   AKKVLKAQLIGGELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNI
FT                   DDDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAAT
FT                   ETEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDS
FT                   STSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQ
FT                   YRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSI
FT                   QNLTSQAENFIMNMNNSIDNGVSSNTTNNMNNINDTRLQSHYANLVKTEGTISPMFM"
FT   gene            complement(<760610..>762355)
FT                   /locus_tag="CAGL0M07612g"
FT                   /old_locus_tag="CAGL-IPF9610"
FT                   /old_locus_tag="CAGL-CDS1610.1"
FT   CDS_pept        complement(760610..762355)
FT                   /locus_tag="CAGL0M07612g"
FT                   /old_locus_tag="CAGL-IPF9610"
FT                   /old_locus_tag="CAGL-CDS1610.1"
FT                   /note="similar to uniprot|P50264 Saccharomyces cerevisiae
FT                   YMR020w FMS1 suppressor of fenpropimorph resistance
FT                   mutation FEN2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62655"
FT                   /db_xref="GOA:Q6FJB5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB5"
FT                   /inference="similar to AA sequence:UniProtKB:P50264"
FT                   /protein_id="CAG62655.1"
FT                   /translation="MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCT
FT                   VTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSA
FT                   SSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTA
FT                   ELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVS
FT                   WYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTV
FT                   SYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAA
FT                   LQKMHFGSLGKVVFEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQR
FT                   LQALVQDVKQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSH
FT                   QVYEFFKPVLSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDP
FT                   YSKGAYSACYAGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYI
FT                   LKQMK"
FT   gene            <763929..>764702
FT                   /locus_tag="CAGL0M07634g"
FT                   /old_locus_tag="CAGL-IPF9223"
FT                   /old_locus_tag="CAGL-CDS3952.1"
FT   CDS_pept        763929..764702
FT                   /locus_tag="CAGL0M07634g"
FT                   /old_locus_tag="CAGL-IPF9223"
FT                   /old_locus_tag="CAGL-CDS3952.1"
FT                   /note="similar to uniprot|P53438 Saccharomyces cerevisiae
FT                   YMR016c SOK2 or uniprot|P36093 Saccharomyces cerevisiae
FT                   YKL043w PHD1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62656"
FT                   /db_xref="GOA:Q6FJB4"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB4"
FT                   /inference="similar to AA sequence:UniProtKB:P53438"
FT                   /protein_id="CAG62656.1"
FT                   /translation="MSERELPGYTYLPPPRLSYQPSIALVPGVMQVRPPASPASPVGTG
FT                   AGTPGAAGTTGITGISSTTGTTGTGGTALGTVPTSALTNNNNNNNSSSSGNAYMTSALA
FT                   SWNQYQYPWLQHPLLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTG
FT                   MTRGRRDGILKNEPVRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQ
FT                   AITLLRQQVQPQVQMPAPQLPVQSQQLIPQIHHHM"
FT   gene            <765772..>767379
FT                   /locus_tag="CAGL0M07656g"
FT                   /old_locus_tag="CAGL-IPF9226"
FT                   /old_locus_tag="CAGL-CDS1868.1"
FT   CDS_pept        765772..767379
FT                   /locus_tag="CAGL0M07656g"
FT                   /old_locus_tag="CAGL-IPF9226"
FT                   /old_locus_tag="CAGL-CDS1868.1"
FT                   /note="highly similar to uniprot|P54781 Saccharomyces
FT                   cerevisiae YMR015c C-22 sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62657"
FT                   /db_xref="GOA:Q6FJB3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB3"
FT                   /protein_id="CAG62657.1"
FT                   /translation="MASVVDQVHMSMNATAHAAGAASAGAVMAAPSLLDKLQGMSYLQM
FT                   FVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSC
FT                   VSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSL
FT                   NGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCG
FT                   DYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKD
FT                   HIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSS
FT                   LACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPP
FT                   VLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWVEGSPANE
FT                   AKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKD
FT                   DLLLSFKKRDPVTGEIKE"
FT   gene            complement(<767857..>769278)
FT                   /locus_tag="CAGL0M07678g"
FT                   /old_locus_tag="CAGL-IPF9228"
FT                   /old_locus_tag="CAGL-CDS2235.1"
FT   CDS_pept        complement(767857..769278)
FT                   /locus_tag="CAGL0M07678g"
FT                   /old_locus_tag="CAGL-IPF9228"
FT                   /old_locus_tag="CAGL-CDS2235.1"
FT                   /note="similar to uniprot|Q04347 Saccharomyces cerevisiae
FT                   YMR014w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62658"
FT                   /db_xref="GOA:Q6FJB2"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="InterPro:IPR037393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB2"
FT                   /inference="similar to AA sequence:UniProtKB:Q04347"
FT                   /protein_id="CAG62658.1"
FT                   /translation="MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKN
FT                   NKKVTKILESSDKEKVRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQ
FT                   PVLEAVEAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKW
FT                   AADHEYVKMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDL
FT                   FLNINKQKRLQKQQEKKKSTKTSSKQHEEENEDASGDDFGYSDNDDPRYNENIDEDELL
FT                   KQYDGMLVGSDDESDEEEDSAKSSASEDETSERIGKQEPVPKLKKKEKAKLPELMVGYV
FT                   SGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREIEKEMEKK
FT                   RKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEHRKKLEKIEDHPSWVAKKMAED
FT                   KEKNAKFAGKKITFD"
FT   gene            <772364..>773746
FT                   /locus_tag="CAGL0M07700g"
FT                   /old_locus_tag="CAGL-IPF9229"
FT                   /old_locus_tag="CAGL-CDS2150.1"
FT   CDS_pept        772364..773746
FT                   /locus_tag="CAGL0M07700g"
FT                   /old_locus_tag="CAGL-IPF9229"
FT                   /old_locus_tag="CAGL-CDS2150.1"
FT                   /note="similar to uniprot|P20048 Saccharomyces cerevisiae
FT                   YMR013c dolichol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62659"
FT                   /db_xref="GOA:Q6FJB1"
FT                   /db_xref="InterPro:IPR026566"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB1"
FT                   /inference="similar to AA sequence:UniProtKB:P20048"
FT                   /protein_id="CAG62659.2"
FT                   /translation="MEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVVVQMVIVVHLVCF
FT                   VLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGL
FT                   MKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATA
FT                   PNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEK
FT                   ITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLL
FT                   IVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLI
FT                   VSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFI
FT                   VGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSMEKLLA
FT                   QS"
FT   gene            complement(<774048..>777851)
FT                   /locus_tag="CAGL0M07722g"
FT                   /old_locus_tag="CAGL-IPF9230"
FT                   /old_locus_tag="CAGL-CDS0207.1"
FT   CDS_pept        complement(774048..777851)
FT                   /locus_tag="CAGL0M07722g"
FT                   /old_locus_tag="CAGL-IPF9230"
FT                   /old_locus_tag="CAGL-CDS0207.1"
FT                   /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
FT                   YMR012w translation initiation factor eIF3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62660"
FT                   /db_xref="GOA:Q6FJB0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR027523"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJB0"
FT                   /inference="similar to AA sequence:UniProtKB:Q03690"
FT                   /protein_id="CAG62660.1"
FT                   /translation="MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKL
FT                   QNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQY
FT                   QALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKP
FT                   TSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVP
FT                   AFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTL
FT                   YDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI
FT                   DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNG
FT                   TAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNL
FT                   PNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGL
FT                   DENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLA
FT                   NTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENL
FT                   YSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNG
FT                   VNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAK
FT                   INKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK
FT                   HILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTL
FT                   LKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYK
FT                   QSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLT
FT                   LLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDS
FT                   FELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSL
FT                   GVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAER
FT                   IFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNK
FT                   KETTNPDLADKSVDELLSFIEGEDGKSSKTTKKSKSKGKNKK"
FT   gene            complement(<779281..>779985)
FT                   /locus_tag="CAGL0M07744g"
FT                   /old_locus_tag="CAGL-IPF9231"
FT                   /old_locus_tag="CAGL-CDS4130.1"
FT   CDS_pept        complement(779281..779985)
FT                   /locus_tag="CAGL0M07744g"
FT                   /old_locus_tag="CAGL-IPF9231"
FT                   /old_locus_tag="CAGL-CDS4130.1"
FT                   /note="weakly similar to uniprot|Q8TFJ1 Pichia angusta"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62661"
FT                   /db_xref="GOA:Q6FJA9"
FT                   /db_xref="InterPro:IPR035179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA9"
FT                   /protein_id="CAG62661.1"
FT                   /translation="MSLEKKLVYPWVAEIDGSDTSAIFEEIRNPAICEFKTFILSEVGD
FT                   FQIWIERFEDIILLTNMYWYRFYKAGPYYKEGITDIYERHVISNFDNAMIQLVLKTVSA
FT                   KVRELCDSYLQFGAHHKQVTVFGLIDQIRSHYDRDNPLITYKRYYAWLGHMSNISNVER
FT                   ELDIRRLITDLLDDMPVMELSDKLSFEEQANKRAEISKYKNDIIAYMTIATTPNITADG
FT                   ITRALREKFGDF"
FT   gene            <781830..>782546
FT                   /locus_tag="CAGL0M07766g"
FT                   /old_locus_tag="CAGL-IPF9234"
FT                   /old_locus_tag="CAGL-CDS4099.1"
FT   CDS_pept        781830..782546
FT                   /locus_tag="CAGL0M07766g"
FT                   /old_locus_tag="CAGL-IPF9234"
FT                   /old_locus_tag="CAGL-CDS4099.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62662"
FT                   /db_xref="GOA:Q6FJA8"
FT                   /db_xref="InterPro:IPR035179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA8"
FT                   /protein_id="CAG62662.1"
FT                   /translation="MAYPLLSKLDDIKDEVWLFEKINKPFLSIGFKTIILNEIGDFQKW
FT                   ILQLEWIIKSTDHLWYQFYQAGPFNFAGISDPHKQYIVSVFDGALKKLISNTVSERVNI
FT                   DYEDFLQSHLSNCKITSFDLLEILKIEYDWVNAEKYFRENFEWLQNMDNFNTTQKMLRC
FT                   QRLVHIITEPLVDKIQMTKETKNEIDDFKQQIAANLMIALSPNHTQEILRHYRIGKRLD
FT                   LYDITNTIAYLEDKSI"
FT   gene            complement(<783270..>783341)
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="CAGL0M07788r"
FT   tRNA            complement(783270..783341)
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="CAGL0M07788r"
FT                   /product="transfer RNA-Glu"
FT   gene            complement(<783505..>784724)
FT                   /locus_tag="CAGL0M07832g"
FT                   /old_locus_tag="CAGL-IPF9237"
FT                   /old_locus_tag="CAGL-CDS5600.1"
FT   CDS_pept        complement(join(783505..784319,784445..784724))
FT                   /locus_tag="CAGL0M07832g"
FT                   /old_locus_tag="CAGL-IPF9237"
FT                   /old_locus_tag="CAGL-CDS5600.1"
FT                   /note="some similarities with uniprot|P21651 Saccharomyces
FT                   cerevisiae YJR021c meiotic recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62663"
FT                   /db_xref="GOA:Q6FJA7"
FT                   /db_xref="InterPro:IPR015159"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA7"
FT                   /protein_id="CAG62663.1"
FT                   /translation="MEQRLETEDLHSESTDISSSIDADDLLHSGDSSLGEADKQIMEWA
FT                   GKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQLENCNHSKEEDIVDQVYKLDV
FT                   NINNQLQDWKKSFSDQLKSINHNSNLGQIKNLTECMANQEANILGAIRHNSTILKDECR
FT                   DIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELLLSIDKQLHNIDLALIKEKDQ
FT                   YKVQFKAFKRSLRDMITSNRNNVEDTVVNTVQVTIERKLEDMFDKMFDQKLLGKLRLLI
FT                   TKGEIPVPEGSKLANAIPLNRHTNDYDLNGTTWTDSSSQDGPRTRARFRTKNKVTKPRK
FT                   SEISRTIIPWCEISSPPVEYTSDL"
FT   gene            <785153..>785470
FT                   /locus_tag="CAGL0M07854g"
FT                   /old_locus_tag="CAGL-IPF9238"
FT                   /old_locus_tag="CAGL-CDS5460.1"
FT   CDS_pept        785153..785470
FT                   /locus_tag="CAGL0M07854g"
FT                   /old_locus_tag="CAGL-IPF9238"
FT                   /old_locus_tag="CAGL-CDS5460.1"
FT                   /note="similar to uniprot|P47093 Saccharomyces cerevisiae
FT                   YJR022w pre-mRNA splicing factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62664"
FT                   /db_xref="GOA:Q6FJA6"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA6"
FT                   /inference="similar to AA sequence:UniProtKB:P47093"
FT                   /protein_id="CAG62664.1"
FT                   /translation="MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIR
FT                   LLRGSEIVVCGLLEDAKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKL
FT                   K"
FT   gene            complement(<785578..>786204)
FT                   /locus_tag="CAGL0M07876g"
FT                   /old_locus_tag="CAGL-IPF9239"
FT                   /old_locus_tag="CAGL-CDS4382.1"
FT   CDS_pept        complement(785578..786204)
FT                   /locus_tag="CAGL0M07876g"
FT                   /old_locus_tag="CAGL-IPF9239"
FT                   /old_locus_tag="CAGL-CDS4382.1"
FT                   /note="highly similar to uniprot|P47095 Saccharomyces
FT                   cerevisiae YJR024c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62665"
FT                   /db_xref="GOA:Q6FJA5"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR027514"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJA5"
FT                   /protein_id="CAG62665.1"
FT                   /translation="MGEAAELICTLCKQFYHLNWCTGTGGGISIRERNGESDVAYIAPS
FT                   GVQKELMRPEDLFVMDLIKGDYLSIPRGLKPSACTPLFLACYKKRNSGAVIHTHSQNAV
FT                   MCSLLFDKEFKISNIEQIKAMPNHGYYDTLTIPIIENMAHEDELIDQLNDVLDKYSQDT
FT                   VAVIVRRHGIFVWGPSIEKCKIYNEAIDYLLELALKMHQYNIPLP"
FT   gene            <786678..>789155
FT                   /locus_tag="CAGL0M07898g"
FT                   /old_locus_tag="CAGL-IPF8050"
FT                   /old_locus_tag="CAGL-CDS0748.1"
FT   CDS_pept        786678..789155
FT                   /locus_tag="CAGL0M07898g"
FT                   /old_locus_tag="CAGL-IPF8050"
FT                   /old_locus_tag="CAGL-CDS0748.1"
FT                   /note="similar to uniprot|P46675 Saccharomyces cerevisiae
FT                   YLR045c STU2 suppressor of a cs tubulin mutation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62666"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA4"
FT                   /inference="similar to AA sequence:UniProtKB:P46675"
FT                   /protein_id="CAG62666.1"
FT                   /translation="MADEEVDIERLTLQEKLDHKLWKARQRGYQDLQKELEEGILDPSF
FT                   FDQLWGETGRFEQYIQDSNVVALESAVVALNSFLGKKISKIVDSGDDTIKTHAKFQVDA
FT                   WVPVLIIKPLSSTRAATKKNAMECIIKLVSLMDSVDYTISAILTKLPSVIKQPKPTAAI
FT                   INILNQILTKFQCNLLASADLLKQLLEPLPKLSSHADRNVRSETMNLIVTVFLKVDGFQ
FT                   NRALLDELLLNSLKPIQIKDMEKMIDKVKDQKPEIMPYVWEDVIAKNKQQFNVDEDGDT
FT                   VMMGSNTEPKQDNTNNNVNALDSLVAGDTILDKFPDEFHSRVESQKWKDRAEALEEFYD
FT                   HALSKLKKIDGNANENYTNLFSMYGHIISKDINVQVVTIAAESIDKICHALPKQKLTKH
FT                   LIQLVFNPLLERTKEKKPTLLDAIRKTLKTLVEHSNPVLPHNEDMLQLILQYMEHKVPQ
FT                   IRMECTSLFNYVLQLEAPGFDIHSSYLFGEISRIVPKVVKIVNDTNPSIRQVGFDCFAT
FT                   LVTLLGKRPFIDSLDKLDTQKRKKIEELINSKSRPSSGALPGTRAGATSTVLPVKRPPT
FT                   SPLKKPPTSTSPRSRVLLTSRSLTKPNFGGSQPAPVAELTTGTLTPNKRFDKAVDNGVQ
FT                   GITSNGGANYVSKFNSERERWDKERGGLLSSIKKLEDTNAELTARNFELVDKLTSFEKE
FT                   REQQNLVINSKNEENGKLLEKIDFLEMKVKELQEKLDSNLSSARTFSLGTELSVPEAKR
FT                   VVESSDDELPKRVNSLRINSRASTLSSSDQQLFSRQFSGRDDEESWKRAAEVTRKLKER
FT                   IETMKARNRELSN"
FT   gene            complement(<789467..>791161)
FT                   /locus_tag="CAGL0M07920g"
FT                   /old_locus_tag="CAGL-IPF8048"
FT                   /old_locus_tag="CAGL-CDS1705.1"
FT   CDS_pept        complement(789467..791161)
FT                   /locus_tag="CAGL0M07920g"
FT                   /old_locus_tag="CAGL-IPF8048"
FT                   /old_locus_tag="CAGL-CDS1705.1"
FT                   /note="highly similar to uniprot|P06169 Saccharomyces
FT                   cerevisiae YLR044c PDC1 pyruvate decarboxylase or
FT                   uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62667"
FT                   /db_xref="GOA:Q6FJA3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJA3"
FT                   /protein_id="CAG62667.1"
FT                   /translation="MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRW
FT                   AGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI
FT                   SSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPV
FT                   YLGLPANLVDLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACA
FT                   SRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL
FT                   ILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEA
FT                   IKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTP
FT                   FPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMI
FT                   RWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGE
FT                   WDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKLTASINAKQE"
FT   gene            complement(<792135..>794111)
FT                   /locus_tag="CAGL0M07942g"
FT                   /old_locus_tag="CAGL-IPF8044"
FT                   /old_locus_tag="CAGL-CDS1242.1"
FT   CDS_pept        complement(792135..794111)
FT                   /locus_tag="CAGL0M07942g"
FT                   /old_locus_tag="CAGL-IPF8044"
FT                   /old_locus_tag="CAGL-CDS1242.1"
FT                   /note="similar to uniprot|Q12209 Saccharomyces cerevisiae
FT                   YLR047c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62668"
FT                   /db_xref="GOA:Q6FJA2"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12209"
FT                   /protein_id="CAG62668.1"
FT                   /translation="MNAYDGNSTVPDRRAEKLAQSRIADLYSRACFTCALIIICVMIPS
FT                   YNRVTLSQRYFQVMHYFRHHFVARHAWIHRLRVYHNKSLQQCIFWCSFVGIFTLHGSQG
FT                   NFFIVVKKLGRLAVALMPPLLFLTLRPSPLPKTLYLTLLPFHKWIGRIVVLAAFLHSVF
FT                   YAYVMCANKVLLEKMRKPANLYGLIAMVLFVLIVVTSLAPIRRRAFRVFYTVHYLSTWL
FT                   VVVLIYMHARPGVPYYTAMSLSILVAQVIYRVRITRVCVAKVQRISPTLTLMEFPLEQL
FT                   ALRPQYPGAHVRIRPAKGGGLARAVDYLVNGLVVPLQHPFTIANLPKDDKIQLIIRSEK
FT                   FPMRDGMRYHVSGAFEPVINFLTKPRNLADSLVKYRSTFALGRGTQALLGSPLNYIVDS
FT                   QRVLIVVGGTGISFGLPLLRVLNFNGCLVKLKWAIRDFRDLRILSHIRNNFEGMEVYIS
FT                   GQGAEDEIEIEYTDNDFSDNEHTPLLSHHHMQGGSLLDSMDHVGSGNARAMDPGAKRDT
FT                   KATNNANGVNSANGANGGYCLRNVARENTADEIDFTDVFKNDTEHKRVPVGVFREPSII
FT                   EEQEDRDKKIAIPSGVKVFHGRPRLDQHDYNWCMESECGVNDVSVDKRRVWVVAAGPPG
FT                   LIDATSRWSTDSGLRFHGESFAV"
FT   gene            complement(<794833..>794903)
FT                   /gene="tRNA-Gly (GCC)"
FT                   /locus_tag="CAGL0M07964r"
FT   tRNA            complement(794833..794903)
FT                   /gene="tRNA-Gly (GCC)"
FT                   /locus_tag="CAGL0M07964r"
FT                   /product="transfer RNA-Gly"
FT   gene            complement(<795243..>795569)
FT                   /locus_tag="CAGL0M07986g"
FT                   /old_locus_tag="CAGL-IPF8039"
FT                   /old_locus_tag="CAGL-CDS5387.1"
FT   CDS_pept        complement(795243..795569)
FT                   /locus_tag="CAGL0M07986g"
FT                   /old_locus_tag="CAGL-IPF8039"
FT                   /old_locus_tag="CAGL-CDS5387.1"
FT                   /note="highly similar to uniprot|Q02772 Saccharomyces
FT                   cerevisiae YJR034w involved in assembly of cytochrome
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62669"
FT                   /db_xref="GOA:Q6FJA1"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA1"
FT                   /protein_id="CAG62669.1"
FT                   /translation="MGASCKDQKRAVAICLQRSPCVMIERHKPQECLDNPELSKDLPEL
FT                   CIAQMKAFLDCKRGMVDMTKRFRGNAPLSTGKYDQQYDKLCSGDFNPREEMNKLNTLNS
FT                   SEKE"
FT   gene            <795893..>800059
FT                   /locus_tag="CAGL0M08008g"
FT                   /old_locus_tag="CAGL-IPF8038"
FT                   /old_locus_tag="CAGL-CDS0147.1"
FT   CDS_pept        795893..800059
FT                   /locus_tag="CAGL0M08008g"
FT                   /old_locus_tag="CAGL-IPF8038"
FT                   /old_locus_tag="CAGL-CDS0147.1"
FT                   /note="similar to uniprot|P47104 Saccharomyces cerevisiae
FT                   YJR033c RAV1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62670"
FT                   /db_xref="GOA:Q6FJA0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA0"
FT                   /inference="similar to AA sequence:UniProtKB:P47104"
FT                   /protein_id="CAG62670.1"
FT                   /translation="MSLTFLPGKPNDTVTSVCQRLWLDQTLLAYCSGNNLIIMSNELTK
FT                   LQTLYLDEDCVSVDINATNGFIAVGFGNKTKIYKPMYQVMKNPKWVNCCEVFHDESKVN
FT                   CVKWGNANELVIGSKYLSLWNIKDEFGDYRPVLLWTKLQPKPVYCCDISQDSQLIASYG
FT                   KYEKTVKLWKRVSISGEENVFNVTLLKHDAPITALKWKRNSIDDDINRASQVLFTLCED
FT                   RQLRVWFCYKLDSCHTVDLWGSLTLSHRQRYCLIIDNWLLSYCSKNSKLRSIDRNTIVN
FT                   SDVVLLADSEGNVEIHALDHLSNDPPRIMKKRLLHNKRLHKDSFVAKPDILYFSEVQPF
FT                   TSKDNILSIVIHDLKGVIRHSTISLAELLDNDKEVIGTLEHKFTGHNKSIQKLIRSSDG
FT                   EALLTTTRFSENCVWTPQYLGHGITLRMKNIICTESPIETAVVHEKGKLVIALLQNNKL
FT                   QAWRCPNYDSKMSDTKLSTLEAELTLQKDKTVKPILMLNTPEEKHNHDRHFIAIFYDDG
FT                   SINAFEVSERRGISEIRSQNLALDGREIHQLSTIDPVHRTFNANRPLLAVCTTGGTVIT
FT                   FRAKIDYEKLELSWIQAHEINTGGQKLRLVRGSSTGKMCIVDQSEKIMSLWDMRRGVLE
FT                   YEEHFEEPILDIDWTNTVHHQSVVSIGFESHVILYTQLRYDYTNKTPSYLPIEDINVIS
FT                   HTAHKIGDSIWMKDGIFVVASGNQFYVKDKTLDTNDPFTHASIGSRMIFSNDLFHLSSV
FT                   LNGPLPVYHPQFLIQALYANKLELVKELLLRLFLELRKLQLNAKNIIDLDSTLNIEPYK
FT                   FLYRLNKDYPKEIFPAPYQEFNEQVAGQLSEQLTKIALPYMTRHQQITLMTVITTVIEL
FT                   MKHQSTVDFNGLRFLLGTKLYQSHKKSQKSVLMRDVSWALHSDNKELLMSILGAQILSW
FT                   QQARQYKIAYWAKQDDLLASFEKIAKYEFSKDDTRDPNRCAVFYLALKKKQVLSSLWRV
FT                   CPGHPEQQKMMKFLGNDFKQSRWRTAALKNAFVLSSKHRYIEAASFFLLADSLKDSVNV
FT                   ICRQLKDIDLAIAVCRVYEGDNGPILAEFLTKEVLPTAIVDNDRWTTSYIYWKLRKQEL
FT                   AIKALITAPYDLEDNKQLVEENKVVNKSFLVEDPALLFLYNHLRNRNLRYFLASLDLSN
FT                   EYERYLILRATEILCRMGCDYLAISLVKNWNFIDKPKVATKLPFSPIKDQTYSGINAMT
FT                   EEPTSTNKVRKSLFDMFDKSGEDNTSSSSANNVTKSVLDDFNSNNNLRTSSILDQFKPS
FT                   GGLNTNTDSLCTQKIEKNPDQQPKNLLDAFTYNNVPEGKENDNKLTEKSVPNKPRSLLD
FT                   DFETIPSTSVTNSSQNSVENKTVTEENVALRSEPPKVKNLLDDFM"
FT   gene            complement(<800149..>801312)
FT                   /locus_tag="CAGL0M08030g"
FT                   /old_locus_tag="CAGL-IPF8036"
FT                   /old_locus_tag="CAGL-CDS2853.1"
FT   CDS_pept        complement(800149..801312)
FT                   /locus_tag="CAGL0M08030g"
FT                   /old_locus_tag="CAGL-IPF8036"
FT                   /old_locus_tag="CAGL-CDS2853.1"
FT                   /note="similar to uniprot|P47103 Saccharomyces cerevisiae
FT                   YJR032w Peptidyl-prolyl cis-trans isomerase CYP7"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62671"
FT                   /db_xref="GOA:Q6FJ99"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ99"
FT                   /inference="similar to AA sequence:UniProtKB:P47103"
FT                   /protein_id="CAG62671.1"
FT                   /translation="MKVYLDIAIAGEQIGRIVCELYNDKAPKAVENFHRLCVGSGSVGG
FT                   IHLTYKRSCFHRVIRNFMIQGGDLVFGKEDNLDSDKVGLGGCSIYATEEEIKDDTKELQ
FT                   CHGLFEDENVGEFDEPFLLAMANTGSPNTNSSQFFITTYPSPHLTGKHSIFGRVIHGKS
FT                   VVRTIEYGKVDKEGTPENLVVIEDCGDWDETMSIPLYNASNSTIGGDIYEEYPDDDTHF
FT                   DSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLF
FT                   IELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRY
FT                   DEALKNYRLCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFFR"
FT   gene            <801812..>805744
FT                   /locus_tag="CAGL0M08052g"
FT                   /old_locus_tag="CAGL-IPF8035"
FT                   /old_locus_tag="CAGL-CDS0184.1"
FT   CDS_pept        801812..805744
FT                   /locus_tag="CAGL0M08052g"
FT                   /old_locus_tag="CAGL-IPF8035"
FT                   /old_locus_tag="CAGL-CDS0184.1"
FT                   /note="similar to uniprot|P39993 Saccharomyces cerevisiae
FT                   YEL022w GEA2 or uniprot|P47102 Saccharomyces cerevisiae
FT                   YJR031c GEA1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62672"
FT                   /db_xref="GOA:Q6FJ98"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ98"
FT                   /inference="similar to AA sequence:UniProtKB:P39993"
FT                   /protein_id="CAG62672.1"
FT                   /translation="MLVSDPNTIILRECRELLYVIASERQDEYIPAVPDLIGGSNEYSE
FT                   DEEDTQKAELMKGEGTEDVDDKTAVKNQLQTLIDTVLLSQTLDNIDACTIVAPFNRTLI
FT                   SPRLNREATIRTLDALEKFINFEVINVNMSNYSTAFRMLIDSLNNISFDAYDKTSDDSI
FT                   LFKTLVLLRSSITKNSFEILSDSVAYDLLKTTITLACNSKRSPLLQEYARSSIYELTAI
FT                   AFNKIRSLKSSDDTNNYINDKSLGSSTLKKYLANRSSSEEDSMGLKGDEYFNSTVDLIK
FT                   ENKYKDPNCGLPVIKRYLQLLLSLLTIDQDNKHTKQVKALGFSLIICGIEVAGKDIILF
FT                   PSLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIELTFSHICD
FT                   ILLDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLNRMDLANII
FT                   SGTLCKLLTSNGNDDINTWLLSFESLEIFINFMYEMTIKNASMSTNGIKEGSDIISQKK
FT                   KKIEYLSCVDRFNKKPKEGITYFHRSGFLKTLSDKDIATFLFENKGPLNKQKIGLLLCD
FT                   PNEQKLLQSYMQNFDFRDFRLDEALRIMLSKFRLPGESQQIERIIEMFSEVYSSQNERK
FT                   NENIQPESIDSNEADSELCVSISNKNVTCDADSAFVLSYSLIMLNTDLHNPQIKTHMSF
FT                   SDYTSNLRGCYKGADFPDSFLAKLYNSIKEKEILMPEEHHGNEQLFKDDWNNLIASAFI
FT                   LTKPSSKIQEHEERTKDFTDFIGAIFETFGFSLVSAFLSTTHANQISSNNTRLFAIIEK
FT                   CGRITSIYGLSAPYNKVIDSLLKMTVLIGNLDKELRLVENDNDDYAQIEVESSTSNEAI
FT                   CVSNESIAFGRDEKAQLSYITAYKLLNLEKNNIGLLPDTLETLIEVLTILYDKHIIDMS
FT                   YIDNVNELMRCDILPRTPTEITIKKEALNRSLLSTFASYIKGDEGPSKEQISLSELTIS
FT                   LVREHNVFTALNAHPKLINSGPMKSVLSLTSNARYNSRKNYCNYNFFFLVEFLIKLCID
FT                   NNIIEECGGSMINHLENHSNTPGITTRSRYAIMIIKNLINKHLGEQDKIIIDTLTFLNS
FT                   EDKDLQENDFDLFTTLINELISHSEKNLTVLNNPLFWRALSRACEYNILIETVSSILDN
FT                   FVLNEDTDLTDQIMIHLLFIQTIHQSKALTKLLENITKLPQNYSDANVPHLIELLLNNH
FT                   DEPLRVQVEQCLVALTKECSSSEQPEPSNLVQKYYLPVLSRNITDENVVVSLVNIITTV
FT                   SNQCTDTNSWNKEELKKIMMPFVNHE"
FT   gene            <806323..>808878
FT                   /locus_tag="CAGL0M08074g"
FT                   /old_locus_tag="CAGL-IPF8033"
FT                   /old_locus_tag="CAGL-CDS0687.1"
FT   CDS_pept        806323..808878
FT                   /locus_tag="CAGL0M08074g"
FT                   /old_locus_tag="CAGL-IPF8033"
FT                   /old_locus_tag="CAGL-CDS0687.1"
FT                   /note="weakly similar to uniprot|Q05848 Saccharomyces
FT                   cerevisiae YJR030c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62673"
FT                   /db_xref="GOA:Q6FJ97"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ97"
FT                   /protein_id="CAG62673.1"
FT                   /translation="MDIHTLRSRWAYNVQLLKQLQWACTDTAKRSLNGTISNIEASSFA
FT                   NNLQKCTEALQFCIQKSLTIERTLKNYEIDVPLPVIKDVLLEQELMKYYTVILMEGCKL
FT                   IFDYSISIFRIGTEPRFMLCLIKLYLNLDSITELLGNEGNQFSDLLNSFEYQFMTQYNI
FT                   INCNTIHLDQVRDIFAKSNPLIAPPLLTVNDIEKRGYFFLSSVDLHIDNKLIEIAQLKN
FT                   GHLAVFYVNSQRQSFSTNGAKQLLKELVEGRMELLNMGRTLLFQTLKQRDMVIFLEFED
FT                   SLELVTNNSLTKKLLIQCVDKVSWCTYWKIYLENLFSEEQARTNVKASTSMLNPSHSFQ
FT                   NFKIKHTKLSELRPVSHQGIALNIPQKKSQNCQANITKSDDLEEDPGFKFAIHQSNPIN
FT                   EIYTSQTEELITSPSLNEIEYLSYDKLIALDRSLELTLSPKLLESPREANYKTVSQTFS
FT                   LDRINNISQNTPEVSDQESIVSNDELEKEPVFNPSVEDHKPQLLRKKSSLLSIFSNKNK
FT                   SKNKNNLKLEINSQMSSSNLSLNSASSSRTFFSVNSNDSTSTTVSDKYIEDSDRFQLDN
FT                   TTSILQLKVTKASCWDKSSWQVLSSFPLLLSLVKDHEAVYLTLQNPSNSGRFKFVTRIS
FT                   NIWKTTRSTAKDIQISIPTKDILATILDDLTNTTPRYQVLSLRTEEAERLKNTIDHCIN
FT                   GDMLSSISNSTTTRTLSSDASSSYMSQVSSNVSRSSTEVSDLNVHDFKSMASVKNILVL
FT                   SDIKARLHTKNNGRWCPHHIGLVNIYSLETPNNKKGIRFELTTDTRTTFQFNSKIHDLK
FT                   RLGRTGIAMIDDSEYLFEFPNNVITEQIYRYIAPSHPMI"
FT   gene            <809185..>809559
FT                   /locus_tag="CAGL0M08096g"
FT                   /old_locus_tag="CAGL-IPF9948"
FT                   /old_locus_tag="CAGL-CDS5128.1"
FT   CDS_pept        809185..809559
FT                   /locus_tag="CAGL0M08096g"
FT                   /old_locus_tag="CAGL-IPF9948"
FT                   /old_locus_tag="CAGL-CDS5128.1"
FT                   /note="weakly similar to uniprot|P29461 Saccharomyces
FT                   cerevisiae YOR208w PTP2 protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62674"
FT                   /db_xref="GOA:Q6FJ96"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ96"
FT                   /protein_id="CAG62674.1"
FT                   /translation="MQLKNTPLFVTCIEYTHTLPNNTRTPSNLNKYLTTIGKLTLLTNE
FT                   CIPDADFLSNSVEVHEPSFETVVMMLQLCELPNVSSTDGKFHHTDITPRVGLLPSVRLG
FT                   RSHHRLRQYRKSFAPIREFH"
FT   gene            <810184..>811352
FT                   /locus_tag="CAGL0M08118g"
FT                   /old_locus_tag="CAGL-IPF8031"
FT                   /old_locus_tag="CAGL-CDS5366.1"
FT   CDS_pept        join(810184..810492,811107..811352)
FT                   /locus_tag="CAGL0M08118g"
FT                   /old_locus_tag="CAGL-IPF8031"
FT                   /old_locus_tag="CAGL-CDS5366.1"
FT                   /note="highly similar to uniprot|P46990 Saccharomyces
FT                   cerevisiae YJL177w RPL17B or uniprot|P05740 Saccharomyces
FT                   cerevisiae YKL180w RPL17A"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62675"
FT                   /db_xref="GOA:Q6FJ95"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ95"
FT                   /protein_id="CAG62675.1"
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQ
FT                   KYLDQVLEHQRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFIQGLLQNAAANAEA
FT                   KGLDATKLYVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKAAEK
FT                   KLVRLSSRQRGRIASQKRITA"
FT   gene            complement(<811750..>813732)
FT                   /locus_tag="CAGL0M08162g"
FT                   /old_locus_tag="CAGL-IPF8029"
FT                   /old_locus_tag="CAGL-CDS1232.1"
FT   CDS_pept        complement(811750..813732)
FT                   /locus_tag="CAGL0M08162g"
FT                   /old_locus_tag="CAGL-IPF8029"
FT                   /old_locus_tag="CAGL-CDS1232.1"
FT                   /note="similar to uniprot|P34237 Saccharomyces cerevisiae
FT                   YKL179c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62676"
FT                   /db_xref="GOA:Q6FJ94"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ94"
FT                   /inference="similar to AA sequence:UniProtKB:P34237"
FT                   /protein_id="CAG62676.1"
FT                   /translation="MDGSVYHHAADLWAKADLTNLQKDLDTSILAIKDRESSSLESRKH
FT                   LASETKVFKKLESDEKLNGINKIIKQYQQEIDSLTKRAKSAEQDLLDFYSKISEAPDPL
FT                   PLLKNSADNVEKIEDSDKLNGKITELEDKLARCADYDKIKERLSDLEQSSVKTLAKRLA
FT                   AKEQELNSTWEEKQRNWSEKEKELSKQITILQDNNKALEATIAKKIDIEGGETTSTGTP
FT                   SSMDFSASTERNLLMQELESSQSRVFQLEKRNEELSGKLAKATSEAEKESDLAAKQQQI
FT                   SQLESENALIMASSERERTNLNNITRELQQKVDNLKTESVSYKNELETLRRKVNTFSDY
FT                   NEIKSELEALKKIEFGASDDADDEDDQNQESNKVQKSLMNANKKLQATLVELRTENISQ
FT                   KELNSKLQKEIAQLTDKLGELEEANAKLEIDLQQIEDIDQKFNDTASMVSGATRQMNNR
FT                   TSKGRGKLSPTSSIVGIPEEGEYEPMQNTAILPIITKQRDRFRNRATDLEKQLRQLNQD
FT                   KGKLRQEMQILKAENTKLYEKVRYLTNNQNSSTIGVSSLDTEAQLSHSYDESLNPLSKF
FT                   KKTERDYYLNRHLSVWEKLFSTFAKIVLQNKSTRLIFLLYCVCLHGLVFMMSMYVINIS
FT                   GYLTPEVNVVQTSASKIGNAVDKNI"
FT   gene            complement(<814364..>815722)
FT                   /locus_tag="CAGL0M08184g"
FT                   /old_locus_tag="CAGL-IPF8028"
FT                   /old_locus_tag="CAGL-CDS2378.1"
FT   CDS_pept        complement(814364..815722)
FT                   /locus_tag="CAGL0M08184g"
FT                   /old_locus_tag="CAGL-IPF8028"
FT                   /old_locus_tag="CAGL-CDS2378.1"
FT                   /note="similar to uniprot|P06783 Saccharomyces cerevisiae
FT                   YKL178c STE3 pheromone a-factor receptor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62677"
FT                   /db_xref="GOA:Q6FJ93"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ93"
FT                   /inference="similar to AA sequence:UniProtKB:P06783"
FT                   /protein_id="CAG62677.1"
FT                   /translation="MSFESAIIGLCTLGMLALVPPLAWHTKTKNTPAVILIMWLILMDF
FT                   KCIVNAAIWSGSDFMMKWEGKGWCDIVIKLEVGANVGISCAVTNIIYNLHKILKADNAL
FT                   LKHNSWRKIAQDLSISLLTPIMVMALSYLVQVFRFGIARCYGCLNILSPTWVTTVVYTM
FT                   WLLIWSSIGSIYAVLVLIVYYRKRKDVKDILYCTNSGLNITRFARLLIFCFLIILVMFP
FT                   FSIYLFVKDLRQVGTKFSFRATHSKEFWGTILKFDVGHKFVNVWIYVLMSYLVFLIFGL
FT                   GTDALDMYASFMRLIGLGFTLDKFSAKRDEKNNNRFSAFMESIILHQNSDMQQRYSESL
FT                   TPTSQDCTFDCEMGNFKDAMFSNKPYHINVKKSYVLNDCVLEKIPQGQYLLSDLYSYDD
FT                   QITFHQHSANSLGSLGHVYSISYRSEVNSANTNKEIDTEGSSNGSPITRVESG"
FT   gene            complement(<816472..>817674)
FT                   /locus_tag="CAGL0M08206g"
FT                   /old_locus_tag="CAGL-IPF8027"
FT                   /old_locus_tag="CAGL-CDS2769.1"
FT   CDS_pept        complement(816472..817674)
FT                   /locus_tag="CAGL0M08206g"
FT                   /old_locus_tag="CAGL-IPF8027"
FT                   /old_locus_tag="CAGL-CDS2769.1"
FT                   /note="similar to uniprot|P46992 Saccharomyces cerevisiae
FT                   YJL171c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62678"
FT                   /db_xref="GOA:Q6FJ92"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ92"
FT                   /inference="similar to AA sequence:UniProtKB:P46992"
FT                   /protein_id="CAG62678.1"
FT                   /translation="MAMIKNVIAATAAALMCGSLVEAEVRGYDMIEFSNVGFTGSYTPV
FT                   KKMSNLDNNSTCKCEVGDRTWFQGDNAPLNEHLSVHFRGPLSLEKFAFYTSPNFVINDN
FT                   SSNSQSWNRSAFYDASAQTADNVTFMNNQGADSPCVGKALSYASDNGTSSASSPNVLKA
FT                   DNYVSSDQEYSIFSTVKCPKSGVKNGCGYYRDGIPAFYGFGGETKMFLFEFKMPTETQS
FT                   NSSSFEFYDMPAIWLLNDKIPRTSQYPINANCSCWSSGCGEFDIFEVMNGTERNHLYST
FT                   FHTYQGIEDLGTGIQSYGYIPRDTKGTMMGGVIFDSNGNTVSFISNSTSFDQTLSPSAV
FT                   NSLLRAIPSNETYSTKLMSISGVAPSSSKSKSSGAALSVDQGIWYYVFTAFTAVAHFLL
FT                   I"
FT   gene            complement(<818072..>820594)
FT                   /locus_tag="CAGL0M08228g"
FT                   /old_locus_tag="CAGL-IPF8026"
FT                   /old_locus_tag="CAGL-CDS0711.1"
FT   CDS_pept        complement(818072..820594)
FT                   /locus_tag="CAGL0M08228g"
FT                   /old_locus_tag="CAGL-IPF8026"
FT                   /old_locus_tag="CAGL-CDS0711.1"
FT                   /note="similar to uniprot|P34239 Saccharomyces cerevisiae
FT                   YKL176c protein required for regulated transport of
FT                   nitrogen-regulated permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62679"
FT                   /db_xref="GOA:Q6FJ91"
FT                   /db_xref="InterPro:IPR037545"
FT                   /db_xref="InterPro:IPR041153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ91"
FT                   /inference="similar to AA sequence:UniProtKB:P34239"
FT                   /protein_id="CAG62679.1"
FT                   /translation="MGERFEGLENLNDECKVKLFGCRMRAPGSGTGGHESIEYRLLILE
FT                   ENAEMVCRQRYRTILDYSSRGHGSMGLKHDEMTNGNVSAPFITASELRQYIYGSPIRSK
FT                   TRVTEDKFRIIPNSRQLLITRVFYPRRTSMNLHGTFPKNYQSSDRRVSITMCLPSYLLA
FT                   DISDSWADIDGWLTQTERHLMATSFHVVETQDNFVTLVNKLLIPALRSCHEIPRLFLYP
FT                   QDNIDFIHTWFKDVFNWIELKEGTKLSFLPFLIAKTLIEYRDDPQESECHRIVITSGNL
FT                   VIANKLVFILGGLLKPRYDGEMKIMITPVSTPTPSNHLMPPSMNGSNESSYHSSSNSHT
FT                   PSKLKIPATINEHRPSRPRYSSTENIHVQSRTMDIPIVKSDQSPFSTSRGWKIPSSYRS
FT                   ATSSVSISSDESLAEVIQPSSLKSTTSIPFQNFSSSLSNQLYSSSYGSWFNGSITGSFT
FT                   NSNPLSNGTSNMATFSSSFKKNNISSIFQSNSPTAGTDSWERPENNTGLNPNITLQRTA
FT                   SNSSLRHMLTPYQQQLISPSTNSEYDEYPWFGATNNAGGATVGTSSETVGSQQPVLLQG
FT                   AHMDTTTLLDSIRTSNNNGAYTFPLKNVGFDRDCSSLDHHKLLTSCFEEIFEGDIDANK
FT                   VTTMVPCSDIAVHIHSKQEDSEGVTSHPRVVIDVDIPGTTISKYPEELLPRYTMYLSHF
FT                   NPFFKLQAIPATNEIENKIVHGLKRDFISEKCDVSKTLFISMRSRSIKEIVVRKTTSIN
FT                   TPSNSSNQDPRNKSKGSMLKQKIKKVFSNGTCTGRVTPVLNNCVAFVEAALMSAMSLYS
FT                   DPTIDKKYRDERILKIFLAVAHYNVDEV"
FT   gene            <821047..>822765
FT                   /locus_tag="CAGL0M08250g"
FT                   /old_locus_tag="CAGL-IPF8024"
FT                   /old_locus_tag="CAGL-CDS1654.1"
FT   CDS_pept        821047..822765
FT                   /locus_tag="CAGL0M08250g"
FT                   /old_locus_tag="CAGL-IPF8024"
FT                   /old_locus_tag="CAGL-CDS1654.1"
FT                   /note="similar to uniprot|P34240 Saccharomyces cerevisiae
FT                   YKL175w vacuolar membrane protein involved in the
FT                   regulation of zinc storage"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62680"
FT                   /db_xref="GOA:Q6FJ90"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ90"
FT                   /inference="similar to AA sequence:UniProtKB:P34240"
FT                   /protein_id="CAG62680.1"
FT                   /translation="MIARWLLFSLISSLLCILGALFVPIISRYSSKSHENNNTKLVNYG
FT                   LSLSAGSMMTTALYKMLPAMDPDNRFTVFFGFTFGILISFFLNYVVHAFTSESLIHCAH
FT                   GDDHSHSHGDHDRAHDHDHDHNDSHEYGHGHEHSHEHGNNNNHVHLDDNEADDDLYDPL
FT                   SRHRSVETEHSALLPHGKEGVRRRLSLLDLFSKKHRDIGPCCDSIVKSCGVLSVPADKL
FT                   TCVPLNQRGKCLNEQCHNYMQEVDQRPNHVSSQTDSSYSPNHSNSSSYESQDDAEHKHE
FT                   HTSGVVCLENNIGYDLENLDTYRNNYMLGRRNTIEYQPSAKVSTNAGSTSVRSQAISRP
FT                   SLKGINSAPHYSENAQATKASNHDGHGHDDGHEHFHHHDEEALYSHHHHLETPFSKLLS
FT                   IGLQTCLVLTLHKFPEGLIIFYTNQSDETKSLGLSIFISLLIHNFVEGFAMTLPFYTAF
FT                   ESKWKAILITTILGGGSQPFGAVLGYFIFKSSGGDHKHSDGAPPIMGLLLSITAGFLVV
FT                   ISVQMFQTGVSFSDSHHHHSDDNEEEIAQNHTMGTTCLKWCCAGICLILLSGIFV"
FT   gene            complement(<823019..>824884)
FT                   /locus_tag="CAGL0M08272g"
FT                   /old_locus_tag="CAGL-IPF8023"
FT                   /old_locus_tag="CAGL-CDS1401.1"
FT   CDS_pept        complement(823019..824884)
FT                   /locus_tag="CAGL0M08272g"
FT                   /old_locus_tag="CAGL-IPF8023"
FT                   /old_locus_tag="CAGL-CDS1401.1"
FT                   /note="highly similar to uniprot|P36029 Saccharomyces
FT                   cerevisiae YKL174c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62681"
FT                   /db_xref="GOA:Q6FJ89"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ89"
FT                   /protein_id="CAG62681.1"
FT                   /translation="MIQEYTLIPENIRENIRENMPNLDPHEIFENLHHYVQEDEVTDEP
FT                   EEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFIS
FT                   GILIWFSSLSLGEIVSKFPMELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTSITF
FT                   AGAQLTISLILMANNELISETHLILFTVIVFYMVVTLVGLVNLKFARFIEIINKVCVYW
FT                   IIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFTLQGFS
FT                   MLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLILPDIETIFSNHKVLPIVT
FT                   IFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDLWTFVPPD
FT                   SQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLCTGRR
FT                   SIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAIVVYVLCLIGI
FT                   TILYFKWGKYNFRLPLSDDAKNNPFSLEAQFPTTKEDNEYEHSGSNAKTANLPEGQASP
FT                   VENPFIGEHENSQTDIDFDVVSVDLQDAIEERDTRLEGQTRNDTN"
FT   gene            <825250..>828219
FT                   /locus_tag="CAGL0M08294g"
FT                   /old_locus_tag="CAGL-IPF8020"
FT                   /old_locus_tag="CAGL-CDS0461.1"
FT   CDS_pept        825250..828219
FT                   /locus_tag="CAGL0M08294g"
FT                   /old_locus_tag="CAGL-IPF8020"
FT                   /old_locus_tag="CAGL-CDS0461.1"
FT                   /note="similar to uniprot|P36048 Saccharomyces cerevisiae
FT                   YKL173w U5 snRNP-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62682"
FT                   /db_xref="GOA:Q6FJ88"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ88"
FT                   /inference="similar to AA sequence:UniProtKB:P36048"
FT                   /protein_id="CAG62682.1"
FT                   /translation="MDFDEFGNPIGDELELGEEIEVKKEETESIGTNGEGSNHSDNEIN
FT                   EEDDDYMSDLDADFDDENLALESLRHTYGDQVEVLMEYEDRDANEPIVESGDTGESHSK
FT                   EGVFIRLKKNIPRAQFDREYMMQMMKVPERIRTVCILGPLHSGKTSIADIFVLNNYDRL
FT                   NCITKNIRLGWKQLRYMDNTRQEIERGMTLKLNGMTFLATDMQDKSHVINLLDTPGHVD
FT                   FIDEVAVAMSVSDTALVCIDIIEGISSTTRYIIKECQKRGLSMVFLINKIDRLVLELML
FT                   PPTEAYMKLQELVLNIQGATKDSMFTPENNNILFASAKFGIIFSIEQFVSKCYGKVLAG
FT                   PKLNEFVKRVWRNNYYDRGVFHPRTLNDKNHEATFVTFILNPIYKIFTHTLSREVDVVS
FT                   KTLKKNFGVSLTEDEMANDPQPLLKVVFTKIFPDQKALISSLTSCSGSGNYYQKQVNLL
FT                   ENGVQNTSSRQFLAHAVKNMSIGDSEWTLVKVYHGNIAVGDKISVIVPVSNISDSGVKF
FT                   IDEEMLEEGSQHVIEAISLLGGRFCYPVPSASEGQLVLLKGISKSFVKSATLCSNNIES
FT                   AGLPLFQAINYIGRPVFKVIIAPLNPKELPKLLSGLEKTNRYYPGLHVKVEESGEHVLL
FT                   GNGELYFDCLMHDLRNVYGGIEVKISDPVTVFAESCQGESFAAIPVESSNHNISLTVCA
FT                   EPLDKKIVQDISKKKLDVELLGDKKGLREMAKVLRRDYGWDSLAARNIWAFFHTSILVD
FT                   DTLPDETDKNLLQHFREQVLQGFYWAVREGPLMEEAIHGVKFRILKFEMSGRVNLDSLD
FT                   VGIIGVQLIPLMRKACNVALLTAKPIVVEPIYEMDIIMKKVYYPVLEEVLKKRRSAYIY
FT                   ATETIPGTPLIEVKTQVPVIESFGLETDIRLSSEGNAIIQSHQWNDIWRKVPGDVMDED
FT                   APIPKLKPAPTSSLSRDFVMKTRRRKGISNDGFMSNDGPTLQKYIDKELFSQLKEAGFV
FT                   "
FT   gene            <829069..>831963
FT                   /locus_tag="CAGL0M08316g"
FT                   /old_locus_tag="CAGL-IPF8018"
FT                   /old_locus_tag="CAGL-CDS0491.1"
FT   CDS_pept        829069..831963
FT                   /locus_tag="CAGL0M08316g"
FT                   /old_locus_tag="CAGL-IPF8018"
FT                   /old_locus_tag="CAGL-CDS0491.1"
FT                   /note="weakly similar to uniprot|P36003 Saccharomyces
FT                   cerevisiae YKL171w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62683"
FT                   /db_xref="GOA:Q6FJ87"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ87"
FT                   /protein_id="CAG62683.1"
FT                   /translation="MYGQRRVRSERYSSDISSGKDEEIKVSRSKGIDCPPRRRESSTNE
FT                   DSLYFQPTKIYKLEKELASRSTLVKSDKDSTDEERDSDEIVSNRFNEADSVRHFGRYTD
FT                   ENYQYRHINGLVPDYYEGMRKNKLGLVSDLTNESRNNYIFEQNANFEMEFPIDESALGG
FT                   NETRGMHDEYIPNLNYGQLIENWVDEEKQVQTMEDLQREDSMLQGQLMKEASMILSNKV
FT                   RSPTQERSQTPRLATWVNDYDSEPRIMTNRSSSVIPEALSDDDIREDSLSPNTSAIFSN
FT                   SHAQVEPIPLPSKNSSRMPTSTLEDRRSYMNFLGKPASTFGAIDSMGMSALKNVNSFLP
FT                   IHKSSLPSTIPVRKGSSGQSTANSDSSSLNLQHNLSSSVGDLKLDSDQMMDLIRKLPKD
FT                   FLTLPYSQRKKQIIKLAPDKDSRLIMSLLKKVMITNSKSASSIQKPSMRSRHGSLASQF
FT                   LSSFSPSVASMASSGGFRPDDKGLFIMGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKI
FT                   VRFKDNQKVKRNVIREVNVWKEMHHMYILPLLDWKLISDYAMYCLTERVKDGTLYDLVL
FT                   SWEDRKNNQIPVDERIKLTMFLMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNW
FT                   TIFLCDFGMSCRFGSYRSRYDTLIDEEKNNSGIIREESYMPLSFEASPKPIYREVSQLN
FT                   SQHSQLSSQLTPQLQLQSNSASFSQPQQFLAVQQLPQPEPSLPHVHSDSNSTSQPPSKF
FT                   MKIVTDRNVIHDDTPFEILTARQASRRSFESHNSKKSQKMSTVSVESLPSSPSATPLDN
FT                   VNAFDPCSLDAQRHFSLSVENSNTKTPSSLIGSLPYAAPELLVPEPSPLGPGADIWALG
FT                   VTMYTMLMGKLPFKHDLESKLKQLIASGKFDKKSLKCMCNGGHSNLSDEALKYQGLYDA
FT                   ILGCLTINLLDRWGLHDVETALREELKKNGELSQ"
FT   gene            <832444..>832860
FT                   /locus_tag="CAGL0M08338g"
FT                   /old_locus_tag="CAGL-IPF8015"
FT                   /old_locus_tag="CAGL-CDS4953.1"
FT   CDS_pept        832444..832860
FT                   /locus_tag="CAGL0M08338g"
FT                   /old_locus_tag="CAGL-IPF8015"
FT                   /old_locus_tag="CAGL-CDS4953.1"
FT                   /note="highly similar to uniprot|P35996 Saccharomyces
FT                   cerevisiae YKL170w MRPL38"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62684"
FT                   /db_xref="GOA:Q6FJ86"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ86"
FT                   /protein_id="CAG62684.1"
FT                   /translation="MIYLKSIIKVIDNSGAQLAECIKVIGKGSPKSPGRVGDRIVCVIQ
FT                   KARPLTQNITGTATTNRVKKGDICHAIVVRTKQTNEYRRDGSMISFGDNACVLINKNTG
FT                   EPLGTRIMANDGVVDRTLKDKGFNKICSLASKAL"
FT   gene            complement(<833220..>835520)
FT                   /locus_tag="CAGL0M08360g"
FT                   /old_locus_tag="CAGL-IPF8014"
FT                   /old_locus_tag="CAGL-CDS0897.1"
FT   CDS_pept        complement(833220..835520)
FT                   /locus_tag="CAGL0M08360g"
FT                   /old_locus_tag="CAGL-IPF8014"
FT                   /old_locus_tag="CAGL-CDS0897.1"
FT                   /note="some similarities with uniprot|P38970 Saccharomyces
FT                   cerevisiae YJL165c ser/thr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62685"
FT                   /db_xref="GOA:Q6FJ85"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ85"
FT                   /protein_id="CAG62685.1"
FT                   /translation="MPEHEERHSHGVNRSLSLGSSMRSLFKSQRSRGPSDRGANGTPGP
FT                   AQKVDIRVDTASASREHTPVVHKTPQSANPELQQPRHHLGLPNILKLNLTPTNSNPQSK
FT                   SGSPVSQNTSQESLITDTDIEVEDYRPSKDSRRTVRNASPMSSNGNLPINANTVIGPDT
FT                   SSNNIDSMLDGTGLRPFYEEADSSDYIENLRSFPLPTGHYAPGFIQPPKSPTSSRVPSR
FT                   SNSRKGREHAGTVSAAQLPRYNETPGKCILDLEYFKLYEDGHHVHTLKVMTSVNSDANG
FT                   NSHNHASKNDGHLDLPKGDDGSVVRQKSKFSLSGFFKPHSKEDIANADEKLKYAVSLLP
FT                   RNKICSKVETDRDTFAPVFTKTRSHVQSGSDDSSDDDEELDDPSIPKIVNKNAAVGSQE
FT                   LKLINNLSEKIRMGLSTAAKNKHNQSSKHRTPSGAGVQDENQPAFADLYGKCVAVVGHG
FT                   AYGVVKVCARTRDEKDDLPATKTYMDSKKIYFAVKELKPRPSDPIEKFSTRITSEFIIG
FT                   HSLSHYYDKNGEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTARKNKIGKPLH
FT                   PLEADCFMKQLLKGIQFMHDHGVAHCDLKPENILLHPNGLLKICDFGTSCVFQTAWERH
FT                   VHFQTGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHYLWRNAARGKDSL
FT                   YDSFYEEMASKKEFYVFEELRHINQEINRLRRIALYQIFQPNPEKRISIDKLLQTGWMR
FT                   HTKCCVPYKNIPR"
FT   gene            complement(<835962..>836369)
FT                   /locus_tag="CAGL0M08382g"
FT                   /old_locus_tag="CAGL-IPF8013"
FT                   /old_locus_tag="CAGL-CDS4995.1"
FT   CDS_pept        complement(835962..836369)
FT                   /locus_tag="CAGL0M08382g"
FT                   /old_locus_tag="CAGL-IPF8013"
FT                   /old_locus_tag="CAGL-CDS4995.1"
FT                   /note="similar to uniprot|P32388 Saccharomyces cerevisiae
FT                   YKL167c MRP49"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62686"
FT                   /db_xref="GOA:Q6FJ84"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040049"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ84"
FT                   /inference="similar to AA sequence:UniProtKB:P32388"
FT                   /protein_id="CAG62686.1"
FT                   /translation="MSKVARQLKFLNKISSTTTDAQVILSPGKYQRLSLTFQTKNHNGH
FT                   MGARKFWKDYLPTIQFYNPQLRIDVTRIKNESKTVSVPCTLQAIGTDGKVVEEIDMSNK
FT                   HAPEILQSLLQKLDHERVPESQIISVGTQSA"
FT   gene            complement(<836791..>838179)
FT                   /locus_tag="CAGL0M08404g"
FT                   /old_locus_tag="CAGL-IPF8011"
FT                   /old_locus_tag="CAGL-CDS2308.1"
FT   CDS_pept        complement(836791..838179)
FT                   /locus_tag="CAGL0M08404g"
FT                   /old_locus_tag="CAGL-IPF8011"
FT                   /old_locus_tag="CAGL-CDS2308.1"
FT                   /note="some similarities with uniprot|P05986 Saccharomyces
FT                   cerevisiae YKL166c TPK3 or uniprot|P06244 Saccharomyces
FT                   cerevisiae YJL164c SRA3 or uniprot|P06245 Saccharomyces
FT                   cerevisiae YPL203w TPK2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62687"
FT                   /db_xref="GOA:Q6FJ83"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ83"
FT                   /protein_id="CAG62687.1"
FT                   /translation="MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQLE
FT                   NHIDKATESQMSKELVVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQSNE
FT                   QQTESNHEQQQQQRLQQTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGTGSF
FT                   GRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDS
FT                   QHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENI
FT                   LLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEM
FT                   LAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRDLSKRLGNLQNGSED
FT                   VKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADL
FT                   FREF"
FT   gene            complement(<838957..>840594)
FT                   /locus_tag="CAGL0M08426g"
FT                   /old_locus_tag="CAGL-IPF8009"
FT                   /old_locus_tag="CAGL-CDS1802.1"
FT   CDS_pept        complement(838957..840594)
FT                   /locus_tag="CAGL0M08426g"
FT                   /old_locus_tag="CAGL-IPF8009"
FT                   /old_locus_tag="CAGL-CDS1802.1"
FT                   /note="similar to uniprot|P46996 Saccharomyces cerevisiae
FT                   YJL163c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62688"
FT                   /db_xref="GOA:Q6FJ82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ82"
FT                   /inference="similar to AA sequence:UniProtKB:P46996"
FT                   /protein_id="CAG62688.1"
FT                   /translation="MQLGASHSDEEIDESHYTNREGTVEAALLESFFDESHPMPVSAEL
FT                   KRIQENQARHIHLPWYQKPSTFLICLLIMLIALAETLYMTPIIIITKDKVCESISNGQI
FT                   KGEETICDPIKVQTILSEISSMTIIISGVISTFMAGKMGELSDRFGRVHVFIYIGLIRL
FT                   LGNAAHVYALWPSTTYYKWFIILAGSLNSFSGGMYAIIANANSYLSDIVEPENRSVSFG
FT                   KVTSALFATMGVGFLLASNIVTLFHGNNFAPIYFAISCSSLFILLCLFFIKETRHEDSL
FT                   RDSQEAFGRRMDKHFERLMADIESAERPGLAGKIYLYGHYYTNQALHLLSPLKTLWIPR
FT                   DSNGSLRGRHTVILLLVIDIAYVCSTTACMPPLILLTTYKYNWQTVEIGYFVSFSGISK
FT                   AVVLLLLSPYIVAWLKKIYTACTDKVDNIDMICIRISMVAIVFGISAIIFKTESESSVI
FT                   GFALFQAFSAFLSPTIQSTVIKYCPKDRTGQCFGGMALVRSLTMLVFPPLLLKIYGATV
FT                   AGSPEVFLWIPMIASIISVVLSLMIKTH"
FT   gene            complement(<841439..>844204)
FT                   /locus_tag="CAGL0M08448g"
FT                   /old_locus_tag="CAGL-IPF8008"
FT                   /old_locus_tag="CAGL-CDS0566.1"
FT   CDS_pept        complement(841439..844204)
FT                   /locus_tag="CAGL0M08448g"
FT                   /old_locus_tag="CAGL-IPF8008"
FT                   /old_locus_tag="CAGL-CDS0566.1"
FT                   /note="highly similar to uniprot|P36051 Saccharomyces
FT                   cerevisiae YKL165c sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62689"
FT                   /db_xref="GOA:Q6FJ81"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="InterPro:IPR037671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ81"
FT                   /protein_id="CAG62689.1"
FT                   /translation="MKNNTRFTLIVVGVLFHLLYLWSIFDIYFISPLVHGMEQKISTNN
FT                   PPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISHTRMPTES
FT                   RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILPMFKDGASDPN
FT                   KVDAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQDGNAFFLHLLG
FT                   CDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADHGMSAFGSHG
FT                   DGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKRNDVKQADIAALMSYLI
FT                   GTNYPANSVGELPLAYIEGSEGQKLEALLNNAESILEQYRVKENEVINSQFVYKIYPKF
FT                   AEKSPTEYLKEIKELIKKIENGEESLEPEAIRLTEELMKVTLEGLHYLTTYNWRFIRTI
FT                   VTFGFLGWICYSFMIFLKLFILNNSQTTHPSILNISIFTSLGLILNYILFYQKSPLNFY
FT                   LYLIFPLFFWSKIFSNTAIIRDGVNEFFKGISKAESVIIGLTIISIYEGIVYGFFHRWI
FT                   LSLILVSFAFYPLVCGVTDLFTNLLWILTSVGLSSFTLLDAVKIENLQQIQVAGILIVL
FT                   SSAYAVMRLSQDISKYTQHLLSIQIFLVSGMLHFTSKSVISLQKREGLPAFAQVGGWAI
FT                   LVISLTIMPFLHYLKPNNNYQVRLLTIYLTFAPSFIILSISFEALFYFIFTAYIVQWLQ
FT                   IEKNIKVLKDEQKSDSNGIQLLRVAIIGFFLQQIAFFGTGNVASISSFSLDSVYRLLPV
FT                   FDPFPMGALLMLKLIIPYVLLSCGLGIMNIQLDIKDYTISSLIISTSDILSLNFFYLLK
FT                   TEGSWLDIGVTISNYCLAILSSLFMLILEIVGHQLLKNVTRATSSQKKTN"
FT   gene            complement(<845650..>845721)
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="CAGL0M08470r"
FT   tRNA            complement(845650..845721)
FT                   /gene="tRNA-Glu (TTC)"
FT                   /locus_tag="CAGL0M08470r"
FT                   /product="transfer RNA-Glu"
FT   gene            <848089..>849096
FT                   /locus_tag="CAGL0M08492g"
FT                   /old_locus_tag="CAGL-IPF8003"
FT                   /old_locus_tag="CAGL-CDS3289.1"
FT   CDS_pept        848089..849096
FT                   /locus_tag="CAGL0M08492g"
FT                   /old_locus_tag="CAGL-IPF8003"
FT                   /old_locus_tag="CAGL-CDS3289.1"
FT                   /note="highly similar to uniprot|Q03178 Saccharomyces
FT                   cerevisiae YKL164c PIR1 or uniprot|Q03180 Saccharomyces
FT                   cerevisiae YKL163w PIR3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62690"
FT                   /db_xref="GOA:Q6FJ80"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ80"
FT                   /protein_id="CAG62690.1"
FT                   /translation="MQYKKSLAATALLASSGLAAYVPGNPWSTLTPSGTYKGGLTDYSS
FT                   TFGIAVQPIATSSSVAKRAVSQIGDGQVQAATKTQAAPVSQIGDGQIQATTKTQAAPVS
FT                   QIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQI
FT                   GDGQIQATTKTQAAPVSQIGDGQIQATTKTTQAASQIGDGQVQAATKTASAASQIADGQ
FT                   VQQNKDPKDPVGAVSCKVDGTLQMNLKGGILTDEKGRIGSIVANRQFQFDGPPPQAGAI
FT                   YAAGWSLTPQGNLALGDSDVFYQCLSGNFYNLYDQSIGAQCHPVHLSAIDLVKC"
FT   gene            complement(<849926..>850558)
FT                   /locus_tag="CAGL0M08514g"
FT                   /old_locus_tag="CAGL-IPF8000"
FT                   /old_locus_tag="CAGL-CDS4364.1"
FT   CDS_pept        complement(849926..850558)
FT                   /locus_tag="CAGL0M08514g"
FT                   /old_locus_tag="CAGL-IPF8000"
FT                   /old_locus_tag="CAGL-CDS4364.1"
FT                   /note="similar to uniprot|P47001 Saccharomyces cerevisiae
FT                   YJL158c or uniprot|Q03178 Saccharomyces cerevisiae YKL164c
FT                   PIR1 or uniprot|Q03180 Saccharomyces cerevisiae YKL163w
FT                   PIR3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62691"
FT                   /db_xref="GOA:Q6FJ79"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ79"
FT                   /inference="similar to AA sequence:UniProtKB:P47001"
FT                   /protein_id="CAG62691.1"
FT                   /translation="MQFNKISLLAMASAASAATTSPTTTETKPTTTKFFTPGDNFSTFA
FT                   PNATFSGAAVNFTSTFGIAVQSIDSKSVVSKSLVSTSTTSTLAPSSSTSSAASSTTSSP
FT                   NITIVNKSCKADGTLVMELENGILRDGKGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSV
FT                   TPEGNLALGDSDVFYQCSSGNFYNLYDEYIAEQCHPIHLEVLSLVDC"
FT   gene            complement(<852150..>853376)
FT                   /locus_tag="CAGL0M08536g"
FT                   /old_locus_tag="CAGL-IPF7998"
FT                   /old_locus_tag="CAGL-CDS2714.1"
FT   CDS_pept        complement(852150..853376)
FT                   /locus_tag="CAGL0M08536g"
FT                   /old_locus_tag="CAGL-IPF7998"
FT                   /old_locus_tag="CAGL-CDS2714.1"
FT                   /note="weakly similar to uniprot|P36052 Saccharomyces
FT                   cerevisiae YKL162c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62692"
FT                   /db_xref="GOA:Q6FJ78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ78"
FT                   /protein_id="CAG62692.1"
FT                   /translation="MSRCLSKSLRDYLAWVNLPVARSNFFITYDYRLRHQRQQNALTAD
FT                   LLRSVATCLAKYLLVDYKLNEYPYYDLTVVNVFSNYRQSMEILSAAMRYLEPVVDRQLL
FT                   SRVKVYMMPLYPSPQHPGETRQVSENVWVLGDDQAVFGTPATLQDMRLADLLPLEYSTA
FT                   SSIAEEDPVHVVMFDDVLQNLAPDLVRVRPDCGNVNTSAGAGGSASGSASAGEWEQCFV
FT                   NTSDMSRTYLGQGMGMDPLCELAVQLCLPPAENVACGTEVYVPSQAALLFSHLKRRFPE
FT                   HKLFAVDSFEVTHETMYFRWKSWLAAIMGFGTRGITGTGTGSASAPYGIESSSLVLGYT
FT                   SGTGTSTSYSHRALKLVPNAHQCQLLYTGINDGRKACTVEPLDTFIDKWRGSDLPAPEA
FT                   GPFSVMYQE"
FT   gene            <854646..>854813
FT                   /locus_tag="CAGL0M08552g"
FT                   /old_locus_tag="CAGL-IPF14175"
FT   CDS_pept        854646..854813
FT                   /locus_tag="CAGL0M08552g"
FT                   /old_locus_tag="CAGL-IPF14175"
FT                   /note="highly similar to uniprot|P87284 Saccharomyces
FT                   cerevisiae YDR276c PMP3 plasma membrane proteolipid 3"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58076"
FT                   /db_xref="GOA:B4UN60"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN60"
FT                   /protein_id="CAR58076.1"
FT                   /translation="MDSTKIVNIFLAIFLPPVAVFSARGFGTECILSIILTICAWFPGM
FT                   LYALYVVLTD"
FT   gene            complement(<855046..>855342)
FT                   /locus_tag="CAGL0M08558g"
FT                   /old_locus_tag="CAGL-IPF9944"
FT   CDS_pept        complement(855046..855342)
FT                   /locus_tag="CAGL0M08558g"
FT                   /old_locus_tag="CAGL-IPF9944"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62693"
FT                   /db_xref="GOA:Q6FJ77"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ77"
FT                   /protein_id="CAG62693.1"
FT                   /translation="MFISFFSLNCGYMTQTLYTRIHTISTHIKKYHGIADTRSSRAITG
FT                   ACLQDVPAGVQCAHLAAVGTNPTTRCDRYRTVRSPAHRLLYPTHSILPEDIRL"
FT   gene            complement(<855443..>856036)
FT                   /locus_tag="CAGL0M08580g"
FT                   /old_locus_tag="CAGL-IPF9943"
FT   CDS_pept        complement(855443..856036)
FT                   /locus_tag="CAGL0M08580g"
FT                   /old_locus_tag="CAGL-IPF9943"
FT                   /note="some similarities with uniprot|Q05610 Saccharomyces
FT                   cerevisiae YDR273w DON1 and some similarities with
FT                   uniprot|Q08412 Saccharomyces cerevisiae YOR042w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62694"
FT                   /db_xref="GOA:Q6FJ76"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR041807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ76"
FT                   /protein_id="CAG62694.1"
FT                   /translation="MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLI
FT                   IRAILLAARGDLAPAFNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQ
FT                   LSQLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKG
FT                   LISDTKSEEANISVVEPQVENGKSVNPFELLQDE"
FT   gene            complement(<856349..>859387)
FT                   /locus_tag="CAGL0M08602g"
FT                   /old_locus_tag="CAGL-IPF11718"
FT   CDS_pept        complement(856349..859387)
FT                   /locus_tag="CAGL0M08602g"
FT                   /old_locus_tag="CAGL-IPF11718"
FT                   /note="similar to uniprot|P38995 Saccharomyces cerevisiae
FT                   YDR270w CCC2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62695"
FT                   /db_xref="GOA:Q6FJ75"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ75"
FT                   /inference="similar to AA sequence:UniProtKB:P38995"
FT                   /protein_id="CAG62695.1"
FT                   /translation="MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVV
FT                   SEDSVATDGIIEAVEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAI
FT                   EGVSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVD
FT                   LRLLGFNSKDDNELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIID
FT                   ILESLGINAVVDVSFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFP
FT                   SLMKDKIFPYSSVGAVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTL
FT                   VCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTS
FT                   TALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISE
FT                   VDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKK
FT                   ASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQI
FT                   ATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLT
FT                   TGHMTVQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMII
FT                   EDEQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDD
FT                   KVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEV
FT                   TPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILND
FT                   PDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVA
FT                   GLAMAFSSVSVVVNSLMLKWWKAPELTSKNSHSSKGYGYYTKGTEQLNRLLGSASTGMS
FT                   DDTEIEIQDLELQPTSLSSQRTL"
FT   gene            complement(<859796..>860809)
FT                   /locus_tag="CAGL0M08624g"
FT                   /old_locus_tag="CAGL-IPF11721"
FT                   /old_locus_tag="CAGL-CDS3264.1"
FT   CDS_pept        complement(859796..860809)
FT                   /locus_tag="CAGL0M08624g"
FT                   /old_locus_tag="CAGL-IPF11721"
FT                   /old_locus_tag="CAGL-CDS3264.1"
FT                   /note="highly similar to uniprot|P04803 Saccharomyces
FT                   cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62696"
FT                   /db_xref="GOA:Q6FJ74"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ74"
FT                   /protein_id="CAG62696.1"
FT                   /translation="MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITI
FT                   PKPDAAQFKQLRREAIASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRM
FT                   TQWKSKSNLREDKDATAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELT
FT                   RTLAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETI
FT                   IRKIKKARTDSITDKFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKA
FT                   HVSEVIIEELRVPREKFHQYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTMGFI"
FT   gene            <861488..>862501
FT                   /locus_tag="CAGL0M08646g"
FT                   /old_locus_tag="CAGL-IPF11722"
FT                   /old_locus_tag="CAGL-CDS3265.1"
FT   CDS_pept        861488..862501
FT                   /locus_tag="CAGL0M08646g"
FT                   /old_locus_tag="CAGL-IPF11722"
FT                   /old_locus_tag="CAGL-CDS3265.1"
FT                   /note="similar to uniprot|Q05583 Saccharomyces cerevisiae
FT                   YDR267c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62697"
FT                   /db_xref="GOA:Q6FJ73"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028608"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ73"
FT                   /inference="similar to AA sequence:UniProtKB:Q05583"
FT                   /protein_id="CAG62697.1"
FT                   /translation="MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNG
FT                   KENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELL
FT                   AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV
FT                   VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS
FT                   DDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK
FT                   EKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWNYQD"
FT   gene            <862981..>864954
FT                   /locus_tag="CAGL0M08668g"
FT                   /old_locus_tag="CAGL-IPF9949"
FT                   /old_locus_tag="CAGL-CDS1248.1"
FT   CDS_pept        862981..864954
FT                   /locus_tag="CAGL0M08668g"
FT                   /old_locus_tag="CAGL-IPF9949"
FT                   /old_locus_tag="CAGL-CDS1248.1"
FT                   /note="similar to uniprot|Q05580 Saccharomyces cerevisiae
FT                   YDR266c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62698"
FT                   /db_xref="GOA:Q6FJ72"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR041888"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ72"
FT                   /inference="similar to AA sequence:UniProtKB:Q05580"
FT                   /protein_id="CAG62698.1"
FT                   /translation="MSSEQQQNGSKPKNRNFRRTQTGGRSNGESGNGRKAKKITGNPDF
FT                   LQKEIKSGKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQ
FT                   RALYEKKSCLICRTENDRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLL
FT                   KYACPLCPDNEQHVSTTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNH
FT                   HSRGDSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQ
FT                   LFEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFIS
FT                   APSQVIRERDSYNYDMGSVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLN
FT                   ENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQT
FT                   EKRKNALPSLLDDHIQTVPGGAWGSSTGRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPN
FT                   KAPVYKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSN
FT                   SSSKNKLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQKGEPAPQLTEEQQLLESLN
FT                   LNGNSKSKKKGKQKQLLFHIGV"
FT   gene            complement(<865182..>866168)
FT                   /locus_tag="CAGL0M08690g"
FT                   /old_locus_tag="CAGL-IPF8150"
FT                   /old_locus_tag="CAGL-CDS3340.1"
FT   CDS_pept        complement(865182..866168)
FT                   /locus_tag="CAGL0M08690g"
FT                   /old_locus_tag="CAGL-IPF8150"
FT                   /old_locus_tag="CAGL-CDS3340.1"
FT                   /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
FT                   YDR265w peroxisomal assembly protein - peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62699"
FT                   /db_xref="GOA:Q6FJ71"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ71"
FT                   /inference="similar to AA sequence:UniProtKB:Q05568"
FT                   /protein_id="CAG62699.1"
FT                   /translation="MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRG
FT                   QLFINNYQKEISVVVKLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVL
FT                   SYTSIPYLVTKLSKKVNNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVF
FT                   KRFWGMRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTK
FT                   ETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCL
FT                   MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQVLALRA"
FT   gene            <866454..>868745
FT                   /locus_tag="CAGL0M08712g"
FT                   /old_locus_tag="CAGL-IPF8152"
FT                   /old_locus_tag="CAGL-CDS0904.1"
FT   CDS_pept        866454..868745
FT                   /locus_tag="CAGL0M08712g"
FT                   /old_locus_tag="CAGL-IPF8152"
FT                   /old_locus_tag="CAGL-CDS0904.1"
FT                   /note="similar to uniprot|P39010 Saccharomyces cerevisiae
FT                   YDR264c ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62700"
FT                   /db_xref="GOA:Q6FJ70"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ70"
FT                   /inference="similar to AA sequence:UniProtKB:P39010"
FT                   /protein_id="CAG62700.1"
FT                   /translation="MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSVG
FT                   VDGENGNEDDDPILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINN
FT                   RLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNL
FT                   LHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNA
FT                   SVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQ
FT                   EALRHNNFDKNGYPINKLVKRDDHAKIITFLIPLLVLGFAFFGFSHLHILFALPVIILL
FT                   LLASNKFIKSFLLPSYETKGTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKR
FT                   PLGNLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLE
FT                   TWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVC
FT                   LKYFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKG
FT                   LTNSELNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTT
FT                   FSGNLPKPRTCMGMICAVTGLHQCVAIIKDTFGIARHGSSRSTNTRSLLSSISTDYGWR
FT                   RNWCDFWLLSDTNTPLWKRIFFSPPSTKALLNGKEADYATLYEVPNKNHGSVSQLQELQ
FT                   DPLSEIDDMV"
FT   gene            complement(<869007..>869768)
FT                   /locus_tag="CAGL0M08734g"
FT                   /old_locus_tag="CAGL-IPF8153"
FT                   /old_locus_tag="CAGL-CDS3978.1"
FT   CDS_pept        complement(869007..869768)
FT                   /locus_tag="CAGL0M08734g"
FT                   /old_locus_tag="CAGL-IPF8153"
FT                   /old_locus_tag="CAGL-CDS3978.1"
FT                   /note="similar to uniprot|Q12331 Saccharomyces cerevisiae
FT                   YDR262w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62701"
FT                   /db_xref="GOA:Q6FJ69"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69"
FT                   /inference="similar to AA sequence:UniProtKB:Q12331"
FT                   /protein_id="CAG62701.1"
FT                   /translation="MVALKYVLVPVALVAAKNIVEMITFRDENGKLHRRLAPEEYRGGV
FT                   LDGEESRLLQKRDLEMHPPVDLGVYFSNRPIHRTIDVPDIYLDSQISVLTELDIFASYS
FT                   RNDEKSYDMFRDPESDLIVIAPTNAAITALAKKPWQFPMDIDTMEQAGSSERDIDNAIH
FT                   NNIVNFVRSHVVAYQKDTKTSKDGTVLLQSKQYSMQHSNGKGGDVLLKREGEKYCVASV
FT                   VDEVFHDVQNIYSTKNGVILVIDATLSRPGA"
FT   gene            <870824..>872533
FT                   /locus_tag="CAGL0M08756g"
FT                   /old_locus_tag="CAGL-IPF8154"
FT                   /old_locus_tag="CAGL-CDS1666.1"
FT   CDS_pept        870824..872533
FT                   /locus_tag="CAGL0M08756g"
FT                   /old_locus_tag="CAGL-IPF8154"
FT                   /old_locus_tag="CAGL-CDS1666.1"
FT                   /note="similar to uniprot|P52911 Saccharomyces cerevisiae
FT                   YDR261c exo-beta-1 3-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62702"
FT                   /db_xref="GOA:Q6FJ68"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ68"
FT                   /inference="similar to AA sequence:UniProtKB:P52911"
FT                   /protein_id="CAG62702.1"
FT                   /translation="MLHLFVVIFLALGVLGYDNSGLTTDELQSLQKRFQDYYNDGEVQV
FT                   KGITIGGWLVTEPYITPSLYETAFTHVNKTLNGTNSTTFQNSTFGNYSIVDEYTLCKEL
FT                   GYQNALTLLKDHYETFITEDDFAQIKENGFNLVRLPIGYWAWKKNSNDTSRYNYVGNIS
FT                   YDDPYVSEGLQLQYLLKAIDWASKYELNVWIDLHGAPGSQNGFDNSGQRILYDDLGWLH
FT                   ADKTKPLTLAIWKDMFEKFVRTNNYNGYNTSSVVGLEIMNEPLGPKIGMRNIAQSYYEA
FT                   FDMFKTAEAENNNPQNDNLTFVIHDAFQSIGYWNLHLNPDYRNVSNQYYNLTNVTYNSQ
FT                   SVLVDHHHYEVFTDFQLKNNQYNRIMDIINYGDSISKELDFHPAVVGEWSGAITDCARW
FT                   VNGIGIGARYDGSYYKTTAFQSDSPPNGTCISQNDISTWSESYKTRVRQFIEAQLATYS
FT                   AKTTGWIFWNWKTENAAEWDYLKLKENNLFPQPFDNFTYFNKDGQINSSFSTSLSIEAF
FT                   GSPTSSRVSSTKHKNFAISTKMRTSITGSSNNNTWMYFLSAALGMLAVCCVM"
FT   gene            <873232..>873642
FT                   /locus_tag="CAGL0M08778g"
FT                   /old_locus_tag="CAGL-IPF8156"
FT                   /old_locus_tag="CAGL-CDS4975.1"
FT   CDS_pept        873232..873642
FT                   /locus_tag="CAGL0M08778g"
FT                   /old_locus_tag="CAGL-IPF8156"
FT                   /old_locus_tag="CAGL-CDS4975.1"
FT                   /note="weakly similar to uniprot|Q12379 Saccharomyces
FT                   cerevisiae YDR260c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62703"
FT                   /db_xref="GOA:Q6FJ67"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ67"
FT                   /protein_id="CAG62703.1"
FT                   /translation="MTYNNSHFNYHHLNRSHYVLYSEWNKDEFPNPTRTALGSRLEGPS
FT                   KDSANPNDLKIDDEYWDNYLEEEDYQLFKNAKLESNGVVTFTIANLSLPLPSQNTALEV
FT                   HNEESSTLTGSIFVRDGRVIAKAKHRQLTGGL"
FT   gene            <878328..>879119
FT                   /locus_tag="CAGL0M08800g"
FT                   /old_locus_tag="CAGL-IPF8160"
FT                   /old_locus_tag="CAGL-CDS3896.1"
FT   CDS_pept        878328..879119
FT                   /locus_tag="CAGL0M08800g"
FT                   /old_locus_tag="CAGL-IPF8160"
FT                   /old_locus_tag="CAGL-CDS3896.1"
FT                   /note="weakly similar to uniprot|Q03935 Saccharomyces
FT                   cerevisiae YDR259c YAP6 transcription factor of a
FT                   fungal-specific family of bzip proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62704"
FT                   /db_xref="GOA:Q6FJ66"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ66"
FT                   /protein_id="CAG62704.1"
FT                   /translation="MGQVNMRPSLASQPAHYQLPSIAPNIHPHQYTTSQPPHQQHYHVV
FT                   HTPISRISSENGQQQHMMPPSMNPTAYQGPEQVIIDHGIPTFQYAHQPQHVLRSSIMTG
FT                   ANMSPGQPQPQTIVMGPQPIQHAIDGHLASQTIATPMGTTLLTSSAQLQGQKTKKNTKR
FT                   AMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRLIEKLKD
FT                   NGIEVDIPSDFLDKINASISASRRLQEQHEEISKSIAGEKS"
FT   gene            <880145..>882508
FT                   /locus_tag="CAGL0M08822g"
FT                   /old_locus_tag="CAGL-IPF8162"
FT                   /old_locus_tag="CAGL-CDS0836.1"
FT   CDS_pept        880145..882508
FT                   /locus_tag="CAGL0M08822g"
FT                   /old_locus_tag="CAGL-IPF8162"
FT                   /old_locus_tag="CAGL-CDS0836.1"
FT                   /note="highly similar to uniprot|Q12137 Saccharomyces
FT                   cerevisiae YDR258c heat shock protein of clpb family of
FT                   ATP-dependent proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62705"
FT                   /db_xref="GOA:Q6FJ65"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ65"
FT                   /protein_id="CAG62705.1"
FT                   /translation="MLSRVCRSSLRNSVARVSRYAGPRALALSMVVSGRQVSGSWQTCA
FT                   YGVRYIHSSRPRYVQMRMNPNQGEPEKPPLEQFGTNLTKLARDGKLDPVIGRDEEISRA
FT                   IQILSRRTKNNPVLIGRAGVGKTALIDGLAQRIVAGEVPESLKDKELVALDLGALIAGA
FT                   KYRGEFEERLKKVLEDIDKADGKVIVFIDEVHMLLGLGKTDGSMDASNILKPKLARGLR
FT                   CISATTIDEFKIIEKDPALTRRFQPILLNEPSVQDTISILRGLKERYEVHHGVRITDTA
FT                   LVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDEIQRLDRAIMKIQIELES
FT                   LKKETDPVSIERKEDLEKELERKNEELQRLTKIWEEEKAEIESIKNSKADLEKARIELD
FT                   RCQREGDYAKASELRYAKIPALEEKVKLSETKDSNKENLLHDAVTSDDISKVIAKMTGI
FT                   PMETVLKGDKDRLLYMENSLRERVVGQDEAIEAVSDAVRLQRAGLTSEKRPIASFMFLG
FT                   PTGTGKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSKLIGAPPGYVLSESGGQLTE
FT                   AVRRKPYAVVLFDEFEKAHPDVCKILLQVLDEGKLTDSLGHHVDFRNTIIVMTSNIGQD
FT                   ILLSDTKLDDEGKIDPSTRNEVIEAMKRSYPPEFINRIDDILVFNRLSKKVLRSIVDIR
FT                   AKEIQERLNDKRMTIEISDTAKEWLTEHGYDQLYGARPLNRLIHRRILNPMATYLLKGQ
FT                   IRNGETVQVDVENKELVVKSNHAEGEIVDEEPEK"
FT   gene            <882940..>884472
FT                   /locus_tag="CAGL0M08844g"
FT                   /old_locus_tag="CAGL-IPF8163"
FT                   /old_locus_tag="CAGL-CDS2011.1"
FT   CDS_pept        882940..884472
FT                   /locus_tag="CAGL0M08844g"
FT                   /old_locus_tag="CAGL-IPF8163"
FT                   /old_locus_tag="CAGL-CDS2011.1"
FT                   /note="similar to uniprot|Q12504 Saccharomyces cerevisiae
FT                   YDR257c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62706"
FT                   /db_xref="GOA:Q6FJ64"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ64"
FT                   /inference="similar to AA sequence:UniProtKB:Q12504"
FT                   /protein_id="CAG62706.1"
FT                   /translation="MADNYTETTTEYVSWLTNNGVKISPKLKVEDNRYKDEGRCVVTTT
FT                   DIQKDELLFEIPRNVLLNCETSQLVKDIPAVLTELETFSGSEPLSWEPLILCLFYEMYI
FT                   LKDKSRWWPYFEVLPTLEDMNVLVLWSDEDLAALEPSYVLSCIGKEQVENMYQLLKRFI
FT                   EASDHEQLKSNLNKFSWDSFIRIGSLIMSYSFDVGKEIHNEGKEGESMNENDNMTNGDE
FT                   DEDEDEEDLEVEMIKSMVPLADTLNADTKKCNANLLHSKQTLRMIAIRDIPSGEQVYNT
FT                   YGELSNSELLRRYGYVEWDGSYYDCGEISKSAIHKSLLQLFPTSTETLERLDAVIDENE
FT                   KVLDLFDDDTIVEDTYIFESDGEIPFKFLFYIQLMALLLQNSRIEKMGPIALNKCMAPT
FT                   IDKTSKILQEQKVTRKALDVLNDSLDTRMKQYEQKITDSGEDSLEPPSHEASTKEKRMR
FT                   MVKMILLSEYKSLRKCSEVIREEFGPLSDSDVLSEIKQSKEEKRPKKRAKTR"
FT   gene            <884842..>886491
FT                   /locus_tag="CAGL0M08866g"
FT                   /old_locus_tag="CAGL-IPF8165"
FT                   /old_locus_tag="CAGL-CDS1773.1"
FT   CDS_pept        884842..886491
FT                   /locus_tag="CAGL0M08866g"
FT                   /old_locus_tag="CAGL-IPF8165"
FT                   /old_locus_tag="CAGL-CDS1773.1"
FT                   /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
FT                   YDR479c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62707"
FT                   /db_xref="GOA:Q6FJ63"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ63"
FT                   /inference="similar to AA sequence:UniProtKB:Q03370"
FT                   /protein_id="CAG62707.1"
FT                   /translation="MDSVTNFFWNDTYGRGSASTIDTVGSDSNDKDKNTNGTPTTNRHN
FT                   RRFSNSLEKMNSRDSGSNVQGSFANTAFSTSGGLQKAMTDTLVEKIIKMAIPASSELAA
FT                   NTIKNRMAAGKERPSLSVPITSRNFILMNSRLSVPFLVIDEIIKILNWVDPAYTLSMAL
FT                   IYTLIVLRPLQVLSSLPILYLLFGIMVPEYLHIHEPSENVYLDTNRVPAQGPPLRKAEV
FT                   PKPVPEFSQEFVLNLTDLQNHMLLYVQLYDSIIYVLQKFAFFVNEQISAVAFVLLMILA
FT                   VTNIIFIDVLVRIIPIKLILVATGWAFIIICHPKYRDNFFNKVNSEETRLRLLKLTSSY
FT                   DDWVNDNLGYVEARETKVVIIYEMQKYKDKHKEWHPVGYANDDFTLFSQFRINENAIES
FT                   VAVPSLDSISPPTGWEWAENSSWVLDLDPTGWVEEGFIQFVQIDPETKWVYDINLDGKR
FT                   GKYRRRLWTNTCVRQIHAGVDERNASDKLREVSNPLRSDETHSRSIHGVSKGSMSGNVK
FT                   TEADIEENAFTDEDDSHITDDSIASNILNTTI"
FT   gene            complement(<886536..>887063)
FT                   /locus_tag="CAGL0M08888g"
FT                   /old_locus_tag="CAGL-IPF8166"
FT                   /old_locus_tag="CAGL-CDS4639.1"
FT   CDS_pept        complement(886536..887063)
FT                   /locus_tag="CAGL0M08888g"
FT                   /old_locus_tag="CAGL-IPF8166"
FT                   /old_locus_tag="CAGL-CDS4639.1"
FT                   /note="similar to uniprot|P40993 Saccharomyces cerevisiae
FT                   YDR478w RNA binding protein of RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62708"
FT                   /db_xref="GOA:Q6FJ62"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ62"
FT                   /inference="similar to AA sequence:UniProtKB:P40993"
FT                   /protein_id="CAG62708.1"
FT                   /translation="MNRDQKIQFRDKQIRHKYALLHAMPTIDVPELSGMYLKNFYNSVK
FT                   RYQLNLPDHIVQPDKKFCGECGYIQIPDHSVDINIISGERPEISSIAKFKCKKCGHHYD
FT                   ETVLCRKQKVADSANISKDIGQVKKKTNNAKMRAKMRKQNSLTSLLSKKDKEKKDVTKS
FT                   ASMLSLDSFMKR"
FT   gene            complement(<887703..>889541)
FT                   /locus_tag="CAGL0M08910g"
FT                   /old_locus_tag="CAGL-IPF8167"
FT                   /old_locus_tag="CAGL-CDS1441.1"
FT   CDS_pept        complement(887703..889541)
FT                   /locus_tag="CAGL0M08910g"
FT                   /old_locus_tag="CAGL-IPF8167"
FT                   /old_locus_tag="CAGL-CDS1441.1"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62709"
FT                   /db_xref="GOA:Q00372"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR032270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00372"
FT                   /protein_id="CAG62709.1"
FT                   /translation="MENKEHHHHHHHHHHHHSNGSYVSNKVSSLADGSRVGNYQIVKTL
FT                   GEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
FT                   VIKSKDEIIMVIEYAGNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLK
FT                   PENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC
FT                   GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISI
FT                   HEIMQDEWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEEIDDEMVVTLSKTMGYDKDE
FT                   IYEALESSEDTPAYNEIRNAYILIKDNKSLIKDMKQDNNVTQELDTFLSQSPPTFQQNG
FT                   DGMKASEDQKKKHSGRRLASSVTQQRTFHQPPFMDQSKEEDSTISILPTSLPQIHRANM
FT                   LAQGLPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDL
FT                   WTIRVRWKYDSDESRLIEDGVKKIPNLMKIVIQLFQIETNNYLVDFKFDGWESTYGDST
FT                   ISTNMSEDEMSTFSAYPFLHLTTKLIMELAVNSQGN"
FT   gene            <889916..>890548
FT                   /locus_tag="CAGL0M08932g"
FT                   /old_locus_tag="CAGL-IPF8170"
FT                   /old_locus_tag="CAGL-CDS4365.1"
FT   CDS_pept        889916..890548
FT                   /locus_tag="CAGL0M08932g"
FT                   /old_locus_tag="CAGL-IPF8170"
FT                   /old_locus_tag="CAGL-CDS4365.1"
FT                   /note="weakly similar to uniprot|Q03362 Saccharomyces
FT                   cerevisiae YDR476c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62710"
FT                   /db_xref="GOA:Q6FJ60"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ60"
FT                   /protein_id="CAG62710.1"
FT                   /translation="MDAADIAKWNTERAHNLKDILCVYGKVKQRPYAVKLQGVDAQAME
FT                   LNFKNHESDTQMTKFVDIRDQLEGVSPDYNEVVMSLARQSARKLNKSFNKLDKVLYPCG
FT                   VADLLVILAVLLPPLCYLYRPLLHWLFPPQVPVLGQLGQLVDSDYRLLAVIVLEFAIHA
FT                   GEVYLGLWPLLHYYRITESPDLLIEYTLFGLLEGYGPIRRLKSLQWD"
FT   gene            <890764..>893316
FT                   /locus_tag="CAGL0M08954g"
FT                   /old_locus_tag="CAGL-IPF8173"
FT                   /old_locus_tag="CAGL-CDS0689.1"
FT   CDS_pept        890764..893316
FT                   /locus_tag="CAGL0M08954g"
FT                   /old_locus_tag="CAGL-IPF8173"
FT                   /old_locus_tag="CAGL-CDS0689.1"
FT                   /note="weakly similar to uniprot|Q99248 Saccharomyces
FT                   cerevisiae YOR019w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62711"
FT                   /db_xref="GOA:Q6FJ59"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ59"
FT                   /protein_id="CAG62711.1"
FT                   /translation="MEQDESLRSFYRRVKVYRRSVGDGEPGLGGDIGNLDSRLCESESA
FT                   LSGNDSLEPGTPVLDAVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDF
FT                   PGVQLFPQEYTMEEYYDDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPL
FT                   DREYPSAGKQKKMSSKQQANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWH
FT                   NTWRSRRHTIEQRKEDLSETFEYPQLLFPQQTKPSEPVIMMGEDYKPLTKEQRKKEKII
FT                   HKKIESTSGPRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITS
FT                   ASASRSRSRTRSRSRDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQED
FT                   VETTMENIFDYIANILPEERSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERT
FT                   DNLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLEKENIEMEKE
FT                   NNVTGDIVESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAE
FT                   NVFEEESGSETGSDVDSELSDLSSDEGNDKLTVREKLHLKARSYRLQTAQYLKDLDNNK
FT                   SISHEEIQIKKVETIINQTIKFSLAIEDLGSESDDDDDVGLTKLKRVITGGAVLNPQSG
FT                   SKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVV
FT                   HTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNSLRRVKSNDSSRISQSS
FT                   KKSSSSTSSGGFMSLFKGKSKERSESPSSKRKSGLKFW"
FT   gene            <893866..>895236
FT                   /locus_tag="CAGL0M08976g"
FT                   /old_locus_tag="CAGL-IPF8176"
FT                   /old_locus_tag="CAGL-CDS2346.1"
FT   CDS_pept        893866..895236
FT                   /locus_tag="CAGL0M08976g"
FT                   /old_locus_tag="CAGL-IPF8176"
FT                   /old_locus_tag="CAGL-CDS2346.1"
FT                   /note="similar to uniprot|Q03338 Saccharomyces cerevisiae
FT                   YDR473c essential splicing factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62712"
FT                   /db_xref="GOA:Q6FJ58"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="InterPro:IPR027104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ58"
FT                   /inference="similar to AA sequence:UniProtKB:Q03338"
FT                   /protein_id="CAG62712.1"
FT                   /translation="MPPKNTTSRKPRSGRGLDVELHPALASSNANIIKAQQKQVNPYLS
FT                   DIGQQNGKVFKKYKDGLRFYKKGEISAQLHKEREELARRLKEEELRAAAEKAHRVSLAE
FT                   QKRERIANAEIPDDSIGEELYMQRFKDIPNYEWWDESYLDKSGNILPKYTTEYPEDMDS
FT                   DYDSDDMNSGVECMKSQTEETGPPSIRYVQHPVPIKIPEEITAPKMYLTKLEHKKARRR
FT                   NRKLQREEKMAKVQLGLEPKPETKVKLSNMMNVLDNNKNISDPTAWENMVKDQIEERRQ
FT                   RHIQENEKRHEEAVLRKKSKVSDQIEGSEDLFCKAFYFQSLQNPKIRYKLKMNSQQLNL
FT                   KGFCLRVGEGGPGIIVVIGKEKSCNFYKKLVCTRIKWNENFKIKDATNNGELIDMTGNY
FT                   AVEIWDGLLKETKLRNWFMKICQTEDEMKNILQQNDALSFFNLFIENKAENTNLSQQ"
FT   gene            <895492..>895573
FT                   /gene="tRNA-Ser (AGA)"
FT                   /locus_tag="CAGL0M08998r"
FT   tRNA            895492..895573
FT                   /gene="tRNA-Ser (AGA)"
FT                   /locus_tag="CAGL0M08998r"
FT                   /product="transfer RNA-Ser"
FT   gene            complement(<896312..>897358)
FT                   /locus_tag="CAGL0M09020g"
FT                   /old_locus_tag="CAGL-IPF8177"
FT                   /old_locus_tag="CAGL-CDS3178.1"
FT   CDS_pept        complement(896312..897358)
FT                   /locus_tag="CAGL0M09020g"
FT                   /old_locus_tag="CAGL-IPF8177"
FT                   /old_locus_tag="CAGL-CDS3178.1"
FT                   /note="highly similar to uniprot|P33303 Saccharomyces
FT                   cerevisiae YJR095w succinate-fumarate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62713"
FT                   /db_xref="GOA:Q6FJ57"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ57"
FT                   /protein_id="CAG62713.1"
FT                   /translation="MSSSKKKSSNPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQ
FT                   AAPAAAAVASMAGGAGGAATATVGGGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGA
FT                   VVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVK
FT                   IRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTV
FT                   YSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGES
FT                   GWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENLGVFSKP
FT                   TPKPKKLN"
FT   gene            <901459..>902817
FT                   /locus_tag="CAGL0M09042g"
FT                   /old_locus_tag="CAGL-IPF8179"
FT                   /old_locus_tag="CAGL-CDS2379.1"
FT   CDS_pept        901459..902817
FT                   /locus_tag="CAGL0M09042g"
FT                   /old_locus_tag="CAGL-IPF8179"
FT                   /old_locus_tag="CAGL-CDS2379.1"
FT                   /note="weakly similar to uniprot|P21190 Saccharomyces
FT                   cerevisiae YJR094c IME1 transcription factor required for
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62714"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6G0"
FT                   /protein_id="CAG62714.1"
FT                   /translation="MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRA
FT                   MHSSSPNFKEAKVASRGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLA
FT                   TNWDDTDKYINFSVCEELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYS
FT                   ELDFHSNYDFEDYSISYDNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKL
FT                   INPKILSTTFDIELSSFINEETYLLSSKYSEASSFSSIFSYDIDNIQNIASITNSSGEL
FT                   MKEANFCNEQNERDSVVTIKLETKNNKKTTKYSIKKETHFPIPDQHKFNDNIEYYYYFD
FT                   PDEGNPIILPEYPPLRTYEVSTGFKKKKRINKEPKPVIKTKKSQANSYVHRTSKNRIRK
FT                   SKDSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYKFSKTYF"
FT   gene            <903560..>904543
FT                   /locus_tag="CAGL0M09064g"
FT                   /old_locus_tag="CAGL-IPF8181"
FT                   /old_locus_tag="CAGL-CDS3350.1"
FT   CDS_pept        903560..904543
FT                   /locus_tag="CAGL0M09064g"
FT                   /old_locus_tag="CAGL-IPF8181"
FT                   /old_locus_tag="CAGL-CDS3350.1"
FT                   /note="similar to uniprot|P45976 Saccharomyces cerevisiae
FT                   YJR093c component of pre-mRNA polyadenylation factor PF I"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62715"
FT                   /db_xref="GOA:Q6FJ55"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ55"
FT                   /inference="similar to AA sequence:UniProtKB:P45976"
FT                   /protein_id="CAG62715.1"
FT                   /translation="MSSSEDEDDKFLYGSDNEEPKNEKKRPREAAEDDNEGPTSDKVVS
FT                   QHNNDLKRPKLAKDSLANASSDEEESGSESDSDIEFIISTGPDPHRLDSSTVPGSNNAI
FT                   VTVSEGANVGGETMSKSTATATTAEISTLNALGDTEVAGTSELDNETLGPETTTKSGTS
FT                   AEGIDLDKEGLYNDEPVSTIDPEVLKEKPWRQPGANISDYFNYGFNEYTWMEYLHRQEK
FT                   LRQEYNPRRILMGLMTLQQQGRLDQPQGGHQSMPDNMAINNPQPTNNDNMMHKPTPPLP
FT                   NFPMPPMFGGFSPFMPPGMMAPMNRMPNQNQNQGQNQNQNQNQLSK"
FT   gene            complement(<904879..>909219)
FT                   /locus_tag="CAGL0M09086g"
FT                   /old_locus_tag="CAGL-IPF8182"
FT                   /old_locus_tag="CAGL-CDS0130.1"
FT   CDS_pept        complement(904879..909219)
FT                   /locus_tag="CAGL0M09086g"
FT                   /old_locus_tag="CAGL-IPF8182"
FT                   /old_locus_tag="CAGL-CDS0130.1"
FT                   /note="similar to uniprot|P47136 Saccharomyces cerevisiae
FT                   YJR092w budding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62716"
FT                   /db_xref="GOA:Q6FJ54"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ54"
FT                   /inference="similar to AA sequence:UniProtKB:P47136"
FT                   /protein_id="CAG62716.1"
FT                   /translation="MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMD
FT                   MLVQYNTENNANSNVNANANANANQWNKVDDPQDLLPMENNYDDDEEQGDESDTTNLLS
FT                   GNKHLTEEESEQVLVDSKNLVLPPSSSKSNLINNLKQVVEDEVSDSQLSNDMDDTRTLN
FT                   FSVKGTEPLLADELQDKEPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSK
FT                   IPITNAQTINYFKDAPVEDAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSF
FT                   VISNLKEASQSVENLGFPDYEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTP
FT                   SIKPIDIDNNCEHENRLVSEEESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENK
FT                   LDETLNMIDHQLSSNKSIDSVKTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESH
FT                   NSLINLTSGNNFDQSMHNDLIEESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKND
FT                   NGIQQNLEDNHTGIQPEMVVPEEVTTTLPEVNILPASENMLENTSESEISVQFLQNRDN
FT                   EDKVSSDPQLEENIRSTETVMNTQETFEPKPAKKNQYTDREIEVLNSQKDISEATDNSA
FT                   VNSRISSSASNFTPVLPPLPKLEKLSIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHL
FT                   QEQTTKAVSPALSSNSQFSYNSNSTKSSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQ
FT                   EQSMDFIYTKLPSILDPMRRNTINSKKIRQTVIDKRKSHPSFSVDEGNTITEVNIEPEV
FT                   KVQPISIENDSSSLKANNQDDNESCSSGSQAFVTPSATMDNFDSQFNELGTSFENDLEN
FT                   VLNYFDKDINTNTSSDLIEETTTKNQALPTSKVWSESVDYSLPTGEEPNVDHNIMKKLL
FT                   NTENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMFALNGRDISISKSEMTND
FT                   IDMGIFSDKKSLVHTPELSPVKSTHVGSPFKVISPKKNTQKDLKDGTTAEKRVSSESEA
FT                   AQISIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEPIVDKGLLYLHLQGTTKLSL
FT                   AGINAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKEFEIPIDQSINKLIITLMIKY
FT                   TRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEIL
FT                   LDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGC
FT                   FLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVE
FT                   LVGYHEVSMKPKIRINMLKVVKVIGKDDVVTGKDNVRNFTTWVLMNDCFQLVFDDGEVI
FT                   TFSDESSLADEQSWYMKLKEVVELNAFHQPWVKRFSENMIINDI"
FT   gene            <910473..>913802
FT                   /locus_tag="CAGL0M09108g"
FT                   /old_locus_tag="CAGL-IPF8187"
FT                   /old_locus_tag="CAGL-CDS0313.1"
FT   CDS_pept        910473..913802
FT                   /locus_tag="CAGL0M09108g"
FT                   /old_locus_tag="CAGL-IPF8187"
FT                   /old_locus_tag="CAGL-CDS0313.1"
FT                   /note="similar to uniprot|P47135 Saccharomyces cerevisiae
FT                   YJR091c suppresses the high-temperature lethality of
FT                   TUB2-150"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62717"
FT                   /db_xref="GOA:Q6FJ53"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ53"
FT                   /inference="similar to AA sequence:UniProtKB:P47135"
FT                   /protein_id="CAG62717.1"
FT                   /translation="MEKKFTNIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAGK
FT                   FSNTLSNLLPSISAKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQ
FT                   GMPSMTAAVAADMGPPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTEYLISRPRT
FT                   SNDSFGNNLPRQISRTRNNTMSSQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQQQQQ
FT                   QQQQQMVPQINTYNAMDMGQQPNYGDTMNQQMGGNNLTVNNAWNSNRPRSHSNASSIYT
FT                   DAPQYDTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNT
FT                   ISISNVFPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSA
FT                   IRALDALQGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQL
FT                   NNGAVTFHQQGNISIPVFNQNQYSNGQNTNNNASSHPGTSSSSDKEQCPFPLPPPPLSG
FT                   KKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNKQFDAPKLRE
FT                   LRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTG
FT                   KYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYVIQCVLKF
FT                   GYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVIYAEYLT
FT                   TNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRGDDAAR
FT                   KTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIAQVRKIL
FT                   MESNTAQHHRRLMEEVGLMTTGNNNNQTSNNKHRKNSSHTYVQDNNGHMRGVSVSSVRS
FT                   GGSRQTGLTPNIPQTFQMPSLPNTSMSTVVSGNMSLNQLPTQMQQQQQSGVLPQTVQQQ
FT                   QQQPMVGSNQNNAMSYMNYPGVFPMGYPNNNSSYGINDDLVSKLDMLTLGNGTHLSLPQ
FT                   LSVTNHENNTNYSNNNNNNNNNNNNNNNSNGNNNTNGGNPMNLMNSSLNNTQEFGGSSL
FT                   WN"
FT   gene            <914811..>918188
FT                   /locus_tag="CAGL0M09130g"
FT                   /old_locus_tag="CAGL-IPF8189"
FT                   /old_locus_tag="CAGL-CDS0293.1"
FT   CDS_pept        914811..918188
FT                   /locus_tag="CAGL0M09130g"
FT                   /old_locus_tag="CAGL-IPF8189"
FT                   /old_locus_tag="CAGL-CDS0293.1"
FT                   /note="similar to uniprot|P24814 Saccharomyces cerevisiae
FT                   YJR090c required for glucose repression and for glucose and
FT                   cation transport"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62718"
FT                   /db_xref="GOA:Q6FJ52"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ52"
FT                   /inference="similar to AA sequence:UniProtKB:P24814"
FT                   /protein_id="CAG62718.1"
FT                   /translation="MDITNQNHSIDTPMPDTRPDIEFGFGYNAGTTRGGPSLASMQIQQ
FT                   GTNTHHQINNDISFNIGNNDTNSNDTNENIHVDSLRNNGNIQRFTAGDRLPNTIGNQSV
FT                   AMARSIPGSIESRNGFPQDGEALMDMSNVESIDYNAPAKIFADMDINRLFYDPNLSSLQ
FT                   AEDIIKLHNFKEVVHRKIENFIEVIQKRRERILKEIELGNQRLEGVDLETSVSAMTYLN
FT                   KLQRIRISALKSETMELQNLRIQIVSIVDEYKKAMAEYSKLNQEGRNAVNPTPYFQRWI
FT                   KSLNPEDISGLNKELIELQMYSKQLSDIPELASIEYQVSTPQTSQFPLRSLPSEILHLV
FT                   LDKITQKADIVNLLRVCKLWALIIVKILYYRPHINRKHQLDLFMRTMKLTKDETVFDYR
FT                   SMIKRLNFSFVGDHLHDEELYNFVGCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVD
FT                   ITGIKEIYDNVFDTLAESCKRVQGFYVPQAKLVSYNALTNFVSNAPMLKRIKVTANANV
FT                   NDEFLDLLAEKCPLLVEVDITLSANVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLD
FT                   LSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTL
FT                   GKNLQTVHFGHCFNITDRGVRALIKSCPRIQYVDFACCTNLTNHTLYELSYLSRLKRIG
FT                   LVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSNLTIYPIYELLMACPRLSHLSLTAV
FT                   PSFLRPDITAFCRPAPSDFSDNQRQIFCVFSGKGVHKLRHYLMSLTTPTDGPQIDVGDT
FT                   LEQYVISKHLLRPGEYLNDGIRRITSELNQDSAAILAATGLNQMNGMNSDFPFQNIDFE
FT                   RLDEVFNWINMSMDGHSLNSDELNDLISEVDRDFCDDPFDEDYNSRDSIVAPGANTGLN
FT                   SELCHIVKKFHRLDDQICDFEVNVSSLARVQFQFTGFLLHEMAQAYMNMVEINRQIWHI
FT                   QKTTLEAGVESDIKALLVWRILFIDKFTALLHKYQISTVVLRLYLKDSITLLTRQRELF
FT                   LAHQRTPWNPTIVEEAPDSNYWQLVGDRIQLLPEQMRVMPFGLRNPAIANNAQQNAAEA
FT                   QNDDRSETPEDDVAIEDF"
FT   gene            complement(<918323..>920777)
FT                   /pseudo
FT                   /locus_tag="CAGL0M09152g"
FT                   /old_locus_tag="CAGL-IPF8190"
FT                   /old_locus_tag="CAGL-CDS4129.1"
FT                   /old_locus_tag="CAGL-IPF8192"
FT                   /old_locus_tag="CAGL-CDS1442.1"
FT                   /old_locus_tag="CAGL0M09163g"
FT                   /note="some similarities with uniprot|P47134 Saccharomyces
FT                   cerevisiae YJR089w BIR1 frameshift"
FT   gene            <921030..>921911
FT                   /locus_tag="CAGL0M09185g"
FT                   /old_locus_tag="CAGL-IPF8194"
FT                   /old_locus_tag="CAGL-CDS3672.1"
FT   CDS_pept        921030..921911
FT                   /locus_tag="CAGL0M09185g"
FT                   /old_locus_tag="CAGL-IPF8194"
FT                   /old_locus_tag="CAGL-CDS3672.1"
FT                   /note="similar to uniprot|P47133 Saccharomyces cerevisiae
FT                   YJR088c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09185g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62721"
FT                   /db_xref="GOA:Q6FJ51"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR039856"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ51"
FT                   /inference="similar to AA sequence:UniProtKB:P47133"
FT                   /protein_id="CAG62721.1"
FT                   /translation="MRDLRREKLLTVMTTRAYTRFEPQELVQLYNELLMRMGKLERSSE
FT                   PNDVSLLEMYFYVCCYLGKDQEMSLVFQRLRDRFGESSPRVAVMKATMMEVEGNDSSAA
FT                   KQYLEGRLKELEYDADSVSYVMLSKKLLALKMRDLKKNPQQQLKETLALIEKFPLDPEL
FT                   QWVCSELYYSLKDLDKAIYCIEEVLVAMPFNYVAFARLSELLYYKYVREFQDKPAKRRD
FT                   TAALQQALDNALRSVELSELFLKGWSLVATISKELDKPQLLQLSKKKLQEISEVSNSND
FT                   ARIAKKFLQKMA"
FT   gene            complement(<922042..>922308)
FT                   /locus_tag="CAGL0M09207g"
FT                   /old_locus_tag="CAGL-IPF8195"
FT                   /old_locus_tag="CAGL-CDS5674.1"
FT   CDS_pept        complement(922042..922308)
FT                   /locus_tag="CAGL0M09207g"
FT                   /old_locus_tag="CAGL-IPF8195"
FT                   /old_locus_tag="CAGL-CDS5674.1"
FT                   /note="similar to uniprot|P18852 Saccharomyces cerevisiae
FT                   YJR086w GTP-binding protein gamma subunit of the pheromone
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09207g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62722"
FT                   /db_xref="GOA:Q6FJ50"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR041848"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50"
FT                   /inference="similar to AA sequence:UniProtKB:P18852"
FT                   /protein_id="CAG62722.1"
FT                   /translation="MEVSQSQLDLKIKYLKLKRINELNDKLRDELQRERITASNACLQL
FT                   IAYTTSTRDYALPTLWGYPPADTNHFRDFQTQHADDATCCTIM"
FT   gene            <922638..>922955
FT                   /locus_tag="CAGL0M09229g"
FT                   /old_locus_tag="CAGL-IPF8198"
FT                   /old_locus_tag="CAGL-CDS5458.1"
FT   CDS_pept        922638..922955
FT                   /locus_tag="CAGL0M09229g"
FT                   /old_locus_tag="CAGL-IPF8198"
FT                   /old_locus_tag="CAGL-CDS5458.1"
FT                   /note="similar to uniprot|P47131 Saccharomyces cerevisiae
FT                   YJR085c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09229g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62723"
FT                   /db_xref="GOA:Q6FJ49"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ49"
FT                   /inference="similar to AA sequence:UniProtKB:P47131"
FT                   /protein_id="CAG62723.1"
FT                   /translation="MEHPAFTLSALTTIGGVVGYMRKKSLPSLVAGLTFGGLYAISGYL
FT                   LHLNRDYGLELALGSSALLTVSGAMRGGVKTPLKPIPFLLTVCGATGSYYYWSKYKEFY
FT                   P"
FT   gene            complement(<923094..>924443)
FT                   /locus_tag="CAGL0M09251g"
FT                   /old_locus_tag="CAGL-IPF8200"
FT                   /old_locus_tag="CAGL-CDS2406.1"
FT   CDS_pept        complement(923094..924443)
FT                   /locus_tag="CAGL0M09251g"
FT                   /old_locus_tag="CAGL-IPF8200"
FT                   /old_locus_tag="CAGL-CDS2406.1"
FT                   /note="weakly similar to uniprot|P47130 Saccharomyces
FT                   cerevisiae YJR084w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09251g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62724"
FT                   /db_xref="GOA:Q6FJ48"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ48"
FT                   /protein_id="CAG62724.1"
FT                   /translation="MEYSRFVDCFERRSYTAEFLEFVGFKLSSEPLGATALILGGSQAK
FT                   QARYGDVNALYDAIVQIKLKESLTSLRELDPNAAVKKNKQRKVHQRVVDVFQALTNELR
FT                   ILNKILERSDDSVWLVYPVYTVCHDVSTFLRDTGKYMQLESRKQLWEECIRVIHRSFMI
FT                   CLNDKNPNMQENKRGGCILFANLEMMFYKMLRNRDMMKNLIKVLESTGMTDISRQRDNK
FT                   VLKRHRSQKIIFNYFIGEYYGCYLFQFNKAQEHLQVCVSEFPVKYTSSKWFKRIIHLYT
FT                   QFRMLATSNKLIHVELPRETNEKFANAYDSDLMNKCYKNGDTIVFDELIKEHAAQYLID
FT                   GTYSAMLLIKELVFLRLVKVCYKVNDKKSILPLDLIAAGYRIHFRNHDNEENRVTTTNP
FT                   RKLQKKNEDLLDELECRIANLIANGRIKGYLSHSQRCMVLSKTEPFPLAS"
FT   gene            <924718..>925602
FT                   /locus_tag="CAGL0M09273g"
FT                   /old_locus_tag="CAGL-IPF16207"
FT   CDS_pept        924718..925602
FT                   /locus_tag="CAGL0M09273g"
FT                   /old_locus_tag="CAGL-IPF16207"
FT                   /note="similar to uniprot|P47129 Saccharomyces cerevisiae
FT                   YJR083c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09273g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62725"
FT                   /db_xref="GOA:Q6FJ47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ47"
FT                   /inference="similar to AA sequence:UniProtKB:P47129"
FT                   /protein_id="CAG62725.1"
FT                   /translation="MSERIVSNPIELHKLSLVDKQKGDTSGSSGAAGTGSGANDGNSNA
FT                   GNSNAGNSNAGGAGVTGTPVKQRARPVVPIASPTKVKEEPKSEDGLYKLASKQREIFEL
FT                   EQKLKQARVELKQLEEEVGKSLGYAGMPQESLRNRLQKRIEEVNRSPNVIRTKQSMSNL
FT                   IQRGNTLFMDGSSSARGATDRDMRTDQRRSAHAHAAAPAQAQPSAHRQNGPPLPSRPRE
FT                   PQKNFFKSIVDKFHEMTQEEEDFDDQTTSNHKDKYYIGETYGYDQDEEDEDPEDHGEPL
FT                   EHINDIPTTLFKR"
FT   gene            <925881..>926156
FT                   /locus_tag="CAGL0M09295g"
FT                   /old_locus_tag="CAGL-IPF16210"
FT   CDS_pept        925881..926156
FT                   /locus_tag="CAGL0M09295g"
FT                   /old_locus_tag="CAGL-IPF16210"
FT                   /note="highly similar to uniprot|P47128 Saccharomyces
FT                   cerevisiae YJR082c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09295g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62726"
FT                   /db_xref="GOA:Q6FJ46"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ46"
FT                   /protein_id="CAG62726.1"
FT                   /translation="MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVDG
FT                   GSKSYHNILRGFDGMSRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ"
FT   gene            <926244..>927407
FT                   /locus_tag="CAGL0M09317g"
FT                   /old_locus_tag="CAGL-IPF11559"
FT   CDS_pept        926244..927407
FT                   /locus_tag="CAGL0M09317g"
FT                   /old_locus_tag="CAGL-IPF11559"
FT                   /note="similar to uniprot|P47127 Saccharomyces cerevisiae
FT                   YJR080c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09317g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62727"
FT                   /db_xref="GOA:Q6FJ45"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ45"
FT                   /inference="similar to AA sequence:UniProtKB:P47127"
FT                   /protein_id="CAG62727.1"
FT                   /translation="MLKSRFKVVGKEALMASLPLEPSVPMCIRKGCLVSVMAGGAHGSG
FT                   KTASLVIGHKWVNFWTNLARFRSWNSSLYHVLTTSGKENRALVAPNISRGSPWLSALKL
FT                   VVSILSKNSKGITITDPQRSIYPLELDGTQDWNVWGRDSLIAFEQNDSLDIKPASLSSS
FT                   LKRDALFSHSHKYQVVTGRGSVLLGGYGDIYSIDLKNSTDDIVINAQNILAVSGKGQTE
FT                   TMNAIENNPFIISHTAASNIPEFTSNVQELAAFEDPKQQQSQTIVQKTVKEAARASKAV
FT                   WHWISYVYKKTVIFSNNNGHNITSPAFVKIKGPRTIIIQTSHETTQPVSVSTVDILPRT
FT                   VENAIPEVVETPKAKSDSYINYATVQPDGNVTFRSVSNFNETIAERY"
FT   gene            complement(<927557..>928153)
FT                   /locus_tag="CAGL0M09339g"
FT                   /old_locus_tag="CAGL-IPF9396"
FT                   /old_locus_tag="CAGL-CDS4465.1"
FT   CDS_pept        complement(927557..928153)
FT                   /locus_tag="CAGL0M09339g"
FT                   /old_locus_tag="CAGL-IPF9396"
FT                   /old_locus_tag="CAGL-CDS4465.1"
FT                   /note="similar to uniprot|P38162 Saccharomyces cerevisiae
FT                   YBL107c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09339g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62728"
FT                   /db_xref="GOA:Q6FJ44"
FT                   /db_xref="InterPro:IPR016805"
FT                   /db_xref="InterPro:IPR019171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ44"
FT                   /inference="similar to AA sequence:UniProtKB:P38162"
FT                   /protein_id="CAG62728.1"
FT                   /translation="MAKQGQEELTVSFSEQLLDPNLSFPDYQQTTRQLTLNRARCVDPT
FT                   LIDTFLRNLRHGSDDVIKQKLNNYSKQTEHRNDTRLQKCDSLIHREIYPNWQVRDSIID
FT                   FCAAQATQLKYELDQQKSSEVIRTTVDTRLDPYSVRDLQHEEEKKYKQWNDLNNWVENN
FT                   RTIEGILRGSSDHFLKQNCDQNVDYLRKFWDLSSK"
FT   gene            complement(<928484..>931918)
FT                   /locus_tag="CAGL0M09361g"
FT                   /old_locus_tag="CAGL-IPF9392"
FT                   /old_locus_tag="CAGL-CDS0281.1"
FT   CDS_pept        complement(928484..931918)
FT                   /locus_tag="CAGL0M09361g"
FT                   /old_locus_tag="CAGL-IPF9392"
FT                   /old_locus_tag="CAGL-CDS0281.1"
FT                   /note="highly similar to uniprot|P24583 Saccharomyces
FT                   cerevisiae YBL105c PKC1 ser/thr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09361g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62729"
FT                   /db_xref="GOA:Q6FJ43"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR036274"
FT                   /db_xref="InterPro:IPR037312"
FT                   /db_xref="InterPro:IPR037778"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ43"
FT                   /protein_id="CAG62729.1"
FT                   /translation="MLSQVEQDIRRKIAVEENIIKGSSALKKKTDNVMVIQKCNTNIRE
FT                   ARQNIEYLEETLKKLQLSQSQQGQTDSQQQQANDDSTVTEIDRGQGYRQLSTIAPEEHV
FT                   FSRLDLVKYDCPSLAQKIQYMLQQLEFKLQVERQYQEANNKLTKLYQIDGDQRSSSAAE
FT                   GGALESKNRVQLLKKALKKYQAINVDLDQYYKHHNDESLKDMQPKLREKQLTGMLTIGI
FT                   TAIRDVDHIQSPLFARNPETFITVKIDDVVKSRTKPSRNDRWNEEFSIEVDKGNEIEIT
FT                   IYDRVNESVTPVAVMWLLLSDIAEEIRKKKVGKTNGQGWVRAASIKSQTVHNSQAVANR
FT                   TYASDSRTTSLNNSNSDLNQDMSLSPTQVTTNAWFVLEPAGQILLTLGFHKTSQHQRKN
FT                   LVGGLHRHGAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCH
FT                   KKCYGNVVTKCISKASTETDPSEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKQKV
FT                   RKCTECGIMCHTQCAHLVPDFCGMSMEMANKILKTIEDTKRTQEKKKRKPPQTNASALT
FT                   STSTMIGSSVHDRLDSSPSKSMNASIPSIPSPRKHPYAANQYHEKAEEHQMQNQNRLNN
FT                   YIEDNEAYLKFTSGVGVPGASQDVKAQNMNDAYVDQYGHEYQQDNNDSQLKASEDELEL
FT                   WKQHRERMERELQQEQQMQMSYDNNAEGQIDLYTKQASGDVNMLPAVDETVSSHNNPFR
FT                   DMNHETFEQTQNYVANQLQGDVTDIRSSTEIITAAGNNVSPQKRSSGKHKKRGSKRPKV
FT                   SLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL
FT                   ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLAL
FT                   KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL
FT                   REQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF
FT                   QGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFE
FT                   QEFTSAPPSLTPLPSVLSTTQQEEFRGFSYMPEDLEL"
FT   gene            complement(<932379..>935324)
FT                   /locus_tag="CAGL0M09383g"
FT                   /old_locus_tag="CAGL-IPF9390"
FT                   /old_locus_tag="CAGL-CDS0470.1"
FT   CDS_pept        complement(932379..935324)
FT                   /locus_tag="CAGL0M09383g"
FT                   /old_locus_tag="CAGL-IPF9390"
FT                   /old_locus_tag="CAGL-CDS0470.1"
FT                   /note="similar to uniprot|P38164 Saccharomyces cerevisiae
FT                   YBL104c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09383g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62730"
FT                   /db_xref="GOA:Q6FJ42"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031488"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037593"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ42"
FT                   /inference="similar to AA sequence:UniProtKB:P38164"
FT                   /protein_id="CAG62730.1"
FT                   /translation="MALIKKAFNWSYDEFLDYLSVNPTRDEVTHYKVNPDLEGDDSIMK
FT                   MLTVKDFGSITCLDYSEAEVGLTAVGEKNGYMRLFNIINAEDDGEEHFNLGARAKQQRT
FT                   INAVGINTNGLIAIGLDRNRHDPSLQIWDINYQSTESDIINPTFSYCTNESIVSLKFLN
FT                   DTNILTSSTKFLKEIDVRSPNSIYQHPTRLTYDIKLNPFNDWQFSTYGDDGTLAIWDRR
FT                   RLVSNVSNGNLTLTTPLLTFEKLVGAGSASRKYMNSCFRWSPIRDKEFSTLYHGDTIKI
FT                   WRLGSYVNSEVSEDYESFFVSTVHDIETPYDRVATFDYISKNNKDASFLCMRQSGTVYR
FT                   MSIDQNYTNSKFNNRNTLLLSNSNGPDIEEIAVAQDKPKSALENLGAIHKNLSFEDLDL
FT                   RDDYGKSEDDTNDDYEDEDVDDDNHSNVTEHTEGNESKHLLQEGEGNNLYWKAEKLLQE
FT                   DISVIMRKRAQLGYGLDPMTTVEIVDRSRALQNYSYIRNTWRWIAIAKTSDVDGTMVSG
FT                   DLDLGYEGILGIWNGLNGISNQNRHSEDVIISDKQLIREMDKIIRLRKKNKDINSYHGA
FT                   IAKFADSPKFIQRKLCLIISGWDLSPSDYQEKYDIIIKNGNYEKAAAWAMFFGDIPKAI
FT                   EILGSAKKERLRLIATAISGYLVYKDQPGNNAWRQQCRKMSNDLDDPYLRVIFAFIADN
FT                   DWCDILYEPAISLRERLGVALRFLNDSDLTRFLERTSSIVINNGELEGLILTGITPIGI
FT                   DLLQSYVMKTSDIQSAALIAVYGCPRYFRDQRVDEWIDTYRTMLNSWQLFSMRAKFDVL
FT                   RAKLSKTSAGNVTVNVTPRQLYIQCLSCKKNINKPISAEASAAKNKYTHKLSHDKEERS
FT                   VNHSYFCPHCGAPFPRCAICLMPLGTSNLPFVINGIKGNDQDAHTEVHSTEHSDTAEPQ
FT                   ETNVYKRKLKLNEWFSFCLTCKHGMHAGHADEWFERHTICPTPGCTCQCNR"
FT   gene            complement(<935685..>937040)
FT                   /locus_tag="CAGL0M09405g"
FT                   /old_locus_tag="CAGL-IPF9389"
FT                   /old_locus_tag="CAGL-CDS2394.1"
FT   CDS_pept        complement(935685..937040)
FT                   /locus_tag="CAGL0M09405g"
FT                   /old_locus_tag="CAGL-IPF9389"
FT                   /old_locus_tag="CAGL-CDS2394.1"
FT                   /note="weakly similar to uniprot|P38165 Saccharomyces
FT                   cerevisiae YBL103c bHLH/zip transcription factor that
FT                   regulates CIT2 gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09405g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62731"
FT                   /db_xref="GOA:Q6FJ41"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ41"
FT                   /protein_id="CAG62731.1"
FT                   /translation="MEINNEDHELLAEIMGHGGDGSELFGNDADVFLRNGSGSGETQAG
FT                   NADGLALYPQATPAHRHEQMAMMNHGNSEMHSFLDDMFTNSSLGHGQPVTESNLTKNMM
FT                   GNHYEQNLESDIASSLYNSRHPSVSMEHGTAGHPEMLFHQNDNSISSFSESFYGSSLDS
FT                   SISEVSSINSFMSGNSFPAPLPHQIDENSILVNNNMSPSGFRDSIRPGSFLSTSLRAPS
FT                   SMSRQMRNPSYNDSGIPMTVGSVPKNATSHMTPDEKLKRKREFHNAVERRRRELIKQKI
FT                   KELSKLVPPSLLNYDADGNQIKSNRGTILDKSVEYLEYLLYVIDIQKRKREALQEKIAQ
FT                   LSSLSSRTTDDLGMGPRKMTNLPQRISSQATLKANTFNEEKIIDTRGIPDTRGISASQA
FT                   HTDNPLEDFNHNHVDFNATHTDFNNNINDDLQQFLSGDLMEAEDNAKLMFNP"
FT   gene            <937627..>938268
FT                   /locus_tag="CAGL0M09427g"
FT                   /old_locus_tag="CAGL-IPF9387"
FT                   /old_locus_tag="CAGL-CDS4324.1"
FT   CDS_pept        937627..938268
FT                   /locus_tag="CAGL0M09427g"
FT                   /old_locus_tag="CAGL-IPF9387"
FT                   /old_locus_tag="CAGL-CDS4324.1"
FT                   /note="highly similar to uniprot|P38166 Saccharomyces
FT                   cerevisiae YBL102w suppressor of SED5 ts mutants"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09427g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62732"
FT                   /db_xref="GOA:Q6FJ40"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ40"
FT                   /protein_id="CAG62732.1"
FT                   /translation="MTDNNDQVNLLRDSLSRWNQGRAQQSQGFNESAKTLFSSWADSIN
FT                   ERAQDVYSRLPVSRQDLIQDEEPAWFNLSRTERLILFVCFILGSAACFTLCVFLFPVLA
FT                   IKPRKFGILWSVGSLLFVLAFGIFQGPVAYIKHLTSRERLPFTVFFFGTCALTIYFAAF
FT                   MKSTILTIPCAVLELIAVLYYAISYFPFGGTGLRMLSSFGINTARGALHI"
FT   gene            complement(<938424..>941660)
FT                   /locus_tag="CAGL0M09449g"
FT                   /old_locus_tag="CAGL-IPF9385"
FT                   /old_locus_tag="CAGL-CDS0344.1"
FT   CDS_pept        complement(938424..941660)
FT                   /locus_tag="CAGL0M09449g"
FT                   /old_locus_tag="CAGL-IPF9385"
FT                   /old_locus_tag="CAGL-CDS0344.1"
FT                   /note="similar to uniprot|P38167 Saccharomyces cerevisiae
FT                   YBL101c involved in cell wall biogenesis and architecture"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09449g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62733"
FT                   /db_xref="GOA:Q6FJ39"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ39"
FT                   /inference="similar to AA sequence:UniProtKB:P38167"
FT                   /protein_id="CAG62733.1"
FT                   /translation="MVSSSSSRRRSSTIKSALSSLLHGHSNGSGHHGKDSAYARRHSTN
FT                   SISANGSDTSVRSKLSSHGTGSAANARVPSRTPNKSSTMPDVQSNSTGHLNDTMRNTRY
FT                   DSTRYSRSFATDDENAIEFDDQNTSLNSDPSGLTPLPESFNKEYLAEYLHNRGFLNPKS
FT                   VETRENFSIGIATSGDVIFLPTVSSNDDEYLARLNGVGSGESNMELDQGAMDDELTGDD
FT                   FVIQDGVLQRQQQNQGHSATDNSSSTAVASPSGTQSDVPDSGAYQNRSLEFDASMVSFS
FT                   VAVILSVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLNDTNYDV
FT                   FVPTTVSSNTQIVERHNNTPTKIFRNKPISERYYTDKSKLKRQYLDSLLDCEGHLLEAG
FT                   DYVYLLPVIFSNHIPESTYLPSARISYKLKIGTRAIGSSIKRAGSTGSSLSIGQQNQPI
FT                   SSHSSTSSLSSLRDMDHEGKANSSASPHKGLSGNLLKKVKNHLHLPHNQVKPGEIEESR
FT                   ELYTEYPIKVIRTPPPISISTANKPIYINRVWSDSLSYEISFASKYVSLNSRVPIKIKL
FT                   APIAKNICVKRVRVSITEKITFVSKNLEYEYDQVDPVAKDPYNPYYLDFTSKRRKERNL
FT                   ALLEVRTKPKGSRALREEIVENCVNDNLLSFGEIKEPGKADSIPLVEPVSIETRLDFPS
FT                   YMDLDKRHAKNIPPYGIDVYTAIANPEEQQSTSHHKSSVIGILTGIKNSTDSGSSPSKA
FT                   NSDKNTNNSSSAETESAARRQTVSRFHQTSIKANSHPNVKFHTRLNKCKRGLYLDSLHY
FT                   TNVHARHKLEVMLRISKPDPENPSKLRHYEVLIDTPVFLVSDQCNTGNMELPTYDMATT
FT                   VTSTDLTPIPNATNLAPPPTFEEAISVPASPFQSPAASPIGSPVMSPSYDPELLSIQQL
FT                   NLSRSTSFSGPSVHLENTNTGTGGSSVGGISLLQPGSSHRPSISAEASSGRYSNLDRLM
FT                   FASSQTSPPPPLPMDIMQGRRASDAAAVSSSYTNPEQSPRIPIIVETNPFFKKDYTLTP
FT                   RSNEPEADDNSTTPGQLPSKDPPTYEEAVS"
FT   gene            complement(<942333..>942659)
FT                   /locus_tag="CAGL0M09471g"
FT                   /old_locus_tag="CAGL-IPF9382"
FT                   /old_locus_tag="CAGL-CDS5388.1"
FT   CDS_pept        complement(942333..942659)
FT                   /locus_tag="CAGL0M09471g"
FT                   /old_locus_tag="CAGL-IPF9382"
FT                   /old_locus_tag="CAGL-CDS5388.1"
FT                   /note="some similarities with uniprot|Q03818 Saccharomyces
FT                   cerevisiae YMR159c coiled-coil protein required for
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09471g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62734"
FT                   /db_xref="GOA:Q6FJ38"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ38"
FT                   /protein_id="CAG62734.1"
FT                   /translation="MLAERDTLEKNYCELFEVPVDGRSNDGDAMLLQEALRGKDNEIRM
FT                   LEERLAVSSKNVERLNDELLGANLEANVLGQKLQDLQQEHDKLLERWMQRVRVEVDKMN
FT                   AQLE"
FT   gene            <942904..>945030
FT                   /locus_tag="CAGL0M09493g"
FT                   /old_locus_tag="CAGL-IPF9381"
FT                   /old_locus_tag="CAGL-CDS1068.1"
FT   CDS_pept        942904..945030
FT                   /locus_tag="CAGL0M09493g"
FT                   /old_locus_tag="CAGL-IPF9381"
FT                   /old_locus_tag="CAGL-CDS1068.1"
FT                   /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
FT                   YMR160w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09493g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62735"
FT                   /db_xref="GOA:Q6FJ37"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ37"
FT                   /inference="similar to AA sequence:UniProtKB:Q03823"
FT                   /protein_id="CAG62735.1"
FT                   /translation="MNGENSWWSRNGENRVSDGGDQVGDERWYQSVWNKLPQLRRPNME
FT                   VNITAATQYSHLNAEQIQYLENDALEKIRARSNTWCWFQDMNALASAGAAGVVSVAGTG
FT                   SSILPLPLPAYPGDTFPGHQLYVKNSLLLPESPLEIYHREPLRTQISNAFKEHYNFPNE
FT                   KHLYLRRPEQTGIVDQKVVVISIVGHLPDKYEKITLGKQPSAYYLTQRFLKTLEHVNPG
FT                   TVVTFSIEADIDTQPMETAFQSLVKVFNNWKFRLKDASAIYIQSVYHSVPIAIKLAKHL
FT                   MLNHIDYGFTDKTSIGLLGLESCIEGYRFWDHSIDISSSTEQEIDKLQQAKEKQLYQGC
FT                   TKQQQTILAQIKEYCDLESEESQNMQNDLDWVLYNWGPARVTLVGKLYDNFMTLSQKLA
FT                   IDYRHSKIMRSLWCNGSYLGLDPKLPEKISVPNSHLKTIKFDCNVQIPEERLFEVSLLM
FT                   IVVLALNLGYTSGTSLAKLIGPYFISRSYNSNTVPPNIRKQQTYDNKIWLQEMEEKWKD
FT                   LNIRESYMDELPKHVSSTHSFLEFSYFQAQRSPDLLQIKSDIYDDDSVYKLFLENTMLT
FT                   RNPRYKKHLQLHKDEYMPSSIFDRANQYDLVWKFHEFLSNFVTARNLPRQNFPPLISFS
FT                   ISLDYSFWKYMYPESNSFNRDTTESRKKLVQLWECYNSWDPPTRGLQKLRNILSVLSIY
FT                   KEPSKFIEDIQRTL"
FT   gene            <945440..>946045
FT                   /locus_tag="CAGL0M09515g"
FT                   /old_locus_tag="CAGL-IPF9537"
FT                   /old_locus_tag="CAGL-CDS4444.1"
FT   CDS_pept        945440..946045
FT                   /locus_tag="CAGL0M09515g"
FT                   /old_locus_tag="CAGL-IPF9537"
FT                   /old_locus_tag="CAGL-CDS4444.1"
FT                   /note="highly similar to uniprot|P25046 Saccharomyces
FT                   cerevisiae YBL093c transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09515g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62736"
FT                   /db_xref="GOA:Q6FJ36"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ36"
FT                   /protein_id="CAG62736.1"
FT                   /translation="MEMEEFAPSYYYYVEPEMGYQPQQPNPMEDLITVYHLDDISRQVA
FT                   RTNEDGTKAVKLRKSYKNQITDLSGKFSSIPNRENRKGGEIAHILFQNNPDMMNQVHRS
FT                   PDMTDEQWREALMNVDASLFQAPNMDWEVCQSVLSQFDRSYPTEFQNDPNFHVDDLAFD
FT                   LDGTGKSNAKKRKNRSNGSSMATPNSEMQDDVKRRRLE"
FT   gene            complement(<946553..>947281)
FT                   /locus_tag="CAGL0M09537g"
FT                   /old_locus_tag="CAGL-IPF9538"
FT                   /old_locus_tag="CAGL-CDS4070.1"
FT   CDS_pept        complement(946553..947281)
FT                   /locus_tag="CAGL0M09537g"
FT                   /old_locus_tag="CAGL-IPF9538"
FT                   /old_locus_tag="CAGL-CDS4070.1"
FT                   /note="similar to uniprot|P38172 Saccharomyces cerevisiae
FT                   YBL095w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09537g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62737"
FT                   /db_xref="GOA:Q6FJ35"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ35"
FT                   /inference="similar to AA sequence:UniProtKB:P38172"
FT                   /protein_id="CAG62737.1"
FT                   /translation="MPPLFRAVTRGILLPTLGFSAGFLTFLKAWPDEAGAITLQKQQGS
FT                   DMQLLQRADVLQKITQSTLYKQLLRADDVDHTRQSDKIPHGHKPYHVGQGILFGKDKLE
FT                   IDPLIFLNEEKGQLTVFYHLGKNLGNEKSQVHKGVISLLMDEALCYCGFPRLPSKRGVT
FT                   AKLNLKFNREIPADSTVILTATVRESKGRKCIIDGELQVFSDKVHTLPSLWGEKEPNVE
FT                   AECILVEPKWFKYFSRLNMF"
FT   gene            complement(<947542..>949797)
FT                   /locus_tag="CAGL0M09559g"
FT                   /old_locus_tag="CAGL-IPF9539"
FT                   /old_locus_tag="CAGL-CDS0936.1"
FT   CDS_pept        complement(947542..949797)
FT                   /locus_tag="CAGL0M09559g"
FT                   /old_locus_tag="CAGL-IPF9539"
FT                   /old_locus_tag="CAGL-CDS0936.1"
FT                   /note="similar to uniprot|P38170 Saccharomyces cerevisiae
FT                   YBL097w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09559g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62738"
FT                   /db_xref="GOA:Q6FJ34"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ34"
FT                   /inference="similar to AA sequence:UniProtKB:P38170"
FT                   /protein_id="CAG62738.1"
FT                   /translation="MLANLEEWIKMATDNKINSRNSWNFALIDYFYDLNILKDSENNIN
FT                   FQKASATLDGCVKIYSSRVDSVTSETGKLLSGLSQRKNEQANSKNNKQPGDGNDGDYDD
FT                   ADSSVQIDALTGLPVGKDSDEYLKRRRVHNRVLETTLVEFDNIRMKELDQELNIDPLFK
FT                   KALVDFDEGGAKSLLLNTLSIDESGRVVFDAAMKNEPSLLKEKESNEEPLNENNLPLDS
FT                   SKSMDEDNSHGDRSDKNSTPTPQTPITEPEEEEDSKADITLNKSFSSNFQYSMDDEILA
FT                   LGIDYIKFDDISTSDISPSLQNLRNVIADINKAKGFIDSINNKFDNFLTEDEIKEAVPE
FT                   EEGPNGNDYDDGINQELEYSMGNNEDVLPFDINDGGDNFGEDNEGGIDDEEGDENGGLD
FT                   SMLGSILEKDLMAYFDEKMNRNWRGREHWKVANYKKANTIDNKSSEPNNEIEREATESE
FT                   GTSEENKKSDTKKERKKQIQIDFLNLDPNIESIVFDSKKRSGIDMAIKSRTNDSHYLLP
FT                   DDYHFSTEKITGLFIKPNTKMSIFNRVKRRKMTAAQVDTTSDNLGNGIPQIADEQFWAN
FT                   NYEEQENENNIGGNNDLESSNIVGADIENPFEEEGIDFNQAFEDMSLDENDDAGKDIFT
FT                   QKDEKEDLTKLRQPDKVTYSRVSKKVDVRRLKKNIWMSVKSVVSQLDETSDILQFRFTD
FT                   ITKNLGKFYSPESLSDISTSFCFICLLHLANEHGLQIKSTENYEDLTVIFDKSVVTV"
FT   gene            complement(<951054..>952685)
FT                   /locus_tag="CAGL0M09581g"
FT                   /old_locus_tag="CAGL-IPF9540"
FT                   /old_locus_tag="CAGL-CDS1821.1"
FT   CDS_pept        complement(951054..952685)
FT                   /locus_tag="CAGL0M09581g"
FT                   /old_locus_tag="CAGL-IPF9540"
FT                   /old_locus_tag="CAGL-CDS1821.1"
FT                   /note="highly similar to uniprot|P07251 Saccharomyces
FT                   cerevisiae YBL099w F1F0-ATPase complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09581g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62739"
FT                   /db_xref="GOA:Q6FJ33"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ33"
FT                   /protein_id="CAG62739.1"
FT                   /translation="MLSRVVLARNALRAVSRASRASRGSVVRTSARCYAAKAQPTEVSS
FT                   ILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEPG
FT                   QVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVGTAR
FT                   AQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQK
FT                   RWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLA
FT                   PFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL
FT                   LERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPA
FT                   INVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGER
FT                   LTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLKSNHENILND
FT                   IRDKGELTKDLLATLKSATESFVATF"
FT   gene            complement(<955022..>955492)
FT                   /locus_tag="CAGL0M09603g"
FT                   /old_locus_tag="CAGL-IPF9048"
FT                   /old_locus_tag="CAGL-CDS4773.1"
FT   CDS_pept        complement(955022..955492)
FT                   /locus_tag="CAGL0M09603g"
FT                   /old_locus_tag="CAGL-IPF9048"
FT                   /old_locus_tag="CAGL-CDS4773.1"
FT                   /note="highly similar to uniprot|Q03799 Saccharomyces
FT                   cerevisiae YMR158w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09603g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62740"
FT                   /db_xref="GOA:Q6FJ32"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ32"
FT                   /protein_id="CAG62740.1"
FT                   /translation="MSLVKLANTCAHLQNCSRVRLSLTSLPYTKLQLQFAYNLYKQGFL
FT                   SSVERGSTRGPDDEFIEVTPDNIATRRLWVGLKYRDNKPVLSQCRLISKPNMRIMMGPD
FT                   ELKKVCSGVSVRQVKPLQPGELMLVRTERNTIVDIHEAIAQRHGGELLCRVK"
FT   gene            <955675..>956367
FT                   /locus_tag="CAGL0M09614g"
FT                   /old_locus_tag="CAGL-IPF9047"
FT                   /old_locus_tag="CAGL-CDS4172.1"
FT   CDS_pept        955675..956367
FT                   /locus_tag="CAGL0M09614g"
FT                   /old_locus_tag="CAGL-IPF9047"
FT                   /old_locus_tag="CAGL-CDS4172.1"
FT                   /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
FT                   YMR157c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62741"
FT                   /db_xref="GOA:Q6FJ31"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ31"
FT                   /inference="similar to AA sequence:UniProtKB:Q03798"
FT                   /protein_id="CAG62741.1"
FT                   /translation="MALMRLGLRIPARLGSNLPVAQLGIRAAKHRFYATAPRNDGGELP
FT                   SIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVALFPGNQLKVYG
FT                   VLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVEYFDMLPQGLM
FT                   VKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLKDTDICKYYD
FT                   AVGKLESV"
FT   gene            <956604..>957353
FT                   /locus_tag="CAGL0M09636g"
FT                   /old_locus_tag="CAGL-IPF9046"
FT                   /old_locus_tag="CAGL-CDS4012.1"
FT   CDS_pept        956604..957353
FT                   /locus_tag="CAGL0M09636g"
FT                   /old_locus_tag="CAGL-IPF9046"
FT                   /old_locus_tag="CAGL-CDS4012.1"
FT                   /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
FT                   YMR156c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62742"
FT                   /db_xref="GOA:Q6FJ30"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ30"
FT                   /inference="similar to AA sequence:UniProtKB:Q03796"
FT                   /protein_id="CAG62742.1"
FT                   /translation="MKTHKVTILPHLIKFIPQVDSSIADDSLNLYGFDLDHTIIQPKSG
FT                   AVFARGSNDWKFMEFGGKQTLQKLIKLVLGESNAFVVVFTNQGGVVTVPTTAKSCLNFT
FT                   NKIKNLLEHIEGVENGSKFLERLFIYAAPKKPASFGKKKVAGTKSGRVNKSINSMLAKT
FT                   TKEKEQIDNKDIDDQVSIFTKMRKPETGMADAFISDLELIFPKEKYKYNWKLYCGDAAG
FT                   RKSDFSDADKAFAETLKVPFVIPEEFF"
FT   gene            complement(<957350..>958915)
FT                   /locus_tag="CAGL0M09647g"
FT                   /old_locus_tag="CAGL-IPF9044"
FT                   /old_locus_tag="CAGL-CDS1955.1"
FT   CDS_pept        complement(957350..958915)
FT                   /locus_tag="CAGL0M09647g"
FT                   /old_locus_tag="CAGL-IPF9044"
FT                   /old_locus_tag="CAGL-CDS1955.1"
FT                   /note="similar to uniprot|Q03795 Saccharomyces cerevisiae
FT                   YMR155w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09647g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62743"
FT                   /db_xref="GOA:Q6FJ29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ29"
FT                   /inference="similar to AA sequence:UniProtKB:Q03795"
FT                   /protein_id="CAG62743.1"
FT                   /translation="MTDSTTSAGLLILSAALVSLGAGTPYLYSFWAPQFISQCHINAGS
FT                   VSTLSYSLNIGSCILGPMAGYIVDQSPKVACAIGSGATLLAYIVVKICYDRAIGNVPLI
FT                   SFALALIGFGSVAGFYAAVKCCTAMFPRNRGSATAIPIAMYALSAMIYSTIGTTIFKQE
FT                   ESKFFVFLILSCPALIAVGATSFVMPETKYEPIVEDSSGLQAAPVIEGLSNADIWSKNM
FT                   NLNIELRDTRKTFSPGAHEGVTLSPYKIRDDDDLTQRGLTPSSFDIDTKIEDMHTPSSN
FT                   QLELTIKQQVLSAQFFSYYLVLMILQGFGQMYIYSVGFLVTSEVEYANSFGAGFNAETI
FT                   QSIQVTILSLFSFLGRLTSGTISDFLVKRWQLHRLWNIAIAAFLAIIASLILMKNFDSP
FT                   AITPGISAAKLGNLQKIYLSSLLIGLMFGIVFGTFPLIVADTFSQKHYSTIWGLLTTGG
FT                   FVGVRVLSNILSSNMVKNIPLGSTENVCTNSTHCYQDTFKFTASIVSTALVAIFVIIYK
FT                   HRRY"
FT   gene            <959603..>961744
FT                   /locus_tag="CAGL0M09669g"
FT                   /old_locus_tag="CAGL-IPF9040"
FT                   /old_locus_tag="CAGL-CDS1049.1"
FT   CDS_pept        959603..961744
FT                   /locus_tag="CAGL0M09669g"
FT                   /old_locus_tag="CAGL-IPF9040"
FT                   /old_locus_tag="CAGL-CDS1049.1"
FT                   /note="weakly similar to uniprot|Q03792 Saccharomyces
FT                   cerevisiae YMR154c calpain-like cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09669g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62744"
FT                   /db_xref="GOA:Q6FJ28"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ28"
FT                   /protein_id="CAG62744.1"
FT                   /translation="MNVDRCWEQYYKTLKLIYLEENKETCQREIDHLVDTAIELKEKTY
FT                   SNAVLDLGRQFREVCPKARIMWKTSSIAGNFYPPISISDIYSPVIANVFDQTTRLECRR
FT                   QEYSLRMPLQEEPNFTGIQQHAQVSDCSLVVSLININRYKTTMPVVKQVAENLYATNLY
FT                   FNGAQRRLVLVSTENIPTMQDDPTKQMSVHSANKINKILELGLLKLTSLSYHSEGSNTA
FT                   IDTYRLCGWIPDISSINEFNFLKVHKAFSRGECLIAMGTGGFVPKENIFGVKLRKYHDY
FT                   AVLDIDMINEVVTLRDPLISDTLLTINFDSIRKYFLQVYCNWDSSKLFMFTKDTQIFYS
FT                   DKKFNPYQTLAGKPTFYLKNNSDRDEYAWVLLEFHLDKNNNTTAYLQEIPDRISTVRLG
FT                   YNDNSAETGFQLIKIRLKPKQCIWYFCYSSTDKMLTFHTYSTSSDVVFVRSKMPGCDFD
FT                   VTECAILPENIVPMQYPNHSETDIYYLASIDFSIEGEPGITIITDMVVCLETDDDLVNF
FT                   QMFHWDDLDFNSPIYDEFYMNERMFEKKDLPLTSGERYRIVASTARPPISKGYQCAVSG
FT                   INIHADYPCSYKLRESDVRYNSMMFKLPHVFTLASTGITKISLVNRNKYNKVFMRIYPQ
FT                   TQEDYRYNYRVISADTGEDLVKPGNNIQKLYGGIVIKEFLVSDQTNLELHLSFQDNGRV
FT                   PVELKCQLYVGSVKIITLS"
FT   gene            complement(<961939..>963159)
FT                   /locus_tag="CAGL0M09691g"
FT                   /old_locus_tag="CAGL-IPF9038"
FT                   /old_locus_tag="CAGL-CDS2729.1"
FT   CDS_pept        complement(961939..963159)
FT                   /locus_tag="CAGL0M09691g"
FT                   /old_locus_tag="CAGL-IPF9038"
FT                   /old_locus_tag="CAGL-CDS2729.1"
FT                   /note="weakly similar to uniprot|Q03790 Saccharomyces
FT                   cerevisiae YMR153w component of the karyopherin docking
FT                   complex of the nuclear pore complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09691g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62745"
FT                   /db_xref="GOA:Q6FJ27"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PDB:2M4M"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ27"
FT                   /protein_id="CAG62745.1"
FT                   /translation="MFGNSAGFGSVGDNSSGGSGANRDANNRPSWFQETARRTIPNTVL
FT                   RREVKSSSNSGEDDNGNRGDSTSTGFNTLTFGAKKHMLLGSSNVSTGGNDHMNPLLMDN
FT                   SEAPPTVSISDWKREEGLFDLRNTRNENTINTIGTPTFISPISREKSEVSLFDSNSQSR
FT                   SSSASSIGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGY
FT                   FFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISEL
FT                   SRDTYNSMNDVKQTNSISTNQLTQHNQSEVPKSNQTFETKPTNETERNQIKTPSAFGSD
FT                   NKGNGSISSGRTKRRLSIKDGSSLFLSGTDNIFSTLDGQPTKKRMINRDRSLIGKISGW
FT                   LFGWNDL"
FT   gene            complement(<963527..>964633)
FT                   /locus_tag="CAGL0M09713g"
FT                   /old_locus_tag="CAGL-IPF9036"
FT                   /old_locus_tag="CAGL-CDS3008.1"
FT   CDS_pept        complement(963527..964633)
FT                   /locus_tag="CAGL0M09713g"
FT                   /old_locus_tag="CAGL-IPF9036"
FT                   /old_locus_tag="CAGL-CDS3008.1"
FT                   /note="similar to uniprot|P28625 Saccharomyces cerevisiae
FT                   YMR152w YM27"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09713g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62746"
FT                   /db_xref="GOA:Q6FJ26"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ26"
FT                   /inference="similar to AA sequence:UniProtKB:P28625"
FT                   /protein_id="CAG62746.1"
FT                   /translation="MVQQRSITFVDGYSKPAITTTELDLDNCFKDDEIVIKVKCCAINP
FT                   IDMVVYGLSTTWLTGCKPKTFGRDFSGVIVRAGSRVDPQWKVDDEVNGQYVHLLGDRGS
FT                   FSDYLIFNPAKNKSIAHMQKFPRGEGALNYNEGKYDDWVLNASFPLVYGTADSVLADYI
FT                   KKWTPESRILVIGASTQVSNCLIQIAKRHYNIGTVVGICNKNSFEYNEKFGWDHLVSYN
FT                   DGKTIENVTKLMEEKLGGEKFDMIFDSVGNTDFFPVIDKFLKPKSTGSYFLTVVGDNKL
FT                   DYKNPTFRRAMPLSVAWKKINPFLGFNYSTVLVKPIDRYMKLSTEMIQKNQFEPVIDSV
FT                   YEFDQYQEAMDKLLTNKAKGKIVIRVNK"
FT   gene            <964915..>966207
FT                   /locus_tag="CAGL0M09735g"
FT                   /old_locus_tag="CAGL-IPF9035"
FT                   /old_locus_tag="CAGL-CDS2567.1"
FT   CDS_pept        964915..966207
FT                   /locus_tag="CAGL0M09735g"
FT                   /old_locus_tag="CAGL-IPF9035"
FT                   /old_locus_tag="CAGL-CDS2567.1"
FT                   /note="similar to uniprot|Q02574 Saccharomyces cerevisiae
FT                   YLR288c G2-specific checkpoint protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09735g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62747"
FT                   /db_xref="GOA:Q6FJ25"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ25"
FT                   /inference="similar to AA sequence:UniProtKB:Q02574"
FT                   /protein_id="CAG62747.1"
FT                   /translation="MKLKLEINGNDYPENFKLLKTTVTTVASLRSLAVLRFDSDRLVII
FT                   STPRVSNGVVAGHGVVARDSGELWCTIPRDVFSLYHVSAERQNNTIALECNVESLKNAV
FT                   LRYDKVMTQGSASTLQLKLRQMPEWNAASANGPDSAGNSRIRVAALAVSFEELVNVYSG
FT                   QGKDDAFMDATQNNTSHAVNKLISHSSKIPVRFLNAQQDERIQEPMMDYNQTMLCRLPS
FT                   ITDEAGGAFLNFLKRIERYTNVNHIKLQGSTSPHISHNRRDAKLRILVDELDWNLVISW
FT                   NGPLELQERADIDEMAEPTSPERPRSETPLLSRISGDNNFDRIDDSEVNTLQESGPDTN
FT                   SHTNGFLEQVQQAEDESSLVQEVIIRSKDLKVCSKLFAAFEEVIMAISHDYACVFHCSL
FT                   SRGLRDTQTQEEKENGQIIYYISRSKALEFA"
FT   gene            <966493..>967554
FT                   /locus_tag="CAGL0M09757g"
FT                   /old_locus_tag="CAGL-IPF9034"
FT                   /old_locus_tag="CAGL-CDS3135.1"
FT   CDS_pept        966493..967554
FT                   /locus_tag="CAGL0M09757g"
FT                   /old_locus_tag="CAGL-IPF9034"
FT                   /old_locus_tag="CAGL-CDS3135.1"
FT                   /note="similar to uniprot|Q05881 Saccharomyces cerevisiae
FT                   YLR287c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09757g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62748"
FT                   /db_xref="GOA:Q6FJ24"
FT                   /db_xref="InterPro:IPR026907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ24"
FT                   /inference="similar to AA sequence:UniProtKB:Q05881"
FT                   /protein_id="CAG62748.1"
FT                   /translation="MGEEVTFAELKELAGSIKEQFVDPYKNDIGALKKISSETKLQGSD
FT                   PLTELEKLAKILKAYSTKLGIICEPSKLHGNYHAAYTELKNYADSLFYLLSLLPLFTRE
FT                   QGKLYASYLNEDVFTQVLGLLNGTEMLCDEICSSSKENEGDNKDRLISVGIIWASCDEL
FT                   CDIVKGGNYGLLSKRIALSCGLVDDVLEDIHGWLEDPQLEGADDFLGDDLDSIDELEDG
FT                   VKKMGIDGDDEEMIEIVKKFLSEWQTKIKMIKLLLSSFSKSITLTTGKNIPNLGSKLDE
FT                   LNKLHKQVILHLDELVSDVFMSGAAFDEDEMGPSIADLNDTLAKMVHIIKEISKQDPKK
FT                   SKWIDVWNNKYFE"
FT   gene            <968440..>969993
FT                   /locus_tag="CAGL0M09779g"
FT                   /old_locus_tag="CAGL-IPF9032"
FT                   /old_locus_tag="CAGL-CDS1976.1"
FT   CDS_pept        968440..969993
FT                   /locus_tag="CAGL0M09779g"
FT                   /old_locus_tag="CAGL-IPF9032"
FT                   /old_locus_tag="CAGL-CDS1976.1"
FT                   /note="similar to uniprot|P29029 Saccharomyces cerevisiae
FT                   YLR286c endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09779g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62749"
FT                   /db_xref="GOA:Q6FJ23"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR005089"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ23"
FT                   /inference="similar to AA sequence:UniProtKB:P29029"
FT                   /protein_id="CAG62749.1"
FT                   /translation="MIQILLPLLFILSTVFAFDINSKTNVAVYWGQNSAGSQKSLASYC
FT                   QNTEADIFLLSFMNSFPAIGLNFADACTTTFPDGLLQCSQIAEDIKTCQSLGKKVLLSM
FT                   GGASGAYGFADDAQAEAFATTLWNTFGEGSDISVERPFGQSIVDGFDFDIENNNGKGYA
FT                   ALVSKLRQLFSNGSKQYYISAAPQCPYPDASVGDLLANADVDFAFIQFYNNYCNVEAQF
FT                   NWDDWKNFAINTSPNKNIKLYLGLPGAPSAAGSGYISNLDNLSKVIKEISSLANFGGIS
FT                   LWDASQATSNVIDGADYLSQMKNILKSAAGSTETPTTSSSYSMPSNLITNTGEQSSSVL
FT                   VSSVERTTTTLEPTSIISSSSFSDSAPTPTNSHITTTLQPNTNTPPAAAQDSSANVQVS
FT                   VTPSTTTTTPDSPSNHLNDVSPTPSTPAPSSPANPSPDTPAHTIAKQLNAQYAAGQFNG
FT                   KSSCQDGELSCSADGKFAMCAHGSWVEMACAAGTTCYAYDSGNSVFTQCNYVDLKASFV
FT                   "
FT   gene            complement(<970260..>971030)
FT                   /locus_tag="CAGL0M09801g"
FT                   /old_locus_tag="CAGL-IPF9031"
FT                   /old_locus_tag="CAGL-CDS3957.1"
FT   CDS_pept        complement(970260..971030)
FT                   /locus_tag="CAGL0M09801g"
FT                   /old_locus_tag="CAGL-IPF9031"
FT                   /old_locus_tag="CAGL-CDS3957.1"
FT                   /note="similar to uniprot|Q05874 Saccharomyces cerevisiae
FT                   YLR285w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09801g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62750"
FT                   /db_xref="GOA:Q6FJ22"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR025784"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ22"
FT                   /inference="similar to AA sequence:UniProtKB:Q05874"
FT                   /protein_id="CAG62750.1"
FT                   /translation="MSDTESLNDALGLFDEPEDFRPEKPKEHYANYERIDVPDISKSKI
FT                   TNLKLQLVGSSPLWGHLLWNAGIYTARHLDKYPELVSNKNVLELGAASALPSLVAGLIG
FT                   AKRAVVTDYPDADLMANIQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDKKFD
FT                   LIILSDLVFNHNQHDKLLQTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKEYGLT
FT                   PEKIEMVNWKPMFEEDEETAEVRSRVYAYYMTHA"
FT   gene            complement(<971284..>974670)
FT                   /locus_tag="CAGL0M09823g"
FT                   /old_locus_tag="CAGL-IPF9029"
FT                   /old_locus_tag="CAGL-CDS0291.1"
FT   CDS_pept        complement(971284..974670)
FT                   /locus_tag="CAGL0M09823g"
FT                   /old_locus_tag="CAGL-IPF9029"
FT                   /old_locus_tag="CAGL-CDS0291.1"
FT                   /note="highly similar to uniprot|Q06685 Saccharomyces
FT                   cerevisiae YLR410w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09823g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62751"
FT                   /db_xref="GOA:Q6FJ21"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR037446"
FT                   /db_xref="InterPro:IPR040557"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ21"
FT                   /protein_id="CAG62751.1"
FT                   /translation="MQEEAKSPSNGQFLNKYTKKAMESIAPILEGFTPKTSSSENMSLK
FT                   LPPPMLDDKPPMYRSGSSNSHCDLSIDEGRKEGAGKTRSYSATVAAHAVAKMRQLALEN
FT                   PPSSDGSGNTSRNDSAVTSPANTPITELPPQSNIPSNTSSRKSSTSQAKPSLPKIGKIG
FT                   VCAMDAKVLSKPMRHILNRLMEHGEFETIIFGDKVILDETIENWPTCDFLISFFSSGFP
FT                   LDKAISYVKLRKPFIINDLTMQKVLWDRRLCLSILNASKVPTPRRLEISRDGGPHVDDE
FT                   LHEKLKMLGVEIKPVEEPNWRMVDDDTLEVGGQIMRKPFVEKPVDGEDHNIYIYYHSKN
FT                   GGGGRRLFRKVGNKSSEFDPALLAPRLEGSYIYEEFMDTDNFEDVKAYTVGENFCHAET
FT                   RKSPVVDGIVRRNTHGKEVRYVTELSKEEKQMASRVSKAFSQMICGFDLLRVGGKSYVI
FT                   DVNGFSFVKDNQEYYDSCARILKETFIQAKKQIDIEKQTLPVIREEKKQKWVFKGLVTV
FT                   IRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRKVNDLKIVLQALRIALEEKAGNPT
FT                   KIKLLANTLEKKLELPGTKIQLKPVLTQNNEVEKVQFILKWGGEPTHSARYQATELGEQ
FT                   MRQDFDLLNKNILQDIKIFSSSERRVLVSAQYWATALFGADEFSSDEINIRKDLLDDSN
FT                   AAKDIMDKVKKKLKPLLREGKETPPQFAWPAKMPEPYLVIKRVVELMNYHKKIMDHNFE
FT                   TKDVSKLQERWCTSEDPGLFKERWNKLFKEFVSVEKADPSKISELYDTMKYDALHNREF
FT                   LQNIFDPGELANENISNHSLVDRYPINVLARNNFKIVDSSYAAGTSSSSKTSVGSLGWV
FT                   LESGKTKVNSESKSASPFDGQKYVQFRELYRLAKVLFDFICPKEYGIEDAEKLDIGLLT
FT                   SLPLAKQILNDIDIMKNKEAPACVAYFTKESHIYTLLNIIYESGIPMRIASNALPEFDY
FT                   LSQINFELYESTDANEVKSHSIRLKMSPGCHTQDPLEVQLDDRHYISCIPKMSLTRHLD
FT                   MEYVQQKLRNKFNRVNMPSKFTPVNITSPNLTFRRESLTKTTTKRVKSGSVSASATSSP
FT                   PPVPLSSNSSSTTSIDNTLGK"
FT   gene            <975007..>977817
FT                   /locus_tag="CAGL0M09845g"
FT                   /old_locus_tag="CAGL-IPF9026"
FT                   /old_locus_tag="CAGL-CDS0543.1"
FT   CDS_pept        975007..977817
FT                   /locus_tag="CAGL0M09845g"
FT                   /old_locus_tag="CAGL-IPF9026"
FT                   /old_locus_tag="CAGL-CDS0543.1"
FT                   /note="highly similar to uniprot|Q06078 Saccharomyces
FT                   cerevisiae YLR409c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09845g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62752"
FT                   /db_xref="GOA:Q6FJ20"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ20"
FT                   /protein_id="CAG62752.1"
FT                   /translation="MSEVAKRRKLTSTKRYASKIFSPFRVIGNVSNGTPFAVGSLGSTF
FT                   YIVTSVGKSFQIYDANNLHLLFISDRETDEEISCLEAHFHYVYAGFGGKVGIYKRGILE
FT                   HTIEVGNGCKVTKLCVFGDYLCVSTDNNEVHIFKKENSTTDKYATKFYTKFEIPELVGG
FT                   DIVSVLHMPTYLNKIVVVTKINVLLYNVRSGKLLYSSPDFPDQLTVGEAAPALDIIALG
FT                   TISGEVILFNLRLGRKVRTIKVPNMRISSISFRTDGSSHICVGSSKGDILFYDLNRRAR
FT                   IHLLKNVHSEEFGGVTRASFLNGQPIIVTSGGDNSLKEYVFDPSLSQSDEDMVVQPPRF
FT                   LRSRGGHSQPATSIAFADDESHFILSASRDKSVWAFSLRKDAQSQELSQRLHKKNDGNR
FT                   VAGSTMREKFPEVSSIAIENARIGEWENILTAHNESKAARTWDMRSKRVGRWTFETIDD
FT                   GMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVS
FT                   CGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVV
FT                   RQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPN
FT                   GDMLATTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFLEGAFQD
FT                   GGDDHEPLDINNYQSVEQVNSELVTLSLGPRNKMNTILHLDVIKKRSKPKEAPKKPEKA
FT                   PFFLQLAGDKVGDEASGREGISFETPEEIRAREEKQKQSEEAQAELTKFKPGTNRGFQS
FT                   KFTKLLLHGNKQNQYEEFLEYLVSMSPATLDLEIRSLNSFEPFEEIIAFISALTAGLKT
FT                   NKNYELYEAIMNLLFKAHGDVIHANNTNCDLQDALSQWETVHGTEQKMDELVKFCSSVL
FT                   DFVSRS"
FT   gene            <978062..>978382
FT                   /locus_tag="CAGL0M09867g"
FT                   /old_locus_tag="CAGL-IPF9025"
FT                   /old_locus_tag="CAGL-CDS5433.1"
FT   CDS_pept        978062..978382
FT                   /locus_tag="CAGL0M09867g"
FT                   /old_locus_tag="CAGL-IPF9025"
FT                   /old_locus_tag="CAGL-CDS5433.1"
FT                   /note="similar to uniprot|Q06071 Saccharomyces cerevisiae
FT                   YLR408c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09867g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62753"
FT                   /db_xref="GOA:Q6FJ19"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ19"
FT                   /inference="similar to AA sequence:UniProtKB:Q06071"
FT                   /protein_id="CAG62753.1"
FT                   /translation="MPPSTELDALVDKIVNDHSLSEPGQSLKELGDNGKYIMDVQMKKL
FT                   LKLHDQSFIERCFTPMEELKNRYAKVKERSGDLQKEAELVDRDIRIIEMAIQDINKNKS
FT                   HQ"
FT   gene            complement(<978795..>979652)
FT                   /locus_tag="CAGL0M09889g"
FT                   /old_locus_tag="CAGL-IPF9024"
FT                   /old_locus_tag="CAGL-CDS3721.1"
FT   CDS_pept        complement(978795..979652)
FT                   /locus_tag="CAGL0M09889g"
FT                   /old_locus_tag="CAGL-IPF9024"
FT                   /old_locus_tag="CAGL-CDS3721.1"
FT                   /note="similar to uniprot|Q06070 Saccharomyces cerevisiae
FT                   YLR407w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09889g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62754"
FT                   /db_xref="GOA:Q6FJ18"
FT                   /db_xref="InterPro:IPR025124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ18"
FT                   /inference="similar to AA sequence:UniProtKB:Q06070"
FT                   /protein_id="CAG62754.1"
FT                   /translation="MIGGKSSPKSMKNSIGSTLRKWRSTLRKVTHDTLNSLDEVTANEE
FT                   KIDALFDGEGGKTVNWGPVRTSKNGLVQVHEEDMLEEDVTNDLKSSSFGFEKSTTAQPV
FT                   GIQGLLKSGSIEQISSGSRSLVGGVGGTSMRLSEESEEGGSTTGTSNKHEQLTIMKSSS
FT                   GGSQGVSHKEKLTYDNFDAVAECNKLRQRSDKPFVGGPKIWEKRRKLWCEPSVSAEEIA
FT                   HRRENGRGVFDAIPEAYHTSVYKKLVVDNKPLKEPLNLSHAMKVINAGWIDTKKWANAG
FT                   KGLP"
FT   gene            complement(<980073..>981107)
FT                   /locus_tag="CAGL0M09911g"
FT                   /old_locus_tag="CAGL-IPF9023"
FT                   /old_locus_tag="CAGL-CDS3212.1"
FT   CDS_pept        complement(980073..981107)
FT                   /locus_tag="CAGL0M09911g"
FT                   /old_locus_tag="CAGL-IPF9023"
FT                   /old_locus_tag="CAGL-CDS3212.1"
FT                   /note="highly similar to uniprot|Q06063 Saccharomyces
FT                   cerevisiae YLR405w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09911g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62755"
FT                   /db_xref="GOA:Q6FJ17"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ17"
FT                   /protein_id="CAG62755.1"
FT                   /translation="MIEVPVPKELTKENDPLHIIKTRAQTHGRPATIAGPMVRYSKLPF
FT                   RQTCRQYDTDIVYTPMILAREFVRNQQARIADLTTNKNDTPLIVQVGVNNVGDLMKFAE
FT                   MVAPFCDGIGINCGCPIREQIREGIGCALIYNPDLLCEMVKSVKSKYGAKLRLETKIRI
FT                   HDDWDVTVNLCRRLCDSGVDWITIHGRTRTTRSSQPVNLEAIKYIVDKIKDKNVPVVAN
FT                   GDCFTMKDFKHISDYTGVQGVMAVRGVLANPALFAGHDKCPWGCVEWFWYWTTEYNTLP
FT                   FALTQHHLYCMLENMGIRRKLLKEMMLQRSYPELLDWFDTNFVMHRHGDKEFGTTIDPQ
FT                   LKTN"
FT   gene            complement(<981376..>982197)
FT                   /locus_tag="CAGL0M09933g"
FT                   /old_locus_tag="CAGL-IPF9022"
FT                   /old_locus_tag="CAGL-CDS3812.1"
FT   CDS_pept        complement(981376..982197)
FT                   /locus_tag="CAGL0M09933g"
FT                   /old_locus_tag="CAGL-IPF9022"
FT                   /old_locus_tag="CAGL-CDS3812.1"
FT                   /note="similar to uniprot|Q06058 Saccharomyces cerevisiae
FT                   YLR404w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09933g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62756"
FT                   /db_xref="GOA:Q6FJ16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ16"
FT                   /inference="similar to AA sequence:UniProtKB:Q06058"
FT                   /protein_id="CAG62756.1"
FT                   /translation="MKFNLTRPLQIAQWVSYILGVGILQIVVILPLAVLLFHDFYTRLL
FT                   PSDSSVWVPLDNFNSNASGLNTRFKQGIVCVSPDKQLPGLKPNGLSQPIALRCHTNYKL
FT                   DMKLEFYCHSLDAIGNSKGTDLQYAVVSLSDDSNLFYRYRQPVICRNQGATNVLEGNNH
FT                   AKSRMEVLRNEWLNSLSLEDIADISPQLENIEISIDLPNSNGEILLEPTSGILLRRSFE
FT                   QGLRNWMLRRWRTTYIIGTAVFYISLSFIFVITCMATFLIFTKVYGKHQKQ"
FT   gene            complement(<982943..>984334)
FT                   /locus_tag="CAGL0M09955g"
FT                   /old_locus_tag="CAGL-IPF9020"
FT                   /old_locus_tag="CAGL-CDS2301.1"
FT   CDS_pept        complement(982943..984334)
FT                   /locus_tag="CAGL0M09955g"
FT                   /old_locus_tag="CAGL-IPF9020"
FT                   /old_locus_tag="CAGL-CDS2301.1"
FT                   /note="some similarities with uniprot|P32432 Saccharomyces
FT                   cerevisiae YLR403w zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09955g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62757"
FT                   /db_xref="GOA:Q6FJ15"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ15"
FT                   /protein_id="CAG62757.1"
FT                   /translation="MEYNSLMMDAHDVGEYEMGDAFKATHLNVKDGGGQRMSYSVSPSS
FT                   RPLMTAGEEVVHHIPTRGPSDAQAARLRRDSIAHSQGIGGVSWGSLSISSWLRDEVMLQ
FT                   HPSSQQSYQNQERKFSINNGLLQIQMNAPIGQGPISASTNTFLPHLEEQYCKDYSCCGI
FT                   SLPGLHDLLRHYEEAHISTSPGTSMSRPVGGSDASMGMSTGTVQTRNLMDRSMGSHGMS
FT                   PPTPMSSQSKIGSNTSINMHQISGANNNNNIKSKYMVNRGHNSNNIVDTVSTNEVFLNN
FT                   GRGTTSMETSRGTQPIHKHAHPQALQNMMMPPNNGSTQGLHSSNVDIAIDDDDDDEDDD
FT                   DDDEDDEEEEEQDKKEFYIDDPARRLYVMDHEEYKPFKCPVIGCDKTYKNQNGLKYHRL
FT                   HGHQNQTLRENADGTFSVIDPESNEVSTLDAMGNDKDKPYRCEVCGKRYKNLNGLKYHR
FT                   GHSTH"
FT   gene            <984997..>986919
FT                   /locus_tag="CAGL0M09977g"
FT                   /old_locus_tag="CAGL-IPF8388"
FT                   /old_locus_tag="CAGL-CDS1312.1"
FT   CDS_pept        984997..986919
FT                   /locus_tag="CAGL0M09977g"
FT                   /old_locus_tag="CAGL-IPF8388"
FT                   /old_locus_tag="CAGL-CDS1312.1"
FT                   /note="similar to uniprot|Q06053 Saccharomyces cerevisiae
FT                   YLR401c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09977g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62758"
FT                   /db_xref="GOA:Q6FJ14"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR041367"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ14"
FT                   /inference="similar to AA sequence:UniProtKB:Q06053"
FT                   /protein_id="CAG62758.1"
FT                   /translation="MKRELEGSYESERKRGVAQVKAEYVVGAASNVRVDEEEAGSERFV
FT                   QGEFGGKKNKKKRGQNKNRDNRQQKETHALCPKYVLADVTNQVDLCTFGDNCRFVHDIP
FT                   TYLEHKRPEITDSVFKTCPVFETLGYCPMGFKCRFLSSHMDKETHKLLGEYPSDLASAS
FT                   HEINHITQDQKYDLIKKRFPFSKSELVLEILDSFQEENREMHREAEKVKEDQQDNEDEQ
FT                   KEKAPQVVQRELEAQKRRQRQKDLYLQYKDTRFFAQEKKPLDLRHKKIVSPLTTVGNLP
FT                   YRRLMRTLGADVTYSEMALAVPLVQGTNSEWALPKAHESEYPGFGVQVACSKGWQASKA
FT                   AEALATYIPNGISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYVSGDIPIT
FT                   VKIRTGTKEGHPIADTLVRRLVFETDVAAITLHGRSRQQRYTKVADWDYVSQVAKALRQ
FT                   AEADFMESPQGKESHHDEKTRHTQFVGNGDIFNYTDWYQHLEDPEVDSCMVARGALIKP
FT                   WIFEEINAQQHLDKTSSERLEILKTYSKFAMDHWGTDEYGIALGRRFFCEFMSFFHRYI
FT                   PVGILERVPVQLNERPPLWKGRDDMETLLGSSDVKDWIKLSEMFFGPTEDSFVFTPKHK
FT                   SSSYK"
FT   gene            <987540..>996914
FT                   /locus_tag="CAGL0M09999g"
FT                   /old_locus_tag="CAGL-IPF8386"
FT                   /old_locus_tag="CAGL-CDS0005.1"
FT   CDS_pept        987540..996914
FT                   /locus_tag="CAGL0M09999g"
FT                   /old_locus_tag="CAGL-IPF8386"
FT                   /old_locus_tag="CAGL-CDS0005.1"
FT                   /note="similar to uniprot|P18963 Saccharomyces cerevisiae
FT                   YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
FT                   YOL081w IRA2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M09999g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62759"
FT                   /db_xref="GOA:Q6FJ13"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="InterPro:IPR039360"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ13"
FT                   /inference="similar to AA sequence:UniProtKB:P18963"
FT                   /protein_id="CAG62759.1"
FT                   /translation="MSHFGKSGHRRFSSSGNKPDSRHVSAHHRVPPPRPPRPTTPITNA
FT                   TPNVLSPESGQSSAGSRGSHRQSLSNPIGKSKMTETLVYHLFFDRILPVLPVESTLTTY
FT                   REVESDQFFISCRGVIMNVALSRDLNPVIDYSLQLIESLTESRELISDEINEDVAQSVL
FT                   VLLRLLSDTLEFCWESKESPEDKVKDEPSFENIPIDDNKEYVNMGEQARAGNMFTGSTI
FT                   GYSTHKPGFHRVPPPQIDSTLATRLLSVCTRLKYNTRTLRVLKNMSKNLYGNGTITYSS
FT                   VLPKFQAWLKYHNYPKYTETVDLTIDYILRFIAAANPADYDKYVDSKVTNPLLISHTLT
FT                   ELGIVKYLDFFGCVFLTPENVGPFLETLRHLSGFMKRTIFHSLLLYYSSKAFLFWILSR
FT                   PNEYVQLYYALQNLDSSKSNTFHQGNSNSSIATIPYCVSVLFDDIYSTFNVSSLLTNIY
FT                   DTRGHNGSTTQPVETEQSQATSPGSTNPVLFSPTLTSNDGIITSPTMGSNQIASPLSPL
FT                   PMSLDFNSRTQAQGFPLEETASIHSSKRSYNIDESVYSTMGSTHSNINTPTTNASFTHP
FT                   NEDEIPTSGSGHLQYVLELFSNYEETELSSHTSILRFLLSLILLDTDVFTDINAMTFRY
FT                   IPDTSKIIQQYSQKQGTRDAGAGTHMQNDDPSKEKEKNQSIKQITHGLKKLTNLSSSKK
FT                   KTVKFITMLIRNLNGAQMVSDVSLVDSLKTLVALVTLTSSISLIDSNLPSVLFAKRIFS
FT                   ILGHNLDVGKNWESKTNGFIASCTERNPISHRRLQLEFFAAAIQLDSDKLLSHIHLERE
FT                   LAGLNLRRLLLYTEGFKVFFNLLSSDVLRKKVALSSSNFLKSLFCIIADILLKAFPYFD
FT                   AKVTSIVSSILDGSILEKYDTIKTLAGLEPSNPPVLDRTDSSVKLKLQKKITNWDVHEV
FT                   LPTLSAVSSSSDINLSDTGKSIAESTERRSNTSTPAHTSTPANLTHNPLSTIASPPSTP
FT                   GSIGNYRNNPGMNVLSPHARRLQNVKIDSPQVEGERTRQSPYYFGATSTGEYSNQSVSH
FT                   SSLPKTTRSSGSQEKSRRSSDDKNKPQLKMQDSDDVIVLKTNENDDARRIMINIFSIFK
FT                   KMTNYFILPHDQNLNTIWVSKDFRNIMKPIFVAIIDTDTRLQTTAQSFMDVLIRYISKF
FT                   SSDITARSLNEHYLLCNYTITLFAASLFDLKLDNKKREIILRIVVKFLNVKSDLSRIAA
FT                   QKDLQYALYSTELVTFPLLTATVGGGLFISLYCNKGEIPRLLKKGFGEFLFAINCYEKH
FT                   VGEIDRTCIYNLGFIVAMSRDNYAASGSVAFQRRLRNKILHHIKRPDTILLDAMDVIYR
FT                   KWSSYMRKENITQEELIDFRSLAGILASMSGILLSFGETSTDNVPHLFEFRGDLIKKMD
FT                   YFVFKQCQWLNNPDLLTRENSRDILSMELHPLSFNILFDNLRIKIEELRSVNLSQKVHE
FT                   SSFVLLEQIITIVRTVLNRDDDERIMLLFSIRVVSTIDQLSDLVEKIPHSSVKYYKAII
FT                   QMAKLFRAIQHSEISLGIKNHFYLKNKWLKLLTNWFKVTISIDYDFDNLSKPLREMDLK
FT                   KRDLDFLYIDTAIETSKAVAYLTENVPLDIPPSASKDELERASTIVFGNYFTIFLKGLE
FT                   KSTDIQRFPVSLKHKITILNENVILSLTNLSNANVDASLQFTLPMGYSKDKNIRIAFLK
FT                   VFINIVTNYPKLKVESERKKLYAVDQLVQYLIEHPHLAFQAGIICPASDVDAFVAGLVN
FT                   GFDSRNASHILVTQLIKDEIDRASRYADVLRRNSCATRALSLYARSKGQSYLVRTLKPV
FT                   LDEFFESRDSFEIEKILPDDPEAEKNVDMFIHYMSKLINAITESVDYFPPELINICQTI
FT                   FHSVKEKFPDYSFIAVGSFVFLRFLGPAIVSPDAENIILISQTRDKRPLITLAKVLQNM
FT                   ANGSENLTRWPILNKKLDIFKDFSNRIFEFLSKICTIDSKPNIEIRRDPEPYYFEFNFL
FT                   HKFLYEHELEIRKMIVESLVSLDDFDYVRKTFLFVDDIMGVLGRPKVELKNEIPPYIVE
FT                   HMEENPHLYEFMNRNAFKNVSLGDEYEPFMHESMSLDGLPIITITFRKFEAENIEVDAI
FT                   VYRTIQVYSKMWMTKHYLVLDCTGSDSIDMNYNKLTSLFFSLLPDIAIENCIGAIYFNV
FT                   SENFMNQWVNVLRGDNPYLVAQVPHHFINSSSDQEQVKTLGLTGKGADVVQDTRVSLHD
FT                   ISLYHEDTKNLENVSLKIGNRYIQILHEATKQYKLHALNQILNIPFNDVYEIVDLATVG
FT                   VSSITGLPNEFTINFINGKRLVLVSKKYLEIVKMFNYAQLKIEDEYGTESQNRELTSTH
FT                   EESYVKESQEIICHLSLVILNGLFNDDNEVKNISYNLLVVTQNAFNLNFGSRFQKAPEV
FT                   YVPDNTTTFLSTIARALAESSPELTLHMWTYFLEGLENDVIPHEHIPTIICCLSYWVPN
FT                   LYRYVYLVDEEEGANNLSKIIRSLIQLTVKDPDFTTVYLQQIWFLLVLDDRLTSVTVEE
FT                   FVTHALDRDSESRDWKKAVSLLTAFPTVEVACQVIGKLMDIIKSFLPSLKMEVSTHSWS
FT                   ELEILVRISVSLFFESPLLTQMCLPEVLFIISLLIDIGPTHIRYCLHELLMNICHSLMI
FT                   NSSLPKENSERLDGICAVFARQKLNFMSGFSQEKGRILPNFSASSFSSKFGTLDHFVTN
FT                   VFKLMEYGSTSEAAQWKTKYKKYLLGCVFNHESFLSARAIMILGIIGKIDTNEILCRDL
FT                   LAETMKIFAEPVVTDEQLFVGISHIFTYSKIVAGLDPAGQMLPRMFWLATVFVESPHPI
FT                   LFEGGLQFLINCLKHLYEYHYKINNTEKLISELLIESRSFASELLEELEGYTDCLWTKD
FT                   NFEHLILGFITRGLSLAVLRGVALDCLMTAFKYSFREHQMIPRTSHHLNYLFLLYLVSN
FT                   QETFLNLLDSVGFESDYIELDDNIKIPRALVEWISSDNECSNITLYQGALLFASPASDE
FT                   PSKLRFELLTRYLLGISPKCVFRYYFVTRQELRRISSLEQQSDSSTIAFEIAGMLVMHD
FT                   DFDILDIYNKDSVQLLKSRGLFSLTKVNIFGRSFEDIMNSLQENSDQIYNRKRLTTLII
FT                   SKIIYQSQLTL"
FT   gene            <997486..>998997
FT                   /locus_tag="CAGL0M10021g"
FT                   /old_locus_tag="CAGL-IPF8384"
FT                   /old_locus_tag="CAGL-CDS2063.1"
FT   CDS_pept        997486..998997
FT                   /locus_tag="CAGL0M10021g"
FT                   /old_locus_tag="CAGL-IPF8384"
FT                   /old_locus_tag="CAGL-CDS2063.1"
FT                   /note="similar to uniprot|P38277 Saccharomyces cerevisiae
FT                   YBR138c High-Dosage Reductional segregation defective"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10021g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62760"
FT                   /db_xref="GOA:Q6FJ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ12"
FT                   /inference="similar to AA sequence:UniProtKB:P38277"
FT                   /protein_id="CAG62760.1"
FT                   /translation="MDDQTRLRVFEPLDCNSFVSATPNSTHLSKLSVQTPTTSSFIRNP
FT                   YERDQTALENQSGSELLRWKYDQREFMFNSNSTPSKNSNSQTEKYEFPITEKLVKNKNP
FT                   GCKRRTNQLIGAKPSRPSGLQNVTSKLELLDETHFTSLPIPAPKGTKIDNSAILSDIID
FT                   DNSDDIITADDSVILPSKRSFRTPANEIKVHNNGNKRYISYKYSNRYPERESSPSEQMI
FT                   SSGKDTHPIVIVEDYLLSDSERSFTESTRKRKRYNSNNDGLKPKLSLHNLKTKIRSSNT
FT                   DHLPVKKKVHYLKECSTVDSSTNEENEAGSSKCIKEVLNEFLPPKSNSADCDLYISNLL
FT                   SKGTNELKRCVICEKILYEVSSLLYKENDFKELVCGSCTEKYETIAKLLEGCELESTFE
FT                   YSLDSSSFEANTLDSSLIQSSHTVCREVTPPHNSSLQHMRRDSFSEDLIKALQSQLIKN
FT                   SKQIPENSIFPNKALSWFIDARRKLRWRWRVSGLLPEFTINNNNE"
FT   gene            complement(<999113..>1001089)
FT                   /locus_tag="CAGL0M10043g"
FT                   /old_locus_tag="CAGL-IPF8382"
FT                   /old_locus_tag="CAGL-CDS1243.1"
FT   CDS_pept        complement(999113..1001089)
FT                   /locus_tag="CAGL0M10043g"
FT                   /old_locus_tag="CAGL-IPF8382"
FT                   /old_locus_tag="CAGL-CDS1243.1"
FT                   /note="similar to uniprot|Q04093 Saccharomyces cerevisiae
FT                   YDR444w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10043g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62761"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR034315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ11"
FT                   /inference="similar to AA sequence:UniProtKB:Q04093"
FT                   /protein_id="CAG62761.1"
FT                   /translation="MKKDGGLLLVHEKNSLGIGGMCRYILQVDHKKLKEDGIDTQELYL
FT                   RFKNLESPLLRPVYLTGPYAFYIDVRPCNYDEDKTYIGSEDVAFCSDLKPDEKFKAKLY
FT                   FNANSRLQTKNARDEIYSWTIDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTSV
FT                   RGLSLKMWDEKSLWNLPPKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEER
FT                   YNPNVVVRGCMDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPT
FT                   QSMAIHYISVMYPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGR
FT                   DLNLKYTPLTSNEGLSALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHD
FT                   GIVPLRTAALLYLDWRSLTQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEI
FT                   PSESPNSKNFLQWALPQVIIKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKG
FT                   PSEASTFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQHYLKRSTMKRV
FT                   VYPNESVNRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVR
FT                   EHFGLEACKKQAGVNNNIKLTKL"
FT   gene            <1002184..>1002933
FT                   /locus_tag="CAGL0M10065g"
FT                   /old_locus_tag="CAGL-IPF8380"
FT                   /old_locus_tag="CAGL-CDS4009.1"
FT   CDS_pept        1002184..1002933
FT                   /locus_tag="CAGL0M10065g"
FT                   /old_locus_tag="CAGL-IPF8380"
FT                   /old_locus_tag="CAGL-CDS4009.1"
FT                   /note="similar to KLLA0F09251g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10065g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62762"
FT                   /db_xref="GOA:Q6FJ10"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ10"
FT                   /protein_id="CAG62762.1"
FT                   /translation="MSHHCEDEHFEHDHDHDHGHDHGHSHEAPIATSAAQSLYEQIDTP
FT                   KIKCLNGVGKGATGKELYKYFIKPHEEKYNTEIYLESDADCQLIINIPFVNSCKVHSVV
FT                   LRTNANSSGYSTPRTIKIFNNFKKSLDFDTLSGESKVDFKTEHPNNVGVHKGEASVTED
FT                   SSFVEYHLPRAQFQNCESLTLFIEDNWADDEDELSQLFFLEIRGEITGKLRPENAVPLM
FT                   TVYESAPNPLDHAKLESEVSDGLNLGK"
FT   gene            <1005238..>1006344
FT                   /locus_tag="CAGL0M10087g"
FT                   /old_locus_tag="CAGL-IPF8375"
FT                   /old_locus_tag="CAGL-CDS3006.1"
FT   CDS_pept        1005238..1006344
FT                   /locus_tag="CAGL0M10087g"
FT                   /old_locus_tag="CAGL-IPF8375"
FT                   /old_locus_tag="CAGL-CDS3006.1"
FT                   /note="some similarities with uniprot|P38749 Saccharomyces
FT                   cerevisiae YHL009c transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10087g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62763"
FT                   /db_xref="GOA:Q6FJ09"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ09"
FT                   /protein_id="CAG62763.1"
FT                   /translation="MNNEPFDILGLMQGPHFSNSGDDIYTNGRMEVKYPPIGIDDEGQN
FT                   ISGNGIGLDYAPFTPAGLSGSGQSAMANFQQQNNINSAGFQTQLTPSNIELHNNLQNLR
FT                   TPPDIIKTEQSISPNLDFSTSINGNFNTNNSISGDSNNDKLNTTARSTFSHHRENSNPG
FT                   DNIDDKKKAQNRAAQRAFRERKEAKFKELQRKVRESEIDRDQLLKELEKLRKWNMEINA
FT                   ENRKLLQKERLGNNGVYSGNMECSSSQSLPNMEQTTYIFPSTNECFEQSINQKNLRDKN
FT                   PEQIFERKPVYSAAGRFLQYEDEYPDDVLLTVPETWEYLSQLSENEEFDVHEVMERLVG
FT                   LEQCHPSGPAYSKQRIDNLVKQSIENNR"
FT   gene            <1006975..>1008366
FT                   /locus_tag="CAGL0M10109g"
FT                   /old_locus_tag="CAGL-IPF8374"
FT                   /old_locus_tag="CAGL-CDS2299.1"
FT   CDS_pept        1006975..1008366
FT                   /locus_tag="CAGL0M10109g"
FT                   /old_locus_tag="CAGL-IPF8374"
FT                   /old_locus_tag="CAGL-CDS2299.1"
FT                   /note="similar to uniprot|P36075 Saccharomyces cerevisiae
FT                   YKL090w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10109g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62764"
FT                   /db_xref="GOA:Q6FJ08"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ08"
FT                   /inference="similar to AA sequence:UniProtKB:P36075"
FT                   /protein_id="CAG62764.1"
FT                   /translation="MAADNNLLMQLAEMFPDHRLETLARCLEDSNNDVNLACSMVISGT
FT                   HISVGEDLHNDNTTLDELYSLFPQIPRDDIQTAYYEHKGNKEKLFDSNEVVLELLSLES
FT                   IRNQKLEIDQPVLSSTVKADENTSKWGKTHNNIETIIRYTNVDRERASKYYTNNLFSAP
FT                   LAIISIIRDGYEQPIISKTNTTNRKTAFRKGAIRGGRVQSSHGIAHRKQNGLDLKTENS
FT                   FEHLCDVTDNMSDTISTVEAPTYEDVADLKKLLSGEQTLSAFNMEFINKAYRYYHLNLD
FT                   KLASLINYLKLNSASKLTFITAEKMSAESLQHSTDDVGMRVPYSKTIKKKSTVNTSPAL
FT                   TKNMIQGKENFQIANKMVVEFFNTYKLDFHGFLPQEAVRIADICLTQWWAEELSNRELN
FT                   AGKLNMKKSQYMSPVTLITGRGIHSAGGFSKVRIAIVKYLQNNYYIFEEFPSYFIVNGK
FT                   GKVFG"
FT   gene            <1008833..>1010461
FT                   /locus_tag="CAGL0M10131g"
FT                   /old_locus_tag="CAGL-IPF8373"
FT                   /old_locus_tag="CAGL-CDS1827.1"
FT   CDS_pept        1008833..1010461
FT                   /locus_tag="CAGL0M10131g"
FT                   /old_locus_tag="CAGL-IPF8373"
FT                   /old_locus_tag="CAGL-CDS1827.1"
FT                   /note="similar to uniprot|P35201 Saccharomyces cerevisiae
FT                   YKL089w required for normal chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10131g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62765"
FT                   /db_xref="GOA:Q6FJ07"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025974"
FT                   /db_xref="InterPro:IPR028386"
FT                   /db_xref="InterPro:IPR028929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ07"
FT                   /inference="similar to AA sequence:UniProtKB:P35201"
FT                   /protein_id="CAG62765.1"
FT                   /translation="MDYMNLGLRSRKTGIDVKKNLAKDEYSMENIDDFFKDDDTSFLSR
FT                   RKSRKSSLLPEADIQNRILPSPLTKQHNVRDTDGFKVPQNINVSHRSTIERAPTEFQHS
FT                   VISEDIPEVIPYEGQSATPDRNIEPIDEDELANMPKPRYRSQYNLGAGNDDTDLINLTP
FT                   EKDGRGTYNDVPDLIDDEGDTSKDNTTFNTSDHAMLEDEVEDGFVLESEEDRDYMESDE
FT                   GSLADDTDDASDSGDDIGTQFAAEINRPGNESPLSSDDEDYISENSTGHNRLEDEIDNP
FT                   SLPTRLSKPYDIVDGVRRSKRVKIPPLEYWRNEKIQYKRRRNEPVLDIDKVITYNHSES
FT                   EEESEEEQKKVKKQRKPVTRTRPYNYVPNGRPRGRPRKNISDDPNGNLIRKIENGEEPK
FT                   GEWLKHGMLEATVKNLHGEAKTELVAMAPNVSQSEETKASGEDDYSIEILFDKYNEAFA
FT                   SGMLKVPVDGRKSPADSNTAFITFHVLDGIVEVTLDGKNFICTKGSSFQIPAYNEYAFA
FT                   NIGSNEVRMFFVQVSPPSDFYSEHY"
FT   gene            complement(<1010688..>1013291)
FT                   /locus_tag="CAGL0M10153g"
FT                   /old_locus_tag="CAGL-IPF8372"
FT                   /old_locus_tag="CAGL-CDS0654.1"
FT   CDS_pept        complement(1010688..1013291)
FT                   /locus_tag="CAGL0M10153g"
FT                   /old_locus_tag="CAGL-IPF8372"
FT                   /old_locus_tag="CAGL-CDS0654.1"
FT                   /note="some similarities with uniprot|Q03497 Saccharomyces
FT                   cerevisiae YHL007c ser/thr protein kinase of the pheromone
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10153g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62766"
FT                   /db_xref="GOA:Q6FJ06"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ06"
FT                   /protein_id="CAG62766.1"
FT                   /translation="MSAELKSHKLDRSIGSNKAGHEHPISRNYVNNVHNANKHKLSDYP
FT                   MMLTITHIGTSRLSSSSSSSSSSSSNSSSSSSYSRGFISDNLSEYRSMDPKSPNRPVRY
FT                   RSIHSKYTSIREDTQHELVTDKEEIQNNKEVSINILSKPNKHTSIDYHNQGVDTTYQIN
FT                   SGQISRHKQMSKSLPNTPKPLQYQKSLSLSHSPRKLSLKSPSRNFSFKSNSKLNVGTKH
FT                   DQEKKRPVKMKEVFSLFVNSIKVSNNSNNSNDRSDQEVPPKHDLKKVKSISKPYNPKHV
FT                   HHVGFDPVTGDYIGLPEKWQALLESNGITKKEQEKDIKTLLNVVQFYQDVSASKTTDKL
FT                   LQTFPLEKGTICVDDTQVSTPSNITSSADDDAAKPSFNESLMPAISIESRHKNEVNQLI
FT                   LKESFSTEDKFIPSRPAPKPPALQELKAIPPKSPNRPKATRVKNNSSKITSVNSLPNNG
FT                   EPTVQFSNDQKSHKSQRVGTSTDTFRFEKSLSGNKKTISITSTSTSTSKHPTNYRESWG
FT                   IKGHTDKKENSNVIKRDEGNKKAEKDKRMQVVLSRLSKICTPGTPEDKFETYLKIGQGA
FT                   SGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQNIVNYIDSYLSGL
FT                   DLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLL
FT                   SMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIE
FT                   MIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFIDKCLAVTVSERAESSEL
FT                   LQHKFITEVAENTEGLSALVKFSRMKKAAEQNSDSEGRSSSSSSKAVASVESGIQ"
FT   gene            complement(<1014414..>1018844)
FT                   /locus_tag="CAGL0M10175g"
FT                   /old_locus_tag="CAGL-IPF8370"
FT                   /old_locus_tag="CAGL-CDS0115.1"
FT   CDS_pept        complement(1014414..1018844)
FT                   /locus_tag="CAGL0M10175g"
FT                   /old_locus_tag="CAGL-IPF8370"
FT                   /old_locus_tag="CAGL-CDS0115.1"
FT                   /note="similar to uniprot|P33202 Saccharomyces cerevisiae
FT                   YKL010c Ubiquitin fusion degradation protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10175g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62767"
FT                   /db_xref="GOA:Q6FJ05"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ05"
FT                   /inference="similar to AA sequence:UniProtKB:P33202"
FT                   /protein_id="CAG62767.1"
FT                   /translation="MDDHSTDYEMDDHYTDGEEDEVQYVYPDGEEEDSDDDGLGDDYDG
FT                   EGDGMFHSLDEDEDHEGVEDDIDEEIDGDGFDVEGAIPAAFGGRRVRVATQPAMNLQEL
FT                   LGTLSQHMGQAQQNRRNTTNAGDTSTPPANATFSDFISMFSSRMAREGGTGSRNSRMVK
FT                   LVENIANASEDSYIAMESLREISENLLMTNQLLLDRIIPMDELLVAVIDILKDPMLSQE
FT                   SELQVQACRCLHNLYEVNIDSMSSSVDQNIIQILQDKLQQIDFIDLAEQVLETLEYLSR
FT                   IQGKDICRNGEMSIYIRYYDFFTVHAQRKAVYIVTNALTNAIEADFVNIKEVFPSLTQI
FT                   FMNTNDSNVISHILNAYTGVCRNIKNSDQLVSLFLPSLFDKILQILSNVDSQLEDKLKC
FT                   INIMTLLVSQCLDLKRHFLRREEPVQDIMLCLNVYAKNNSTKINDKLMFVPKKLLLSVT
FT                   RFITALLPSEEDSLLSNNVLTEVEIDGSNIYLDRIFKDLTPLLIELYGNTTDFEMKEYV
FT                   LVCMARISTHTKQTDVQKLCKHLLPCLASILSHIQNNDLLATSLDNIISDKQMEQWILC
FT                   TATLSILRILLNKFGDVVANSMKREGINIMINSISEKVKEFTGLNLRSIELKHVSHDNN
FT                   EDESSDSDSANNEDNYDISVPDYVKPKAIKFNLLSYPSPEKTLKYLELYCDELTDIAPL
FT                   YRTNSNEELDSIKQTINFMADIEVETFDAEKCDKLWRMLYSNIFGNDEELSGFEMISTG
FT                   LGKAVATLLEQLSNNYQIRKSFEKIFSSKAINLVTLLQSTLNRVENFPIIDSGISGESG
FT                   VSLLTKLLKLELVIDENLEELGLPKNLETTNVQIHCIATYTNLKDFIKQRFLKVQFLDN
FT                   LLPNSSIRNNESNPNSADALDSLLKEKNMEFYFEDYQIDSNDTIFGGLLKAYEKLDKSI
FT                   RDVWQKSQRIKVKFVSKSDKFEETQGDEKESISRMKSSTPADHDDPALDILKILKFLHN
FT                   CSISAENFVNTKLSSKLARQLDEPLIVLSIRLPEWATLLTKEFSFLFPFETRMFALQCI
FT                   SFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRIPRKDMFSTGVKVLKRFGGD
FT                   STVMEVEYIDEVGTGLGPTLEFYAIISKEFARKSLNMWHCLDDNMKHVADGTPNDNTMS
FT                   EVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSLYDNRILDFRFNPVFFMLCHAI
FT                   TKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLRYIYNNRTNTPLIKSLSLTFTLPGY
FT                   NFELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAPQLNSFIDGFSRLFPYKNMLLFS
FT                   PNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIRDLISIISTFDNQEKRMFLQFL
FT                   TGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVMTCANYLKLPKYSSREVMRQQ
FT                   ILTAMTEGADSFQLS"
FT   gene            <1019623..>1020342
FT                   /locus_tag="CAGL0M10197g"
FT                   /old_locus_tag="CAGL-IPF8368"
FT                   /old_locus_tag="CAGL-CDS4092.1"
FT   CDS_pept        1019623..1020342
FT                   /locus_tag="CAGL0M10197g"
FT                   /old_locus_tag="CAGL-IPF8368"
FT                   /old_locus_tag="CAGL-CDS4092.1"
FT                   /note="highly similar to uniprot|P33201 Saccharomyces
FT                   cerevisiae YKL009w mRNA turnover 4"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10197g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62768"
FT                   /db_xref="GOA:Q6FJ04"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ04"
FT                   /protein_id="CAG62768.1"
FT                   /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQL
FT                   DDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLF
FT                   TNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEP
FT                   TLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIISAYYD
FT                   NESSTVSELNINKKQDA"
FT   gene            complement(<1020895..>1022088)
FT                   /locus_tag="CAGL0M10219g"
FT                   /old_locus_tag="CAGL-IPF8367"
FT                   /old_locus_tag="CAGL-CDS2784.1"
FT   CDS_pept        complement(1020895..1022088)
FT                   /locus_tag="CAGL0M10219g"
FT                   /old_locus_tag="CAGL-IPF8367"
FT                   /old_locus_tag="CAGL-CDS2784.1"
FT                   /note="similar to uniprot|P28496 Saccharomyces cerevisiae
FT                   YKL008c protein required with LAG1 or uniprot|P38703
FT                   Saccharomyces cerevisiae YHL003c LAG1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10219g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62769"
FT                   /db_xref="GOA:Q6FJ03"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ03"
FT                   /inference="similar to AA sequence:UniProtKB:P28496"
FT                   /protein_id="CAG62769.1"
FT                   /translation="MLKVETKQRPRRASSVGNIDLGDTVPGFATMHESKASKVAAKRRH
FT                   ERLATQRNLKMTTKLYLKARDYNYHHMWFLPLCILILTYAAYFGISNKRVKGFLHMFVA
FT                   ISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRITQWLNITSKYKIKRM
FT                   MEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLFKAFYLIQAAFWA
FT                   QQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYITMDVSDFFLAL
FT                   SKTLNYIDSPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRTEGPYILNFATQQYKC
FT                   WISLPIVFVLIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVRSDEETDSGSDELKKD"
FT   gene            complement(<1023374..>1023655)
FT                   /locus_tag="CAGL0M10235g"
FT                   /old_locus_tag="CAGL-IPF16038"
FT   CDS_pept        complement(1023374..1023655)
FT                   /locus_tag="CAGL0M10235g"
FT                   /old_locus_tag="CAGL-IPF16038"
FT                   /note="highly similar to uniprot|P43682 Saccharomyces
FT                   cerevisiae YKL006ca SFT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10235g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58077"
FT                   /db_xref="GOA:B4UN61"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR039897"
FT                   /db_xref="InterPro:IPR039899"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN61"
FT                   /protein_id="CAR58077.1"
FT                   /translation="MSRYQEADNDKKLESLATKLSTFRNINEDIGRQAQIDSSVIDSIS
FT                   ESFSSLLNDLKNSSSRLTRSMSMGSGVWRMVFIALSVFFIIYTLYKFF"
FT   gene            <1025157..>1025570
FT                   /locus_tag="CAGL0M10241g"
FT                   /old_locus_tag="CAGL-IPF8363"
FT                   /old_locus_tag="CAGL-CDS4965.1"
FT   CDS_pept        1025157..1025570
FT                   /locus_tag="CAGL0M10241g"
FT                   /old_locus_tag="CAGL-IPF8363"
FT                   /old_locus_tag="CAGL-CDS4965.1"
FT                   /note="highly similar to uniprot|P36105 Saccharomyces
FT                   cerevisiae YKL006w RPL14A or uniprot|P38754 Saccharomyces
FT                   cerevisiae YHL001w RPL14B"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10241g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62770"
FT                   /db_xref="GOA:Q6FJ02"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ02"
FT                   /protein_id="CAG62770.1"
FT                   /translation="MSSTTVRNSNWRLVEVGRVVLVKKGQSAGKLAAIVEIIDQKQVLI
FT                   DGPETGVPRQSINLGQVVLTPLTFTLPRGARTSIVSKKWAAAQVTESWKASSWAKKIAQ
FT                   RERRSALSDFERFQVMVLKKQKRYTVKKALAKA"
FT   gene            complement(<1027450..>1027902)
FT                   /locus_tag="CAGL0M10263g"
FT                   /old_locus_tag="CAGL-IPF8360"
FT                   /old_locus_tag="CAGL-CDS4976.1"
FT   CDS_pept        complement(1027450..1027902)
FT                   /locus_tag="CAGL0M10263g"
FT                   /old_locus_tag="CAGL-IPF8360"
FT                   /old_locus_tag="CAGL-CDS4976.1"
FT                   /note="similar to uniprot|P25565 Saccharomyces cerevisiae
FT                   YCL002c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10263g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62771"
FT                   /db_xref="GOA:Q6FJ01"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ01"
FT                   /inference="similar to AA sequence:UniProtKB:P25565"
FT                   /protein_id="CAG62771.1"
FT                   /translation="MLAVSSIVFFNCGNTELLETLSNESLLLICIFLMILILSYFTYIC
FT                   AEYNLPERNNGRFGGYYIEYVNYLWVIGQFLSAVKYLPQISLNWMGISTKGLPPKYLKI
FT                   SIIATSVLQASNLRTFIDNLEFYQWSFNPTPRMVSFLQLIWLGIIY"
FT   gene            complement(<1029427..>1031250)
FT                   /locus_tag="CAGL0M10285g"
FT                   /old_locus_tag="CAGL-IPF8356"
FT                   /old_locus_tag="CAGL-CDS1468.1"
FT   CDS_pept        complement(1029427..1031250)
FT                   /locus_tag="CAGL0M10285g"
FT                   /old_locus_tag="CAGL-IPF8356"
FT                   /old_locus_tag="CAGL-CDS1468.1"
FT                   /note="similar to uniprot|P36106 Saccharomyces cerevisiae
FT                   YKL005c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10285g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62772"
FT                   /db_xref="GOA:Q6FJ00"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ00"
FT                   /inference="similar to AA sequence:UniProtKB:P36106"
FT                   /protein_id="CAG62772.1"
FT                   /translation="MESLRKSSRSTKGKNTYLEVLRRQEEEEYEQRVNRPKKEKVQEIV
FT                   HCSPCGTTDANYVEDEDPYGEMIQCDQCDTWQHINCMLQVKDIKVPKELENSDDVDSLS
FT                   KLLVNSEDKYYCDRCIYKSQLREERRAYKELNKSEMIGDNDILDEPKEHPDEYVDDQDE
FT                   DQDFILSKDTANIAEVDDDEFVENDDNRVKKDKRKRKPSNSAITTTKTVPKKKARVITD
FT                   DQTETETIPSEDSYAKVRTNARKMLVTLFKNYIIPDTLKNNVFEIVKGHDEQSISDEFA
FT                   EEMESKLFSHCRSISNYKTLISVYTEKVRVLFSNLKDPKNLSLKEAVINRQLDLEQLVS
FT                   MSATDLANPDLQSMKKKIDSQKIDSLVIPNQPLDKLKQDNSEDDHNSFEFTNPTFTKTF
FT                   NPKDIHESNSNNRPYTTDSPTNSYTDEPDSMKSDSNNGVDTNDQNILNVKFKLDYNEVD
FT                   LNVVGTFKFLGSTLLDENQEHKIYQAVVGDGKLIYEGRLHTKIATEYISEIKTTRAVLA
FT                   YQLLPSASHREKYEQLVEFMDDLDRVLGMKPRKPYVKNMYILSSLLGKLPDILQILTTD
FT                   ESIAKKRIDLSRINDNDKTLYLVVVVKPEIV"
FT   gene            <1032001..>1033347
FT                   /locus_tag="CAGL0M10307g"
FT                   /old_locus_tag="CAGL-IPF8355"
FT                   /old_locus_tag="CAGL-CDS2418.1"
FT   CDS_pept        1032001..1033347
FT                   /locus_tag="CAGL0M10307g"
FT                   /old_locus_tag="CAGL-IPF8355"
FT                   /old_locus_tag="CAGL-CDS2418.1"
FT                   /note="similar to uniprot|P36107 Saccharomyces cerevisiae
FT                   YKL004w aureobasidin-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10307g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62773"
FT                   /db_xref="GOA:Q6FIZ9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ9"
FT                   /inference="similar to AA sequence:UniProtKB:P36107"
FT                   /protein_id="CAG62773.1"
FT                   /translation="MFLKVRDWFLKDRPANHSATDLEYGWNPMESVRYLRSQYRHYKAN
FT                   PHLLSYKDVCHYTFMGSVWLFVLIMNPAPMVLKLLFYAFLTLLFLVPITSQFFFNALPI
FT                   LTWLALYFTSSYLKADIRPPITVKALPAIETVLYGDNLSDILATSTNPVLDIFAWIPYG
FT                   LFHFGAPFVVALILFLFGPPTILKGYAFAFGYMNLIGVMIQNFFPAAPPWYKILYGLES
FT                   ANYTMKGSPGGLARIDELLHINLYSNAFANSSVIFGAFPSLHSGCATMEALFFSYCFPF
FT                   LRPLFIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYVIFQYTKYYHLPVVNTSYLTRWAY
FT                   PSVSKYDFKTSDPLNTDSEMHVENIPLRTYDETMSIDSRSNSNGRLELELDMDMDNMRT
FT                   VSSNTSTPASVFDRMESLSRSSATSNTSLGNLSTTDLTDPPVARKPSAF"
FT   gene            complement(<1033952..>1034308)
FT                   /locus_tag="CAGL0M10329g"
FT                   /old_locus_tag="CAGL-IPF8353"
FT                   /old_locus_tag="CAGL-CDS5205.1"
FT   CDS_pept        complement(1033952..1034308)
FT                   /locus_tag="CAGL0M10329g"
FT                   /old_locus_tag="CAGL-IPF8353"
FT                   /old_locus_tag="CAGL-CDS5205.1"
FT                   /note="similar to uniprot|P28778 Saccharomyces cerevisiae
FT                   YKL003c MRP17"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10329g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62774"
FT                   /db_xref="GOA:Q6FIZ8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ8"
FT                   /inference="similar to AA sequence:UniProtKB:P28778"
FT                   /protein_id="CAG62774.1"
FT                   /translation="MLYELIAMVRILQPKHQMQQEAKELATTIGRMIIENRGVVRKIMP
FT                   MGKTMLPRVITKDQERHFQAFKFLMLFDSSIPVQSQILRTLRKDPRVIRSSIVKINTEK
FT                   ELASLSSIEKSQGL"
FT   gene            <1035054..>1036229
FT                   /locus_tag="CAGL0M10351g"
FT                   /old_locus_tag="CAGL-IPF8942"
FT                   /old_locus_tag="CAGL-CDS2827.1"
FT   CDS_pept        1035054..1036229
FT                   /locus_tag="CAGL0M10351g"
FT                   /old_locus_tag="CAGL-IPF8942"
FT                   /old_locus_tag="CAGL-CDS2827.1"
FT                   /note="similar to uniprot|P41910 Saccharomyces cerevisiae
FT                   YDR005c MAF1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10351g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62775"
FT                   /db_xref="GOA:Q6FIZ7"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR038564"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIZ7"
FT                   /inference="similar to AA sequence:UniProtKB:P41910"
FT                   /protein_id="CAG62775.1"
FT                   /translation="MKFIDELDIERVNQVLNFETIDCKIVGGCDIFTTKAVASDRKLYK
FT                   TIDHHLDTILQDNESYNLALQQQIALDAEDKNERSMSPGGQRRDSSSFWEQKRRMSVSD
FT                   SPIYLQHINGNLNESNGAQGEIVADLVPPIIKTSKLNDHNLKELVSNYEAGYSSSSSVE
FT                   SLTHKNKERRTSSLSSTGGKVDKLRADSSTANDITARSVLNDTSRTLNLGPFGPINEPS
FT                   SRRTFAYLIAILNASYPDHDFSLLEPTDFKRSSIKSFIAKFENSMYSLGRKPEEWIWEV
FT                   INSHMTLSDCVLYQYCPTQSFLDDEPGHLWSLIGFFFNKKRKRVAYVYLLASRLQLAVN
FT                   NAIGTPDEMQNEDGTFRNNNTTSFDNNNTQFEGEYDLTYEENAIVDDDDEE"
FT   gene            complement(<1036696..>1038096)
FT                   /locus_tag="CAGL0M10373g"
FT                   /old_locus_tag="CAGL-IPF8943"
FT                   /old_locus_tag="CAGL-CDS2283.1"
FT   CDS_pept        complement(1036696..1038096)
FT                   /locus_tag="CAGL0M10373g"
FT                   /old_locus_tag="CAGL-IPF8943"
FT                   /old_locus_tag="CAGL-CDS2283.1"
FT                   /note="similar to uniprot|P25301 Saccharomyces cerevisiae
FT                   YDR004w RAD57"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10373g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62776"
FT                   /db_xref="GOA:Q6FIZ6"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ6"
FT                   /inference="similar to AA sequence:UniProtKB:P25301"
FT                   /protein_id="CAG62776.1"
FT                   /translation="MDLYEELPGSQLLFDPEFETFLEALNANKVTCVDFLTLKAPDLAK
FT                   LSQRSINEVIRFQQRLIREYDAQYNSNSTKPLAKQIPNKQFTTGDLGIDEVLGGGISTN
FT                   CITEIFGESSTGKSQLLMQLCLSVQLPISEGGLNAKCVFITTEGDLPTNRLAGMIEARK
FT                   DWHELGISQSNIFTVSCPDLISQEHIVNVQLPVLLERNKGEIKLIIIDSISHHLRVELD
FT                   TKSFKDSLENKAYITEMAEKLQGIATKHSVAIVVANQVGDKPLNENLDPYNLNVNDLEY
FT                   QLGWLVGWKNSTILYRQTIQQIGFQKQQVIASNADSILSDDEDYMLVEEQVRRIKREED
FT                   GEKFVESGIGGSTSALARGEVEEADNKLTELKPRKNNSVKKTIKRKMDHRVPNLGLTWA
FT                   NYVSTRILLKKSYAASPMIRRGELKKYKGSDTSDFWQVKRLLKVVYSSFCTPEEINFKI
FT                   TKCGVESV"
FT   gene            <1038860..>1043857
FT                   /locus_tag="CAGL0M10395g"
FT                   /old_locus_tag="CAGL-IPF8946"
FT                   /old_locus_tag="CAGL-CDS0068.1"
FT   CDS_pept        1038860..1043857
FT                   /locus_tag="CAGL0M10395g"
FT                   /old_locus_tag="CAGL-IPF8946"
FT                   /old_locus_tag="CAGL-CDS0068.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10395g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62777"
FT                   /db_xref="GOA:Q6FIZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ5"
FT                   /protein_id="CAG62777.1"
FT                   /translation="MVINCVGKTFEIMAWNYPDNFTLLEAGKLASKIGYRVAKREFKRD
FT                   WEKYKKGHQKRKAARAIKKKKAKEIKYGKNKDLKENIVQQASNPEKQKEQPKRKRAWYQ
FT                   VLSWSVDDLDDYLKNNPQPPENPIKAMVKSWFEKEPTKLPPRIWMLNKDSSQEFSDSTI
FT                   NRKTLTSDTDAKVIEPEAVDGINGNDHCNSDSSLLAMEALVSLDYISNSSTYSINVKNL
FT                   QSVTSEKWSIFRSLKKCTSSSTQKINEEQDSSRSKSRWRNFLGKLKIRTSKRSNVLTEL
FT                   SLQSCDRSYEDPKSYQHNKFDFKSSSVPFTSDDEKLFSHKSPSCRGESTTQTEPIGSRE
FT                   LTPGYNPKKVAQTQKTENQCLDLVCSDNKTANVCSASKDLIAGNNELVSKQLICGDNSN
FT                   IATNIVSNNASNNAADKLSIDDYMKFSCTKNCENLTSYCENILDQKYMIESDSNISAEL
FT                   QKLFKTLDDEIEYYSENLKKDCNNISISEFDISVVKPLNIEQLSINEEASICTEKLKIV
FT                   EAKVGNSVSENGEISRPNTNTSANSEHNPEQADLQDNVSQEFIRNSIGNEQVSTESSIQ
FT                   KQQIDRGTPSVMQLFSNFVENSINQLKKRADFTQNKGNWEGDLGTLPEQLPNSIEKVCV
FT                   DNLKQQQQQQQVDLTGNTIESINSSSTSNVFVSAKGTTKVGSDTVVSGSSDHPLNGAKQ
FT                   SADEKTEVMTNVSHECSANESKLNANGNIGLGNAITSIFNETCNKLSSMTFPVLFKKPL
FT                   QDEPSFTISEIDDKENRECDVITEEKRAEIQEQIKKSTAEFNIFLKEKTKPLEKYENLS
FT                   YCLPNVIDESKLHPRIQAYQNDNNGFNNENVGYFTLLVASDREWEKERLKKEEATNSLP
FT                   IQHCTLDGLDKGIQQGLNSYTSSNVVSPNKRIISSCKEKKEVPECLLEGIKEVDNIIQL
FT                   QEPLIERKVSEITNESYKSVPSTKSVSFKADCSIHSVSKSKSCTAGTSKSIKGPTDHAA
FT                   KPLKSCLKKSFISPVSLDNKVNEQSSKEVGVASENVGVISVTSFHDKLPDQFDDVNHRD
FT                   SRAISKVPSGNCSVDHLPLDPEVVNKVPPGEYDSAVGTNKQLYNEPCSKQDSFRIVESL
FT                   KIKKNTPPPPPPHGQLKKKPPPPPPQGQLKKKPPPPPPQGQLKKKPSPLPQPVTVTGCF
FT                   PSEREYPICTGEQQSTPNKVDDECVTVNSLCSQNFSSKIVDCDEHKYDSVANDSSPDSI
FT                   IDHPIANLNGLTPEESFDSETESIDYTYELDEFEIALPEWVREKRATKGESKLVKKLDH
FT                   RLIKSQVDKNGVFVFGTPHYHDACPVWVVGPHSRLISEKEKANNKPIYKKKLPKRLKRI
FT                   RKRIVWHRNRIAKSYSSQPHIRYRVIENAADNPYLAEGEHTFDAGYKKVGVNMYDFDMD
FT                   EWLQSEQDVDAGDVVKVVPVANLDVNQERFWISLFSDLKTFAKIELNIKQKRPRFLLAV
FT                   DECEIDQDKCIVDDMKIRGCSYLADEPKDEILLEKLLDDFYLEDFDPLAALKNGFMTKS
FT                   EAERIMKVQELKKRGLKDTPEFEFLNDIIGETEEMVYSFDKNMPIEDAVAYATKVKSLA
FT                   IVECRERHKLKLPPIDSEGVVVKFIKNMDKVLANVDTEITEFYIKGDLYDIALEEIVRD
FT                   VQKGIRRKKMEEYRKRYEWRKKILWDV"
FT   gene            complement(<1044619..>1045248)
FT                   /locus_tag="CAGL0M10417g"
FT                   /old_locus_tag="CAGL-IPF8948"
FT                   /old_locus_tag="CAGL-CDS4374.1"
FT   CDS_pept        complement(1044619..1045248)
FT                   /locus_tag="CAGL0M10417g"
FT                   /old_locus_tag="CAGL-IPF8948"
FT                   /old_locus_tag="CAGL-CDS4374.1"
FT                   /note="similar to uniprot|Q03446 Saccharomyces cerevisiae
FT                   YDR003w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10417g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62778"
FT                   /db_xref="GOA:Q6FIZ4"
FT                   /db_xref="InterPro:IPR020999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ4"
FT                   /inference="similar to AA sequence:UniProtKB:Q03446"
FT                   /protein_id="CAG62778.1"
FT                   /translation="MIAYKRATGDNNNDGFTDDDPYGRGSWVWGRWILFVIFVVGILLM
FT                   TLLTFRINRRRTATGRAPIYGTAWMTPPSYRQSERDYNHTQNYVEEYVPTYTETTNAND
FT                   LGYYDANGVFHKNAKAEMLQPPALDGEVARPDGPPPGFDGLTQPESAYLRPEDVPQEDI
FT                   DLEFRRPAQTNFQRTTAGPSSSLETNDDEDSSVSVQMQQVRTSSKK"
FT   gene            <1047060..>1049357
FT                   /locus_tag="CAGL0M10439g"
FT                   /old_locus_tag="CAGL-IPF8949"
FT                   /old_locus_tag="CAGL-CDS0900.1"
FT   CDS_pept        1047060..1049357
FT                   /locus_tag="CAGL0M10439g"
FT                   /old_locus_tag="CAGL-IPF8949"
FT                   /old_locus_tag="CAGL-CDS0900.1"
FT                   /note="highly similar to uniprot|P32356 Saccharomyces
FT                   cerevisiae YDR001c NTH1 neutral trehalase or uniprot|P35172
FT                   Saccharomyces cerevisiae YBR001c NTH2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10439g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62779"
FT                   /db_xref="GOA:Q6FIZ3"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ3"
FT                   /protein_id="CAG62779.1"
FT                   /translation="MDEGPLGKGAVATPAMVEKVANESPKKTRPRRLSSLNEFYDPFST
FT                   AEVYYGPATDPRKQKKSSTKLNRTRTMSVFDNTSIAKTTASFGQFQLKRRGSEDDSLTA
FT                   SQGNRKFFIEDVDGTLEELLSSEDTDRNYQITIEDTGPKVLKVGTANSGGYKHVNIRGT
FT                   YMLSNLLQELTIAKSFGRHSIFLDEARINENPVNRLSRLITNQFWNNLTRRIDLNNIGE
FT                   IASDTKVDTPEAKNPRVYVPYNCPEQYEFYIQASQMNPSMKLEVEYLPKDITPEYVKSL
FT                   NATPGLLALAMEEHVNPATGEVSLIGYPYAVPGGRFNELYGWDSYMMALGLLESNKVDV
FT                   ARGMVEHFIFEIEHYGKILNANRSYYLCRSQPPFLTDMALVVFNRIGGDNNPNAIDFLK
FT                   RSFKAAIKEYKTVWMAHPRLDPETGLSCYHPDGLGIPPETEPTHFDSILTPYAAKYYCT
FT                   IPEFIAMYNDGSVKEPHLDEFFLHDRGVRESGHDTTYRFEGVCAYLATIDLNSLLYKYE
FT                   VDIANFIEKYHNDEYHDPFDGTVTNSAYWRDLAAKRKENITKYMWDEETGFFYDYNIKV
FT                   KCRTNYESATTFWSLWAGLATPEQAKKMVELALPKLEMLGGLVACTEESRGPISIDRPH
FT                   RQWDYPFGWAPHQILAWEGLNDYGYTSVATRLAYRWLFMMTKAFVDYNGIVVEKYDVTR
FT                   GTDPHRVDAEYGNQGADFKGVAKEGFGWVNTSYILGLKFMNSHARRALGACIPPAPFFN
FT                   SLKDDEKSIYGL"
FT   misc_feature    1049554..1049664
FT                   /locus_tag="CAGL0M10461s"
FT                   /note="Centromere Cen0M"
FT   gene            complement(<1049771..>1051069)
FT                   /locus_tag="CAGL0M10483g"
FT                   /old_locus_tag="CAGL-IPF8950"
FT                   /old_locus_tag="CAGL-CDS2546.1"
FT   CDS_pept        complement(1049771..1051069)
FT                   /locus_tag="CAGL0M10483g"
FT                   /old_locus_tag="CAGL-IPF8950"
FT                   /old_locus_tag="CAGL-CDS2546.1"
FT                   /note="highly similar to uniprot|Q03441 Saccharomyces
FT                   cerevisiae YDL001w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10483g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62780"
FT                   /db_xref="GOA:Q6FIZ2"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ2"
FT                   /protein_id="CAG62780.1"
FT                   /translation="MSEESDALLNRGSKSNDMGENSQAKYIPRPVNSDRSISDSKDGKL
FT                   GIIDSKTKGISNIAKVTGRQIRNGAQRTSRTAQKLKLLPEEAFHRDEEVSELRDRDVYS
FT                   QVNRITDKNARRDAEKLGKAHRHLLPRCTSYCTASSYNMKDLIRWLKDSKKTHHTHPKL
FT                   FDECLYTPFLYNDWRGDKRFEHEDVIRLDDEGGEINVSDKHPDIFIFEYGVIVLWGFTE
FT                   REEKAFLNDLEKFEKEKLAEEDIQIEEFNYYVTQSYQPRIYNDFITLRDGSNYMIKLSI
FT                   SHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSGKVSMSKEEIMKSIGELFILRININ
FT                   LHGSVLDSPEIMWSEPQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHS
FT                   HEEYLELIVIVLVVVEVVVSLVNIAVDMIANRT"
FT   gene            <1051487..>1052077
FT                   /locus_tag="CAGL0M10505g"
FT                   /old_locus_tag="CAGL-IPF8953"
FT                   /old_locus_tag="CAGL-CDS4482.1"
FT   CDS_pept        1051487..1052077
FT                   /locus_tag="CAGL0M10505g"
FT                   /old_locus_tag="CAGL-IPF8953"
FT                   /old_locus_tag="CAGL-CDS4482.1"
FT                   /note="similar to uniprot|Q03435 Saccharomyces cerevisiae
FT                   YDL002c non-histone protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10505g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62781"
FT                   /db_xref="GOA:Q6FIZ1"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR030483"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ1"
FT                   /inference="similar to AA sequence:UniProtKB:Q03435"
FT                   /protein_id="CAG62781.1"
FT                   /translation="MDARNLSDEELKRKVEELKENNEVIGLALQRSRLSVKRLKLEYGV
FT                   LLERLEARADMDPDVGTFNPLPSLENFQKELMSTPLKKPKTRKQKLKERDPNMPKRPTN
FT                   AYLLFCEMNKEKIKEGGSVDVTKDLTESWKNLSEQERKPYYRLYNEDRERYQAEMEAYN
FT                   KKSKTEDAGKEDSMSKNSSKQEDSDQTSNEVEN"
FT   gene            complement(<1052421..>1059914)
FT                   /locus_tag="CAGL0M10527g"
FT                   /old_locus_tag="CAGL-IPF8955"
FT                   /old_locus_tag="CAGL-CDS0012.1"
FT   CDS_pept        complement(1052421..1059914)
FT                   /locus_tag="CAGL0M10527g"
FT                   /old_locus_tag="CAGL-IPF8955"
FT                   /old_locus_tag="CAGL-CDS0012.1"
FT                   /note="similar to uniprot|P35194 Saccharomyces cerevisiae
FT                   YBL004w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10527g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62782"
FT                   /db_xref="GOA:Q6FIZ0"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ0"
FT                   /inference="similar to AA sequence:UniProtKB:P35194"
FT                   /protein_id="CAG62782.1"
FT                   /translation="MKQKTTTKTTKRYRYSSFKSRIDDLRIEPARNLEKRAHDYVESSH
FT                   LLASFEHWKDINLSASFTALVPQLEPLVQTLPQILFHSKQVCALLIEAIDKHDELSLQP
FT                   ELDMLAQFCHDLGPDFMPFYKPAMDSLIALISDAGSLESPQVLEWAFNCLAYLFKYLSR
FT                   LLTADLAQTSELLFPLLSHHREYLSRFSAEALSFLIRKTSAKNLPALLNYFFAKLSENE
FT                   EEGHYYEGLLTLFTESLVSTQGSLHSKSNIILTAFITKVLTPQAVDPVCTTLFCDVWMN
FT                   ISKHTAAENLAPVYQLIFQHITEKLGPENTNTVVQIMATLVFSESGKKIPHWETVVSIT
FT                   KSILESCNAENCSSSNLAFYSAALFRNADVRSMTQLHKLLFSTYATKFTDDYFAFLRYC
FT                   MDLCPDKISSYNGDKYANVFLEENWASQGQNLSLFLLELEQNTQLQNRLRIKIPSGLVN
FT                   SLLDTLRTINDKEITEEQLADLYWMSVILKKCDVQESDPVINVILNLISDASNPSDMKK
FT                   DLLGNLILAIPSDENNILINIMEKLVHSFGAYRDSVFFVKSITYLLRKTGNTDSVKTII
FT                   DSLLTDNLENFQQNLVLPDSKIRYETLVLISTLYELRSSEVPQLINECKIIEEIPLSLD
FT                   NGRALTARIRAMSAPFLKIERGSPEIKLVISHMFGLLTIRFSPIWDGVNDFLSATTGKC
FT                   PDLVWKLILQFINVLEHPIISSYPQTFMDIDSPVSLWDSRVDRLTNTINNFREIWNRFF
FT                   NKNESIFELSKDLRGSFQYPGQIRNQTLKVMLLVPHLAEQHFADIITYFFNQVEYEELF
FT                   DNDFNGEKTAKNWTEADRNVLLKVLSKFKNIKNVYKSDELHNRLLTLLGSKNTEVQKLA
FT                   LDAIFAYKEPAVNKYKDNLSNLLNDTLFKDEITIFFANKEKNQLEEQHEIKLMPYILRI
FT                   LYGRAQTPITSGSKKSSKYAVVSVLPNFKRKYIIDFLSLTYNGLAFEKFFDKKYAVDKD
FT                   DLTQGTLKRMSGFVTLMSGVIGTLGSKFSIELATVLKPLLFVISSSYYICGSDANLKDS
FT                   DQSHLLKIGSTLRQHSLKCLSEFFDTLGDDLNWDPYIKDIYECAFKPRLANFSVENAQQ
FT                   ISSLMRIMVQWSGNESLYRFLYYNSFSCTKALVELLHNPHTKEPVLVSILTACNDVITR
FT                   PAQDAEYVELVTIISTSTLKSLPTLYERLGNSDSISIAIEVLVNLTENGYVQDDETISY
FT                   LLSSLTLILESNKNVNNPKIITKMLNVLKTLIPVSTMPFSDLESLFRTLSGFYQTCADK
FT                   ETRLGVNDVLSAFSERFDELEKVASLMKSLNSYSNRRIQEYDFPVMLSAFKKFTEEDYC
FT                   NYSEIQWFPVVHTCLFLINDKEELAVRTNATHTLTVFVKYINEKSSFEEAKPGITILKS
FT                   IILPQIKSGLRKYNDEIQTEYIALLEYIVQNSKYYNDMADMQVLSFGDDEEASFFKNIA
FT                   HVQLHRRQRAIRRLKEVASELSDNSISHYLIPIAEQYVFSDEEKFRNIANESLITIGEL
FT                   ANFMSWNQYKALMRRYIHLLKTKDTALKQSVLLITSVSVALKNTLTAKRNSSDEKINSR
FT                   TMRKFPNNFNDAESFIKHELYPTLSKILGTRNDDTIVARMPLSEGIINILLGLDEDDKI
FT                   TLLPGVLTSICQVLRSKSEELRDAVRQSLSKIVVILGAKYIVFIIKELVSALQRGSQVH
FT                   VLSYTVHHVLRTIVDDLNHGDLDDSAHLIVRVIMEDVFGAVGEEKDSDNYHTKMKEVKV
FT                   NRSYDTGEVLAANISLQEFSTILKPIKMLLMERVSFKSQNKLQELLRHYALGINHNTEA
FT                   AEINSLRLCYEIFNQDVEQKKYNRPKATVTEQEEFFLVNLNAKKERVVTEYSLLSHTFQ
FT                   KFSLDLLRTVITRHKSLMQAKYLQGFVPLLQQSLTSDDENVLISTLKVLIILVKIDFEM
FT                   STENLFKNCVKKALNIVKDSPSTGSELCQMAIKYLSAAIKHKEMKLKNVALSYVLQRIL
FT                   PDLNEPNKQGLAFNFLKSLISKQVMLPELYDIMTTVREIMITNHSKDIRNVARSVFYHF
FT                   LMEYDQSKGRLEKQFKFMVDNLQYPAPDGKQSVMELINLIVTKANPELLSKLASSFFIG
FT                   LANVSVNDDSPRCREMATIILTNMLPRLDATALRTIVKYISAWLKQLENDAFLNLGLRI
FT                   YKVYLEGLGIGHSAELDDQATKAIIKTLHNTDENSKTQWDLIYSALAVFTVFTNKNPEV
FT                   FNSEYKNIWDSVIKCLLYPHIWVRQASGKLVCDLFNHLEKDNWMYENSDIQIITSKIIH
FT                   QLRAPSIPEALAETAIKTLLKVSSYWNKNNVSYIPFGETTESINRYSTAIEYVVSSIGG
FT                   IIRSEENRNDTFFSKKFAIQYFYLLTQMLNAEALESVLEIILFSLYIYLEKSDVSRLTD
FT                   EESELVTSSQECMKQLEDSVSVSAFSKAYANVKQMVYRRRLERKNKRSVLAVTAPDVAA
FT                   AKKLKKHARSREKRKHERDENGYYQRKNKKKRI"
FT   gene            <1060642..>1061319
FT                   /locus_tag="CAGL0M10549g"
FT                   /old_locus_tag="CAGL-IPF8959"
FT                   /old_locus_tag="CAGL-CDS4211.1"
FT   CDS_pept        1060642..1061319
FT                   /locus_tag="CAGL0M10549g"
FT                   /old_locus_tag="CAGL-IPF8959"
FT                   /old_locus_tag="CAGL-CDS4211.1"
FT                   /note="highly similar to uniprot|P53721 Saccharomyces
FT                   cerevisiae YNR018w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10549g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62783"
FT                   /db_xref="GOA:Q6FIY9"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="InterPro:IPR040153"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY9"
FT                   /protein_id="CAG62783.1"
FT                   /translation="MKLLTKEEIEAHRSHTLSGGIQGCVAGLAVSALMFKFLPRRYPSF
FT                   NPARMTWSIKTALFITPPTLLTAICAEEASNNFDATMYSSGSSSKDAIEEHQRWKNLPL
FT                   KDKLVEGLSNNKYKIITGAWAASLYGSWVLVDRDPIMTTAQKAVQARMYAQFITVALLL
FT                   ASVGLSMYEAKLHPDKKKQGEKRRWEKALQYAEQEEREEAEAKARGFVSNEDRVNAKIY
FT                   KYK"
FT   gene            <1061770..>1063629
FT                   /locus_tag="CAGL0M10571g"
FT                   /old_locus_tag="CAGL-IPF8963"
FT                   /old_locus_tag="CAGL-CDS1411.1"
FT   CDS_pept        1061770..1063629
FT                   /locus_tag="CAGL0M10571g"
FT                   /old_locus_tag="CAGL-IPF8963"
FT                   /old_locus_tag="CAGL-CDS1411.1"
FT                   /note="similar to uniprot|P53629 Saccharomyces cerevisiae
FT                   YNR019w ARE2 acyl-CoA sterol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10571g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62784"
FT                   /db_xref="GOA:Q6FIY8"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR014371"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY8"
FT                   /inference="similar to AA sequence:UniProtKB:P53629"
FT                   /protein_id="CAG62784.1"
FT                   /translation="MGDELLGDKRFLRIQRLNSPDDGRRHSLQIDSEEHLYEHKEIAVD
FT                   ETHREVEEDIPSETHTPPELRQTIEVTEKPVGDGEVEQTVKINTERMNSNGSGKDMEDK
FT                   NVEKISKKFKTRYQKGTQDFRSYFDDVAFEFRPSIFDVSINEPYQTKFAGPTLEASIKS
FT                   KEKELRKLRREQKRQLDSGEGPVSWEETLLSSNFSGIYVAIWMTLALGVLKSIVDYYCE
FT                   TGSLTESEIWKFMTTDLFKVALVDTQMYLATYLSLVVQYLCKWGLLSWEKQAWLIMAVY
FT                   EFCYVFFFMIYTEHIMKLHWIAKIFLFLHSLVLLMKMHSYSFYNGYLWEIYDELTYSKK
FT                   ALAKYRETAKSPIIKTLENSIEFCTLEIKSQSKHNEFPKNISIGNYFMFTMFPTLVYQI
FT                   EYPRTKKVRWSYVLEKVCAIFGTIVVMMTVAQIFMYPVAIRALSIRDSTEQSLFEKAKE
FT                   WPRLLIDIVPSFIIMYLLVFYLIWDAILNCIAELTCFGDRYFYGDWWNCVDWAEFSRIW
FT                   NVPVHKFLVRHVYHSSMSAFRLNRDQATLFTFFLSSVIHEMAMYVIFKRFRLYLFSFQM
FT                   LQLPLVAISNTKFMRERTVIGNVIFWLGICLGPSVICTIYLTF"
FT   gene            complement(<1063895..>1064572)
FT                   /locus_tag="CAGL0M10593g"
FT                   /old_locus_tag="CAGL-IPF9481"
FT                   /old_locus_tag="CAGL-CDS4213.1"
FT   CDS_pept        complement(1063895..1064572)
FT                   /locus_tag="CAGL0M10593g"
FT                   /old_locus_tag="CAGL-IPF9481"
FT                   /old_locus_tag="CAGL-CDS4213.1"
FT                   /note="some similarities with uniprot|P53722 Saccharomyces
FT                   cerevisiae YNR020c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10593g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62785"
FT                   /db_xref="GOA:Q6FIY7"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIY7"
FT                   /protein_id="CAG62785.1"
FT                   /translation="MAGESFEWWRRTMQYQTGLGLTADEKARYEKDYAVYNREKQCKSC
FT                   YEYRDWMLKYSPTVRFMIQQISKLNGNASDGKVLNFDESKIICDECPDWKSGGFHPEIG
FT                   ILLCQNRLKDKWHLEDTLSHELVHYFDNLKWQIDWLNLKQHACSEIRASALSGECRFSR
FT                   EFARLGFSMNFGRGHQDCAKRRAIISVMGNPNCKDKEHATKVVEEVWDSCFYDTRPFEE
FT                   IYR"
FT   gene            <1064930..>1066162
FT                   /locus_tag="CAGL0M10615g"
FT                   /old_locus_tag="CAGL-IPF9482"
FT                   /old_locus_tag="CAGL-CDS2703.1"
FT   CDS_pept        1064930..1066162
FT                   /locus_tag="CAGL0M10615g"
FT                   /old_locus_tag="CAGL-IPF9482"
FT                   /old_locus_tag="CAGL-CDS2703.1"
FT                   /note="similar to uniprot|P53723 Saccharomyces cerevisiae
FT                   YNR021w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10615g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62786"
FT                   /db_xref="GOA:Q6FIY6"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY6"
FT                   /inference="similar to AA sequence:UniProtKB:P53723"
FT                   /protein_id="CAG62786.1"
FT                   /translation="MFGALSGMFEYINGLNAHYAALSYEEQKAMTIVERLSIYNWSFEL
FT                   CALGLLALVVLAYKVGTSINVGKAKKVMTSVNSFLNDELCFAKVGIVDPRFPTRMYNSE
FT                   RQNTWFTTFATGRSAIASIRVNLHLPPLNNPFTLFIEGILAYAFPVLKSKELESFIEVV
FT                   IRPNGIHFGSTTQELTNDKLKARKDILAKFKFITAVVNKHVMNEVRDDHYFLSLCATTD
FT                   NDALPQEYVFMSEMNQLNGFITNYLSKTKTPLNEALKQSNRILEFIAFTDLPSDKPFSV
FT                   EEWNEETHDPRILIRTAVPNSTAELEALNKLISVAVEVYDNYTAELSTKGFAYVTNDML
FT                   KKSNNMRTQELEKLVKAAKMKALEEAKEKKLAEEKERRRQLKGTTEQQKLDQKMKEKRE
FT                   RRQRNKQKVRM"
FT   gene            complement(<1066302..>1066718)
FT                   /locus_tag="CAGL0M10637g"
FT                   /old_locus_tag="CAGL-IPF9483"
FT                   /old_locus_tag="CAGL-CDS4956.1"
FT   CDS_pept        complement(1066302..1066718)
FT                   /locus_tag="CAGL0M10637g"
FT                   /old_locus_tag="CAGL-IPF9483"
FT                   /old_locus_tag="CAGL-CDS4956.1"
FT                   /note="similar to uniprot|P53724 Saccharomyces cerevisiae
FT                   YNR022c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10637g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62787"
FT                   /db_xref="GOA:Q6FIY5"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY5"
FT                   /inference="similar to AA sequence:UniProtKB:P53724"
FT                   /protein_id="CAG62787.1"
FT                   /translation="MFKPTSVCLSALSKRTKRVQVQLLKDFPRFHLYKGEVARVKPSLM
FT                   VNYLHYGNGARYILFEDQVDQGLLEYSKKQAELRKASQPSASKVVSETTASTAATTAGI
FT                   RADVKEEEPPAEKKKGFLDSDITVNDVKIPGLRI"
FT   gene            <1066944..>1068665
FT                   /locus_tag="CAGL0M10659g"
FT                   /old_locus_tag="CAGL-IPF9485"
FT                   /old_locus_tag="CAGL-CDS1651.1"
FT   CDS_pept        1066944..1068665
FT                   /locus_tag="CAGL0M10659g"
FT                   /old_locus_tag="CAGL-IPF9485"
FT                   /old_locus_tag="CAGL-CDS1651.1"
FT                   /note="similar to uniprot|P53628 Saccharomyces cerevisiae
FT                   YNR023w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10659g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62788"
FT                   /db_xref="GOA:Q6FIY4"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY4"
FT                   /inference="similar to AA sequence:UniProtKB:P53628"
FT                   /protein_id="CAG62788.1"
FT                   /translation="MNNTKRSSNESGGATRKNSETRSGSSASNTSGNGSGETSGAIGHP
FT                   SDTYISPELSKLIPGLRLYEQLVEEEKKIDTVIKRRKLTMNQTIQRIRSNLIPFREAYN
FT                   LNGVKQTTYLRVFISSVSENQLWQNPDAKLEDGGWTMRIEGRLVDSKQGGSATRDKFSS
FT                   FIDGIRVEFKKPKKDEQNSANKDDDNNNSTAGNNNDNDIESNESSAEGFTREPSESAPQ
FT                   FFADQTPNPLGTDISNPPTVTDMGSASEITTPYESNKLEKEDQIQEIVEWKADPKKPVE
FT                   FDGFDIKRNGNTNLDAVVTIYPKAVESNRYSYSPALASLVGLSHGSKSDAIFSLYKYIN
FT                   ANNLLVSREYSRNTSLAATIVSSRRAQNVKNVVKLDEPLMKLLSRHNSYSSLESTPATV
FT                   KLTDIPSIVERNLEQTKPVRLNYTVRVDKASTYGEVVFDMEVPTKEALLQSISMKGQKR
FT                   PLITDNLAEESQAILRDYEAHITKTAVKNAELDKKLAILHAQLNSTKMKHQFYKKFAED
FT                   PANALKEYIESTSGALKVLSGDEGFLEDTVRRSQFYKENEQILEENISVLFKHERI"
FT   gene            <1068929..>1069375
FT                   /locus_tag="CAGL0M10681g"
FT                   /old_locus_tag="CAGL-IPF9487"
FT                   /old_locus_tag="CAGL-CDS4859.1"
FT   CDS_pept        1068929..1069375
FT                   /locus_tag="CAGL0M10681g"
FT                   /old_locus_tag="CAGL-IPF9487"
FT                   /old_locus_tag="CAGL-CDS4859.1"
FT                   /note="similar to uniprot|P53725 Saccharomyces cerevisiae
FT                   YNR024w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10681g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62789"
FT                   /db_xref="InterPro:IPR019324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY3"
FT                   /inference="similar to AA sequence:UniProtKB:P53725"
FT                   /protein_id="CAG62789.1"
FT                   /translation="MSGKGELSSRVMNMKFMKFMRPEGQDNKDEGTSKHTHLDASKWDL
FT                   KSSVNSDSTNKRRVVVKRASKALKIMENVGITSVKAEDDSNKSSALHGRRIFGENKNKR
FT                   VAEEEEENKTEQEPKQEKDMDELFKESRRNTKPKKKSHKKHKKA"
FT   gene            complement(<1069787..>1071166)
FT                   /locus_tag="CAGL0M10703g"
FT                   /old_locus_tag="CAGL-IPF9488"
FT                   /old_locus_tag="CAGL-CDS2326.1"
FT   CDS_pept        complement(1069787..1071166)
FT                   /locus_tag="CAGL0M10703g"
FT                   /old_locus_tag="CAGL-IPF9488"
FT                   /old_locus_tag="CAGL-CDS2326.1"
FT                   /note="similar to uniprot|P11655 Saccharomyces cerevisiae
FT                   YNR026c SEC12 GDP/GTP exchange factor for SAR1P"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10703g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62790"
FT                   /db_xref="GOA:Q6FIY2"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIY2"
FT                   /inference="similar to AA sequence:UniProtKB:P11655"
FT                   /protein_id="CAG62790.1"
FT                   /translation="MKFHTKLYKVGYPLYGAKFVCDDQFVVTGGGGEGNNGVDNKLTVL
FT                   KVGSSEGNGLRVDEVCDATLPANDDSPTALDAVGDTILIGCNENSAKVKSGAGNSHVRK
FT                   FRYDGKSLKFESAADIDKSTNPEDYTKVIRLSKDGSEAAIASSKNPPSMAIIDPRNYSV
FT                   KYEIETGRDVKDLHFSPNGKLIGYITESSLEIISTVTGSCVVRKTDFDRKIILSKMKFL
FT                   DDNNVLIAATWASSKGILLTKISIKSGKTTVFWSRQISSKFKGITAMDVNDQMNLVMLA
FT                   TNDNSVLLVKLRNLSVGKTFTQVHGFAITRVIFSPDSRYAVSISAAETVHVIEIPSDFA
FT                   DSRSLSESTTQWLMNTIMVLFLAFVLNSMYKEDMHKNVLNYFRSVKSIDSSSILSMEDM
FT                   EQVTLVGTISTSVRSTTQRFESSKSVSSTSVVARTNVSEKERSQQDPVKKSPEQHQQNQ
FT                   Q"
FT   gene            <1071524..>1072495
FT                   /locus_tag="CAGL0M10725g"
FT                   /old_locus_tag="CAGL-IPF9489"
FT                   /old_locus_tag="CAGL-CDS3391.1"
FT   CDS_pept        1071524..1072495
FT                   /locus_tag="CAGL0M10725g"
FT                   /old_locus_tag="CAGL-IPF9489"
FT                   /old_locus_tag="CAGL-CDS3391.1"
FT                   /note="similar to uniprot|P53727 Saccharomyces cerevisiae
FT                   YNR027w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10725g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62791"
FT                   /db_xref="GOA:Q6FIY1"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY1"
FT                   /inference="similar to AA sequence:UniProtKB:P53727"
FT                   /protein_id="CAG62791.1"
FT                   /translation="MTGEGSVPGGVSVVGKVLAIQSHVVHGYVGNRAATFPLQYRGWDV
FT                   DALNTVQYSNHLGYGQATGFKYSGEELCSVFRDGLLKAMGNRYDAIITGYTPSAEVLED
FT                   ISGIIKNQLNQQQDLKWIVDPVLGDNGRLYVSEDIVPVYKRLLSQNKIFLATPNQFEME
FT                   LLSESELTDLESASTAVSKFFQLYPHVERLVVTSVVLAGSDDYVVIAADRTTSPQDTIY
FT                   IRSPRIKCHFSGSGDLFTALLVDALLRDRESTKLSQAVAKSQWMIGSVLQRTYEQALKS
FT                   GELKDQDSPVIKDLKLIQCRELFRLHDIPEIPITGHINVPQT"
FT   gene            complement(<1072542..>1073840)
FT                   /locus_tag="CAGL0M10747g"
FT                   /old_locus_tag="CAGL-IPF9490"
FT                   /old_locus_tag="CAGL-CDS2547.1"
FT   CDS_pept        complement(1072542..1073840)
FT                   /locus_tag="CAGL0M10747g"
FT                   /old_locus_tag="CAGL-IPF9490"
FT                   /old_locus_tag="CAGL-CDS2547.1"
FT                   /note="similar to uniprot|P53729 Saccharomyces cerevisiae
FT                   YNR029c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10747g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62792"
FT                   /db_xref="GOA:Q6FIY0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIY0"
FT                   /inference="similar to AA sequence:UniProtKB:P53729"
FT                   /protein_id="CAG62792.1"
FT                   /translation="MSLKNYKHDEDDGELPPLVTGRESNLAEILGKVRNDGGHNLVSAD
FT                   KVDRSNKQVEVPLSSNSGIQTEKKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAVIL
FT                   NEFGDSSEIEKAMTIQNGDSKYQEWLDLGNGCLCCSLKNIGVKAIEDMIERSPGSIDYI
FT                   LLETSGIADPAPIAKMFWQDEGLNSSVYIDGIITVLDAEHIVKCLDDVSPDAHWYNQSV
FT                   VKEENLTIAYFQIAMADRILLNKVDKIEGKRVSISDIEARIKDINGVAPIYHTQYGEVS
FT                   LDKLLDLHAYEGTDLNLDGSFKDRILQNEKVMHDHRMGTVTLSFRPLKTEQEFENFKRN
FT                   FLQKLLWKNFGLSDDDEIKNLSKLSDDWEIERSKGLVLVADSTYVIQGVRDTFDIFTGH
FT                   SDDTISDCKLVLIGKYLDKDSIQKLLLRVIDSK"
FT   gene            <1074047..>1075735
FT                   /locus_tag="CAGL0M10769g"
FT                   /old_locus_tag="CAGL-IPF9491"
FT                   /old_locus_tag="CAGL-CDS1715.1"
FT   CDS_pept        1074047..1075735
FT                   /locus_tag="CAGL0M10769g"
FT                   /old_locus_tag="CAGL-IPF9491"
FT                   /old_locus_tag="CAGL-CDS1715.1"
FT                   /note="similar to uniprot|P53730 Saccharomyces cerevisiae
FT                   YNR030w involved in cell wall biogenesis and architecture"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10769g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62793"
FT                   /db_xref="GOA:Q6FIX9"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX9"
FT                   /inference="similar to AA sequence:UniProtKB:P53730"
FT                   /protein_id="CAG62793.1"
FT                   /translation="MFKWSLLDTALLAVIFYHLAQAPYTKVEESFTLQAIHDILEYGVF
FT                   DISRYDHLQFPGVVPRSFIGPLIVAVLSKPAIMISSMLNLFTDDTQMHAQLIVRGVIGL
FT                   VNGLSLIMLKNALQSLFDEIEEKKNKKLEKDGETPANTVTMTSVGSWFLLFCMTSFHMM
FT                   FYSSRTLPNFVGAFPLSNIALSLALKGNLEWAILLLSGSAVIFRLELGGLAAGLTIFGF
FT                   IFKKVDIFRALKFGFMGAGIAIGISMSIDSYFWGDWGIPEVDAFIFNVVYGKSAQWGTE
FT                   SPLAYFTNYLRMLFLPPTVLVLNYIGYRAAPKNLKIVTLAGYFHILAMSTQPHKEWRFI
FT                   IYSVPPIIMLGSAGAAYLWENFKVRTMGNAALLALLPLSVAIGGVVSYIFCYISTMNYP
FT                   GGEALAMFNDYVMANNVTNSTVFITVPPCMTGVSLFGQLDFDKYGITYDRTEDSKSVQN
FT                   KWDSYDYMITHESLDIGKSFGIEDPSASKWELIGKSKIFAGVNPAPLTDYIFKEGNNVF
FT                   SLVKDVIMRESPYDFMFAMLDNCLIRQDLFFIHKRIRNDADENLQ"
FT   gene            complement(<1076233..>1081236)
FT                   /locus_tag="CAGL0M10829g"
FT                   /old_locus_tag="Cagl0M.mRNA.at.536.p"
FT   CDS_pept        complement(1076233..1081236)
FT                   /locus_tag="CAGL0M10829g"
FT                   /old_locus_tag="Cagl0M.mRNA.at.536.p"
FT                   /note="highly similar to uniprot|P53599 Saccharomyces
FT                   cerevisiae YNR031c SSK2 MAP kinase or uniprot|P25390
FT                   Saccharomyces cerevisiae YCR073c SSK22"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10829g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58078"
FT                   /db_xref="GOA:B4UN62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN62"
FT                   /protein_id="CAR58078.1"
FT                   /translation="MSNSDYFSHKPADSTGTPGTGTGTGTGGGTGTGTGTGTGSRRLAK
FT                   EYLPARSRSSSSDARNPYMYHYNPRDAAGAAGAVTGSGSGSNVGTPPGFHTTSPQSGYM
FT                   SSRIGGPESLMQHHTGLTFDSMMQNPVLSMGPLSPGISPLTNLNAFGKNSTGVPKQPSS
FT                   GNNTISFAPVPSPTSTSARSSRRASVVSNSSQGIHSLPKIATQIHQGQGQQVQQQSPNK
FT                   KPYKIYNSQDGNPSITNTASKIRTSSIAMDSSTSTITTPTLVISPDMAAGSLPSNLGST
FT                   PSESTLKHSSGKHSAMATPGGTASNAVNMGSVGSLQDMATPGASTRSATIQNGSTASLR
FT                   TFKKQYVLNEQLYLEKMRRNVPDDYYTRGIGPTSVTDEDEEFDIEMDEVFDQSGSNNKL
FT                   SELDGNVDIQDDVDFGTKFINPDADRNENLVALSSRFLSRKLDWAFPSKKVREDQSSST
FT                   PTESRRSPADINDGNNNNINNNINNNTNDNNNTNSNRNNSNNNNNNNNNNNNNNNNKDS
FT                   NGTSNTAITTTSTTNNSADVTPRKSTPNNSVSDTPAPQENLSANEHFISQLLQDPAVVK
FT                   RFEWQTMLANVLKGDIVKSEKTKIAKEVKGPGFTTQYSDDIWLELKAWMNGRNVDDQKK
FT                   SLKLLRESADEVFQRVLDFRLPDGLTSDEGEVEIAKLMNKYYRVIKLWSNMKRLYQDKP
FT                   IAKTEAFRNRIDTLDSWLNFKRNFEEKIHYIRNWVVGTKDPETQVVVDINDDDAIFRHY
FT                   AHEFADQMIKEKDIEAIFQKRIFFPLAPWILKAKLFFLKNRDTLNELNLMYLNDQLEML
FT                   LMFPMRLVKDIIQLRLSYAKKLQKPTMMMIDQMIDDFNSYIRVAVQMKFTVISYCQGWQ
FT                   FTVNIDPQFDDTVVEAIRHLFILLELKLLDGGGKSTNAFKEPDILLKYWDGLKNCGHYI
FT                   DGAGKVIAIEFTKLTLRLVHRLHSYLLQQQNSPPKLTNEAEAEKWLVQLFETLGSMKRK
FT                   LNRFTNVLMKAFQNSVTYRIDDHAQLMNGLKDTGHFLVYTGGKLEKQGIYLIASPELLG
FT                   CPENEILKVLYNSDSGCDLIPKLEIENSLTLYNAVAEKWDLSTSIVQGVGKDGLPRYYL
FT                   QNGNVDAQFRPPNLNSGKSHVAEMYNDDRDPDADILELEMKLNSLGYILVLCPQEPMLW
FT                   SGEVFNLSEFTTEEINDLDFKTRPDTIKLMCQSSSYALEYQCDRFLQSASDCVTFLEKR
FT                   CSFEVVENNLQKLNKAYFRCTYSVLKNYHKIVKTFKKVCPNNDLLNGIFLFARDFGLNF
FT                   LRINVASNEKKSLIILLLVRLSVGWLQFLSVDCDPTDPRTFRWCVTAMEFAMHMTSGWN
FT                   ILALDENQFSSLKHKISACMSLLISHFDVMGARAVELEKNSQQPRPNINIEDVFDDDSM
FT                   LQKNSELRMQSIKALEENVTRGTHRIGKVLDDTDKGNKYISSLASSISNVSIRWQKRNF
FT                   IGGGTFGSVYSAVDLDNGEILAVKEIRIQDSKAMEKVFPSIKEEMNVLEMLNHPNIVQY
FT                   YGVEVHRDKVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHESGIVHR
FT                   DIKPENILLDFNGIVKYVDFGAARKISKKGTKRTKMPGADNDMKEDKIVPDSTGLNDLI
FT                   GTPMYMAPESITGSTNKGHLGSDDIWSLG"
FT   gene            <1082128..>1083222
FT                   /locus_tag="CAGL0M10890g"
FT                   /old_locus_tag="CAGL-IPF8853"
FT                   /old_locus_tag="CAGL-CDS3038.1"
FT   CDS_pept        1082128..1083222
FT                   /locus_tag="CAGL0M10890g"
FT                   /old_locus_tag="CAGL-IPF8853"
FT                   /old_locus_tag="CAGL-CDS3038.1"
FT                   /note="highly similar to uniprot|P32838 Saccharomyces
FT                   cerevisiae YNR032w PPG phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62796"
FT                   /db_xref="GOA:Q6FIX8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX8"
FT                   /protein_id="CAG62796.1"
FT                   /translation="MELDECLERLYRGQLLPEVTVQALCFKLKELLVRESNVIHIRTPV
FT                   TVVGDMHGQFHDMLEIFEIGGRVPDTNYLFLGDYVDRGLYSVETMMLLVVLKLRYPSRI
FT                   HLLRGNHESRQITQSYGFYTECLNKYGGSPKVWQYITDLFDYLVLCCIIDDEIFCVHGG
FT                   LSPNVQTIDQIRIIDRFREIPHDGAMADLVWSDPEDDEKILDKSPSDLDYYTAHLSSSQ
FT                   HFQVSPRGAGYTFGRSVVEKFLHSNNMSRIYRAHQLCNEGYQVYFNGLVTTVWSAPNYC
FT                   YRCGNKASILELYSKDNFYFNVFEEAPENKQLNENANQIINTKAIQDYFGSSSNLESEP
FT                   TQVDLFSDEYQAKYAMSRHVEYFL"
FT   gene            complement(<1083434..>1083655)
FT                   /locus_tag="CAGL0M10912g"
FT                   /old_locus_tag="CAGL-IPF16010"
FT   CDS_pept        complement(1083434..1083655)
FT                   /locus_tag="CAGL0M10912g"
FT                   /old_locus_tag="CAGL-IPF16010"
FT                   /note="highly similar to uniprot|Q6Q546 Saccharomyces
FT                   cerevisiae YNR032ca HUB1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62797"
FT                   /db_xref="GOA:Q6FIX7"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIX7"
FT                   /protein_id="CAG62797.1"
FT                   /translation="MIEVLVNDRLGKKIRVKCLEDDTVGDFKKVLSVQLGMQPSKIVLQ
FT                   KGGSVLKDHITLYDYEVHDNTNLELYYS"
FT   gene            <1083885..>1086206
FT                   /locus_tag="CAGL0M10934g"
FT                   /old_locus_tag="CAGL-IPF8851"
FT                   /old_locus_tag="CAGL-CDS0879.1"
FT   CDS_pept        1083885..1086206
FT                   /locus_tag="CAGL0M10934g"
FT                   /old_locus_tag="CAGL-IPF8851"
FT                   /old_locus_tag="CAGL-CDS0879.1"
FT                   /note="similar to uniprot|P37254 Saccharomyces cerevisiae
FT                   YNR033w ABZ1 para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62798"
FT                   /db_xref="GOA:Q6FIX6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010117"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX6"
FT                   /inference="similar to AA sequence:UniProtKB:P37254"
FT                   /protein_id="CAG62798.1"
FT                   /translation="MHINVLFIDSYDSFTYNVVRLIEEQSVEGLGVKVTTIHNDKFDLD
FT                   SLKEYLPLFDCIVVGPGPGNPINGAKDVGVIDALFKNGHDPTINQIPLLGICLGFQAMC
FT                   LHEGAVIEELHTIKHGQVYPMALADDQQCDIFKGYPQEFKSVRYHSLQVKTVTDSLLPL
FT                   AYTNDENGKILMAAKVKNREWYGVQYHPESCCSELGQILISNFLDIAHKHNVISGRRAT
FT                   KELLCADNSTLQNIEYLNHTIDLSSIFVSDSLPLDVKSPRLAMEEYDIEETPNVTFKLA
FT                   ELIDSHKFIFASSSLSENRGEWSIIALPDSNSPVFSHYVNYNKTVCHRWRSEHVKKQDI
FT                   LECFRGGSDARVNEHLTVIDEDKDKFWCTLGAFMKDLLVEEHTDMPFIGGLLGILGYEM
FT                   GNDVENIYDDRELTDIIPRPDAKLIYIENTLLINHKEGKLYLISLRDQFPQDIKERVSK
FT                   YVTQSVKEDLHWPDRLPEGINYDIEMPKLEEYKEAFEECQRIMHRGDSYEICLTTQTRI
FT                   NMETVLEPWRIFQTLVQRNPAPFSSYLEFSDIVDNHDSNLCFISTSPERFLRWDQDSCE
FT                   LRPIKGTVKKGPDMDLEKATAILKTPKEFGENLMILDLIRNDLYQLLPDVKVEEFMSVE
FT                   EYATVYQLVSVVKARGIQSPTRHNRQYSGMDILRHSLPPGSMTGAPKKITVEYLYRDLE
FT                   RKLNRHVYSGSRGIYSGVTGYWSVNGNGDWSVNIRCMYSYNSGSSWQLGAGGAITVLST
FT                   AEGEQEEMFTKLESALQIFT"
FT   gene            <1086758..>1087729
FT                   /locus_tag="CAGL0M10956g"
FT                   /old_locus_tag="CAGL-IPF8849"
FT                   /old_locus_tag="CAGL-CDS3390.1"
FT   CDS_pept        1086758..1087729
FT                   /locus_tag="CAGL0M10956g"
FT                   /old_locus_tag="CAGL-IPF8849"
FT                   /old_locus_tag="CAGL-CDS3390.1"
FT                   /note="highly similar to uniprot|P37262 Saccharomyces
FT                   cerevisiae YCR073wa SOL2 or uniprot|P50278 Saccharomyces
FT                   cerevisiae YNR034w SOL1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62799"
FT                   /db_xref="GOA:Q6FIX5"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX5"
FT                   /protein_id="CAG62799.1"
FT                   /translation="MTTTVPKVFAFHEFAGVAEAVADHVVHAQESALAEKPKERKHSLT
FT                   NLSGTVESLEMSRATSVKSVSSTRENSSGKKNGAPKKERRFKIALSGGSLIQVLHEGLL
FT                   KRTDVKWGKWDIYFADERLVPFSSQESNYGQAKRKILDQIDTEKYGTPNVFHIDESLID
FT                   DPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQENLREKLAWV
FT                   VPVENAPSGPSNRISLTIPVICHSHRVTFVVEGATKAPVIKTIMERPEKGLPSSIVNEG
FT                   AAGRVSWFVDDDALTDVFVTKKKYKFHDAEGLGTENNNDNEQ"
FT   gene            complement(<1088278..>1090119)
FT                   /locus_tag="CAGL0M10978g"
FT                   /old_locus_tag="CAGL-IPF8848"
FT                   /old_locus_tag="CAGL-CDS1434.1"
FT   CDS_pept        complement(1088278..1090119)
FT                   /locus_tag="CAGL0M10978g"
FT                   /old_locus_tag="CAGL-IPF8848"
FT                   /old_locus_tag="CAGL-CDS1434.1"
FT                   /note="similar to KLLA0F27401g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62800"
FT                   /db_xref="GOA:Q6FIX4"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX4"
FT                   /protein_id="CAG62800.1"
FT                   /translation="MLSAVYTVCGLAITSVVSLVVVNRYFNFRIYKSYPFTIVVLVSNL
FT                   LLLLVTALLLPLDLHDTAAGHPNSLLFKVIWLSIYWLQFAVCWLVIPILISYVSLKYEI
FT                   PANEITTKISKSIKLNLKFYLICLIALALGLFYLILSTGHGLREVKSLLMALSHLYSLS
FT                   YTLILLSTGLIILPRDILRDSLELASSDKNMNTLFVNLSKINEDMNESQLNLNESAMLI
FT                   LSTREQENGDIIFNDLLRDCKSEIEYKLEELKSSSLLTSPLVQISNSGNHASSSITTLE
FT                   KLNKNYNDFINNYYNFMYDKVKSDEIIHKLAVLQDATLNNSKGKMVVRALSLICGIFTT
FT                   LLSLLVYFLELTPTKWFHGWVFVDQKLYNFFLQLAIISYNTLASLYAMSKFKFLDFHLI
FT                   PNGQSSPSNALYYSLYSSRLLFPLCFNLIALIPKHSNNSEKTPVSSIFEKVLYQNLTVI
FT                   PMVNFLNKFLPLLFMTIIPLSYKFDIKQKILLKVLGEEYYYQFFGLMLYEPIGEIPSTE
FT                   QDIESRHRMVPNNNGSGTITGQPRISPISMATAERSPLDEDYQYSLQDGKFLFERASNS
FT                   LKQSSPQHNNPLTNIQTNSTTSDSGRLNDMPASHTYL"
FT   gene            <1090961..>1091239
FT                   /locus_tag="CAGL0M11000g"
FT                   /old_locus_tag="CAGL-IPF16008"
FT   CDS_pept        1090961..1091239
FT                   /locus_tag="CAGL0M11000g"
FT                   /old_locus_tag="CAGL-IPF16008"
FT                   /note="similar to uniprot|Q3E841 Saccharomyces cerevisiae
FT                   YNR034w-a"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58079"
FT                   /db_xref="GOA:B4UN63"
FT                   /db_xref="InterPro:IPR021591"
FT                   /db_xref="InterPro:IPR035098"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN63"
FT                   /inference="similar to AA sequence:UniProtKB:Q3E841"
FT                   /protein_id="CAR58079.1"
FT                   /translation="MPSKITFESLTALGQDTLGTLTFDEKHHLIDTSGIGEKINKSFVA
FT                   DAVRKSNDELGKLGYQVYEDSKVVGHAFKDGAGKTTVYFHDKKDEKK"
FT   gene            complement(<1091512..>1091598)
FT                   /gene="tRNA-Lys (TTT)"
FT                   /locus_tag="CAGL0M11000r"
FT   tRNA            complement(join(1091512..1091548,1091561..1091598))
FT                   /gene="tRNA-Lys (TTT)"
FT                   /locus_tag="CAGL0M11000r"
FT                   /product="transfer RNA-Lys"
FT   gene            <1091979..>1093118
FT                   /locus_tag="CAGL0M11044g"
FT                   /old_locus_tag="CAGL-IPF8844"
FT                   /old_locus_tag="CAGL-CDS2912.1"
FT   CDS_pept        1091979..1093118
FT                   /locus_tag="CAGL0M11044g"
FT                   /old_locus_tag="CAGL-IPF8844"
FT                   /old_locus_tag="CAGL-CDS2912.1"
FT                   /note="weakly similar to uniprot|P24869 Saccharomyces
FT                   cerevisiae YPR119w CLB2 cyclin or uniprot|P24868
FT                   Saccharomyces cerevisiae YGR108w CLB1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62801"
FT                   /db_xref="GOA:Q6FIX3"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX3"
FT                   /protein_id="CAG62801.1"
FT                   /translation="MSLANLYMCSVACAINLNINFTMDSKIIKNYLLPKAIYKPGNKIG
FT                   ATIFNDNRTINNKLPLSLEKNANSLNIMDNTNVLKSVLKNYKCNKSLPYSSLIDKENIS
FT                   NESSQIHIAKENSEVDLCNTTLDNAYEYLLKLDEDTYLPDTILNEYSSLRQTRDLLLNW
FT                   VIKIHQNLKLENETLYMTIDLIDKFLIKKKLPIEKFQLLGLTCLYIASKYEEVLPPSIF
FT                   QFALESNGIFDSEEIKESEFNILETLNFKIGYPSPIVLLDRQLDGYLNYNEMKFMSLYL
FT                   LEITFVDFRFLSYRMSMRTKAAALITLKMYNHSIKDLKTRFQKEGLMQTIEKICRYILQ
FT                   YLLEPTIHTELQRKYSQLASYNVADRATKYVKCLIKKYA"
FT   gene            complement(<1093298..>1094299)
FT                   /locus_tag="CAGL0M11066g"
FT                   /old_locus_tag="CAGL-IPF8843"
FT                   /old_locus_tag="CAGL-CDS3303.1"
FT   CDS_pept        complement(1093298..1094299)
FT                   /locus_tag="CAGL0M11066g"
FT                   /old_locus_tag="CAGL-IPF8843"
FT                   /old_locus_tag="CAGL-CDS3303.1"
FT                   /note="similar to uniprot|P32943 Saccharomyces cerevisiae
FT                   YGR109c CLB6 cyclin B-type or uniprot|P30283 Saccharomyces
FT                   cerevisiae YPR120c CLB5"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62802"
FT                   /db_xref="GOA:Q6FIX2"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX2"
FT                   /inference="similar to AA sequence:UniProtKB:P32943"
FT                   /protein_id="CAG62802.1"
FT                   /translation="MDMDKRVERVPLAEVRASNVLSQPVTISSSKRKLEVYDGEETPAK
FT                   KVKVVDQVAIRDVATVPEYSTDIFKNLFKSEEDTIPSHNYLLDEKSEYHIRANMRAILV
FT                   DWLVDVHRNFKCLPETLLLAINILDRVLSSTKVSVSKLQLVAVTSLFIACKYEEVKLPK
FT                   IANFAYITDGAATVEDIREAEFNILETLRFNINWPNPLNFLRRLSQIDDYNYELRDIAK
FT                   FVLEFIMCTHYFVNYKPSFLSAMAIYLSKRICNDESSNHNEGILTTWSATHTEYSGGIN
FT                   PNNDPKFNDSLNVLIDEFKQPSNSTKSLLAKYKANTYHGMFFRVQDWCLNYI"
FT   gene            complement(<1095254..>1095910)
FT                   /locus_tag="CAGL0M11088g"
FT                   /old_locus_tag="CAGL-IPF8841"
FT                   /old_locus_tag="CAGL-CDS4270.1"
FT   CDS_pept        complement(1095254..1095910)
FT                   /locus_tag="CAGL0M11088g"
FT                   /old_locus_tag="CAGL-IPF8841"
FT                   /old_locus_tag="CAGL-CDS4270.1"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62803"
FT                   /db_xref="GOA:Q6FIX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX1"
FT                   /protein_id="CAG62803.1"
FT                   /translation="MDTNQARDSAGTALTQPSFRVDSQGSQTTSSIEDDVAKIIGPMEG
FT                   GKVTKVDTIFLQQEIDDIKTKERASGFKFQPFKNLKSKFKAKRKRQKEAIDSAKRTLLS
FT                   DELDLRAANKYDHEYRKFIDKSYFAARNATAQQTEAEMESCFMDVEQAFNKALTNYFKE
FT                   RYNILVTQTIPNAAAEPAKVAKAPPRSIRRPKILGKSDADECTYPFPKPDSPHHL"
FT   gene            complement(<1096321..>1096539)
FT                   /locus_tag="CAGL0M11104g"
FT                   /old_locus_tag="CAGL-IPF16004"
FT   CDS_pept        complement(1096321..1096539)
FT                   /locus_tag="CAGL0M11104g"
FT                   /old_locus_tag="CAGL-IPF16004"
FT                   /note="highly similar to uniprot|P35179 Saccharomyces
FT                   cerevisiae YDR086c SSS1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58080"
FT                   /db_xref="GOA:B4UN64"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN64"
FT                   /protein_id="CAR58080.1"
FT                   /translation="MAKNEKGENKEQILDAPMEFVKEGSQFLSKCKKPDLKEYTKIVKA
FT                   VGIGFVAVGVIGYAIKLIHIPIRYVIV"
FT   gene            complement(<1096867..>1097679)
FT                   /locus_tag="CAGL0M11110g"
FT                   /old_locus_tag="CAGL-IPF8839"
FT                   /old_locus_tag="CAGL-CDS3833.1"
FT   CDS_pept        complement(1096867..1097679)
FT                   /locus_tag="CAGL0M11110g"
FT                   /old_locus_tag="CAGL-IPF8839"
FT                   /old_locus_tag="CAGL-CDS3833.1"
FT                   /note="similar to uniprot|P35178 Saccharomyces cerevisiae
FT                   YDR087c RRP1 involved in processing rRNA precursor species
FT                   to mature rRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62804"
FT                   /db_xref="GOA:Q6FIX0"
FT                   /db_xref="InterPro:IPR010301"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIX0"
FT                   /inference="similar to AA sequence:UniProtKB:P35178"
FT                   /protein_id="CAG62804.1"
FT                   /translation="METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKL
FT                   WKGLYYAMWFCDRPRPQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRI
FT                   MCLEWLGIDRFRLDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPK
FT                   VYNGIPIHVMDIMLDEWERLALEDEEEELEEDKKLEIMKEFVSGSPLDQVLDILRNLLK
FT                   NYDNSKILRDKIKKEVLTDKRLAQWGIVEKKQTEEEKEAQSEEEWKGF"
FT   gene            complement(<1097934..>1098006)
FT                   /gene="tRNA-Arg (ACG)"
FT                   /locus_tag="CAGL0M11132r"
FT   tRNA            complement(1097934..1098006)
FT                   /gene="tRNA-Arg (ACG)"
FT                   /locus_tag="CAGL0M11132r"
FT                   /product="transfer RNA-Arg"
FT   gene            <1098232..>1101204
FT                   /locus_tag="CAGL0M11154g"
FT                   /old_locus_tag="CAGL-IPF8836"
FT                   /old_locus_tag="CAGL-CDS0459.1"
FT   CDS_pept        1098232..1101204
FT                   /locus_tag="CAGL0M11154g"
FT                   /old_locus_tag="CAGL-IPF8836"
FT                   /old_locus_tag="CAGL-CDS0459.1"
FT                   /note="similar to uniprot|Q12176 Saccharomyces cerevisiae
FT                   YDR060w MAK21"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62805"
FT                   /db_xref="GOA:Q6FIW9"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW9"
FT                   /inference="similar to AA sequence:UniProtKB:Q12176"
FT                   /protein_id="CAG62805.1"
FT                   /translation="MAKGFSLKDQVASKIGQQKKKHDKKQEKNGSKETDEVLKREALEL
FT                   GASEKDLDLIKDVDVDENDDEVLILDAEDGDDGELGSELKSFIGKLGLDKHAVPDAKEE
FT                   VAEEAQENDEDDDEDEENDDEEELSSESEEEGQDSEPEEPKEKKDSGFISQTTIISSDK
FT                   LIVPYDVPWYQVPLDPQLKQNVLDSQNEEPLTKEQITTLFNRGKETLEADNQTYYDEFT
FT                   KDSSQRKFMSQILSDGTLSDKISALTLLIQDSPLHNMKSLDMLLSFCSKKSRNSALQSL
FT                   NALKDLLLSGLLPNRKLRYFKNQPGLSMMLNKRTLAIFYFEDYLKKLFFKILETLELLS
FT                   HDPIIHVRMQVLTHIFDFLIKQPEQEFNLLRLGVNKLGDIDSKVSSKSSYLLLKLQQEH
FT                   PNMKSIIIDAIVDIALRPNADYHATYYSTITLNQTILTRTEDEIANKLIKTYFTLFEKF
FT                   LISTEKDNKDDGPEKTKKSYENKRKKNFKRGKKGGKSVKEDVTESEVIKEKNSKLFSSL
FT                   LTGINRAFPFAQLSASVYETHLETLYKITHSSNFNTSVQALVLINQVTVKAKLNNDRYY
FT                   RTLYESLLDPRLVNSSKQGIYLNLLYKSLKQDASNISRVEAFVKRILQVSSHWVNIGTI
FT                   VGFFFLLIQLVQIVPHIQNLLTNTPVDQEYQADEADEDSSEKAHVRQYDSRKRDPKFAN
FT                   ADVSSLWEIANFTDHYHPTVKAYAEAFVNGKYKEVSKPDLGLYTLTHFLDRFVYRNAKQ
FT                   KPLSRGSSIMQPLFGGAQTRESLLVKASDMVRNIGPVNTKNWIDSKVEEIKPEDRFFYQ
FT                   YFTSKKTAIKSDKKEAQPKEEDEEMDEDEIWNALVKSRPDVEDDSDDSVGFSDEDFGDM
FT                   SDMSDDEDQDVAPSDDDDEEDSDSNDVNIDEDIFYSFNDDGEGKEQEDEDENEDDDEDE
FT                   DEDGIDSDTLKRLREDEVSSSEEEEEDNKKNKKQKKSKKKSLPVFAAAEDYAKYLESDS
FT                   E"
FT   gene            complement(<1101519..>1102178)
FT                   /locus_tag="CAGL0M11176g"
FT                   /old_locus_tag="CAGL-IPF8835"
FT                   /old_locus_tag="CAGL-CDS4259.1"
FT   CDS_pept        complement(1101519..1102178)
FT                   /locus_tag="CAGL0M11176g"
FT                   /old_locus_tag="CAGL-IPF8835"
FT                   /old_locus_tag="CAGL-CDS4259.1"
FT                   /note="highly similar to uniprot|Q05015 Saccharomyces
FT                   cerevisiae YMR222c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62806"
FT                   /db_xref="GOA:Q6FIW8"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW8"
FT                   /protein_id="CAG62806.1"
FT                   /translation="MAKKVLMLHGLAQSGEYFASKTKGFAAELEKLDYELYYPTAPNSF
FT                   PPADLPNGLLDEIDDKVSSQSGVIAWLQNKETGDGYYIPETTINYLHNYIIENGPFDGI
FT                   VGFSQGAGLAGYLVTDFNGLLNLTEEEQPPLKFLMAFSGFRFRGEEHQKQYKNPISIKT
FT                   LHVHGELDTVTEPEKVQALYDSCDSSSRTFLTHKGGHFIPNSRGFLKKVVEWLNEL"
FT   gene            <1102767..>1104152
FT                   /locus_tag="CAGL0M11198g"
FT                   /old_locus_tag="CAGL-IPF8834"
FT                   /old_locus_tag="CAGL-CDS2313.1"
FT   CDS_pept        1102767..1104152
FT                   /locus_tag="CAGL0M11198g"
FT                   /old_locus_tag="CAGL-IPF8834"
FT                   /old_locus_tag="CAGL-CDS2313.1"
FT                   /note="similar to uniprot|P50102 Saccharomyces cerevisiae
FT                   YMR223w UBP8"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62807"
FT                   /db_xref="GOA:Q6FIW7"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR037798"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW7"
FT                   /inference="similar to AA sequence:UniProtKB:P50102"
FT                   /protein_id="CAG62807.1"
FT                   /translation="MDDCQHIQSIFENPKNRAAWLNALSTTQSVLRHSPIKAKLLHAFR
FT                   CSTCKEISNGSNFLCLQCGFCGCWNGSHFEQHSKETGHLFGINAQTELVFCFQCMDYVG
FT                   DFDLFRDAALANRWDYYEEYTNVPTVDQIDGMAGLVNMGSTCYMSSIMQCIIHNPYMIR
FT                   YFMCQQHSNNCTLKMASNCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFINLLTC
FT                   SWKVNENLAGYSQQDAHEYWQFILNHIHQDYKSSMHSHSDDKLCNCVVHSSFQGSLKSS
FT                   IVCPECNNDSKTTFDPFIDLSLGIKDKHTLTECLDNFHKKEQLHDYDFFCKKCQAQQNP
FT                   IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSI
FT                   LYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKILEKDVLKEQAYLLFYIVK
FT                   HIS"
FT   gene            complement(<1104310..>1106280)
FT                   /locus_tag="CAGL0M11220g"
FT                   /old_locus_tag="CAGL-IPF8832"
FT                   /old_locus_tag="CAGL-CDS1249.1"
FT   CDS_pept        complement(1104310..1106280)
FT                   /locus_tag="CAGL0M11220g"
FT                   /old_locus_tag="CAGL-IPF8832"
FT                   /old_locus_tag="CAGL-CDS1249.1"
FT                   /note="similar to uniprot|P32829 Saccharomyces cerevisiae
FT                   YMR224c MRE11 DNA repair and meiotic recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62808"
FT                   /db_xref="GOA:Q6FIW6"
FT                   /db_xref="InterPro:IPR003701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007281"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR038487"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW6"
FT                   /inference="similar to AA sequence:UniProtKB:P32829"
FT                   /protein_id="CAG62808.1"
FT                   /translation="MELPDEDTIRILITTDNHVGYNENDPITGDDSWRTFHEIMMLAKE
FT                   NNADMVLQSGDLFHVNKPSKKSLYQVLKTLRLACMGDKPCELELLSDPSKVFNYDEFTD
FT                   VNYEDPNFNISIPMFAISGNHDDATGDSLLCPMDVLHATGLVNHFGKVLEADKINIAPL
FT                   LFQKGKTKLALYGLASVREERLFRTFKDGGVTFEVPTVSENEWFNILCVHQNHTGHTNT
FT                   AFLPEQFLPDFLNLIIWGHEHECIPNFMHNPSKDFDVLQPGSSVATSLCEAECKEKHVF
FT                   IVELRHETKPKLIPLKLDTVRTFKMKTIHLKDEPTLRPHDKEAISKYLVDIIEEMLDEA
FT                   NRETKEKLFPNIPMDEIESMGSFPLPLIRLRVDYSGPDENPEIIYQVENPRRFSNRFVG
FT                   KIANTNNIVQFFRAKRKPIAKTRKDGVTTMDIDNELPFNDGSELQVDDLIADLLKKMNL
FT                   SLLPENGMNEAMKKFVDKDEKLALKQFIEKEIHHEVDILYNNKDFIHGDDPEEIKKFIK
FT                   SVKRANTSDQSSSLDINKDEAADLLLNGYDNGINKLPAKSSRNSRPSTRQKKNLSSEII
FT                   VSEDELESDHDADLKGYDEDLIEISSDEDNYRERRRVRSTKPTKSPKGSAKSSKRSATT
FT                   RKSARTPKTDILGSLLAKKRK"
FT   gene            complement(<1106535..>1106994)
FT                   /locus_tag="CAGL0M11236g"
FT                   /old_locus_tag="CAGL-IPF16002"
FT   CDS_pept        complement(join(1106535..1106773,1106937..1106994))
FT                   /locus_tag="CAGL0M11236g"
FT                   /old_locus_tag="CAGL-IPF16002"
FT                   /note="highly similar to uniprot|P19956 Saccharomyces
FT                   cerevisiae YMR225c MRPL44"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR58081"
FT                   /db_xref="GOA:B4UN65"
FT                   /db_xref="InterPro:IPR019716"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN65"
FT                   /protein_id="CAR58081.1"
FT                   /translation="MITKYFSKVAVRFNPFGKEAGAVRLLLSSIPPVQRMQSTQITNQL
FT                   LTESSTATPLVKITYKDKKELELDPRGHSFEELANYFDRHSRQLQIKETIENQ"
FT   gene            complement(<1107273..>1108079)
FT                   /locus_tag="CAGL0M11242g"
FT                   /old_locus_tag="CAGL-IPF8829"
FT                   /old_locus_tag="CAGL-CDS3845.1"
FT   CDS_pept        complement(1107273..1108079)
FT                   /locus_tag="CAGL0M11242g"
FT                   /old_locus_tag="CAGL-IPF8829"
FT                   /old_locus_tag="CAGL-CDS3845.1"
FT                   /note="highly similar to uniprot|Q05016 Saccharomyces
FT                   cerevisiae YMR226c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62809"
FT                   /db_xref="GOA:Q6FIW5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW5"
FT                   /protein_id="CAG62809.1"
FT                   /translation="MSQGRKAAERLQGKIAFITGASAGIGKATAIEYLDASNGSVKLVL
FT                   GARRMEKLEELKKELLAQYPDAKIHIGKLDVTDFENVKQFLADLPEEFKDIDILINNAG
FT                   KALGSDKVGDIDPEDIAGMVNTNVLALINLTQLLLPLFKKKNSGDIVNLGSIAGRDAYP
FT                   TGAIYCATKHAVRAFTQSLRKELINTDIRVIEIAPGMVETEFSVVRYKGDKSKADDVYR
FT                   GTTPLYADDIADLIVYSTSRKPNMVVADVLVFPTHQASASHIYRGD"
FT   gene            complement(<1108462..>1110111)
FT                   /locus_tag="CAGL0M11264g"
FT                   /old_locus_tag="CAGL-IPF8828"
FT                   /old_locus_tag="CAGL-CDS1775.1"
FT   CDS_pept        complement(1108462..1110111)
FT                   /locus_tag="CAGL0M11264g"
FT                   /old_locus_tag="CAGL-IPF8828"
FT                   /old_locus_tag="CAGL-CDS1775.1"
FT                   /note="similar to uniprot|Q05021 Saccharomyces cerevisiae
FT                   YMR227c TAF67"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62810"
FT                   /db_xref="GOA:Q6FIW4"
FT                   /db_xref="InterPro:IPR006751"
FT                   /db_xref="InterPro:IPR037817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW4"
FT                   /inference="similar to AA sequence:UniProtKB:Q05021"
FT                   /protein_id="CAG62810.1"
FT                   /translation="MAVIKIKKPKKNEGANESEGPKLKKIRISAGNRKEEKEPKKLKIN
FT                   LKKTDVKKSGSVVKLKLGSKKEEKQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIESG
FT                   IILRVLPDVQVDFIKNSIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTIIEVN
FT                   KSVDRKNLFKTFDVTQMLVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEINDHKVK
FT                   LFKNANHVNLHSETEAKNLEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEFEYAEK
FT                   IVDMLLKADAQAEDVKFDLIAPSDVPEKGSVSAAPSHVDLSVANKPEVLNEDVTLQDDD
FT                   EDLDLEEAFQSDEDESESTKRSDALFGDQDEEGGDEVEQDNGEDEDDDDDDEDDDEEEE
FT                   EEEVGSVAKSGDDNEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKSRFVDSIKK
FT                   LEKEVELKKKQLKESENQLSGGTGPVSSTGIVDEDDEDQDDEDDDEDEEEEEEEGEGEG
FT                   EEDKDDSKEDKEEELDQNDLDMMMLFGGEGDE"
FT   gene            <1110364..>1111380
FT                   /locus_tag="CAGL0M11286g"
FT                   /old_locus_tag="CAGL-IPF8826"
FT                   /old_locus_tag="CAGL-CDS3262.1"
FT   CDS_pept        1110364..1111380
FT                   /locus_tag="CAGL0M11286g"
FT                   /old_locus_tag="CAGL-IPF8826"
FT                   /old_locus_tag="CAGL-CDS3262.1"
FT                   /note="similar to uniprot|P14908 Saccharomyces cerevisiae
FT                   YMR228w MTF1 RNA polymerase specific factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62811"
FT                   /db_xref="GOA:Q6FIW3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR016586"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW3"
FT                   /inference="similar to AA sequence:UniProtKB:P14908"
FT                   /protein_id="CAG62811.1"
FT                   /translation="MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNMKV
FT                   LDLYPGPGIHSAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYT
FT                   ELIDQEKLFVPKKADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPM
FT                   LIWMPTPTASKLLADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPL
FT                   VIPDGTDYGGKDFPIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGAR
FT                   DYFSANIDKDHIHLLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQEESRE"
FT   gene            <1111761..>1116119
FT                   /locus_tag="CAGL0M11308g"
FT                   /old_locus_tag="CAGL-IPF6231"
FT                   /old_locus_tag="CAGL-CDS0124.1"
FT   CDS_pept        1111761..1116119
FT                   /locus_tag="CAGL0M11308g"
FT                   /old_locus_tag="CAGL-IPF6231"
FT                   /old_locus_tag="CAGL-CDS0124.1"
FT                   /note="similar to uniprot|Q12697 Saccharomyces cerevisiae
FT                   YOR291w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62812"
FT                   /db_xref="GOA:Q6FIW2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW2"
FT                   /inference="similar to AA sequence:UniProtKB:Q12697"
FT                   /protein_id="CAG62812.1"
FT                   /translation="MPYSQHGSSSHAQRTRASFSSARSNATSATLTSSVIIDHNNSESY
FT                   AGAAFEAVPSSIVSFHRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPLYQGNDHSRSS
FT                   SNNRNFRFFTDEQVSQAEGIATLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIRDIS
FT                   RRSSLSTSPYGSIDHRGRSASKSRPRYDQVYQTSTHSSSSLSRYSVRERIPVEVEDQDD
FT                   NSLDVHSSDQSLASSHSNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDKFYPEF
FT                   KADRHIQRAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPKYKVRIV
FT                   GRKAPLAKAEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTETEEFEHGFQRHHH
FT                   TSEENPNLPILISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGLSSGIQEDR
FT                   VLAFDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSI
FT                   LDTLIETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCD
FT                   SILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTL
FT                   IRAKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFKYIGFMAIIAFF
FT                   GFSISCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIA
FT                   PTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIFPKFS
FT                   LKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFH
FT                   SLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMS
FT                   VIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPK
FT                   NTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTA
FT                   ISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYT
FT                   LAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCG
FT                   DGANDCGALKAADVGISLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVTSFACFQY
FT                   MSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRPSAN
FT                   LVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLFYISNF
FT                   QYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSFVIMLVNPDSKLGNLLQLTSIPT
FT                   GLIILIPIWCMLNYYVLTHVPPKVKQYFRKQRSSKLYKNILRDQSQQYVV"
FT   gene            complement(<1116253..>1117143)
FT                   /locus_tag="CAGL0M11330g"
FT                   /old_locus_tag="CAGL-IPF6232"
FT                   /old_locus_tag="CAGL-CDS3635.1"
FT   CDS_pept        complement(1116253..1117143)
FT                   /locus_tag="CAGL0M11330g"
FT                   /old_locus_tag="CAGL-IPF6232"
FT                   /old_locus_tag="CAGL-CDS3635.1"
FT                   /note="similar to uniprot|Q08743 Saccharomyces cerevisiae
FT                   YOR292c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62813"
FT                   /db_xref="GOA:Q6FIW1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIW1"
FT                   /inference="similar to AA sequence:UniProtKB:Q08743"
FT                   /protein_id="CAG62813.1"
FT                   /translation="MTIALPGVDGSTAYNYAVRQRNVFRTVFTANVFHISLTHWFLMFC
FT                   WLNLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYFSREMDPVPRIID
FT                   ETVQNLIPYNVMPLPGGIFEANEELLDSDNDDNLSVFNDYGEYDNSNDEIEYNHTEKVA
FT                   TFHFRRWLGFMGWGGFISFFQVPWYIILNTIYTEDPTVVQVLERVLTDQLLYSPVSLYF
FT                   FFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWPMMQFINFLVIPKHYQVPFSSSV
FT                   GVVWNCFLSMRNAAK"
FT   gene            complement(<1117631..>1118461)
FT                   /locus_tag="CAGL0M11352g"
FT                   /old_locus_tag="CAGL-IPF6233"
FT                   /old_locus_tag="CAGL-CDS3785.1"
FT   CDS_pept        complement(1117631..1118461)
FT                   /locus_tag="CAGL0M11352g"
FT                   /old_locus_tag="CAGL-IPF6233"
FT                   /old_locus_tag="CAGL-CDS3785.1"
FT                   /note="weakly similar to uniprot|P46989 Saccharomyces
FT                   cerevisiae YJL178c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62814"
FT                   /db_xref="GOA:Q6FIW0"
FT                   /db_xref="InterPro:IPR018939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIW0"
FT                   /protein_id="CAG62814.1"
FT                   /translation="MVMLGQVVALAMASSAVALNCKNHNVLSNYNVANKDILLKNELDT
FT                   PPSKTSEMWYLAPCEDGSRRQRPSECSSDDLMCAIRHVKVDGSDHLTQKLDVHKSAKYE
FT                   VEEVESGGFDIRFLGVKWGSNTIDATLSYSCDTNLKTDELVTTIWNSEYVLIEMSGPSG
FT                   CKRDGNSDSGDNGNGNGNGNDPDNNNNTGKDKKSKKTSWFTWLFVYAILFTVIYLMVVS
FT                   YLNTKGGSFQDFRNEFVERGTEFITSLPTFVKEVVTKTLGTRDSSASRGGYSAV"
FT   gene            complement(<1118773..>1121727)
FT                   /locus_tag="CAGL0M11374g"
FT                   /old_locus_tag="CAGL-IPF6235"
FT                   /old_locus_tag="CAGL-CDS0464.1"
FT   CDS_pept        complement(1118773..1121727)
FT                   /locus_tag="CAGL0M11374g"
FT                   /old_locus_tag="CAGL-IPF6235"
FT                   /old_locus_tag="CAGL-CDS0464.1"
FT                   /note="weakly similar to uniprot|P32591 Saccharomyces
FT                   cerevisiae YJL176c SWI3 transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62815"
FT                   /db_xref="GOA:Q6FIV9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR032451"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV9"
FT                   /protein_id="CAG62815.1"
FT                   /translation="MDFDMDVDLFGDNDGNDGNDAQDYSVYESADEKSRIKTSSPGEAE
FT                   DAHEDAGDAAGDTAGDAAGDAPGILDFEPEHKVSEQESEAPEKEAVDVTEMEAQEPADV
FT                   TEPVSSISQPTEVKSDTDPNKDKTDAEQPIEDNLKAEQLTDDKQELEQPIEEKLDAEQS
FT                   IEDNLNSEQPTDDKQEVEQPIEDSLNAEQPAENKPEVERPTEDKQDSEQPNDNKSDVEL
FT                   QDDATELPTGREISNEQPIEDRADEQPNEERVSGDDGNEFKASDELPNEEKVSDDSIIQ
FT                   EKASDQQITEGIVSDQQISKDKPTDEQAQDEITDGQLQSKVTDDQISQDMTSSEQPSLG
FT                   HVSHEQHIDGPASTQLPTKEDITQEHTNESTSHVHGITSNEQPKEHSPTEELPTLEISN
FT                   GLPIEKPSDEKLSGENPVDEIPGQDKNVQDHTTEDVKMQDGIESPNDLLKEEKDEAQLT
FT                   GSPATEGEQASNDSEYALIQTHEIVIPSYSKWFDLRKIHEIEKKSLPEFFTNRIPSKTP
FT                   QVYLKYRNFMVNAYRLNPNEYFTVTAARRNVSGDAAALFRIHKFLTKWGIINYQVDAKV
FT                   LPKNVEPPFTGDYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMDVNDSESALYRYLK
FT                   EEKRKFIEGKIENSVHHKQHTKTEVKKENQDEKNTESTEQQTAPAHHEGQERSSLKRSS
FT                   EAIFNEEHKLKKPKILDHTDEEWSREDLQKLLDGMQKHGVDWYKVASEIGNKTPEQCIL
FT                   KFLQLPIEDKFLYNGEGGKDLGPIKFAPHLPFSKSENPILSTIAFLVGMVDPQIVKNMT
FT                   SRAIQRIEDVHEQNLKNTKSDAKEGSEIAIASLGVRSGVYANNEEKHLHALSHELVQIQ
FT                   LQKLDSNLELLNQMEKSFDLEKRMLEKQQESLLLQRLQIAKNARSVMEIATKILEDADD
FT                   KEALKKDLEVIRDHVMDPPTPSLATPGDSKSSTEPKEVKPVSIEVPQYYRYWSA"
FT   gene            <1122109..>1125687
FT                   /locus_tag="CAGL0M11396g"
FT                   /old_locus_tag="CAGL-IPF6238"
FT                   /old_locus_tag="CAGL-CDS0249.1"
FT   CDS_pept        1122109..1125687
FT                   /locus_tag="CAGL0M11396g"
FT                   /old_locus_tag="CAGL-IPF6238"
FT                   /old_locus_tag="CAGL-CDS0249.1"
FT                   /note="similar to uniprot|P13186 Saccharomyces cerevisiae
FT                   YLR096w KIN2 ser/thr protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62816"
FT                   /db_xref="GOA:Q6FIV8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001772"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV8"
FT                   /inference="similar to AA sequence:UniProtKB:P13186"
FT                   /protein_id="CAG62816.1"
FT                   /translation="MERDYHVNTGFQMGRREEERGIAMAPASLRMMGKSGARELMEPAT
FT                   VNAGVQDIDANAEMQATDMPGAPASVPAERKSQGQGQSQGQGQGQGQGQGQMKQFHRKS
FT                   LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM
FT                   ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDY
FT                   IIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNV
FT                   YDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVL
FT                   HEKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSYVP
FT                   NRIPLTPEMLDSTVLREMFRLEFIEDIEETRKLLATIVSDPTYLTLSNEYWTRLQSITE
FT                   TTGQGKTTHFEIQGVSINFHLTSGVNKIPFEDPTRAFHPLLSIYYLVAEMLQRKMAKLQ
FT                   KKQALIQQQQQQIQKQQQQRVQQQQPQQQKQPLTPKEPEQTEFAYSKTPNTSDKSAGLT
FT                   VPSRPTDIINEMKAKSDRTDYIMNTPKQDTGSNTTVEKLYTPKEQQSVERKTAPLHIMV
FT                   PPKLTMPEQAHTSPTTRKSSDIHDELNTAMSPKVLSKEYEQRPNTQLDSPEKKRFPALF
FT                   GKLSQKRQPSSQQSPQSNNNPQFQVHAAPNLEPAKRSTKTHTRTVSEYVPGPSNNKEFI
FT                   ETYLPSNYANKNNSPSRSVSTKVANTERFPALPANANTMVEQQLAKDMDNLNVNNNTNR
FT                   APDTSSADYDENKPLPPLTVTKGRKLHPSARAKSVGHSRRESLKFTRPPVPTNVQGYDN
FT                   DDAGFLEYSDDNRNDSAIIRTPNSSKYLSPPTPNTRFGFGSTEELTDEQILEQASRAPP
FT                   GTMPSIDYPRSLFLKGFFSVQTTSSKPLPIVRYKIMHLLKKMHVEFKEVKGGFVCTHEG
FT                   QLSFLNNDNELPEYNPLAETDENNIDNRLTINTNLSPHPSQNHLQLPTPIENQAVTYRS
FT                   IRSGSRQNSIRRQGSTKISPNIPTTPMATTEHHRNISEVMSPVAQNINLGSTLSDEHST
FT                   TSLDNIANQEDILTTSRVQNMNRPDLDLEQQAIAKASNEKSRVKFEIHIVKVRIVGLAG
FT                   VHFKKVSGNTWLYKELASHILKNLNL"
FT   gene            complement(<1125884..>1126939)
FT                   /locus_tag="CAGL0M11418g"
FT                   /old_locus_tag="CAGL-IPF6239"
FT                   /old_locus_tag="CAGL-CDS3145.1"
FT   CDS_pept        complement(1125884..1126939)
FT                   /locus_tag="CAGL0M11418g"
FT                   /old_locus_tag="CAGL-IPF6239"
FT                   /old_locus_tag="CAGL-CDS3145.1"
FT                   /note="similar to uniprot|Q12347 Saccharomyces cerevisiae
FT                   YLR097c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62817"
FT                   /db_xref="GOA:Q6FIV7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV7"
FT                   /inference="similar to AA sequence:UniProtKB:Q12347"
FT                   /protein_id="CAG62817.1"
FT                   /translation="MGGQDAVSCNTEDTNPRADEALQLWEQGAAKEQAGSLMDAINFYR
FT                   KALKVHDGVEKLYRKKLQEDYMLQQKLEALNLNDKSNDHTENTSDVNGTSEEAGPVDPC
FT                   WILEMLPDDILLQIIKQVVYMSGESWVNLSKTCASFNKLCFHNSLPYQAFADYIYPKQV
FT                   YDSETLQMNKVTDMKSFTKEIWGDDAKQMICNRPFIKYHGIYISVVNVVRYGANDEGSL
FT                   SLMNPIHILTYYRYFRFYPDGSCLRLLTTDEPSFVVKHFSKETPIKDSEICRWSLGFDY
FT                   DFGLLHITRTSDKYEFHEKFVIKNQGRKKHHQLAWLSSVVIDNEGVEMENSLKNERAFH
FT                   FSRVKSYENSL"
FT   gene            complement(<1127298..>1129025)
FT                   /locus_tag="CAGL0M11440g"
FT                   /old_locus_tag="CAGL-IPF6240"
FT                   /old_locus_tag="CAGL-CDS1638.1"
FT   CDS_pept        complement(1127298..1129025)
FT                   /locus_tag="CAGL0M11440g"
FT                   /old_locus_tag="CAGL-IPF6240"
FT                   /old_locus_tag="CAGL-CDS1638.1"
FT                   /note="similar to uniprot|P43634 Saccharomyces cerevisiae
FT                   YLR098c CHA4 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62818"
FT                   /db_xref="GOA:Q6FIV6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV6"
FT                   /inference="similar to AA sequence:UniProtKB:P43634"
FT                   /protein_id="CAG62818.1"
FT                   /translation="MSGVRKLACEGCRKRRRRCDKKVPCSNCVKHKIECVMTNNDLRSN
FT                   RTSVAYVQSLEKRVKDLEMHITQMRGTVDSGIDEVESVGSLNASDGSVENLNSGGLSTN
FT                   IGIYPSNSLSLKRPRPPITQTSSQRQLLNLSKNPTILKGLSLFFKWLYPGHFMFIHRET
FT                   FLNSFFGDFNTKSYYCSEELVYAIFALGAQIADRSDDVANMGAEYYRRSKSMVLTKIFQ
FT                   LNEDLNDESTSSSKLAIIQTLLCLAFYDIGHGDNPMAWYLSGLAFRISYEIGLHLNPEA
FT                   WAHVYEDELSGVDIEVRSRVYWGCYIADHLITLLFGRTTILKLSNSTVPETDELPEIES
FT                   GIEDFIFDPKCTLSMAKPLKNLIVVCRITEVFAPKIFGQSEFPMQRREHLSKFNLEMYN
FT                   WRKDLPKELRWSRSTIKNMHDFNPSRAYIWFHYYLVLISYNKPFLEELKLSRELITEHI
FT                   DELSLLLEGWEIKFGGFQTTNLYMVYCVILSLQCMKTETISNRHYKQFMAFLKSPSLTY
FT                   EIAKKFVDNDNEPAGTEPLDLLLGTLSSGTDLKLEYNLDFTLLNEIDLLIGGSNGPML"
FT   gene            complement(<1129244..>1130404)
FT                   /locus_tag="CAGL0M11462g"
FT                   /old_locus_tag="CAGL-IPF6242"
FT                   /old_locus_tag="CAGL-CDS2859.1"
FT   CDS_pept        complement(1129244..1130404)
FT                   /locus_tag="CAGL0M11462g"
FT                   /old_locus_tag="CAGL-IPF6242"
FT                   /old_locus_tag="CAGL-CDS2859.1"
FT                   /note="similar to uniprot|Q12385 Saccharomyces cerevisiae
FT                   YLR099c ICT1"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62819"
FT                   /db_xref="GOA:Q6FIV5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12385"
FT                   /protein_id="CAG62819.1"
FT                   /translation="MWCKGDDLETLQYKVMEEVPVEGQRAVLRCGVNQWYFRGGDRVVT
FT                   PTLLVHGYGASSMAYHRCFAPLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIE
FT                   ENKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLD
FT                   KFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESD
FT                   PSSYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYLFESF
FT                   LGKKHFAKQNVHALKHLFTRSLLARDPIMDTIDKLKVPDVSVFYGDHDWMNSYAGYLMV
FT                   ERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLVQFLSE"
FT   gene            <1131048..>1135787
FT                   /locus_tag="CAGL0M11484g"
FT                   /old_locus_tag="CAGL-IPF6247"
FT                   /old_locus_tag="CAGL-CDS0087.1"
FT   CDS_pept        1131048..1135787
FT                   /locus_tag="CAGL0M11484g"
FT                   /old_locus_tag="CAGL-IPF6247"
FT                   /old_locus_tag="CAGL-CDS0087.1"
FT                   /note="highly similar to uniprot|P08566 Saccharomyces
FT                   cerevisiae YDR127w ARO1 arom pentafunctional enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62820"
FT                   /db_xref="GOA:Q6FIV4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR008289"
FT                   /db_xref="InterPro:IPR010110"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIV4"
FT                   /protein_id="CAG62820.1"
FT                   /translation="MLVKVPILGRETIHVGYGVRSHIVETIVGLKSSTYVVINDSNVGR
FT                   VPYFQELLSDFEAQLPAGSRLLRYVVKPGEANKTRATKEQIEDYLLSEGCTRDTVIVAV
FT                   GGGIIGDMIGYVAATFMRGVRVVQVPTSLLAMVDSSIGGKTAVDTPLGKNFIGAFWQPE
FT                   FVLVDIKWLQSLPKREFINGMAEVIKTACIWNADEFQRLETHADEFLHVVNTPKISEKE
FT                   GFQLYDTDIESIKEHIFKLVLESIKVKAEVVSSDERESSLRNLLNFGHSIGHAYEAILT
FT                   PQALHGECVSIGMVKEAELSRYLGILSATQVARLSKILVAYGLPVSKDEKWFRELTLNK
FT                   KTPLDTLLKKMSIDKKNDGSKKKVVLLETIGKCYGKSAHVVSDEDLRFVLTDETLVYPF
FT                   NNIPRDQNKTVTPPGSKSISNRALVLAALGKGTCRIKNLLHSDDTKHMLTAVQELKGAN
FT                   ISWEDNGETVVLEGQGGSTLVACENDLYLGNAGTASRFLTSVAALVNSTSQKDHVILTG
FT                   NARMQQRPIGPLVDSLRNNGIKIDYVKNEGCLPLKVHTDSVFKGGRIELAATVSSQYVS
FT                   SILMCAPYAENPVTLALVGGKPISILYVEMTIKMMEKFGIKVEKSTTEEYTYIIPKGHY
FT                   VNPAEYVIESDASSATYPLAFAALTGTTVTVPNIGSASLQGDARFATDVLQPMGCSVTQ
FT                   TATSTTVTGPPVGHLKPLKHVDMEPMTDAFLTACVVAAVAHDNDPTSKNTTTIEGIANQ
FT                   RVKECNRIEAMCTQLAKFGVRTNELPDGIQVHGLHSINDLKVPSIGNEAVGVCTYDDHR
FT                   VAMSFSLLAGMVNSEQPNSSNPTPVRILERHCTGKTWPGWWDVLHTELGAQLDGAEPLE
FT                   LNSMKNAKKSVVIIGMRAAGKTTISRWCAAALGYKLVDLDTLFEERYGHGMIKDFVSQH
FT                   GWEKFREEEARIFKEVIENYGDAGYVFSSGGGLVESSESRRILKSFSKSGGYVLHLHRD
FT                   IEETIMFLQKDPTRPAYVEEIREVWNRRESWYKDCSNFSFFAPHCNSEVEFQNLRRAFT
FT                   KFIRTITGVTTVDIPTRRSAFVCLTFENLTEYTNSLKAITYGCDAVEVRVDHLSNMDED
FT                   FVSKQISILRASTDGLPIIFTVRTKKQGGKFPDEDYETLQKLLITALKVGVDYIDLELT
FT                   LPIGIQYKVLNMKRNTKIIGSHHDFASAYPWDHSEWENRYNQALAMDVDIVKFVGMAKS
FT                   FEDNLMLERFRDSHTTKPLIAINMGAHGRVSRVLNTILTPVTSEHLSEVAAPGQLTVAE
FT                   INRIYTEMGGITKKDFFVVGSPIGHSRSPVLHNTGYSVLGLPHHFDKFETTSAEEVKKH
FT                   LLDNKANLGGLAVTIPLKLDIIKYMDELTESAKVIGAVNTVIPLGNSKFKGDNTDWLGI
FT                   RNSLVSNGVPESVSGLSGLVVGAGGTSRAAIFALHKLGCQKIFIVNRTTEKLEELVKFF
FT                   PEEYNIVPIKEAEEAEAVNETIGVAVNCVPADKPLDAKLESLLERLLLKSSHTHFVSTL
FT                   VEAAYKPSVTPVMKLAKDKYQWRVVPGAQMLVHQGVAQFETWNNCRAPFKAIYDAVTEI
FT                   "
FT   gene            <1136195..>1137241
FT                   /locus_tag="CAGL0M11506g"
FT                   /old_locus_tag="CAGL-IPF6248"
FT                   /old_locus_tag="CAGL-CDS3176.1"
FT   CDS_pept        1136195..1137241
FT                   /locus_tag="CAGL0M11506g"
FT                   /old_locus_tag="CAGL-IPF6248"
FT                   /old_locus_tag="CAGL-CDS3176.1"
FT                   /note="highly similar to uniprot|Q12452 Saccharomyces
FT                   cerevisiae YLR100w ERG27 3-keto sterol reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62821"
FT                   /db_xref="GOA:Q6FIV3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIV3"
FT                   /protein_id="CAG62821.1"
FT                   /translation="MTSKTRKVAVITGANSNLGLNIAYRLIERQSADVRLTLVVTSRTL
FT                   PRVREVVELIKKFVATQEDPCSVDFDYLLVDFTNMVSVLNAYYDLNQKYESINYFFVNA
FT                   AQGVYDGIDWIGAVKQVLSDPLEAVTNPTYRKQLVGVKSKDEMGLVFQANVFGPYYLIQ
FT                   KILPQLSKGKATVVWISSIMADPKHLSLQDIEMIKSDVTYEGSKRVVDLLHLATYKQMK
FT                   SQGIHQYVVQPGIFTSYSFAKYLNFFTTFGMLFLFYLARLLGSKWHNIDGYKAANAPVY
FT                   VATLINPHFEHQEVKYGSASSRDGMEYIETTDIDKTGSSDVLAYIEKKKLEWDDKLKDQ
FT                   ITNSRIPI"
FT   gene            complement(<1137426..>1138229)
FT                   /locus_tag="CAGL0M11528g"
FT                   /old_locus_tag="CAGL-IPF6249"
FT                   /old_locus_tag="CAGL-CDS3850.1"
FT   CDS_pept        complement(1137426..1138229)
FT                   /locus_tag="CAGL0M11528g"
FT                   /old_locus_tag="CAGL-IPF6249"
FT                   /old_locus_tag="CAGL-CDS3850.1"
FT                   /note="weakly similar to uniprot|Q12107 Saccharomyces
FT                   cerevisiae YLR102c APC9 subunit of the Anaphase Promoting
FT                   Complex"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62822"
FT                   /db_xref="GOA:Q6FIV2"
FT                   /db_xref="InterPro:IPR024274"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV2"
FT                   /protein_id="CAG62822.1"
FT                   /translation="MSRNIGSNRKSGQRSFQLPTLPPWQTPKFKVANNATPLKRPVRSI
FT                   RSPGIRISHGNTIHVPKRNIGRVSKKPSINIQEYDYSPFFNRKAIRESQIKSLLECERA
FT                   AHCLVFHKDCHINIDEFRPDVDIYCGEFDDYSIENLDPPHQESTIDSALNERQRGVLQH
FT                   TLPNYTGNSIVNKLRNGGSALGIQDPSRNTELIELSKFWSQDSLAYSLRTEDAHNLFQI
FT                   LRLEKDYIRLSREELNQSPKNAGHILDDDVTKHTQQIRHILRMDI"
FT   gene            complement(<1138516..>1140444)
FT                   /locus_tag="CAGL0M11550g"
FT                   /old_locus_tag="CAGL-IPF6251"
FT                   /old_locus_tag="CAGL-CDS1304.1"
FT   CDS_pept        complement(1138516..1140444)
FT                   /locus_tag="CAGL0M11550g"
FT                   /old_locus_tag="CAGL-IPF6251"
FT                   /old_locus_tag="CAGL-CDS1304.1"
FT                   /note="highly similar to uniprot|Q08032 Saccharomyces
FT                   cerevisiae YLR103c CDC45"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62823"
FT                   /db_xref="GOA:Q6FIV1"
FT                   /db_xref="InterPro:IPR003874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIV1"
FT                   /protein_id="CAG62823.1"
FT                   /translation="MYYAVDKYGEAYNTIVRSCSSHSSCQLVLFVSCLNVDALCAAKIL
FT                   SLLFKKQLIQSQIVPVFGYSELKTHYDQIDDNVNTVMFIGFGGVVDLETFLEIDPEEYI
FT                   TENAKWKKRVSKRYIYVWDAQRPWNLDNLFGSEIVQCFDDGTVDDQLSEVKEAYYKLIQ
FT                   LEKEQDEDQDPDGDDEDDNNEDDVATDQDEDDDDDDDDDDPYSKKRSLSDSTDNNKRKR
FT                   KMRKQQIHKYESIIDDYYAQGVTVVNSLAAQVYSLLSSIGETTLQNLWLTILGTTSLDT
FT                   AFTQIYNRLCPLLQDEVRRLSPKSTGVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYFSN
FT                   YVNAKLSLWNESGKKRLHKMFARMGIPLTTAQESWLYMDHSIKRELGVIFDKNLDRYGL
FT                   QDIVRDGFVRSFGYRGSISASEYLEALNALLEVGEAIHDDGISSKDEEDETLTEQENKS
FT                   LKLHKRWLSNFWLSWDALDDKKLDILKLGIQHAQILQRAIFNTGVTVLEKKMIKHLRIY
FT                   RLCVLREGPDLDLYRNPLTLLRLGNWLMECCAESEAKQLLPMVLASLDEATDTYLVAGL
FT                   APRYPRGLDMLQNRKPILNNFSMAFQQITAQTGAKVKIDNFESSIIEIKKADLSPFLEK
FT                   LTLSGLI"
FT   gene            <1140749..>1141108
FT                   /locus_tag="CAGL0M11572g"
FT                   /old_locus_tag="CAGL-IPF6252"
FT                   /old_locus_tag="CAGL-CDS5190.1"
FT   CDS_pept        1140749..1141108
FT                   /locus_tag="CAGL0M11572g"
FT                   /old_locus_tag="CAGL-IPF6252"
FT                   /old_locus_tag="CAGL-CDS5190.1"
FT                   /note="similar to uniprot|Q08045 Saccharomyces cerevisiae
FT                   YLR104w"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62824"
FT                   /db_xref="GOA:Q6FIV0"
FT                   /db_xref="InterPro:IPR034543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIV0"
FT                   /inference="similar to AA sequence:UniProtKB:Q08045"
FT                   /protein_id="CAG62824.1"
FT                   /translation="MNLLMVLFVAQAHAFFFGQQQQQQQQQASYEDRVLDSGCAKYLCS
FT                   DTLECVDSWKDCPCPFPKSQLKCMLPKGSNRPYVCISKPATHDEKLNLIYDDPVQGPKA
FT                   AIKGMRDCGWVQQNL"
FT   gene            complement(<1141245..>1142351)
FT                   /locus_tag="CAGL0M11594g"
FT                   /old_locus_tag="CAGL-IPF6253"
FT                   /old_locus_tag="CAGL-CDS3004.1"
FT   CDS_pept        complement(1141245..1142351)
FT                   /locus_tag="CAGL0M11594g"
FT                   /old_locus_tag="CAGL-IPF6253"
FT                   /old_locus_tag="CAGL-CDS3004.1"
FT                   /note="similar to uniprot|P16658 Saccharomyces cerevisiae
FT                   YLR105c SEN2 tRNA splicing endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62825"
FT                   /db_xref="GOA:Q6FIU9"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016589"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIU9"
FT                   /inference="similar to AA sequence:UniProtKB:P16658"
FT                   /protein_id="CAG62825.1"
FT                   /translation="MAKKQFNTKRYKFPLPIHPIDRNALPVVSQYNPISWLQWLYCLYA
FT                   NTNLLPKKLTLTIRKDEQGWCHLLVEDEQDMKYLWNNGFFGTGQMSRSEPTWKFRTEKR
FT                   LKVNDAGDKPSGTMDLEKVTEIRRIQRLAFKKERLRLEGELSESRSQNISAEQETQIIE
FT                   EHREKLRVFRSDQLKELNNLKLTAPETRDEDLELYDDSGEIRSLESMELMPVEAIFLTF
FT                   ALPVLDIKINDLIKHFEFQHIEELKVLVRKYAAYHHYRSLKWCVRSGIKFGCDYLLYKR
FT                   GPPFQHAEFAIMVLDHTESHDYTWYSSVARVASGAKKTLILCYIDDQGLTNETLLDLWH
FT                   QGNLVKLLQHFKVAEVTYKRWIPGKNRD"
FT   gene            complement(<1143091..>1157733)
FT                   /locus_tag="CAGL0M11616g"
FT                   /old_locus_tag="CAGL-IPF6254"
FT                   /old_locus_tag="CAGL-CDS0001.1"
FT   CDS_pept        complement(1143091..1157733)
FT                   /locus_tag="CAGL0M11616g"
FT                   /old_locus_tag="CAGL-IPF6254"
FT                   /old_locus_tag="CAGL-CDS0001.1"
FT                   /note="similar to uniprot|Q12019 Saccharomyces cerevisiae
FT                   YLR106c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62826"
FT                   /db_xref="GOA:Q6FIU8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR012099"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040848"
FT                   /db_xref="InterPro:IPR041190"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIU8"
FT                   /inference="similar to AA sequence:UniProtKB:Q12019"
FT                   /protein_id="CAG62826.1"
FT                   /translation="MSIQSADTVVFDLDKAFQRRDEFVKRNPNATIDLFEFSKSNSAQI
FT                   SNLEGLTQFILARKYEASAYVYIYEELFPEVVSRWIVSLQHCTDDEAIEILSQLARIIT
FT                   IFPMSTNLIDNCMSEFADNFTKLLDSPAINMEKKSEILLAYYRILYENQQIFNKYIKME
FT                   ILYKILATQESSMEMKFLAVRVLCTLLNTNEKHILETTDLYIGNCNNIPGYYEGLSNVN
FT                   YKFMELNEAHRFSEFFSLPKIGDESNPTSSNIITFGTDCFTDHIVSICGILTPRIVTTK
FT                   DTRDYDFDYVPTKQTVAVLKKLAKLIQKNEPMMLVGKAGTGKTFLINELSKYMKTHDSV
FT                   VKIHLGEQTDAKLLIGTYTSGEKPGTFTWKSGVLATAVKEGRWVLIEDIDKAPTEVLSV
FT                   ILSLLEKRELTIPSRGETLKAAKGFQLIATVQTSERNSTKDSEPVINMIGKSAWNIVSL
FT                   EEPSDKDLEEILSKKFSLLTRLIPQLIETYHNIHSIYQDPKFISLNKGSHSRGISIRDL
FT                   TKLCHRLTSIFTANNIKDSDHLIETSVFDDIFAETADCFTAAVGEYRALEPLYHGIGRT
FT                   LEIPESRILVYLNSRVPSFENQDNFIKIGRSKLEKNSLNMQKKSVNSTNFATTNHSLRL
FT                   MEQIAMSIQMNEPLLLVGETGTGKTTVVQQVSKLLHKTLNVINVSQQTESGDLLGGYKP
FT                   VNSKSIAIPIQEEFEILFASTFSMKKNERFYKMLHKFFNRGNWKNVVKLWNEAFKMAST
FT                   ILQSHKDEENRDSQKKRRKLNSNEKSQLFKKWQLFKDDVEKFEVQSSSLENSFVFNFVE
FT                   GALVKAIKNGEWLLLDEINLASADTLESISDLLADPESRSILLADKGDMLPIKAHPDFR
FT                   LFGCMNPATDVGKKELPSGIRSRFTEIYVHSPDRDISDLLAIIDKYIGKYSVSDEWVGN
FT                   DIAELYLETKKLSENNVIVDGSNQRPHFSIRTLTRTLLYVCDIVHVYGLRRALYDGFCM
FT                   SFLTLLDQKSEDILRPLISKYTIGRLKNIKSVLSQIPQSPGENYIQFKHYWMKKGPGEL
FT                   KPQAHYIITPFVEKNMMNLVRATLGSRFPVLIQGPTSAGKTSMIKYLADITGHTFVRIN
FT                   NHEHTDLQEYLGTYVTDDTGKLSFKEGILVEALRKGYWIVLDELNLAPTDVLEALNRLL
FT                   DDNRELFIPETQEVVHPHPDFMLFATQNPPGLYGGRKFLSRAFRNRFLELHFDDIPQDE
FT                   LEIILRERCQIAPTYAKKIVEVYRQLAIERSANRLFEQKNSFATLRDLFRWAMRDAVGY
FT                   EELAANGYMLLAERCRSNTEKLLVKKVLERVMKVKLNMNKYYMNLEDTDILKDNSIVWT
FT                   NALRKLVVLVSSAMKNKEPILLVGETGCGKTTVFQLLSKYLRNNLIILNAHQNTETGDI
FT                   LGAQRPVRNRSGLQEEFKNLVLPILNINNDEPNSYTVDDLIRSYNKLDKSEVDHQLQTK
FT                   IENSIKNMNILFEWKDGPLVQAMKSGNFFLLDEISLADDSVLERLNSVLEPERSLLLAE
FT                   KGSSDALVTASERFQFFATMNPGGDYGKKELSPALRNRFTEIWVPSMDNLADITMIVED
FT                   RLQIKKQEFANIICKFTEWFGKKFGGGDASSGVVSLRDILSWVEFINESYDSINNHYAV
FT                   LVHGASMVFIDALGTNNTAHFAEDERLLKKLKFECIEYLSNITNEDLTSYIGQKVEVTV
FT                   RDNKVCAGLFSIPIKDATKNSVTFNFSAPTTTVNTMKVIRAMQVHKPILLEGSPGVGKT
FT                   SLITALANATGNNLTRINLSEQTDLVDLFGSDAPGENSGEFIWKDAPFLRAMQLGEWVL
FT                   LDEMNLASQSVLEGLNACLDHRGMAYIPELDRSFSCHPNFMVFAAQNPQYQGGGRKGLP
FT                   KSFVNRFSVVYVDMLDYHDLLKIANHLYPEIKEDIVEKMIRFISLMEDELVHKKSFGAF
FT                   GSPWEFNLRDTLRWLKLLRSSEISDDPLNYVDTIVTQRFRADADKTYVNQLIKSIFGKI
FT                   PTRDKFYCVLPETLQVNSEIIERCSSYHHPSLKKIVPLQCNFDAYESLIRCIKYNWPAI
FT                   IVGPSKSGKTELINFIADVVGQKVDVFSMNSDVDSMDILGGYEQVDLNRKLSQIRTDIL
FT                   SILADFIQQEITKEIQDFQQLMKMIRLYESINERTVLNEISFQQEVLSVVHLLDHNEKY
FT                   NNLLLQASKITNLIGKDMPVKFEWFDGMLIQAIEKGHWLILDNANLCSPSVLDRLNSLL
FT                   ETESTLLINECSNEDGSTRVLKPHPNFRLFLTVDPHYGELSRAMRNRGVEIYLEALPDR
FT                   TTTFDKNLIYESMDGSMPLQKFMPVHLSQLNSFAEIQYLLSNSSNISSNILASRITPFC
FT                   RKTLASWYENLAVTSNTTNLLQSNHLVQFIKLIETNSLIIEDSQQSSLINPLINVYLLP
FT                   QIRKSYIKTSDEEVMFLFVAHRLLNKLITELNHISNASTSLKMEDMNYLELSAAIYNGR
FT                   YLKNRPNVPIFEILMQIQNYLISSFGGNGYEKQQNFYKCHVELLLVLLSLIETCGKKDE
FT                   ARLRVYKTEVQKWISNATVEGFAIDSILLAMDNFEDSLKLKRGKGMSALWIKFRDSYPR
FT                   TSVGWSLWIVAEELSFKFDKIAKLQFSNNLEIISNLKQTFFIVFDEICRDNLDIAEDLI
FT                   SKLKTGIDELEVISKSFLVQKRNYFENEFDDIIVYTAALQANKPSTFFNILALSSFSTL
FT                   NGYKLTRESTSYPKFLSLLWSFDDNNLISKSGTLLTGKFAETTLSKANNLHEIIGSQVD
FT                   ETIHDVKALLSALLSTSYQITSHSLEQTFKTLVDWIVAIIEAFTGSNVIYRSYNELLSE
FT                   LRGLEAPVLEPLQNPYFLGQMEAFIESKCSFALASCWIYFGITLIELFCPDTAFDPAIE
FT                   NYVQYDLFRSHRDFLQAEKSGWAKFRMVTSGVTPIYNELLAQSIEEPSAPEKPLVYRTN
FT                   EAVDDLFDEWNAFLLSSLSQDHINDLVQAGKLKHSISSRLDSLQVNSSKFVERVKSGFK
FT                   MFSDLNDIFAGYIFAIKFGFDIMKQKLLNDNLHQGTTRLWAVNPLLTVSEYSVKQHFKN
FT                   MFVMLQRASANNYDADRTLLHFVRLFRYFKQSDELLDIFHESLHTLYARWSMRKMQSEK
FT                   KQEEQAKTFKYTDESDDFEREFREMFPDYDDELNLSEDIKSQDEETVDLYHQLTIEYMN
FT                   LFSSDEQLSLNDVITEGTKISSLDNSLSAQLTSGIVTPETLLSVANILAQKINGFDKTE
FT                   NKSFSIFKDFSIPESKKAARSILTLLGKVNELLNQWPENATLQDLFRTCHEFLSFTLDT
FT                   TIARQLQKLEQIYTILTEWEKYASSTVSLNDYITEIVNTLVSWRRMELRSWSELLLNED
FT                   KQAQRSISKWWFYLYETIILPTESNMDGENEKQYKLLQALNVFFSESTIGEYDHRINLV
FT                   ISFKEHLLNSFPNKEQTINALTNIILYYKQFQEKVQDVIKTTRKTLDKDMKDIILLASW
FT                   KDVNIDALKQSSKKSHNNLYKIVRKYRNVISGKVTDLITGGLQFSKPKSLGPRNLNNLN
FT                   LETLCVDLSSVTDVDEPLKLHKNFRNIDTIVHNMKHFTNIVKQWDAPDFTQLSEEYLSE
FT                   ADRLRKETPSQYKKEIKKHLAALKVQKRKLLSDGIKELRRIGLKSSYRIDIQKVQSSST
FT                   LILANAPALVQLSDSTRDEWFYKLIDLLPRLRSAISEPNEEVPITSLEKGMAITENLVF
FT                   SLIVTRTPILELQENSKVIEQKLLYIRKFMNSNFALKFNTQHKCIKNMSSDVSAILNLV
FT                   NYSLETLSSVSQYNNKDNDNINSCYQFLKTSKEKFMSLENMISNALNYDISFSDVRNEF
FT                   SSLILSSRTEVQKISTPNNSMFIQPVHDYLLNVGSIELNDELTRNDESHFEAITSLASK
FT                   LSDAVLVRFQKVMSNNFDNLSESDDKWLQLLSKKLLSSLKDMNSKNISKLVSELYEMII
FT                   SCDYSKGESIKLRKILKFVLPFICGYVGLSENLLEKTWSFYYQLSSGTYVFGTILYNLA
FT                   KDGFCSPPPPSEETYDENLHEGTGLGDGEGAENKSNDIDQDEDLTEDAQTSNQDQKDKD
FT                   DREDDDEDNAVDMEGDMAGELEDISDQDNSDDSDNESDEEELDEEINDIDDDDANAVDD
FT                   KMWDEKVDDNLKEKETDNQIENQNNESEDVQAAENEQQENGDEGSNKEPDSKEENNEDQ
FT                   QNDSENQNGDEQEQDLDNEESGEEDVGQQEDEVVNDEKEEQMFDAPEIETMELPEDMQL
FT                   DSEEESKSDNEEEEDDMKDSGFESNAEEMEVEEDILDEKQNKDDMEVDNLEEENIEEEN
FT                   NLSDANEENDNQEGENNDEDNNDVDMQDEEQTLQEEPQTENGETGTNIDDEGAEGIENY
FT                   LDNNDETSEANAEQNAGAKGAGADTKDDEDQENIGDSGMTNLEHQEQEKDSENHNDSSR
FT                   EKANEVLKELGDSLKEYHNRRQEINNPSNDENKENENKANQRPDEFEHLDGANTETDTQ
FT                   ALGGANQEEANKIDDDLAINDDLDEEEKIDSDIDTDDAANLESHNEIKEELEEDLNTDI
FT                   QKDTDSKSQGAFASTMKDLSIEDKEIYENDGLFKREDYENELDQLMDEIDKETNLKAEI
FT                   DKPQRDLTESRELWRKSEIETVELSARLGEQLRLILEPTLATKLRGDYKTGKRLNMKRI
FT                   IPYIASQYRKDKIWLRRTKPSKRQYQIMLALDNSKSMSESKSAQLAFNSLCLVSKTLSQ
FT                   LESGGLSIVRFGEYTKEVHSFDQNFSNDSGSKVFQWFNFQEDKTDVKRLVGESIKIFER
FT                   ARAYSDNDQWQLEIVISDGLCEDHDTVERLVRRARDKKIMLVFVIIDNLGQSNESIMDM
FT                   SQVKYVPDSSGNLQLKITKYLDTFPFEFYVVVHDIVELPEMLALILRQYFSDLASQ"
FT   gene            <1158244..>1159440
FT                   /locus_tag="CAGL0M11638g"
FT                   /old_locus_tag="CAGL-IPF6257"
FT                   /old_locus_tag="CAGL-CDS2778.1"
FT   CDS_pept        1158244..1159440
FT                   /locus_tag="CAGL0M11638g"
FT                   /old_locus_tag="CAGL-IPF6257"
FT                   /old_locus_tag="CAGL-CDS2778.1"
FT                   /note="similar to uniprot|Q12090 Saccharomyces cerevisiae
FT                   YLR107w REX3 RNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62827"
FT                   /db_xref="GOA:Q6FIU7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR034922"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIU7"
FT                   /inference="similar to AA sequence:UniProtKB:Q12090"
FT                   /protein_id="CAG62827.1"
FT                   /translation="MMGKETPSLRPVELPIQPVGFQDRYKVIHKICEALEKVAYPRVKL
FT                   AKFAVSLELKLAKESKTSQLYRFNVGILLRDIVKFKANVYKLKIANKPLVPQKVNGRSH
FT                   TAPITTKQEVFTRLRELLIDKETLRKNGYILPDVKYEPQQPVSSHVTCVRCGTKFSKED
FT                   IMNSVVCKFHPSKKLYDKSTKLEIYPCCGESTSSVSFLRLGCSTQKHHVYKGETYSELC
FT                   TIANFLTTDLIDGKENVLALDCEMGFTTMGYEMVRLTIVDFFTSKTLYDEIIRPIGEVI
FT                   DLNTQFSGVREEDILYAKDYEDVMEDVLRADMINRNSILIGHGLENDLNVMRLFHTRIL
FT                   DTAIMYSVGRFKNSLKNLSFEILSRKIQLGEHDSSQDAIAAMDIIKAKNGISITQTDW"
FT   gene            <1159573..>1159731
FT                   /gene="SNR6"
FT                   /locus_tag="CAGL0M11652r"
FT   ncRNA           1159573..1159731
FT                   /gene="SNR6"
FT                   /locus_tag="CAGL0M11652r"
FT                   /product="U6 RNA"
FT                   /note="SNR6 (noncoding RNA U6)"
FT                   /ncRNA_class="snRNA"
FT   gene            complement(<1160116..>1160862)
FT                   /locus_tag="CAGL0M11660g"
FT                   /old_locus_tag="CAGL-IPF6259"
FT                   /old_locus_tag="CAGL-CDS4022.1"
FT   CDS_pept        complement(1160116..1160862)
FT                   /locus_tag="CAGL0M11660g"
FT                   /old_locus_tag="CAGL-IPF6259"
FT                   /old_locus_tag="CAGL-CDS4022.1"
FT                   /note="highly similar to uniprot|P41277 Saccharomyces
FT                   cerevisiae YIL053w RHR2 or uniprot|P40106 Saccharomyces
FT                   cerevisiae YER062c GPP2"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62828"
FT                   /db_xref="GOA:Q6FIU6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIU6"
FT                   /protein_id="CAG62828.1"
FT                   /translation="MSTSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAE
FT                   HVIHISHGWRTYDAIAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKL
FT                   PKEKWAVATSGTRDMAQKWFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPIN
FT                   KEDPSKSKVVVFEDAPAGIAAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVG
FT                   GYNPETDEVEFIFDDYLYAKDDLLEW"
FT   gene            complement(<1161812..>1163341)
FT                   /locus_tag="CAGL0M11682g"
FT                   /old_locus_tag="CAGL-IPF6261"
FT                   /old_locus_tag="CAGL-CDS2019.1"
FT   CDS_pept        complement(1161812..1163341)
FT                   /locus_tag="CAGL0M11682g"
FT                   /old_locus_tag="CAGL-IPF6261"
FT                   /old_locus_tag="CAGL-CDS2019.1"
FT                   /note="similar to uniprot|Q12259 Saccharomyces cerevisiae
FT                   YLR108c"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62829"
FT                   /db_xref="GOA:Q6FIU5"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIU5"
FT                   /inference="similar to AA sequence:UniProtKB:Q12259"
FT                   /protein_id="CAG62829.1"
FT                   /translation="MPPSRESYESVPDLLPQDKVYKIQVGQKLFKITGRTLSWDGPNFF
FT                   TDYFQKNNTDSEVLFLDRSTECFEIIYRHMQGYFTSIKDEVEYTTLFTDALFYSLPKLV
FT                   KFLRNPEFYYINVGGKSFQVPKSLFKNEGDNNNYFNVVISGFYKEIEARILEKKLHLSP
FT                   YPPTYVPRSAEYFAQILTLLSGAHLEMDDIRRASLIQECRYYRLNNLEQKLIKCKVMNN
FT                   PMSNVEEISIHLGDISKSGLDLRRPMVANPQTMIAACVRQEEHIKKDNQIEKAVQHSND
FT                   TNLSSSEHSNSSSCDDQEKEPERKKLKLSDCNNTAKSFAQKEKIWDIVTYKRPYVDANP
FT                   RDLIFQLDNSECSLIFNKSKKAVHVELCGSTAFLFQKLFADLFYNGEDNQVDLSNYKVT
FT                   APGLPSCASKKNECVRSQLLVLPACVSLCDMQVNGIKCNNIFSLVGDTKCNERVPDFTN
FT                   MSELQYCPGLKLHIAKSMWKIGLKKDKIMLIAIKAVTYCSTKEYCKTIDFL"
FT   gene            <1165319..>1165846
FT                   /locus_tag="CAGL0M11704g"
FT                   /old_locus_tag="CAGL-IPF6263"
FT                   /old_locus_tag="CAGL-CDS4636.1"
FT   CDS_pept        1165319..1165846
FT                   /locus_tag="CAGL0M11704g"
FT                   /old_locus_tag="CAGL-IPF6263"
FT                   /old_locus_tag="CAGL-CDS4636.1"
FT                   /note="similar to uniprot|P38013 Saccharomyces cerevisiae
FT                   YLR109w AHP1 Alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CAGL0M11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG62830"
FT                   /db_xref="GOA:Q6FIU4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIU4"
FT                   /inference="similar to AA sequence:UniProtKB:P38013"
FT                   /protein_id="CAG62830.1"
FT                   /translation="MAAPQVNEKFDVKDIKFQYIDFDQSVSHDACAMPSTTSWSDFLAK
FT                   NKTVVITGAPAAFSPTCSISHIPGYISKLSDLEAKGVDQVVVVTVDNPFANEAWAKNLG
FT                   VQNTKHIKFATDAGAELVRHLGYELKVGEGVYWSGRWTVIVKDGVVVYAGNESNPASDV
FT                   TVSSVEEALKHL"
FT   gene            complement(<1166308..>1166748)
FT                   /locus_tag="CAGL0M11726g"
FT                   /old_locus_tag="CAGL-IPF6265"
FT                   /old_locus_tag="CAGL-CD