(data stored in ACNUC27125 zone)

EMBL: CR382121

ID   CR382121; SV 1; linear; genomic DNA; STD; FUN; 1062590 BP.
XX
AC   CR382121;
XX
PR   Project:PRJNA13835;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Kluyveromyces lactis strain NRRL Y-1140 chromosome A complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Kluyveromyces lactis
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
XX
RN   [1]
RP   1-1062590
RA   Genoscope - CEA;
RT   ;
RL   Submitted (09-SEP-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1062590
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
DR   MD5; a91f35d4724a5c0e22a5b9818e49458e.
DR   BioSample; SAMEA3138170.
DR   EnsemblGenomes-Gn; ENSRNA049509336.
DR   EnsemblGenomes-Gn; ENSRNA049509376.
DR   EnsemblGenomes-Gn; ENSRNA049509396.
DR   EnsemblGenomes-Gn; ENSRNA049509439.
DR   EnsemblGenomes-Gn; ENSRNA049509461.
DR   EnsemblGenomes-Gn; ENSRNA049509492.
DR   EnsemblGenomes-Gn; ENSRNA049560395.
DR   EnsemblGenomes-Gn; ENSRNA049560426.
DR   EnsemblGenomes-Gn; ENSRNA049560482.
DR   EnsemblGenomes-Gn; ENSRNA049560521.
DR   EnsemblGenomes-Gn; ENSRNA049560566.
DR   EnsemblGenomes-Gn; ENSRNA049560607.
DR   EnsemblGenomes-Gn; ENSRNA049560655.
DR   EnsemblGenomes-Gn; ENSRNA049560720.
DR   EnsemblGenomes-Gn; ENSRNA049560775.
DR   EnsemblGenomes-Gn; ENSRNA049560818.
DR   EnsemblGenomes-Gn; ENSRNA049560853.
DR   EnsemblGenomes-Gn; ENSRNA049560922.
DR   EnsemblGenomes-Gn; ENSRNA049560971.
DR   EnsemblGenomes-Gn; ENSRNA049561038.
DR   EnsemblGenomes-Gn; ENSRNA049561094.
DR   EnsemblGenomes-Gn; ENSRNA049561126.
DR   EnsemblGenomes-Gn; ENSRNA049561161.
DR   EnsemblGenomes-Gn; ENSRNA049561216.
DR   EnsemblGenomes-Gn; ENSRNA049561252.
DR   EnsemblGenomes-Gn; ENSRNA049561347.
DR   EnsemblGenomes-Gn; ENSRNA049561377.
DR   EnsemblGenomes-Gn; ENSRNA049561438.
DR   EnsemblGenomes-Gn; ENSRNA049561498.
DR   EnsemblGenomes-Gn; KLLA0_A00308r.
DR   EnsemblGenomes-Gn; KLLA0_A02042r.
DR   EnsemblGenomes-Gn; KLLA0_A02049r.
DR   EnsemblGenomes-Gn; KLLA0_A02409r.
DR   EnsemblGenomes-Gn; KLLA0_A02783r.
DR   EnsemblGenomes-Gn; KLLA0_A03762r.
DR   EnsemblGenomes-Gn; KLLA0_A03784r.
DR   EnsemblGenomes-Gn; KLLA0_A04257r.
DR   EnsemblGenomes-Gn; KLLA0_A04686r.
DR   EnsemblGenomes-Gn; KLLA0_A05987r.
DR   EnsemblGenomes-Gn; KLLA0_A06002r.
DR   EnsemblGenomes-Gn; KLLA0_A06072r.
DR   EnsemblGenomes-Gn; KLLA0_A06864r.
DR   EnsemblGenomes-Gn; KLLA0_A06908r.
DR   EnsemblGenomes-Gn; KLLA0_A08085r.
DR   EnsemblGenomes-Gn; KLLA0_A08228r.
DR   EnsemblGenomes-Gn; KLLA0_A08294r.
DR   EnsemblGenomes-Gn; KLLA0_A08514r.
DR   EnsemblGenomes-Gn; KLLA0_A08558r.
DR   EnsemblGenomes-Gn; KLLA0_A08965r.
DR   EnsemblGenomes-Gn; KLLA0_A08987r.
DR   EnsemblGenomes-Gn; KLLA0_A09273r.
DR   EnsemblGenomes-Gn; KLLA0_A09581r.
DR   EnsemblGenomes-Gn; KLLA0_A10615r.
DR   EnsemblGenomes-Gn; KLLA0_A10725r.
DR   EnsemblGenomes-Gn; KLLA0_A10879r.
DR   EnsemblGenomes-Gn; KLLA0_A11154r.
DR   EnsemblGenomes-Gn; KLLA0_A11264r.
DR   EnsemblGenomes-Tr; EFT00001977552.
DR   EnsemblGenomes-Tr; EFT00001977553.
DR   EnsemblGenomes-Tr; EFT00001977554.
DR   EnsemblGenomes-Tr; EFT00001977555.
DR   EnsemblGenomes-Tr; EFT00001977556.
DR   EnsemblGenomes-Tr; EFT00001977557.
DR   EnsemblGenomes-Tr; EFT00001977558.
DR   EnsemblGenomes-Tr; EFT00001977559.
DR   EnsemblGenomes-Tr; EFT00001977560.
DR   EnsemblGenomes-Tr; EFT00001977561.
DR   EnsemblGenomes-Tr; EFT00001977562.
DR   EnsemblGenomes-Tr; EFT00001977563.
DR   EnsemblGenomes-Tr; EFT00001977564.
DR   EnsemblGenomes-Tr; EFT00001977565.
DR   EnsemblGenomes-Tr; EFT00001977566.
DR   EnsemblGenomes-Tr; EFT00001977567.
DR   EnsemblGenomes-Tr; EFT00001977568.
DR   EnsemblGenomes-Tr; EFT00001977569.
DR   EnsemblGenomes-Tr; EFT00001977570.
DR   EnsemblGenomes-Tr; EFT00001977571.
DR   EnsemblGenomes-Tr; EFT00001977572.
DR   EnsemblGenomes-Tr; EFT00001977573.
DR   EnsemblGenomes-Tr; EFT00001977574.
DR   EnsemblGenomes-Tr; EFT00001977575.
DR   EnsemblGenomes-Tr; EFT00001977576.
DR   EnsemblGenomes-Tr; EFT00001977577.
DR   EnsemblGenomes-Tr; EFT00001977578.
DR   EnsemblGenomes-Tr; EFT00001977579.
DR   EnsemblGenomes-Tr; KLLA0_A00308r-1.
DR   EnsemblGenomes-Tr; KLLA0_A02042r-1.
DR   EnsemblGenomes-Tr; KLLA0_A02049r-1.
DR   EnsemblGenomes-Tr; KLLA0_A02409r-1.
DR   EnsemblGenomes-Tr; KLLA0_A02783r-1.
DR   EnsemblGenomes-Tr; KLLA0_A03762r-1.
DR   EnsemblGenomes-Tr; KLLA0_A03784r-1.
DR   EnsemblGenomes-Tr; KLLA0_A04257r-1.
DR   EnsemblGenomes-Tr; KLLA0_A04686r-1.
DR   EnsemblGenomes-Tr; KLLA0_A05987r-1.
DR   EnsemblGenomes-Tr; KLLA0_A06002r-1.
DR   EnsemblGenomes-Tr; KLLA0_A06072r-1.
DR   EnsemblGenomes-Tr; KLLA0_A06864r-1.
DR   EnsemblGenomes-Tr; KLLA0_A06908r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08085r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08228r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08294r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08514r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08558r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08965r-1.
DR   EnsemblGenomes-Tr; KLLA0_A08987r-1.
DR   EnsemblGenomes-Tr; KLLA0_A09273r-1.
DR   EnsemblGenomes-Tr; KLLA0_A09581r-1.
DR   EnsemblGenomes-Tr; KLLA0_A10615r-1.
DR   EnsemblGenomes-Tr; KLLA0_A10725r-1.
DR   EnsemblGenomes-Tr; KLLA0_A10879r-1.
DR   EnsemblGenomes-Tr; KLLA0_A11154r-1.
DR   EnsemblGenomes-Tr; KLLA0_A11264r-1.
DR   EuropePMC; PMC4381506; 25834639.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF01177; snR67.
DR   RFAM; RF01242; snR36.
DR   RFAM; RF01249; snR190.
DR   RFAM; RF01256; snR43.
DR   RFAM; RF01265; snR42.
DR   RFAM; RF01269; snR80.
DR   StrainInfo; 194089; 0.
XX
CC   This is an updated version of the complete genome sequence. The
CC   Kluyveromyces lactis sequence is made of 6 chromosomes (A to F). The
CC   sequence was annotated by the Genolevures Consortium. For more information
CC   go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1062590
FT                   /organism="Kluyveromyces lactis"
FT                   /chromosome="A"
FT                   /strain="NRRL Y-1140"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klla0A"
FT                   /db_xref="taxon:28985"
FT   gene            <2788..>3834
FT                   /locus_tag="KLLA0_A00110g"
FT                   /old_locus_tag="KLLA-ORF11089"
FT   CDS_pept        2788..3834
FT                   /locus_tag="KLLA0_A00110g"
FT                   /old_locus_tag="KLLA-ORF11089"
FT                   /product="KLLA0A00110p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02592"
FT                   /db_xref="GOA:Q6CQ36"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CQ36"
FT                   /protein_id="CAH02592.1"
FT                   /translation="MSSHPFQVIDLCAPAEETSRLLLEAANTQGFLFIDGHSFSQQQVD
FT                   ALFRLSMEYFTNTPHHEKLQYAFDVAKNYGYTDYTREQGDPSKAKDFKECYNFGSINFS
FT                   NGTYNGQSRSTSENCMQHGEVPPLFTYHNDLIVDSIKKFHELARNIMGLFTVALGIIQE
FT                   DFFVSRFSDDKKNGCVMRLLHYPLFRDDGVDGSSGIDPTLRIGPHSDYGALTLLLQKEG
FT                   EQGLEVQLDPGCDQWTKVPFLTSRYEGSAPPIVVNFGDMLSFWTKGVIRSTKHRVKIDP
FT                   GETRSSDRYSIVFFTHPDADTTLDPVPSRVIESNSNGIGAPPVTAYEYLSAHLSRVINS
FT                   IPSHDGMV"
FT   gene            <4628..>6151
FT                   /locus_tag="KLLA0_A00132g"
FT                   /old_locus_tag="KLLA-ORF11085"
FT   CDS_pept        4628..6151
FT                   /locus_tag="KLLA0_A00132g"
FT                   /old_locus_tag="KLLA-ORF11085"
FT                   /product="KLLA0A00132p"
FT                   /note="similar to uniprot|P36032 Saccharomyces cerevisiae
FT                   YKL221W MCH2 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02593"
FT                   /db_xref="GOA:Q6CYI4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYI4"
FT                   /protein_id="CAH02593.1"
FT                   /translation="MSATLQRIMSENNATFREKGETATSLETSNIPSAGELKDPGRLEK
FT                   EQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYYMD
FT                   SGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALLAAF
FT                   STKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIVFNLS
FT                   TQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDMFKYPV
FT                   IWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPLVGLAAD
FT                   KFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTSIITRLVG
FT                   LPKLEAVYSVVWMFLGACAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTAYLLAALAL
FT                   WCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
FT   gene            complement(<6838..>7056)
FT                   /locus_tag="KLLA0_A00143g"
FT                   /old_locus_tag="Klla0A.mRNA.at.3.m"
FT   CDS_pept        complement(6838..7056)
FT                   /locus_tag="KLLA0_A00143g"
FT                   /old_locus_tag="Klla0A.mRNA.at.3.m"
FT                   /product="KLLA0A00143p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00143g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65215"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI2"
FT                   /protein_id="CAR65215.1"
FT                   /translation="MVSLECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNVS
FT                   AYFENGSFYSWESFATVAATSDFFASH"
FT   gene            <8139..>8579
FT                   /locus_tag="KLLA0_A00154g"
FT   CDS_pept        8139..8579
FT                   /locus_tag="KLLA0_A00154g"
FT                   /product="KLLA0A00154p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02594"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CLV0"
FT                   /protein_id="CAH02594.2"
FT                   /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLEFDMVSNST
FT                   SVCFNSTNYAIDVSELPLPEWLDDWDSLLLAMPCGDEIFVSVPKDLDSNTTAKILAYSL
FT                   ASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVQN"
FT   repeat_region   8591..8991
FT                   /locus_tag="KLLA0_A00159t"
FT                   /old_locus_tag="Klla0A.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   mobile_element  9115..9552
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLLA0_A00165t"
FT                   /old_locus_tag="Klla0A.retrotransposon.1"
FT   repeat_region   9577..9668
FT                   /locus_tag="KLLA0_A00170t"
FT                   /old_locus_tag="Klla0A.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<10102..>11511)
FT                   /locus_tag="KLLA0_A00176g"
FT                   /old_locus_tag="KLLA-ORF11079"
FT   CDS_pept        complement(10102..11511)
FT                   /locus_tag="KLLA0_A00176g"
FT                   /old_locus_tag="KLLA-ORF11079"
FT                   /product="KLLA0A00176p"
FT                   /note="similar to uniprot|P24031 Saccharomyces cerevisiae
FT                   YBR092C PHO3 Constitutively expressed acid phosphatase
FT                   similar to Pho5p; brought to the cell surface by transport
FT                   vesicles; hydrolyzes thiamin phosphates in the periplasmic
FT                   space, increasing cellular thiamin uptake; expression is
FT                   repressed by thiamin"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02595"
FT                   /db_xref="GOA:Q6CYI2"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYI2"
FT                   /protein_id="CAH02595.1"
FT                   /translation="MLSILVTFLSLSSIHAAPISKDNGTVCYALKSSTADASIFPFLNG
FT                   QGPHYDYPQSFGIPVEVPDQCTVEHVQMLARHGERYPTASKGKLMIALWDKLKVFQGQF
FT                   DGPLEIFNDYEFFVSDTKYFDQLTNSSDVDPSNPYMGSKTAEILGKYIAFNYGELFGNY
FT                   TPVFTSSSGRVYQTAKYAVSALEEELNVQLDLQIIQENETAGANSLTPGDSCVSYNGDL
FT                   GDEYFENVTLSYLTDIKNRWMKKNSNLNLTLEQDDIELLVDWCAFVTNIKGSSTVCDLF
FT                   ERNDLIAYSYYSDVTNFYGRGLGNPLVKPIGSVLLNASYNLFTQADDLDNKVWLSFSHD
FT                   TDIQQFVSALGLFDNGVTEYSLEQVEFQDIQKLSWVTPMGGRIFTEKLKCRNSSYVRYI
FT                   VNDVVIPVPGCTSGPGFSCPIEDFDDYIADRLNGIDYVSSCEIQQVSNITELTFYWDYN
FT                   EVEYNGPVSNK"
FT   gene            complement(<14237..>15211)
FT                   /locus_tag="KLLA0_A00198g"
FT                   /old_locus_tag="KLLA-ORF11076"
FT   CDS_pept        complement(14237..15211)
FT                   /locus_tag="KLLA0_A00198g"
FT                   /old_locus_tag="KLLA-ORF11076"
FT                   /product="KLLA0A00198p"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144W THI4 Protein required for thiamine
FT                   biosynthesis and for mitochondrial genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02596"
FT                   /db_xref="GOA:Q6CYI1"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYI1"
FT                   /protein_id="CAH02596.1"
FT                   /translation="MSTTQTQTQNKLSVQSQSVEHCLSDVVKQDDWSDFAFAPIREATV
FT                   SRAMTSRYFKDLDKFAVSDVVIIGAGSSGLSAAYVIAKNRPDLKIAIIEANVAPGGGCW
FT                   LGGQLFSAMIMRKPADKFLDELNIPYEDEGHYVVVKHAALFMSTVLSEVLKFPNVKMFN
FT                   ATAVEDLVTRPADDNSQHVNVAGVVTNWTLVTQNHDTQSCMDPNVIELSGYKDNGERDL
FT                   SQKHGVILSCCGHDGPFGAFTVKRMASIDSSKSYAGMKGLDMNRAEDAVVKNAGAYDKV
FT                   GSVYFAGMEVAEHAGLNRMGPTFGAMAVSGIKAAEDILKHFAA"
FT   gene            <17582..>18067
FT                   /locus_tag="KLLA0_A00220g"
FT                   /old_locus_tag="KLLA-ORF11074"
FT   CDS_pept        17582..18067
FT                   /locus_tag="KLLA0_A00220g"
FT                   /old_locus_tag="KLLA-ORF11074"
FT                   /product="KLLA0A00220p"
FT                   /note="some similarities with uniprot|Q2S3S7 Salinibacter
FT                   ruber SRU_1022 Mitochondrial benzodiazepine
FT                   receptor/sensory transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02597"
FT                   /db_xref="GOA:Q6CYI0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYI0"
FT                   /protein_id="CAH02597.1"
FT                   /translation="MFELYSPVKILASVATTLSFGYSSGLVTRTSVNTWYPTLIKPWFT
FT                   PPNKLFPIAWSSLYLVMGIAAGIVWSHASKGNKLAATGLKHFAVQFGLNMLWSYLFFGL
FT                   KSPGLGLIEVTALWFSIYKTWSVFTLVDPTAGWLMVPYLSWVSYATVLNASIWWLNR"
FT   gene            complement(<18272..>19105)
FT                   /locus_tag="KLLA0_A00242g"
FT                   /old_locus_tag="KLLA-ORF11073"
FT   CDS_pept        complement(18272..19105)
FT                   /locus_tag="KLLA0_A00242g"
FT                   /old_locus_tag="KLLA-ORF11073"
FT                   /product="KLLA0A00242p"
FT                   /note="similar to uniprot|P25613 Saccharomyces cerevisiae
FT                   YCR010C ADY2 Accumulation of DYads member of the TC 9.B.33
FT                   YaaH family of putative transporters Protein involved in
FT                   Accumulation of DYads or uniprot|P32907 Saccharomyces
FT                   cerevisiae YNR002c"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02598"
FT                   /db_xref="GOA:Q6CYH9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH9"
FT                   /protein_id="CAH02598.1"
FT                   /translation="MSDQSLNEKSGDHFENQMRMANHDPSESSAYDDLELQKIHTGGDN
FT                   HEFVFIGRQKFLKEDLFTAFGGTLNPGLAPPSTHKFANPAPLGLSAFALTTFVLSMFNA
FT                   RAMGITIPNVVVGSAAFYGGLVQLIAGIWEIALENTFGGTALSSFGGFWMSFSALYIPF
FT                   FGVADAYKEHPEQFSSAVGFFLLGWAIFTAGMTVCTMKSTVAFFSLFFFLTITFLLLSI
FT                   GEFAQNTNVTRAGGVVGVIVAFIAWYDAFAGVATKENSYVTVRPLPLPKPHHTLF"
FT   gene            <20634..>21338
FT                   /locus_tag="KLLA0_A00264g"
FT                   /old_locus_tag="KLLA-ORF11069"
FT   CDS_pept        20634..21338
FT                   /locus_tag="KLLA0_A00264g"
FT                   /old_locus_tag="KLLA-ORF11069"
FT                   /product="KLLA0A00264p"
FT                   /note="highly similar to uniprot|P40582 Saccharomyces
FT                   cerevisiae YIR038C GTT1 ER associated glutathione S-
FT                   transferase capable of homodimerization expression induced
FT                   during the diauxic shift and throughout stationary phase
FT                   functional overlap with Gtt2p Grx1p and Grx2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02599"
FT                   /db_xref="GOA:Q6CYH8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH8"
FT                   /protein_id="CAH02599.1"
FT                   /translation="MSTNVIKVHWLNQSRAFRVLWLLDHLKLDYEIVPYKRNEQFRAPE
FT                   ELKKIHPLGRAPILEIDYKSSDRKDILAESGYIFQYILENFDKEGILNNADQQKAEKIK
FT                   YYLHYAEGSLQPPLFIEFLLSKAKEAPVPFPFSYITKKFADKISEKYSRGEVKNQLDFI
FT                   ETEIEQNDGYLVGGKLSAADILLSFPLEMAFERQFARTEEYPNIAKWLETIKREESYST
FT                   SKDKAKANGASF"
FT   gene            complement(<22024..>25698)
FT                   /locus_tag="KLLA0_A00286g"
FT   CDS_pept        complement(22024..25698)
FT                   /locus_tag="KLLA0_A00286g"
FT                   /product="KLLA0A00286p"
FT                   /note="similar to uniprot|P47037 Saccharomyces cerevisiae
FT                   YJL074C SMC3 Subunit of the multiprotein cohesin complex
FT                   required for sister chromatid cohesion in mitotic cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02600"
FT                   /db_xref="GOA:Q6CYH7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041741"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH7"
FT                   /protein_id="CAH02600.2"
FT                   /translation="MVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAA
FT                   IRFVLSEENSNLKREDRKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRR
FT                   TVGLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLL
FT                   EDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNR
FT                   DRKVLQFCLYDRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSL
FT                   ESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKK
FT                   QIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDW
FT                   IQEQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDL
FT                   QNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQ
FT                   NVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKEL
FT                   FATKGGRVTFIPLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLV
FT                   VKSLIDGASLAKEYKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYK
FT                   KIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITID
FT                   DSIKALKARLNKIDTELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKET
FT                   SLNFNLSTLNELSSKLDELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMELVLME
FT                   KQTVTRTKEQVESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEK
FT                   VLLKKSTLNSRKEELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVN
FT                   KRASENYTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSR
FT                   VFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSF
FT                   NSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTI
FT                   KNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVNFSRGNNKMEEL"
FT   gene            <26345..>26444
FT                   /locus_tag="KLLA0_A00308r"
FT   tRNA            join(26345..26383,26409..26444)
FT                   /locus_tag="KLLA0_A00308r"
FT                   /product="transfer RNA Gly (TCC) cove"
FT   gene            complement(<26582..>27238)
FT                   /locus_tag="KLLA0_A00352g"
FT                   /old_locus_tag="KLLA-ORF11065"
FT   CDS_pept        complement(26582..27238)
FT                   /locus_tag="KLLA0_A00352g"
FT                   /old_locus_tag="KLLA-ORF11065"
FT                   /product="KLLA0A00352p"
FT                   /note="similar to uniprot|P43544 Saccharomyces cerevisiae
FT                   YFL060C SNO3 Protein of unknown function nearly identical
FT                   to Sno2p expression is induced before the diauxic shift and
FT                   also in the absence of thiamin and uniprot|P53823
FT                   Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
FT                   Saccharomyces cerevisiae YMR095C SNO1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02601"
FT                   /db_xref="GOA:Q6CYH6"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH6"
FT                   /protein_id="CAH02601.1"
FT                   /translation="MVLYDTVTMMTKRIGVLALQGAFAEHIALLNKAIEDNKHDIEVIT
FT                   VKTAPQLSSCDSLIIPGGESTTISLIAKRTGLFDSLIEFVHDPTKTVWGTCAGLIFLAK
FT                   QLSNESSLVNSLDLLKVKVRRNAFGRQAESFIETCDFSSFIPDCTGFQVYFIRAPIIEE
FT                   ILSQDDVETLYTLKDGSIVAVSQQGRILGTSFHPELSDNDARFHNYFIQKFVLNN"
FT   gene            <28198..>29091
FT                   /locus_tag="KLLA0_A00374g"
FT                   /old_locus_tag="KLLA-ORF11064"
FT   CDS_pept        28198..29091
FT                   /locus_tag="KLLA0_A00374g"
FT                   /old_locus_tag="KLLA-ORF11064"
FT                   /product="KLLA0A00374p"
FT                   /note="highly similar to uniprot|P43545 Saccharomyces
FT                   cerevisiae YFL059W SNZ3 Member of a stationary phase-
FT                   induced gene family transcription of SNZ2 is induced prior
FT                   to diauxic shift and also in the absence of thiamin in a
FT                   Thi2p-dependent manner forms a coregulated gene pair with
FT                   SNO3 and uniprot|P53824 Saccharomyces cerevisiae YNL333W
FT                   SNZ2 and YMR096W uniprot|Q03148 Saccharomyces cerevisiae
FT                   YMR096W SNZ1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02602"
FT                   /db_xref="GOA:Q6CYH5"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH5"
FT                   /protein_id="CAH02602.1"
FT                   /translation="MADFKVKSGLAQMLKGGVIMDVVTAEQAIIAEKAGACAVMALEQI
FT                   PADMRKSGKVCRMSDPKMIKEIMNSVSIPVMAKVRIGHFVEAQILQALEIDYIDESEVL
FT                   TPADWKGHIKKNDFNVPFVCGAKDLGEALRRIEEGAAMIRTKGEAGTGDVSEAVKHIKK
FT                   IKSEIKEYQDTLGDDTDFIKQRAESIGVSYELLKYVLDNGKLPVVNFAAGGVATPADAA
FT                   LLMQLGCEGVFVGSGIFKSSDPEKLARAIVEATTHYDDAETLLKVSTDLGDLMGGLSIE
FT                   SLKNSENPKRLANIGW"
FT   gene            <29717..>32755
FT                   /locus_tag="KLLA0_A00396g"
FT                   /old_locus_tag="KLLA-ORF11062"
FT   CDS_pept        29717..32755
FT                   /locus_tag="KLLA0_A00396g"
FT                   /old_locus_tag="KLLA-ORF11062"
FT                   /product="KLLA0A00396p"
FT                   /note="similar to uniprot|P40453 Saccharomyces cerevisiae
FT                   YIL156W UBP7 Ubiquitin-specific protease that cleaves
FT                   ubiquitin-protein fusions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02603"
FT                   /db_xref="GOA:Q6CYH4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH4"
FT                   /protein_id="CAH02603.1"
FT                   /translation="MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAE
FT                   SLFESYRESLSVEKYEDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDE
FT                   LNMSNVLLMVLHKVDSVLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQ
FT                   KSVDDDYKSFASTEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDA
FT                   LDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDR
FT                   SRTHRKDSYHSVYLGDELEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLID
FT                   LRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIV
FT                   YYTDYKSFMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSL
FT                   FLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPPLPG
FT                   SPLSAPTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPFSIPTIE
FT                   RSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIIS
FT                   KWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELS
FT                   EPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQR
FT                   CGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPK
FT                   CGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLSPFKSNS
FT                   VKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKN
FT                   NEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF
FT                   DRGITSISSGDVYVLFYERIHSI"
FT   gene            complement(<33084..>35012)
FT                   /locus_tag="KLLA0_A00418g"
FT                   /old_locus_tag="KLLA-ORF11061"
FT   CDS_pept        complement(33084..35012)
FT                   /locus_tag="KLLA0_A00418g"
FT                   /old_locus_tag="KLLA-ORF11061"
FT                   /product="KLLA0A00418p"
FT                   /note="similar to uniprot|P32191 Saccharomyces cerevisiae
FT                   YIL155C GUT2 Mitochondrial glycerol-3-phosphate
FT                   dehydrogenase expression is repressed by both glucose and
FT                   cAMP and derepressed by non-fermentable carbon sources in a
FT                   Snf1p Rsf1p Hap2/3/4/5 complex dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02604"
FT                   /db_xref="GOA:Q6CYH3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH3"
FT                   /protein_id="CAH02604.1"
FT                   /translation="MFAAKRASKVLLGSAVSAAAVFGAVSMVNQSRDTNTLQNDVSVST
FT                   IKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFAS
FT                   GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPV
FT                   YNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSF
FT                   NDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVV
FT                   VNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLP
FT                   SFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKE
FT                   LQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISG
FT                   GKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAM
FT                   SEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKY
FT                   SLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATE
FT                   YIKTFGV"
FT   gene            complement(<37134..>38201)
FT                   /locus_tag="KLLA0_A00440g"
FT                   /old_locus_tag="KLLA-ORF11058"
FT   CDS_pept        complement(37134..38201)
FT                   /locus_tag="KLLA0_A00440g"
FT                   /old_locus_tag="KLLA-ORF11058"
FT                   /product="KLLA0A00440p"
FT                   /note="similar to uniprot|Q753L8 Ashbya gossypii AFR294W
FT                   AFR294Wp and weakly similar to YIL154C uniprot|P32351
FT                   Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
FT                   activator involved in maintenance of ion homeostasis and
FT                   protection against DNA damage caused by bleomycin and other
FT                   oxidants contains a C-terminal leucine-rich repeat"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02605"
FT                   /db_xref="GOA:Q6CYH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYH2"
FT                   /protein_id="CAH02605.1"
FT                   /translation="MEEPGRGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSKTRD
FT                   TGISSSRSISRSASRVSIKDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQENGGD
FT                   EDEDEDEEEFIEDREDDGEVSEEEQVSDVENEIEIDEHIDYDLGCKVLPNFVTPITQVL
FT                   DSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSFVVYL
FT                   DQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECT
FT                   NGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLV
FT                   IRKKLKRSKRRGIAD"
FT   gene            <38766..>39827
FT                   /locus_tag="KLLA0_A00462g"
FT                   /old_locus_tag="KLLA-ORF11057"
FT   CDS_pept        38766..39827
FT                   /locus_tag="KLLA0_A00462g"
FT                   /old_locus_tag="KLLA-ORF11057"
FT                   /product="KLLA0A00462p"
FT                   /note="similar to uniprot|P40454 Saccharomyces cerevisiae
FT                   YIL153W RRD1 Resistant to Rapamycin Deletion"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02606"
FT                   /db_xref="GOA:Q6CYH1"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYH1"
FT                   /protein_id="CAH02606.1"
FT                   /translation="MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITL
FT                   CKGQQIPDTIKESFFTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLE
FT                   NWLHELLPEKYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKG
FT                   PALLYCFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPK
FT                   DISNTRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKM
FT                   YKVEVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPP
FT                   PLSTSTSRFIHRR"
FT   gene            complement(<40330..>41961)
FT                   /locus_tag="KLLA0_A00484g"
FT                   /old_locus_tag="KLLA-ORF11056"
FT   CDS_pept        complement(40330..41961)
FT                   /locus_tag="KLLA0_A00484g"
FT                   /old_locus_tag="KLLA-ORF11056"
FT                   /product="KLLA0A00484p"
FT                   /note="highly similar to uniprot|P10963 Saccharomyces
FT                   cerevisiae YKR097W PCK1 Phosphoenolpyruvate carboxykinase
FT                   key enzyme in gluconeogenesis catalyzes early reaction in
FT                   carbohydrate biosynthesis glucose represses transcription
FT                   and accelerates mRNA degradation regulated by Mcm1p and
FT                   Cat8p located in the cytosol"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02607"
FT                   /db_xref="GOA:O43112"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43112"
FT                   /protein_id="CAH02607.1"
FT                   /translation="MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERD
FT                   TAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAAD
FT                   YLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFT
FT                   VWNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHN
FT                   VLTLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGC
FT                   YAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPS
FT                   AKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPE
FT                   ATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTR
FT                   AILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSL
FT                   ANLFVENFKTYQDKATEQVLAAGPQL"
FT   gene            <43949..>44488
FT                   /locus_tag="KLLA0_A00506g"
FT                   /old_locus_tag="KLLA-ORF11051"
FT   CDS_pept        43949..44488
FT                   /locus_tag="KLLA0_A00506g"
FT                   /old_locus_tag="KLLA-ORF11051"
FT                   /product="KLLA0A00506p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02608"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG9"
FT                   /protein_id="CAH02608.1"
FT                   /translation="MTDTKGRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGSI
FT                   NKLIQTSKSVVRARASKRQKTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTKIR
FT                   LMKEHHSDADWLRLVVRQHHKLNDKLTLLKTDHPKFSTVILQGLCSSNVHHVLCHDVSF
FT                   FSLYRGVFWCLNWKLG"
FT   gene            complement(<44587..>48276)
FT                   /locus_tag="KLLA0_A00528g"
FT                   /old_locus_tag="KLLA-ORF11050"
FT   CDS_pept        complement(44587..48276)
FT                   /locus_tag="KLLA0_A00528g"
FT                   /old_locus_tag="KLLA-ORF11050"
FT                   /product="KLLA0A00528p"
FT                   /note="similar to uniprot|P36168 Saccharomyces cerevisiae
FT                   YKR096W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02609"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG8"
FT                   /protein_id="CAH02609.1"
FT                   /translation="MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVD
FT                   ISVAEIPQEPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQ
FT                   SPFYLPTTSQTNFEAATTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQED
FT                   GVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQ
FT                   NHDHNNSNPNDHNNSISDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQ
FT                   QQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITT
FT                   ALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF
FT                   IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHG
FT                   KLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRT
FT                   NHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLK
FT                   HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLD
FT                   PVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY
FT                   GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHY
FT                   CMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV
FT                   TTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHG
FT                   CKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGS
FT                   KSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKIL
FT                   DNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFV
FT                   LDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQL
FT                   YYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIE
FT                   KGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETG
FT                   VCTN"
FT   gene            complement(<49433..>49774)
FT                   /locus_tag="KLLA0_A00539g"
FT                   /old_locus_tag="Klla0A.mRNA.1150.m"
FT   CDS_pept        complement(join(49433..49661,49740..49774))
FT                   /locus_tag="KLLA0_A00539g"
FT                   /old_locus_tag="Klla0A.mRNA.1150.m"
FT                   /product="KLLA0A00539p"
FT                   /note="highly similar to uniprot|Q3E833 Saccharomyces
FT                   cerevisiae YKR095W-A PCC1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00539g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65216"
FT                   /db_xref="GOA:B5RSI3"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI3"
FT                   /protein_id="CAR65216.1"
FT                   /translation="MNKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVT
FT                   YSTQDTKLICDFESVDERILRVGVNSVIESIKTIVETIDELC"
FT   gene            <50099..>51241
FT                   /locus_tag="KLLA0_A00550g"
FT                   /old_locus_tag="KLLA-ORF11047"
FT   CDS_pept        50099..51241
FT                   /locus_tag="KLLA0_A00550g"
FT                   /old_locus_tag="KLLA-ORF11047"
FT                   /product="KLLA0A00550p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02610"
FT                   /db_xref="GOA:Q6CYG7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG7"
FT                   /protein_id="CAH02610.1"
FT                   /translation="MARMPDESNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLLD
FT                   DEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKS
FT                   SVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKL
FT                   MDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKM
FT                   GIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQ
FT                   LHVLAYQSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNF
FT                   EVCCDGQLLNLLELEGKNTPPSTIRIETCTEPSLKVLHSL"
FT   gene            complement(<51265..>53081)
FT                   /locus_tag="KLLA0_A00572g"
FT                   /old_locus_tag="Klla0A.mRNA.1130.m"
FT   CDS_pept        complement(join(51265..52910,52994..53081))
FT                   /locus_tag="KLLA0_A00572g"
FT                   /old_locus_tag="Klla0A.mRNA.1130.m"
FT                   /product="KLLA0A00572p"
FT                   /note="similar to uniprot|P32354 Saccharomyces cerevisiae
FT                   YIL150C MCM10 Essential chromatin-associated protein
FT                   involved in the initiation of DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02611"
FT                   /db_xref="GOA:Q6CYG6"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR040184"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG6"
FT                   /protein_id="CAH02611.1"
FT                   /translation="MSYDLTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLT
FT                   NRLLELEKKRNLKDPNFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDY
FT                   VREKVKKLGTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEK
FT                   DDLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKK
FT                   TEPRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSK
FT                   KLEAGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYC
FT                   AYHKEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFV
FT                   REPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGL
FT                   SDKLLSKKEDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND
FT                   KQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEI
FT                   I"
FT   gene            complement(<53304..>58550)
FT                   /locus_tag="KLLA0_A00594g"
FT                   /old_locus_tag="KLLA-ORF11045"
FT   CDS_pept        complement(53304..58550)
FT                   /locus_tag="KLLA0_A00594g"
FT                   /old_locus_tag="KLLA-ORF11045"
FT                   /product="KLLA0A00594p"
FT                   /note="similar to uniprot|Q02455 Saccharomyces cerevisiae
FT                   YKR095W MLP1 Myosin-like protein associated with the
FT                   nuclear envelope connects the nuclear pore complex with the
FT                   nuclear interior involved in the Tel1p pathway that
FT                   controls telomere length involved in the retention of
FT                   unspliced mRNAs in the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02612"
FT                   /db_xref="GOA:Q6CYG5"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG5"
FT                   /protein_id="CAH02612.1"
FT                   /translation="MSVEPIASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSE
FT                   NLRITATLDQLKSQSENKLESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTK
FT                   RIIELEQEIEVERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVV
FT                   NTETELQTQQALELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISEL
FT                   QDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKE
FT                   MSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESN
FT                   CIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDE
FT                   LKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKA
FT                   TVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITK
FT                   TSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVR
FT                   EAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVK
FT                   DLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTL
FT                   ELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFM
FT                   AKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSG
FT                   SLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTIN
FT                   EQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQ
FT                   SVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQ
FT                   TERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKH
FT                   ADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQR
FT                   VQELSTQNKLLYDQIELLNKTEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLK
FT                   QRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENS
FT                   SFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDIL
FT                   HKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNA
FT                   SKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLS
FT                   KLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVA
FT                   EHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQ
FT                   FEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRI
FT                   RLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNALKDSM
FT                   RKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKPVENDTSNMSAAFQ
FT                   APVFGSHSTFTSPFSTSEISPNKRPIDDTATEQPEKRHKEPESDTEDGQEA"
FT   gene            <59180..>60105
FT                   /locus_tag="KLLA0_A00616g"
FT                   /old_locus_tag="KLLA.mRNA.145SC.p"
FT   CDS_pept        join(59180..59187,59727..60105)
FT                   /locus_tag="KLLA0_A00616g"
FT                   /old_locus_tag="KLLA.mRNA.145SC.p"
FT                   /product="KLLA0A00616p"
FT                   /note="highly similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YKR094C RPL40B Fusion protein, identical to
FT                   Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal
FT                   protein of the large (60S) ribosomal subunit with
FT                   similarity to rat L40; ubiquitin may facilitate assembly of
FT                   the ribosomal protein into ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02613"
FT                   /db_xref="GOA:F2Z6I9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6I9"
FT                   /protein_id="CAH02613.2"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLP
FT                   PRATNCRKRKCGHTNQLRPKKKLK"
FT   gene            complement(<60378..>63845)
FT                   /locus_tag="KLLA0_A00638g"
FT                   /old_locus_tag="KLLA-ORF11038"
FT   CDS_pept        complement(60378..63845)
FT                   /locus_tag="KLLA0_A00638g"
FT                   /old_locus_tag="KLLA-ORF11038"
FT                   /product="KLLA0A00638p"
FT                   /note="similar to uniprot|P39928 Saccharomyces cerevisiae
FT                   YIL147C SLN1 Histidine kinase osmosensor that regulates a
FT                   MAP kinase cascade; transmembrane protein with an
FT                   intracellular kinase domain that signals to Ypd1p and
FT                   Ssk1p, thereby forming a phosphorelay system similar to
FT                   bacterial two-component regulators"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02614"
FT                   /db_xref="GOA:Q6CYG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG3"
FT                   /protein_id="CAH02614.1"
FT                   /translation="MLAGLKRRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTII
FT                   TVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFR
FT                   AGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAEL
FT                   FPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIAS
FT                   AESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGT
FT                   FIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMK
FT                   IIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDSNTAI
FT                   THSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRG
FT                   PGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTM
FT                   TDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTA
FT                   IAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQI
FT                   KSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDV
FT                   RIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLPFNSSSGSVNTATK
FT                   DGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESKHEENEDEKEKMSILSTSTSSS
FT                   YDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEP
FT                   FVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVF
FT                   DGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTE
FT                   NSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGL
FT                   TDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVA
FT                   LTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYCSKKEKQREE"
FT   gene            complement(<64397..>65971)
FT                   /locus_tag="KLLA0_A00660g"
FT                   /old_locus_tag="KLLA-ORF11036"
FT   CDS_pept        complement(64397..65971)
FT                   /locus_tag="KLLA0_A00660g"
FT                   /old_locus_tag="KLLA-ORF11036"
FT                   /product="KLLA0A00660p"
FT                   /note="weakly similar to uniprot|P40458 Saccharomyces
FT                   cerevisiae YIL146C ECM37 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02615"
FT                   /db_xref="GOA:Q6CYG2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYG2"
FT                   /protein_id="CAH02615.1"
FT                   /translation="MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPH
FT                   DSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRD
FT                   EYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLA
FT                   YPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWA
FT                   GSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALK
FT                   YTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMS
FT                   YPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKPRKGAKKKPAPHLAKRWWFWP
FT                   ISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSP
FT                   QSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVT
FT                   ALDLVMF"
FT   gene            <67685..>69811
FT                   /locus_tag="KLLA0_A00682g"
FT                   /old_locus_tag="KLLA-ORF11035"
FT   CDS_pept        67685..69811
FT                   /locus_tag="KLLA0_A00682g"
FT                   /old_locus_tag="KLLA-ORF11035"
FT                   /product="KLLA0A00682p"
FT                   /note="highly similar to uniprot|P46655 Saccharomyces
FT                   cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
FT                   forms a complex with methionyl-tRNA synthetase (Mes1p) and
FT                   Arc1p complex formation increases the catalytic efficiency
FT                   of both tRNA synthetases and ensures their correct
FT                   localization to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02616"
FT                   /db_xref="GOA:Q6CYG1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR041103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYG1"
FT                   /protein_id="CAH02616.1"
FT                   /translation="MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAA
FT                   AASFNGETEDVLTKLSAAYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAH
FT                   LNLRTYILNTLEPSLADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAH
FT                   EFLTKSLQELKKASNVNKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAA
FT                   LLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMY
FT                   DYCVQMIKEGKAYCDDTPTERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLK
FT                   NCVRAKIDYEALNKAMRDPVIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHAL
FT                   RTIEYRDRNPQYDWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDP
FT                   RFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVS
FT                   PVKVHLEGDDVPQTPNVEMKLKHKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLM
FT                   DWGNAIITKKNDDGSFNAKLHLEGDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKL
FT                   EEGENFEDFLTPKTEFHTTAYADLNVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFT
FT                   IPDGKSVNKYGAKK"
FT   gene            complement(<69861..>71636)
FT                   /locus_tag="KLLA0_A00715g"
FT                   /old_locus_tag="KLLA-ORF11032"
FT   CDS_pept        complement(69861..71636)
FT                   /locus_tag="KLLA0_A00715g"
FT                   /old_locus_tag="KLLA-ORF11032"
FT                   /product="KLLA0A00715p"
FT                   /note="weakly similar to uniprot|P43620 Saccharomyces
FT                   cerevisiae YFR048W RMD8 Cytosolic protein required for
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00715g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02618"
FT                   /db_xref="GOA:Q6CYF9"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF9"
FT                   /protein_id="CAH02618.1"
FT                   /translation="MSVIDDRNTAVPMSRSLSRRSPSILVTDARSNKNRPSAPFAGHAA
FT                   GMRNVSSVPRSAASSGGKTDSKGSRVRRRGYDMHGDKKSISSRFSDVSMDNLLLDVSDV
FT                   PSGRRQERLSTSSYDMFPRNRQRGTHITKMINPLPTRTSKTSQKLVLIPDEAHDSRNIN
FT                   QFRKRANKTQRAKSSSKTKMDKEVDLPRITAYNVAEGFNLSLTSTFMKQTHDVLPRLYD
FT                   ECLYVPYTLPLLPGKDGFRIKSNISKKTQGGKSIIDYLIDTSERRDHHYEYFSGVETLE
FT                   DVNNNYELDEGGVTNNLNAENTPDHLPNPPVNTSVSFDPSEPQYFAEENNAEAELEAFN
FT                   EINGKTSLFQQQHAEIFIFSYGVVVFWNFTEIQEKNILGDISFSSYKNMVLKPLDEQDI
FT                   EIESFHFEYDMDTERPRIFNDIVTLRSGDHLTALTLSHAIAQSVKLSRFEARIVPIFGS
FT                   VSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHSLY
FT                   QAMREYLEIDPRVQVLNDRCKVFLEFFDICVDSIAERNMARITWWFITIIFISVLISIV
FT                   EILVRYFIIKKHTGT"
FT   gene            <72233..>73981
FT                   /locus_tag="KLLA0_A00737g"
FT                   /old_locus_tag="KLLA-ORF11029"
FT   CDS_pept        72233..73981
FT                   /locus_tag="KLLA0_A00737g"
FT                   /old_locus_tag="KLLA-ORF11029"
FT                   /product="KLLA0A00737p"
FT                   /note="similar to uniprot|P53064 Saccharomyces cerevisiae
FT                   YGL244W RTF1 Subunit of the RNA polymerase II-associated
FT                   Paf1 complex directly or indirectly regulates DNA-binding
FT                   properties of Spt15p (TATA box-binding protein) and
FT                   relative activities of different TATA elements"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00737g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02619"
FT                   /db_xref="GOA:Q6CYF8"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="InterPro:IPR036128"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF8"
FT                   /protein_id="CAH02619.1"
FT                   /translation="MSDLDDDLLALAGAGTDEEEEDEFLSTSKKHASKESSGSKRRRIM
FT                   KDDEDEDEDEDDNDEEDDDGYMPADSFDNDEEEEEEEEETDSIPFPLEGKYKDEKDREK
FT                   LELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQREGSKSTRASTRSSRT
FT                   TGHSDLKQSKLSELKKQRAKKSGNYEFSDNESEDDYRSEDDSRGRRRRGDYDDEEEEES
FT                   EYDEEEDDYDLGYEKSKTRGRERADIHEVEWAEDDNLDRESSLDDYNKIQIGRSFVAKF
FT                   CFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKPYNMGKFFTNQYFGVTQ
FT                   GKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNNKSKAVNEFVCEPLTP
FT                   KLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESESKYANQLKALEKRL
FT                   SSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNKVDAKSDPFSRLKT
FT                   RTKIYYQEIQQEENEKAREEAKRQLEVDQEAEEQKKKELLLAKFRRLGGLEEIIGSLDL
FT                   KLHIDI"
FT   gene            <74187..>75329
FT                   /locus_tag="KLLA0_A00759g"
FT                   /old_locus_tag="KLLA-ORF11027"
FT   CDS_pept        74187..75329
FT                   /locus_tag="KLLA0_A00759g"
FT                   /old_locus_tag="KLLA-ORF11027"
FT                   /product="KLLA0A00759p"
FT                   /note="similar to uniprot|P53065 Saccharomyces cerevisiae
FT                   YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
FT                   adenosine-37 to inosine in tRNA-Ala"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00759g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02620"
FT                   /db_xref="GOA:Q6CYF7"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF7"
FT                   /protein_id="CAH02620.1"
FT                   /translation="MAVIADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFD
FT                   ELNDRYEPISLGTGVKATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQ
FT                   KSFLIEKSADGYKVKDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQ
FT                   YVHPEIDTIIRGRANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSL
FT                   LQSPVYLEWIVLPKQYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQP
FT                   SLSSCVSLYGSNEAVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMP
FT                   SDTDYYGFKSSVVDRNHIISKAKATLSASGWISTCRDNCI"
FT   gene            complement(<75435..>75950)
FT                   /locus_tag="KLLA0_A00781g"
FT                   /old_locus_tag="KLLA-ORF11026"
FT   CDS_pept        complement(75435..75950)
FT                   /locus_tag="KLLA0_A00781g"
FT                   /old_locus_tag="KLLA-ORF11026"
FT                   /product="KLLA0A00781p"
FT                   /note="similar to uniprot|P53066 Saccharomyces cerevisiae
FT                   YGL242C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00781g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02621"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF6"
FT                   /protein_id="CAH02621.1"
FT                   /translation="MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSK
FT                   DPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYGTF
FT                   IAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEEDAEE
FT                   IDDGPEDD"
FT   gene            <76350..>79208
FT                   /locus_tag="KLLA0_A00803g"
FT                   /old_locus_tag="KLLA-ORF11025"
FT   CDS_pept        76350..79208
FT                   /locus_tag="KLLA0_A00803g"
FT                   /old_locus_tag="KLLA-ORF11025"
FT                   /product="KLLA0A00803p"
FT                   /note="similar to uniprot|P53067 Saccharomyces cerevisiae
FT                   YGL241W KAP114 Karyopherin, responsible for nuclear import
FT                   of Spt15p, histones H2A and H2B, and Nap1p; amino terminus
FT                   shows similarity to those of other importins, particularly
FT                   Cse1p; localization is primarily nuclear"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00803g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02622"
FT                   /db_xref="GOA:Q6CYF5"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF5"
FT                   /protein_id="CAH02622.1"
FT                   /translation="MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTAT
FT                   NNNASASTRQLALLCLRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTE
FT                   KKVISTVTYCIVQICAVDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMF
FT                   FDNHSGAKIVNTVLLALNDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIP
FT                   HLKAMNDCIDKLLESYGNNMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRIT
FT                   LDAIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIK
FT                   LCLLPEDYFKLSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQ
FT                   VTSNEAQYQEACLFLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTI
FT                   PKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILD
FT                   YQTSMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTKQEILNLLLK
FT                   LSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPL
FT                   VVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACN
FT                   SNPKFWKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISK
FT                   LVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENR
FT                   SKNMLKEVALSLSELFFSNDQRLTRSSYHDESDGVVRPFKEYIVKMFADELTRQTDIEE
FT                   EEEEEEEEENDITPKDYEEDYVSQLNDDVVLLTGRVIDMELKEILVQFFKSTQQSNDNS
FT                   LGRVLKNLDEQERLKILSALFE"
FT   gene            <79588..>80595
FT                   /locus_tag="KLLA0_A00825g"
FT                   /old_locus_tag="KLLA-ORF11024"
FT   CDS_pept        79588..80595
FT                   /locus_tag="KLLA0_A00825g"
FT                   /old_locus_tag="KLLA-ORF11024"
FT                   /product="KLLA0A00825p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00825g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02623"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF4"
FT                   /protein_id="CAH02623.1"
FT                   /translation="MVKSFYHKPDASLEQKVISNRHKFMNLLQNKSVVFFISTPSHSNV
FT                   SQYAELLHNISTKNYAYDTQWNSLLRKYDAENLKDCIFCILITDVPDWNSVTDWRRDMV
FT                   LASELLPTCIPLKDPLKFSFVSDLNACSYFPTDFDFKDIAFASGCSTSVVIDVNDIEDL
FT                   TRCTQNIRTPNLFITVDEDCNPTIAHTTGNNDMLLLMDLTLATSVVFRDDFGTEDMKLP
FT                   IIIRADTESKDAIKEFIGAGNVMPRVSGFEIPLNLAHLPSVLPGTSYSYRSDTETEYTY
FT                   SNCQPKMNKEKTNWLSSLFGIRRDGTVQQPLANTSLEELEQFLNLVFELNNLLT"
FT   gene            <80886..>81668
FT                   /locus_tag="KLLA0_A00847g"
FT                   /old_locus_tag="KLLA-ORF11023"
FT   CDS_pept        80886..81668
FT                   /locus_tag="KLLA0_A00847g"
FT                   /old_locus_tag="KLLA-ORF11023"
FT                   /product="KLLA0A00847p"
FT                   /note="weakly similar to uniprot|P53068 Saccharomyces
FT                   cerevisiae YGL240W DOC1 Processivity factor required for
FT                   the ubiquitination activity of the anaphase promoting
FT                   complex (APC) mediates the activity of the APC by
FT                   contributing to substrate recognition involved in cyclin
FT                   proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00847g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02624"
FT                   /db_xref="GOA:Q6CYF3"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016901"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF3"
FT                   /protein_id="CAH02624.1"
FT                   /translation="MVATPMSTDKELFKRLQNILPRWENPYEVFPINQHVILDADAEES
FT                   TDENVQYVSNVYNPDDPEDQEESLESYLKSYTTELELIEQQNLVNLTKLAFWKASSFKV
FT                   GNPIANAIDDDPTTFWQSDGLQPHRIDINFSKRVDVVQLAMYFCLVTDESYTPELFKVY
FT                   AGYSPSDASLYRTFEVKNVNGWVVITFKGNRPHDNLLRCRFIQIQILSNHENGKDSHLR
FT                   GIKIFGNSTASRHTVKDPNTLALDNFENSSLFTYQSIR"
FT   gene            <81975..>84857
FT                   /locus_tag="KLLA0_A00869g"
FT                   /old_locus_tag="KLLA-ORF11021"
FT   CDS_pept        81975..84857
FT                   /locus_tag="KLLA0_A00869g"
FT                   /old_locus_tag="KLLA-ORF11021"
FT                   /product="KLLA0A00869p"
FT                   /note="highly similar to uniprot|P33307 Saccharomyces
FT                   cerevisiae YGL238W CSE1 Nuclear envelope protein that
FT                   mediates the nuclear export of importin alpha (Srp1p)
FT                   homolog of metazoan CAS protein required for accurate
FT                   chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00869g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02625"
FT                   /db_xref="GOA:Q6CYF2"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF2"
FT                   /protein_id="CAH02625.1"
FT                   /translation="MADLENIANILSLSVVASSARTAEQQLKELESQEGFALTLLHTVA
FT                   STNLPLSTRLAGALFFKNFIKRRWIDENGNYLISANDVELVKKEVIPLMIQLPGNLQVQ
FT                   IGEAISVIAESDFPQRWSTLMDDLISKLSADDMVTNAGVLSVAHSICKRWRPLFRSDEL
FT                   FLEIQMVLDKFAVPFLTMLQTVDKQIDEYSSDKARMVILFDVLLLLVKLYYDLNCQDIP
FT                   AFFEDNMSVGMSIMHKYLNYQNPLLEDNTEDEEASVLSKVKASIAELIQLYISRYQEEF
FT                   DPMVDNFIQTTWNLLVSLTPQPKYDILVSKCMTFVTAVARVPKYFELFNTESAMNSIIK
FT                   EIVLPNVTLRESDEELFEDDPIEYIRRDLEGSDSDTRRRACTDFLKELKEKNESLVTNV
FT                   VMVHIKSFFEEYNNNQILNWKHKDLCMYLFTSLAINGKVTNAGVTSTNVMLDVVEFFKS
FT                   DVVPDLLNQQAHPILRVDAIKYVYVFRNQLSKEQLIEILPVMAKFLQDKEYVVYTYAAI
FT                   TIERVFSMRQSAISNQLVFSKSDIASSSELLLTNLFSLTLKQGTTPEKLAENEFLMKAV
FT                   HRVLLTTENSLGAFALTVLNQLMEILKIISKNPSNPIFTHYCFESIAVVIKYYHDSLST
FT                   LIDIIIPVFLSILGDDIQEFIPYVFQVMAYILELLPAGSMIPPSIKQINEALLAPAVWE
FT                   LGGVIPAATRLLKDFVKLEQSVYPDLVPVLGVFQRLISSKSYDVHGFELLEYIFTFIPA
FT                   ERLQPFLKNIAVLLLQRLQNSRTEKYLKKFVVFLGVISCKLGSDFVVQFIDEVQEGLFQ
FT                   QIWNNFVIDTISKVGNLLDRKIVLAGSLNTVVSGNLFSSKYGNLIVPTLDIIVKTACSE
FT                   SIANVNSEFVDYDATEEISTFGSSYSRLSSITEKPYDPLPTVDVHNGLRKYTGEVLLEF
FT                   NQKAGGNFLPQIQTQLSEEGKNALTKLCTT"
FT   gene            complement(<85013..>85915)
FT                   /locus_tag="KLLA0_A00891g"
FT                   /old_locus_tag="KLLA-ORF11018"
FT   CDS_pept        complement(85013..85915)
FT                   /locus_tag="KLLA0_A00891g"
FT                   /old_locus_tag="KLLA-ORF11018"
FT                   /product="KLLA0A00891p"
FT                   /note="uniprot|P53768 Kluyveromyces lactis KLLA0A00891g
FT                   HAP2 Transcriptional activator HAP2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00891g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02626"
FT                   /db_xref="GOA:P53768"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53768"
FT                   /protein_id="CAH02626.1"
FT                   /translation="MPTELITYEQNFSSGVDAENDYPPLDSGMGSFQVSELERQGDSHK
FT                   RSNDEISELRDETLNGREKKLRQSESISRNSTGNAQVEAIPHHSINVDQSDNLLSEQEN
FT                   PTKVYLYDDPHLENDPQQRQEESDANGIMEKLTDDNSMKQVSNAKTSLETAQFLETSNS
FT                   MELQRTKPHDMNIISPSEPLEQPFYVNAKQYYRILKRRYARAKLEENLKISRERRPYLH
FT                   ESRHKHAMRRPRGQGGRFLTAAEMAEMKRKEEEGTDNDSFLQEHVPKMNVLPQQLPGPV
FT                   KDNNNEKSDEKPVAKEASN"
FT   gene            <86295..>87059
FT                   /locus_tag="KLLA0_A00913g"
FT                   /old_locus_tag="KLLA-ORF11017"
FT   CDS_pept        86295..87059
FT                   /locus_tag="KLLA0_A00913g"
FT                   /old_locus_tag="KLLA-ORF11017"
FT                   /product="KLLA0A00913p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00913g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02627"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYF0"
FT                   /protein_id="CAH02627.1"
FT                   /translation="MMESKRRLEGLKGVLSELSSVLVHEEANDSEVQIKSSGQQGNLTE
FT                   INTYNFSQDVFNKLSESNRTKKRKLRVTEDVSIVAEKEDLNVNKSALSEDENERDGIPL
FT                   FVQDSSIFSDIVDEEVDTANATPLYDRKQKLTSVEETLNTTNCNFPSHELRHLMTTFLY
FT                   QSSHSKKFTLPSKSAEELKAIINDFIDSLARSISSMIANKETNSVDRPTILRLFSKFGT
FT                   VNKKTTNQELFEICRRYLNLEDLNELEISLFS"
FT   gene            complement(<87118..>89178)
FT                   /locus_tag="KLLA0_A00935g"
FT                   /old_locus_tag="KLLA-ORF11016"
FT   CDS_pept        complement(87118..89178)
FT                   /locus_tag="KLLA0_A00935g"
FT                   /old_locus_tag="KLLA-ORF11016"
FT                   /product="KLLA0A00935p"
FT                   /note="similar to uniprot|P53070 Saccharomyces cerevisiae
FT                   YGL236C MTO1 Mitochondrial protein required for respiration
FT                   in paromomycin-resistant 15S rRNA mutants forms a
FT                   heterodimer complex with Mss1p that plays a role in
FT                   optimizing mitochondrial protein synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00935g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02628"
FT                   /db_xref="GOA:Q6CYE9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE9"
FT                   /protein_id="CAH02628.1"
FT                   /translation="MLSSQFKGRLSPCRHVARRVVVRLPRRSISINHDLEQALKIATSV
FT                   DVVVVGAGHAGCEAAAGSARSGAETMLITPFLDKIGTCSCNPSMGGVGKGTLLREVDAL
FT                   DGVAAKVTDKAGIQFKMLNQSRGAAVWGPRAQIDRELYLKEMQNALQNYPNLTLFSGKV
FT                   KDVIIDHTLKVSFANDVNNRNFGDVRGVVLDNDEVIKCSKVVISTGTFLSAEIHIGLKT
FT                   IPAGRIGEAPTYGISHTLKAAGFKLGRLKTGTPARLDGRTIDFTNLEKQYGDDPPYPMS
FT                   YMNNEVSIKDQILCYGTRTTSELHDYLKLNLHQSIHIRETVKGPRYCPSLEAKIIRFSD
FT                   KDSHRIWLEPEGLNTDVIYPNGISNSMPEDVQEIMMRMIPGLENVKILQPAYGVEYDYV
FT                   DPRELKQTLETKLIDGLYLAGQINGTTGYEEACAQGVVAGINAGLSARGRPPLILSRSD
FT                   SYTGVLIDDLITKGVEEPYRMFTSRSEFRVTVRADNADFRLTEKGKKLGVVSEERWQRF
FT                   LLDKTIYRELENTLKSYVLSNHKWDQLLDVAVGSTHKSQNAWDMFKFNGVTLDSLIKAI
FT                   PDLSIDSSEIPVHILLKINVEAKYAPYLKRQNQFIKAFQADENMLLPLNYDYTKIPSIS
FT                   SECKTILNTVQPATIGQARRIQGMTPASIFELYKLVRSQQSVIKNDRIQQS"
FT   gene            <89999..>92377
FT                   /locus_tag="KLLA0_A00957g"
FT                   /old_locus_tag="KLLA-ORF11014"
FT   CDS_pept        89999..92377
FT                   /locus_tag="KLLA0_A00957g"
FT                   /old_locus_tag="KLLA-ORF11014"
FT                   /product="KLLA0A00957p"
FT                   /note="uniprot|Q9HG45 Kluyveromyces lactis Purine
FT                   biosynthetic pathway protein ADE5,7"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00957g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02629"
FT                   /db_xref="GOA:Q6CYE8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE8"
FT                   /protein_id="CAH02629.1"
FT                   /translation="MSLNILVLGNGGREHALVWKLAQSASVSTIYVAPGNGGTATVENV
FT                   VNVPELSPSPENFSALKEFVLEKNIGLVVPGPEQPLVDGITQVFQSIGIPVFGPSAKAA
FT                   IFEGSKTFSKDFMQKHNIPTARYANFDDYEAAKAYLEKVDYQVVLKADGIAAGKGVLIP
FT                   TTQEEAQEALKIIMVERQFGDAGKSVVIEEFLEGDEISILTISDGYSYFNLPPAQDHKR
FT                   IGENDTGLNTGGMGAYAPAPVATPKLLEQIDKTIVKPSIDGMRKDKLPFVGVLFTGIIL
FT                   TKNGPKVLEYNVRFGDPETQTVLPLLTEDTDLAQVFLAAAEHRLDSVDIKIKDNCYATT
FT                   VVLAAGGYPESYKKGDEITVDSSKIPTDTYIFHAGTKSDNGKVYTNGGRVIASSAVAPT
FT                   LKEAVDKAYEGVESVQFSNRYFRKDIAHRAFKNSAASAGKSITYAEAGVSVDNGNLLVQ
FT                   KIKATVKSTSRPGTDSDIGGFGGLFDLKAAGYNTDETLLVAATDGVGTKLMIAQETDIH
FT                   NTVGIDLVAMNVNDLVVQGAEPLLFLDYFATGALDIKVASDFVSGVATGCIQAGCALVG
FT                   GETSEMPGMYPPGHYDTNGTAVGAVNKTQILPKVEEMGSGNVLLGLSSDGVHSNGLSLV
FT                   RKIIEHTGLPWEAECPWDASKTLGEAILVPTRIYVKQLLPSIKEQLLLGLAHITGGGLV
FT                   ENVPRALPKHLQAKINMNTWEVPEVFKWFGKAGNVPLEDILKTFNMGIGMVLIVKKENV
FT                   ERVTELLKQSGETVYEIGVLVERPSNEAGCIVQNASGLY"
FT   gene            complement(<92561..>93592)
FT                   /locus_tag="KLLA0_A00979g"
FT                   /old_locus_tag="KLLA-ORF11012"
FT   CDS_pept        complement(92561..93592)
FT                   /locus_tag="KLLA0_A00979g"
FT                   /old_locus_tag="KLLA-ORF11012"
FT                   /product="KLLA0A00979p"
FT                   /note="some similarities with uniprot|P38152 Saccharomyces
FT                   cerevisiae YBR291C CTP1 Mitochondrial inner membrane
FT                   citrate transporter, member of the mitochondrial carrier
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A00979g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02630"
FT                   /db_xref="GOA:Q6CYE7"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE7"
FT                   /protein_id="CAH02630.1"
FT                   /translation="MSDTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNA
FT                   EAFNMFHHVKSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAA
FT                   GSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQI
FT                   RPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVG
FT                   NSAVRFTTYTTLKQMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWS
FT                   LYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLMLSMQYERSL
FT                   GHD"
FT   gene            <94392..>95993
FT                   /locus_tag="KLLA0_A01001g"
FT                   /old_locus_tag="KLLA-ORF11010"
FT   CDS_pept        94392..95993
FT                   /locus_tag="KLLA0_A01001g"
FT                   /old_locus_tag="KLLA-ORF11010"
FT                   /product="KLLA0A01001p"
FT                   /note="highly similar to uniprot|P43616 Saccharomyces
FT                   cerevisiae YFR044C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01001g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02631"
FT                   /db_xref="GOA:Q6CYE6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE6"
FT                   /protein_id="CAH02631.1"
FT                   /translation="MLARVFPKRSSFAANHTIKTTVTVKTRRSSRFYSKLSIDNNNLRK
FT                   IKMSSSVAEKNFESLFQKIDELKPRFIERLAKAIEIPAVSGDETLRPQVIKKAHYLAGE
FT                   LKKLGFSDIQMKELGTQPPPVADPNLQLPPVILARYGNDPDKKTVLVYGHYDVQPASLE
FT                   DGWNTDPFKLVVNEEKQIMYGRGVSDDSGPVKGWLNVVEAHRELGLDLPVNLITCLEGM
FT                   EESGSIGLDKLIAEEAEGYFRTVDTVCISDNYWLGTQKPVLTYGLRGCNYYQIIIEGPG
FT                   ADLHSGIFGGSISEPMIDLVQVMSTLVDTKGNILIDGIKEMVAPVLETEDALYDKIDYS
FT                   VDEFNAASGSKTALYDNKKDILMHRWRYPSLSIHGVEGAFHGSGAKTVIPSKVIGKFSI
FT                   RTVPNIESAKLDQFVIDHCNKAFAKLQSPNKFKAELIHDGNYWVSDPFNASFSAAAKAT
FT                   KVVWGVEPDFTREGGSIPITLTFEQELKSNVLLLPMGRGDDGAHSINEKLDLSNYFGGM
FT                   KTMAAYLHYYAASEEK"
FT   gene            <96383..>98968
FT                   /locus_tag="KLLA0_A01023g"
FT                   /old_locus_tag="KLLA-ORF11009"
FT   CDS_pept        96383..98968
FT                   /locus_tag="KLLA0_A01023g"
FT                   /old_locus_tag="KLLA-ORF11009"
FT                   /product="KLLA0A01023p"
FT                   /note="similar to uniprot|P22224 Saccharomyces cerevisiae
FT                   YGL233W SEC15 Essential 113kDa subunit of the exocyst
FT                   complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
FT                   Exo84p) which mediates polarized targeting of vesicles to
FT                   active sites of exocytosis Sec15p associates with Sec4p and
FT                   vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01023g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02632"
FT                   /db_xref="GOA:Q6CYE5"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="InterPro:IPR042044"
FT                   /db_xref="InterPro:IPR042045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE5"
FT                   /protein_id="CAH02632.1"
FT                   /translation="MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDPQI
FT                   FDRWVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKV
FT                   QQIIDGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILEL
FT                   FNRCRELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESIN
FT                   LIKKSLNYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTS
FT                   KLDSLQLQNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTV
FT                   SHSNGKIDAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTS
FT                   IMNKLYPYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYC
FT                   ELLVFLFQKEFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNTTNDNFSATF
FT                   PFSPLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKL
FT                   DTTSREEIAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAET
FT                   KLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKML
FT                   LIFREFDVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPNDVSSVPTSP
FT                   SIPATPTDVPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKK
FT                   YSRVKPEVAQSLLSKLQPPSSEQSNLVSDEGSSAESRANSRFAKLFSRG"
FT   gene            <99292..>100221
FT                   /locus_tag="KLLA0_A01045g"
FT                   /old_locus_tag="KLLA-ORF11007"
FT   CDS_pept        99292..100221
FT                   /locus_tag="KLLA0_A01045g"
FT                   /old_locus_tag="KLLA-ORF11007"
FT                   /product="KLLA0A01045p"
FT                   /note="similar to uniprot|P53072 Saccharomyces cerevisiae
FT                   YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
FT                   protein required for the formation of the modified
FT                   nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
FT                   but not required for the same modification in 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01045g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02633"
FT                   /db_xref="GOA:Q6CYE4"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE4"
FT                   /protein_id="CAH02633.1"
FT                   /translation="MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAAS
FT                   EILSIFEEKVEEYYSDELNAMNSASPDGSGSIEIESKEPVTTESKKEISIEEELQQELE
FT                   GLKNHKTTIVDTKKNKPILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHDLRK
FT                   RTRFVQKLTPITDSCHASMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFSTMDKM
FT                   EMIKYIAGFVGKQGSLEHKVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKYNVQEL
FT                   FEMKHKNKETTPTTAESAPASTQSNTSK"
FT   gene            complement(<100259..>100867)
FT                   /locus_tag="KLLA0_A01067g"
FT                   /old_locus_tag="KLLA-ORF11006"
FT   CDS_pept        complement(100259..100867)
FT                   /locus_tag="KLLA0_A01067g"
FT                   /old_locus_tag="KLLA-ORF11006"
FT                   /product="KLLA0A01067p"
FT                   /note="similar to uniprot|P53073 Saccharomyces cerevisiae
FT                   YGL231C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01067g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02634"
FT                   /db_xref="GOA:Q6CYE3"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE3"
FT                   /protein_id="CAH02634.1"
FT                   /translation="MVKIYDFLKSEIGLIDKLQEGIMSEDIPQWAKDLKVDKVMRRNSV
FT                   NGGKLPDPFGIKKLEIEGQKPPKVIDHDAQNRIAKLTAERAWQISSEPLKSVPMNIIMS
FT                   YMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVIYQL
FT                   ILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEYLYRTLSI"
FT   gene            <102036..>102737
FT                   /locus_tag="KLLA0_A01089g"
FT                   /old_locus_tag="KLLA-ORF11004"
FT   CDS_pept        102036..102737
FT                   /locus_tag="KLLA0_A01089g"
FT                   /old_locus_tag="KLLA-ORF11004"
FT                   /product="KLLA0A01089p"
FT                   /note="weakly similar to uniprot|P43615 Saccharomyces
FT                   cerevisiae YFR043C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01089g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02635"
FT                   /db_xref="GOA:Q6CYE2"
FT                   /db_xref="InterPro:IPR034627"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYE2"
FT                   /protein_id="CAH02635.1"
FT                   /translation="MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKT
FT                   KYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLI
FT                   DERIEDFTAKFFIGCYFNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKVGSER
FT                   IKEIIDVHPWLSHPETLKKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAELFIE
FT                   KIIDELSDMIV"
FT   gene            complement(<102802..>103431)
FT                   /locus_tag="KLLA0_A01111g"
FT                   /old_locus_tag="KLLA-ORF11003"
FT   CDS_pept        complement(102802..103431)
FT                   /locus_tag="KLLA0_A01111g"
FT                   /old_locus_tag="KLLA-ORF11003"
FT                   /product="KLLA0A01111p"
FT                   /note="similar to uniprot|P43614 Saccharomyces cerevisiae
FT                   YFR042W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01111g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02636"
FT                   /db_xref="GOA:Q6CYE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE1"
FT                   /protein_id="CAH02636.1"
FT                   /translation="MNATRRQQPRRLVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRK
FT                   YLPGGIHRFLCCLMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDF
FT                   EHSPLLKNTSYSSFIVGLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPLLYL
FT                   SEFYLLLLNTEIDNYHNGPKTVLFNKFVLVVFIPLCLHLYKGFLYK"
FT   gene            <103746..>104579
FT                   /locus_tag="KLLA0_A01133g"
FT                   /old_locus_tag="KLLA-ORF11002"
FT   CDS_pept        103746..104579
FT                   /locus_tag="KLLA0_A01133g"
FT                   /old_locus_tag="KLLA-ORF11002"
FT                   /product="KLLA0A01133p"
FT                   /note="similar to uniprot|P43613 Saccharomyces cerevisiae
FT                   YFR041C ERJ5 Endoplasmic reticulum protein that may
FT                   function as a cochaperone as suggested by the presence of a
FT                   DnaJ-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01133g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02637"
FT                   /db_xref="GOA:Q6CYE0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYE0"
FT                   /protein_id="CAH02637.1"
FT                   /translation="MLSSSRPVTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGSN
FT                   MDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEGHR
FT                   KTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNANKKR
FT                   IENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLLVRFGEVFVIQPDESLAKISTDDI
FT                   IDPGINDTLLVKLPKWIWNKTLGKFINIGTSKSQQPNKGSPNKNKRNSKINSKAQ"
FT   gene            complement(<104687..>107668)
FT                   /locus_tag="KLLA0_A01155g"
FT                   /old_locus_tag="KLLA-ORF11001"
FT   CDS_pept        complement(104687..107668)
FT                   /locus_tag="KLLA0_A01155g"
FT                   /old_locus_tag="KLLA-ORF11001"
FT                   /product="KLLA0A01155p"
FT                   /note="similar to uniprot|P43612 Saccharomyces cerevisiae
FT                   YFR040W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01155g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02638"
FT                   /db_xref="GOA:Q6CYD9"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD9"
FT                   /protein_id="CAH02638.1"
FT                   /translation="MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNSS
FT                   TVGTLGATAGAAAPVAVTDDNDLNETKTTTTTYNNDTKRINDNHEKKENAKKKKRQGFA
FT                   MGFEDRDKDSDVIIGDSNDSDRLEHNVDSHTTDFIDSSKNTIDTSPGSSQHNPRPSLIP
FT                   TPRRFNGTSDIESTPLKSAASSHPDSLSTTTTSSSSASHLSDEEGPIPLQALSHKFMDE
FT                   ILEETELLNELTRQNNTLLDFVCFGYFYTETGDKVENIAYLIDRLLDCIDKIDDDNDSA
FT                   NLDTVGGNDNVNELDDDDNINEEHRIENRDGSINDEGNNNAVQNIRESATIGSNDSGRG
FT                   ETHNQGDDNEDEDIDTFGNSKGSFENPHEFTSSPHDDSIIPMLDSKLKKKSTFLNKANI
FT                   ISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNLLLTRQD
FT                   QYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLIDHLFA
FT                   FLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLLGCII
FT                   NERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFSENL
FT                   VNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSKKAE
FT                   RIVKERDQVRTELVQQLEDALTDLNIKSKLTADNHNSDSPTELSLDDDIDESFEVPYVN
FT                   DNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRM
FT                   DFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDLVLLGYRNSHKFYEKHNTTL
FT                   GFMGHLVLIAEEIVKFSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGG
FT                   GDYIEDGNLNGGDIVMGNDQDPTSFSTQMDLHDKLREKLIEKSRQEVDEKNEKNGVIIL
FT                   PAGP"
FT   gene            <108738..>110648
FT                   /locus_tag="KLLA0_A01177g"
FT                   /old_locus_tag="KLLA-ORF10998"
FT   CDS_pept        108738..110648
FT                   /locus_tag="KLLA0_A01177g"
FT                   /old_locus_tag="KLLA-ORF10998"
FT                   /product="KLLA0A01177p"
FT                   /note="weakly similar to uniprot|P53075 Saccharomyces
FT                   cerevisiae YGL228W SHE10 Putative
FT                   glycosylphosphatidylinositol (GPI)-anchored protein of
FT                   unknown function overexpression causes growth arrest"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01177g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02639"
FT                   /db_xref="GOA:Q6CYD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYD8"
FT                   /protein_id="CAH02639.1"
FT                   /translation="MRLVSKLLKALLVLLLAFGSVRYSCDNYTSGELQICKYTAPQHYR
FT                   AIIGGRFPQVIKYSDSLVAKYETVVVPRVGSAVIHVKDTVEQKVVPSVIRTSRSSLSLV
FT                   YTKVYPRVVKYAFIAESSLCRWYLQLCHQYTVYVKPVVINLYYKTMIKYPFLEHAIYSV
FT                   QAQYKIMETHVFKYYNIISYNVQVWNDKYGYGRLSRNKIFIRMKSTVVEHLIIWYRYVN
FT                   NRCRKMWRENLCPIINKSRERFAYHGGVRPESATTDPDDESIFYEDDDVDEYTETSTIV
FT                   LTVTQTANSALDLKATPSASGLIVDECDMSMEEMLRNDFMSWKITIENKLSNTMKDFEN
FT                   DINEFAQEKLDHIQPTLADLLKRASNTSQTNFQIITKAIMDVNCTESVDPKTNKTIWFD
FT                   QNNTQLPKYMTRELMREYFSAAHSQFDALSQEIRAHLRKLADEVNDHVEVLRQENVELF
FT                   EEWADVMITEWSKNLAYVDVAVNEEKLADLEKEQRKNWKDFMKLKRQVIKTRDTLMEHP
FT                   VKLDSLQSFVNTVQQSLKTLSHENGEYLYILRSKANLEFQAREALERQQREKEKAESAS
FT                   MKASTEFELSSSSFSSSSPSTASSCTASSTSTASLLAVEKTIALEDLQSYYQNVSSTDS
FT                   L"
FT   gene            <111159..>112508
FT                   /locus_tag="KLLA0_A01199g"
FT                   /old_locus_tag="KLLA-ORF10997"
FT   CDS_pept        111159..112508
FT                   /locus_tag="KLLA0_A01199g"
FT                   /old_locus_tag="KLLA-ORF10997"
FT                   /product="KLLA0A01199p"
FT                   /note="highly similar to uniprot|P39954 Saccharomyces
FT                   cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine hydrolase
FT                   catabolizes S-adenosyl-L-homocysteine which is formed after
FT                   donation of the activated methyl group of S-
FT                   adenosyl-L-methionine (AdoMet) to an acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01199g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02640"
FT                   /db_xref="GOA:Q6CYD7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD7"
FT                   /protein_id="CAH02640.1"
FT                   /translation="MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQP
FT                   LKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWK
FT                   GETEEEYLWCIEQQLFAFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEETTTG
FT                   VHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVA
FT                   GYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGC
FT                   RDIITKEHFLQMPEDAIVCNIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVI
FT                   LLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIG
FT                   VHVLPKILDEAVAKFHLDNLGVKLTKLSDVQSEYLGIPEEGPYKADHYRY"
FT   gene            <113308..>115926
FT                   /locus_tag="KLLA0_A01221g"
FT                   /old_locus_tag="KLLA-ORF10993"
FT   CDS_pept        113308..115926
FT                   /locus_tag="KLLA0_A01221g"
FT                   /old_locus_tag="KLLA-ORF10993"
FT                   /product="KLLA0A01221p"
FT                   /note="weakly similar to uniprot|P53076 Saccharomyces
FT                   cerevisiae YGL227W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01221g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02641"
FT                   /db_xref="GOA:Q6CYD6"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD6"
FT                   /protein_id="CAH02641.1"
FT                   /translation="MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKL
FT                   KTKDELLSADADCSGSVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYL
FT                   IQVHKYFYARDDISNTTDGDGDVDMRKSVMTEEDFLGSMLPDSEADEEDDEIDDDNDLE
FT                   DDDDDEDGNDPEDDDDDELDDEDEDENDEQDSPDHPRRLNESTVQIEQSRGSTTGFENP
FT                   IGTSDAENIENAEVDRSKHKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYPLPHKW
FT                   LLQSDNSILLSQDGCAVLRVNPNWHALSSYGRASPIMNSRLRVNINSKKKQQWATTWAN
FT                   NGVNHTKCAIFYFEIRVLSVTSSQAGRNSHVLVGFKNWAKINDKLSTSEQDTTESGSAP
FT                   SSENFNMLRNVLDGNRNVLNSPSSPSQTIHGDVETYSYSGLDGNKFDASGSQKYSRPFG
FT                   NDDIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDLVPFVSIKSGNSLRTNFGLTEEF
FT                   LFDIDQYQLQWKYKTYSHIFKAVDYDSGLNLVSDESDNEDLGKLGDEINDTLEPEFQEV
FT                   ASEENDLATDGFEDDQPDGFLLTRDRRFSGDKLWKPTTPKLNNINSNNDSIPCQLNSMI
FT                   NDYLIHEGYIDVAKGFLKDLQRDCIPNNSDERARFVIRHNERQIVKEEQNLQVRQTIRR
FT                   YIHDGEILKCMNYIEQQFPGLLEKYLELTFEMKCADYLLCLSQQSPENDMIDSILSKGQ
FT                   DISEQFLQNRAISDDTREIFKAKFDEISPLMAYSNPSKECANDCSFFLTPAYLQERLFQ
FT                   TINSHILQYLDKKSQSSLESMIGYTRAMVTTLMENESYNPREKEPAYHKLVNIDEDLLK
FT                   L"
FT   gene            complement(<115966..>116340)
FT                   /locus_tag="KLLA0_A01287g"
FT                   /old_locus_tag="Klla0A.mRNA.1078.m"
FT   CDS_pept        complement(join(115966..116235,116320..116340))
FT                   /locus_tag="KLLA0_A01287g"
FT                   /old_locus_tag="Klla0A.mRNA.1078.m"
FT                   /product="KLLA0A01287p"
FT                   /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
FT                   YGL226C-A OST5 Zeta subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen, which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01287g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02642"
FT                   /db_xref="GOA:Q6CYD5"
FT                   /db_xref="InterPro:IPR007915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD5"
FT                   /protein_id="CAH02642.2"
FT                   /translation="MSYETLFKLHKSSAQFQSLVPLEKQPYFAAISLLLAIAFISPLLL
FT                   SSALPEEYEEKNKVKPFSVYELLKVIMLGGIGSLFFGISIVFLTNSFGVYV"
FT   gene            <116612..>117037
FT                   /locus_tag="KLLA0_A01297g"
FT                   /old_locus_tag="KLLA-ORF10990"
FT   CDS_pept        116612..117037
FT                   /locus_tag="KLLA0_A01297g"
FT                   /old_locus_tag="KLLA-ORF10990"
FT                   /product="KLLA0A01297p"
FT                   /note="similar to uniprot|P53077 Saccharomyces cerevisiae
FT                   YGL226W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01297g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02643"
FT                   /db_xref="GOA:Q6CYD4"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="InterPro:IPR036639"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD4"
FT                   /protein_id="CAH02643.1"
FT                   /translation="MFSNSLRLSGRVLAHGRRFNSGCCEVYSPPDMSKLVQGGWLHMNR
FT                   DTREEINEYLDWRMEEPWKNLDLNDKRCAYYIAYGEWGPRAKKGSKEDQIEMNGPELIL
FT                   KAMFSLTLFLALGFAFPNYKKDKTLQENLDKLRKSAE"
FT   gene            complement(<117215..>117769)
FT                   /locus_tag="KLLA0_A01309g"
FT                   /old_locus_tag="KLLA-ORF10989"
FT   CDS_pept        complement(117215..117769)
FT                   /locus_tag="KLLA0_A01309g"
FT                   /old_locus_tag="KLLA-ORF10989"
FT                   /product="KLLA0A01309p"
FT                   /note="highly similar to uniprot|P40029 Saccharomyces
FT                   cerevisiae YER042W MXR1 Peptide methionine sulfoxide
FT                   reductase reverses the oxidation of methionine residues
FT                   involved in oxidative damage repair providing resistance to
FT                   oxidative stress and regulation of lifespan"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01309g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02644"
FT                   /db_xref="GOA:Q6CYD3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD3"
FT                   /protein_id="CAH02644.1"
FT                   /translation="MATGISKTLKYNAQTDKLITFAAGCFWGTQHIFLKHFGDKIIDGK
FT                   VGYSNGSESLKDKPDTVSYERVKKGDTGFAEVYQISYNPKLVSLKELVDFFFRIHDPTT
FT                   VNAQGPDQGSQYRSAIFAHSEADLNELKKLKEQWQPKWNNKIVTDISLIDNFYDAEEYH
FT                   QLYLDKNPAGYACPTHYIRDL"
FT   gene            complement(<118369..>120123)
FT                   /locus_tag="KLLA0_A01320g"
FT                   /old_locus_tag="KLLA-ORF10987"
FT   CDS_pept        complement(118369..120123)
FT                   /locus_tag="KLLA0_A01320g"
FT                   /old_locus_tag="KLLA-ORF10987"
FT                   /product="KLLA0A01320p"
FT                   /note="weakly similar to uniprot|P40028 Saccharomyces
FT                   cerevisiae YER041W YEN1 Protein of unknown function has
FT                   similarity to endonuclease Rth1p potentially phosphorylated
FT                   by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02645"
FT                   /db_xref="GOA:Q6CYD2"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR037316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD2"
FT                   /protein_id="CAH02645.1"
FT                   /translation="MGSSELWNQISQYNVPRVAFKQFVAEFVEKNGRFPRIAIDGYLWL
FT                   FECGYFDEPQNKSKTLLNWLRKLKEMLHLQCFIVIIFDGTFKLDGKRRKKRKVATLWDS
FT                   YWLMRSMNRFNHDSVSYVDDYIIECCKLFNIQTINAPGEGEAQCAFLQLVGQVDFVLSN
FT                   DADVLSFGASKVLKNYSKHGWQDLPNSSNSPVKSKQNERFVTFVDLDIIKDWDRDRFVL
FT                   FNLLVGSDYNGGVKGLGGKRAAILSKSREPDISKKLPAVLADAKFEEKAKIQHKWEEFG
FT                   EDILRTIKKNGKTLFGMNLKSMNSLSRFKDWPDVTVGLFYRDPIVQNFDLSSKPTHADV
FT                   KFEEVEAFMKLNGIPRFLMNFDKWFHEFLHQCFIVSYIWKHPDPFNGNYRLTEYHEVSL
FT                   CDGMHQYKEVCVRFKSFLFTEIQKEVEGTPKLQNAELPSRARFAKIDSANSPRKSPAKS
FT                   TILRQKYPYYMWIPTGVIPKSLLIHLDKEIAAAKTSQALRLSSKKSSPKKTRGRSLSPQ
FT                   KNTLDRFLNKRQRTEGPMRDLISALLQEQTNESGIEQKEDREIINPNKAGIKILNIDLI
FT                   DTESEEDL"
FT   gene            complement(<120385..>122730)
FT                   /locus_tag="KLLA0_A01342g"
FT                   /old_locus_tag="KLLA-ORF10984"
FT   CDS_pept        complement(120385..122730)
FT                   /locus_tag="KLLA0_A01342g"
FT                   /old_locus_tag="KLLA-ORF10984"
FT                   /product="KLLA0A01342p"
FT                   /note="some similarities with uniprot|P18494 Saccharomyces
FT                   cerevisiae YER040W GLN3 Transcriptional activator of genes
FT                   regulated by nitrogen catabolite repression (NCR)
FT                   localization and activity regulated by quality of nitrogen
FT                   source"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02646"
FT                   /db_xref="GOA:Q6CYD1"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYD1"
FT                   /protein_id="CAH02646.1"
FT                   /translation="MSDRGLHDPFELFASTDSGVSHEPSWNHTQFDAMLEILPENLNLD
FT                   VGGLQQDTSSPVATTLKFESNTTTTTITNASMKDDGSPDVIGEEDDEGGWKTPVAEISS
FT                   HNGLKSRPIDIVQSVTPSTTAGQLIGNDLNLQNGEIAQLWDFNVHEFMMTPSDHSDSAT
FT                   ISAPSSFNSEQFTPGTTTPGFNPASSTASITNNNYNNGNNNGNNNNNNNTNSNSHFQNS
FT                   WNHLLHQQHDNGPNSSSLAYQHPRLFQNNNSSQSTIKADEYQHKQPQLPRRSSSRNLLI
FT                   KNDMNEDGALPLLTHTTTNLVKKNSSVKNLPTTTLPQYRRCSSSTNMQVMNGPPVNNGA
FT                   KANKPPTQCYNCKTLKTPLWRRDPDGNTLCNACGLFQKLHGTMRPLSLKSDIIKKRNTK
FT                   KRTKKDDKPASNMELQGQNDHSTNRGSQSPEKFQRKLSAKHTSIQPAANIYNQSALSQN
FT                   SLNNLNKKTATKSRRSSTSSSTSSKSSSSRSVVPILPKPSPGSRENTLQQFQYQIQMQV
FT                   SQPNSAASSPRYSNSPRFYPTSPSTGLGVSIPRRKSSRTQISQSSSFMAQSLQQLQHQQ
FT                   HNSSSNHTSAGISTNGSNSQASTATSQNANNLSSSTNSSSNATISAPNSWANHSLSQPQ
FT                   NIASPNSSRSPFELFSNPNSQPKKSHKSLLSQQLQNSSNSSSSSSSFVENASSGQQLSQ
FT                   TPPSHHSQTQQNFGSSVPAASPRSSYVDTLQQQRGILQYEQQQVARRKTPSTRQSNPSL
FT                   FESSGSSLSKPKKENNVMDDLDWLKFGM"
FT   gene            <124161..>125153
FT                   /locus_tag="KLLA0_A01364g"
FT                   /old_locus_tag="KLLA-ORF10979"
FT   CDS_pept        124161..125153
FT                   /locus_tag="KLLA0_A01364g"
FT                   /old_locus_tag="KLLA-ORF10979"
FT                   /product="KLLA0A01364p"
FT                   /note="similar to uniprot|P40107 Saccharomyces cerevisiae
FT                   YGL225W VRG4 May regulate Golgi function and glycosylation
FT                   in Golgi Golgi GDP-mannose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02647"
FT                   /db_xref="GOA:Q6CYD0"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="InterPro:IPR038736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYD0"
FT                   /protein_id="CAH02647.1"
FT                   /translation="MSQLKVDNGPLSHVANSGPISIGAYCFSSIMMTVTNKFVVNLKGF
FT                   NMNFVMLFVQAAVCVNLLFFLRLLGYAKFRPLNRTDAKNWFPITIFLVLMIYTSSKSLQ
FT                   YLAVPIYTIFKNLTIILIAYGEVLFFGGSVTAMELSSFLLMVLSSVVATLGDQQALKKT
FT                   ADAGASLFNIGYMWMFINCLSSAAFVLVMRKRIKLTNFKDFDTMFYNNILSMPVLLALS
FT                   FLMEDWSTENLTKNLSRDSVTAMIISGMTAVCISYCSGWCVRVTSSTTYSMVGALNKLP
FT                   IALSGLIFFDAPKNFLSIFSIFLGFLSGIVYAVAKQKKQQNPQPSAPIK"
FT   gene            <125585..>126721
FT                   /locus_tag="KLLA0_A01386g"
FT                   /old_locus_tag="KLLA-ORF10977"
FT   CDS_pept        125585..126721
FT                   /locus_tag="KLLA0_A01386g"
FT                   /old_locus_tag="KLLA-ORF10977"
FT                   /product="KLLA0A01386p"
FT                   /note="weakly similar to uniprot|P40026 Saccharomyces
FT                   cerevisiae YER038C KRE29 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02648"
FT                   /db_xref="InterPro:IPR014803"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC9"
FT                   /protein_id="CAH02648.1"
FT                   /translation="MLSNDEDEVVASSDDGLYAKIWDIRDEELDDNGKNSDHFSDPGES
FT                   FLLSSDDAMLPTDRVLNNIMSSNAHIGTKRRRSTDREKLWEEWHKSLKSSMEINNMTME
FT                   LKSFTDKRPDVQASQRKNSPHYDRQKQIAYSIKRNIPTSLLTELAADVSDSTVDWYFLR
FT                   EDPDFSVVPSRYSTFLGKRLSIPLDDLYKKFGADLRANIEYTNCPYGKLIPVETMCGLI
FT                   ESNNSDSVQAFKHFIKFILDRKISGNLKTKWVINMWNRFTCDKLSVYFEVTPRNFYLMH
FT                   YRLTRLIPIESEIVSKLFPNDNDVITEFENLLDSQEWTSLLYFIILVLGTSALPFGPSP
FT                   RMTYIKDCILDLNSQNSSKIQLSIIKAYLTVCSKITQR"
FT   gene            complement(<126900..>127760)
FT                   /locus_tag="KLLA0_A01408g"
FT                   /old_locus_tag="KLLA-ORF10976"
FT   CDS_pept        complement(126900..127760)
FT                   /locus_tag="KLLA0_A01408g"
FT                   /old_locus_tag="KLLA-ORF10976"
FT                   /product="KLLA0A01408p"
FT                   /note="similar to uniprot|P53078 Saccharomyces cerevisiae
FT                   YGL224C SDT1 Pyrimidine nucleotidase overexpression
FT                   suppresses the 6-AU sensitivity of transcription elongation
FT                   factor S-II as well as resistance to other pyrimidine
FT                   derivatives and to uniprot|P40025 Saccharomyces cerevisiae
FT                   YER037W PHM8"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02649"
FT                   /db_xref="GOA:Q6CYC8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC8"
FT                   /protein_id="CAH02649.1"
FT                   /translation="MQRRLDRVFRMTYSTLSEYTLQTKDKLRINRQHLESLTYPGSKVT
FT                   FDPDQPIPKPDPNLKVFFFDIDNCLYKKSLRIHDLMEQSIHQYFQMKFNLDNETARELR
FT                   ENYYRTYGLAIKGLVDHHEIDAVEYNELVDDSLPLQDILKPDPEQRKILQRIRESGCFD
FT                   KMWLFTNAYKNHGLRCVRLLGIADLFDGITYCDYSQSDLVCKPDVRAFEKAKLQSGLGE
FT                   YSNAYFIDDSGSNIRTSIKLGLRKSIHLVEAGFDDFFSTSPSEATIIKAITDLPKACPE
FT                   IFAKE"
FT   gene            complement(<128139..>129287)
FT                   /locus_tag="KLLA0_A01430g"
FT                   /old_locus_tag="KLLA-ORF10974"
FT   CDS_pept        complement(128139..129287)
FT                   /locus_tag="KLLA0_A01430g"
FT                   /old_locus_tag="KLLA-ORF10974"
FT                   /product="KLLA0A01430p"
FT                   /note="weakly similar to uniprot|P53079 Saccharomyces
FT                   cerevisiae YGL223C COG1 Essential component of the
FT                   conserved oligomeric Golgi complex (Cog1p through Cog8p) a
FT                   cytosolic tethering complex that functions in protein
FT                   trafficking to mediate fusion of transport vesicles to
FT                   Golgi compartments"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02650"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC7"
FT                   /protein_id="CAH02650.1"
FT                   /translation="MSASLFREKSVAEVRDISVQLSRDVVKLREEFGKALKSNYQAVVD
FT                   TNEQIHSLYENIQDLDSDLLQLCFGDEDLLPRMNDTELPSMKVAKRRGSDGTYGRESSF
FT                   SSSVQKQHLEESYDFNIDEVQNTLKVSSWVVALTKFKRDPSVSDSLDKLLSSFSDLPIT
FT                   GNVLDYCEKLGEWVITEKPSLTLDQYLSLLSLTEESKYQFDSRVHTWLFDQIVQHPDIL
FT                   SGSVSPKVAQFMKTESFREAMSNRLISQYEAELKNWNAHKDDEIKEPELIDPYDTDKKT
FT                   STLVKDITMYELGLTDSRRILLHDCKEKVSELLVHLKSFTSETQYRQITDKLSQMLEKE
FT                   RIRILEDNNGDKPSYSASNMNTLVDALLLERNNSHYVTYLSM"
FT   gene            <130078..>131901
FT                   /locus_tag="KLLA0_A01452g"
FT                   /old_locus_tag="KLLA-ORF10973"
FT   CDS_pept        130078..131901
FT                   /locus_tag="KLLA0_A01452g"
FT                   /old_locus_tag="KLLA-ORF10973"
FT                   /product="KLLA0A01452p"
FT                   /note="highly similar to uniprot|P40024 Saccharomyces
FT                   cerevisiae YER036C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02651"
FT                   /db_xref="GOA:Q6CYC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC6"
FT                   /protein_id="CAH02651.1"
FT                   /translation="MAPVSASKAKRDAKKAERDAKRVAAGKTTRRSKKEDETVDEAAAA
FT                   ADKIAQLKLQQDKDGISDRVVTGVLDSLETSRDIKLSSVSLLFHGKVLIQDSQLELNYG
FT                   RRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGEL
FT                   KRLEDLVEKILLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTK
FT                   DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHSQD
FT                   FLNGVCTNMLDMRLQKLMAYGGNYDSYVKTRSELETNQMKQYTKQQEEIAHIKKFIASA
FT                   GTYANLVKQAKSRQKILDKMEADGLIQPVAADKVFSFRFPEVERLPPPVLAFDDISFSY
FT                   DGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLG
FT                   VYSQHSQDQLDLTKSALEFVRDKYPHVSQDFQYWRGQLGRYGLTGEGQTVQMGTLSEGQ
FT                   RSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIA
FT                   KDIFVVEHKTATRWDGSILDYKNKLAKNVVL"
FT   gene            complement(<132423..>133565)
FT                   /locus_tag="KLLA0_A01474g"
FT                   /old_locus_tag="KLLA-ORF10971"
FT   CDS_pept        complement(132423..133565)
FT                   /locus_tag="KLLA0_A01474g"
FT                   /old_locus_tag="KLLA-ORF10971"
FT                   /product="KLLA0A01474p"
FT                   /note="some similarities with uniprot|P53080 Saccharomyces
FT                   cerevisiae YGL222C EDC1 RNA-binding protein activates mRNA
FT                   decapping directly by binding to the mRNA substrate and
FT                   enhancing the activity of the decapping proteins Dcp1p and
FT                   Dcp2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02652"
FT                   /db_xref="PDB:6AM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC5"
FT                   /protein_id="CAH02652.1"
FT                   /translation="MMSTDTMYFNSSRSMPSHRGRHQKQTRLQKPDRRMENQIKLRKQQ
FT                   SAEPPVVSNQDHETAMSQFAYSGYGNQGTSLTTASSEAMDTMGFVSDDLKQLLSMTDSN
FT                   KKENSSPQLNHNQQQQQPLPVSNSPRLSPSGTYQQSPLPPNQGLYGPMMVPPPFLMSNV
FT                   PKLGPHPYAGIANGPGMLPMYVPMNAGRPINQPPAYPQAMYNATHQQGIAFPPQQLFQH
FT                   QQLHSSQPQPQQVQQVQQQKLQSPAPNNAQITKSSVEPQTVVGNTEQTKQPASDNKQIS
FT                   KSPKEESRQQRSENSSSHSKTKSSKKRNARKNDSIPPQQVPVSFSSPSAPSSRSSKSSN
FT                   KKSNHMRSESRSDDHSKCYAGATFATEAPQVTTLPKPSFV"
FT   gene            complement(<134214..>134804)
FT                   /locus_tag="KLLA0_A01496g"
FT                   /old_locus_tag="KLLA-ORF10969"
FT   CDS_pept        complement(134214..134804)
FT                   /locus_tag="KLLA0_A01496g"
FT                   /old_locus_tag="KLLA-ORF10969"
FT                   /product="KLLA0A01496p"
FT                   /note="some similarities with uniprot|P40022 Saccharomyces
FT                   cerevisiae YER034W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02653"
FT                   /db_xref="InterPro:IPR035303"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC4"
FT                   /protein_id="CAH02653.1"
FT                   /translation="MDAFSLKKDNRKKFQDKEKLKRKHATPSDRKYRSLNKKAEAEAQA
FT                   AEEEKQSMTLESNEHRYTSELLEEPDTGSGDEQIADVTAKIKEILLTKGDEQPFLKSAT
FT                   PQDTTRRFTKKQLENMSVSELNELLLNRTVNANELPSKSKIAPLLGSKSFESSYGGSSS
FT                   DDKNPVTTTHNNLPLSHIPTPLKEDESFLDSII"
FT   gene            complement(<135063..>135920)
FT                   /locus_tag="KLLA0_A01518g"
FT                   /old_locus_tag="KLLA-ORF10967"
FT   CDS_pept        complement(135063..135920)
FT                   /locus_tag="KLLA0_A01518g"
FT                   /old_locus_tag="KLLA-ORF10967"
FT                   /product="KLLA0A01518p"
FT                   /note="similar to uniprot|P53081 Saccharomyces cerevisiae
FT                   YGL221C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02654"
FT                   /db_xref="GOA:Q6CYC3"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC3"
FT                   /protein_id="CAH02654.1"
FT                   /translation="MSRALSRAQLKSVIKKISQLYPESYADSAWDNTGLLIDCSVDTEQ
FT                   SHAKTQPKVLLTIDLTESVAKEALAKECNLIVAYHPFIFPSWKKLTPHSNPQHASAIKL
FT                   IQRGISVYSPHTAIDAAKNGVNDWLVSSLGGSVSSSVSIERVTPVQDEEEHEVGYGRVV
FT                   DLNEPLSLKDIVNNVKDTLDLSFVQVATKNELSDHKIKKVALCAGSGSGVFKSLREDVD
FT                   LYYTGELSHHEVLRYKESGKAVIVCNHSNTERGFLRKVMHPSLTKSGIDCIVSETDIDP
FT                   LQVI"
FT   gene            <136238..>136495
FT                   /locus_tag="KLLA0_A01551g"
FT                   /old_locus_tag="KLLA-ORF10966"
FT   CDS_pept        136238..136495
FT                   /locus_tag="KLLA0_A01551g"
FT                   /old_locus_tag="KLLA-ORF10966"
FT                   /product="KLLA0A01551p"
FT                   /note="similar to uniprot|P53082 Saccharomyces cerevisiae
FT                   YGL220W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01551g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02655"
FT                   /db_xref="GOA:Q6CYC2"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYC2"
FT                   /protein_id="CAH02655.1"
FT                   /translation="MLTQDDLKAKLEKEIPNFYHALITDTSNGCGQSFDVVVVSDVFVG
FT                   KNKLSRCRIVNKALAEEVAQIHAFGCKCYTTNEWNEILGN"
FT   gene            complement(<136823..>138445)
FT                   /locus_tag="KLLA0_A01573g"
FT                   /old_locus_tag="KLLA-ORF10965"
FT   CDS_pept        complement(136823..138445)
FT                   /locus_tag="KLLA0_A01573g"
FT                   /old_locus_tag="KLLA-ORF10965"
FT                   /product="KLLA0A01573p"
FT                   /note="similar to uniprot|P53083 Saccharomyces cerevisiae
FT                   YGL219C MDM34 Mitochondrial outer membrane protein
FT                   colocalizes with mtDNA nucleids required for mitochondria
FT                   shape"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01573g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02656"
FT                   /db_xref="GOA:Q6CYC1"
FT                   /db_xref="InterPro:IPR027536"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYC1"
FT                   /protein_id="CAH02656.1"
FT                   /translation="MSFKFNSGTFEDNTFNEQIRDRLTRALNPSRFENPESTSGQDGSD
FT                   SQKKPKKLDILKSGVTVRQVDFRTIPQLEILDLDVSAQSKSLLKGICKISCKDAMIQIT
FT                   TEIEANLLLLYEAVSPEFTTPKLISNDSFTVPITMTFDHIELEAITNIFVKNTGVGISF
FT                   NDVNLDFRFECSMKLLQTSIEKRLKNSMETIFKDVLPSVIFNMSQRWFTHGPELVEDPS
FT                   LIATDSALSEVTPMTILDDSDLQDLSPATMLRLSTLISSRQSLALNPISSHTVATIPGC
FT                   IERQNLRRFSSRIPSLNNYYAQEVGKHRPSKILPTRENSNSIIANKMASDFIQNSLPTE
FT                   VLESGSYNIREIANIQQRIYERNNEENVIRRRRIRLGKRSKSVQDTAAKMHPVPESGSL
FT                   HPIIQPSTTPAATVTPLLSPQPVVAKSPPESMTPNTLPEQSPYTSNIAIDKIPDLTLPQ
FT                   AQLQKDKVPMRLNLLEESYFKSDLKDLRNSLYSPMRNQRFYVQSEDGARPSLLDGKRFS
FT                   FVGLANQQMKWGNDDLPPPYKAN"
FT   gene            <139355..>141664
FT                   /locus_tag="KLLA0_A01606g"
FT                   /old_locus_tag="KLLA-ORF10963"
FT   CDS_pept        139355..141664
FT                   /locus_tag="KLLA0_A01606g"
FT                   /old_locus_tag="KLLA-ORF10963"
FT                   /product="KLLA0A01606p"
FT                   /note="similar to uniprot|P53086 Saccharomyces cerevisiae
FT                   YGL216W KIP3 Kinesin-related motor protein involved in
FT                   mitotic spindle positioning"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02658"
FT                   /db_xref="GOA:Q6CYB9"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB9"
FT                   /protein_id="CAH02658.1"
FT                   /translation="MHNIVPETRQSSILVAVRVRPFTDEESTRLVHEENGNMVYLKDTV
FT                   LNIPLSAPSLGIDDKSTLLRTQSKFRPIGIRKIIDCVDDKMLIFDPSKSNPLNELNENL
FT                   VHSSSNENRRRLRRFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYG
FT                   ATGCGKTFTISGTSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD
FT                   PNISSKKLVIREDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRS
FT                   HAVLQIHVAQMNRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLA
FT                   LGNCINALCVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETL
FT                   NTLKYANRAKEIKTKVIRNKQSLDRHVGSYLKLITEQKSEIEELRSREQKMIEIQLSQF
FT                   RNGREKVNMLIKESVREMRIHLSDSEKIQDAKLIKSLMLVKRHYLKLVHFELSNVLQYL
FT                   NNLNDERAVFLTDNIHIIQEQILLKMNELEVQFDDPNDIDRTLEYMKTIQLKKMRDCEY
FT                   WQEAIDFEQYEILISGLSESVRNEILVNGTRLMEKVIEDPILRSHFQIISKSIVDENEN
FT                   TDGSNTTMVGTIERELNKLNKLDQEFDQFAQQLNVSTQRKRSSPMQKQQPTWRQKLMKQ
FT                   GMMGEGSPDVTPSKVMKSLSFAEGPPTIWNEPQDVSMMLDDPDPLPIERKLNTTVNKIS
FT                   TPNPKPKLSLTATQLK"
FT   gene            <143922..>145160
FT                   /locus_tag="KLLA0_A01628g"
FT                   /old_locus_tag="KLLA-ORF10961"
FT   CDS_pept        143922..145160
FT                   /locus_tag="KLLA0_A01628g"
FT                   /old_locus_tag="KLLA-ORF10961"
FT                   /product="KLLA0A01628p"
FT                   /note="weakly similar to uniprot|P35190 Saccharomyces
FT                   cerevisiae YGL215W CLG1 cyclin-like protein that interacts
FT                   with Pho85p in affinity chromatography cyclin-like protein
FT                   that interacts with Pho85"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02659"
FT                   /db_xref="GOA:Q6CYB8"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB8"
FT                   /protein_id="CAH02659.1"
FT                   /translation="MASFMYYPNYPAMSVQSNSMATPYHHRSGSMNPSMVSSINGYGCP
FT                   AVNPTTITPHQIDGMFQPGHGQSNSFYFPPPGLSYMQPPAAPVVGHVPGLVQNHGHPVM
FT                   PGHSMMMNQPQVMVPPANNQVIPEKEQNVNGGVCEVLDYELNTMSDFVTKNSCLSFGSF
FT                   DVPADVMELFSSSVSSVLGSTRLPSVTIFLALDYLIKYLDLIDCDFQSIGGKSVDIIYQ
FT                   NLVVALVLANKFNDDKTFTNKSWSQATGMDLLTINQYEKSWLKAFEWRLFEDKFDTYES
FT                   FQESYNAFVREQRLSAYQQQQQQQQHQLSPSSVPTHQRQYSSASSMAYGYQTPNCGHSS
FT                   MAYSSPVYSDLRSYSYNNGYQKQFNCSPPSQYSPRPKNYDNVNYYEQPQQPFWNDHHQQ
FT                   QQVNQNYYCFSAY"
FT   gene            complement(<146030..>147235)
FT                   /locus_tag="KLLA0_A01650g"
FT                   /old_locus_tag="KLLA-ORF10958"
FT   CDS_pept        complement(146030..147235)
FT                   /locus_tag="KLLA0_A01650g"
FT                   /old_locus_tag="KLLA-ORF10958"
FT                   /product="KLLA0A01650p"
FT                   /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
FT                   YGL213C SKI8 essential for protection against viral
FT                   cytopathology dispensable for mitotic but required for
FT                   meiotic recombination and spore viability antiviral protein
FT                   mRNA is induced early in meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02660"
FT                   /db_xref="GOA:Q6CYB7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB7"
FT                   /protein_id="CAH02660.1"
FT                   /translation="MSKLFIPTTNCGKAHETDIYGLVITNPYTVSCSGDGYLKLWNNKL
FT                   TEDQLAKDHVIKEFVTPMGLHHVSAFESVESNGETVIILSAISFDGKIYFYQIDLKEGK
FT                   LVKLSLLNADDSKHSYWACQWYISTNPKNPHKFIATTVQGTTKVWNFIIFQEPELDTET
FT                   GEPLSNSLVYEPHFNFQGKINSQTPRFATAVDVSSTQLIATGFSDGSVVVSQLSTLRPV
FT                   YNFEGFGLKGVEESSSTIRDIKFSPAGSLLAVAHDSGSYGCVSLYETEFGERIGNFTVP
FT                   THGNQTTIASYAHNGWVFSVSFNSTGEYLASAGYDGKIRIWDTKSRERVSTLNVNTTDI
FT                   EIEEDIVLEDEHGDSLEVPPVLAVSFFDKCVRSGMGGSTNEGICCVCSDRSIRWYREAG
FT                   GI"
FT   gene            <147876..>148916
FT                   /locus_tag="KLLA0_A01672g"
FT                   /old_locus_tag="KLLA-ORF10957"
FT   CDS_pept        147876..148916
FT                   /locus_tag="KLLA0_A01672g"
FT                   /old_locus_tag="KLLA-ORF10957"
FT                   /product="KLLA0A01672p"
FT                   /note="similar to uniprot|Q755T0 Ashbya gossypii AER438C
FT                   AER438Cp and weakly similar to YGL212W uniprot|P32912
FT                   Saccharomyces cerevisiae YGL212W VAM7 Regulator of vacuolar
FT                   morphogenesis hydrophilic protein heptad repeat motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02661"
FT                   /db_xref="GOA:Q6CYB6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB6"
FT                   /protein_id="CAH02661.1"
FT                   /translation="MDRGMRCEVSINDVTIVEKRYALYHIIVNVIRSKEDYSEYKSERR
FT                   FKDFLQLKKQLEYECSGELPYELPGRRLLWSRTANSCDPDVVEERRVKLRQFLSDLLND
FT                   SFETKWRNSSLVAQFLNLPEGWYIKSSTKSGNSFTKETIKDGTNPDDALDPSKWLVVLR
FT                   ESKSEFYNGAHDTRTVMKQRLVLDNLEQGLKVIEKEELVSKMECERRKQLLATFKNDLN
FT                   ETIQPASWNKHNNDREELLYKDYQNKFEEPKIGKGRKLGETSETSDLNNQQILQLHKDT
FT                   INDQDEQLHKLHEIVQQQKNISLVLNQELEAQNELLDMFQDETQASANKLRTANRNAVK
FT                   FNQGQR"
FT   gene            complement(<149587..>151293)
FT                   /locus_tag="KLLA0_A01694g"
FT                   /old_locus_tag="KLLA-ORF10955"
FT   CDS_pept        complement(149587..151293)
FT                   /locus_tag="KLLA0_A01694g"
FT                   /old_locus_tag="KLLA-ORF10955"
FT                   /product="KLLA0A01694p"
FT                   /note="weakly similar to uniprot|P25346 YCR098C
FT                   Saccharomyces cerevisiae GIT1 Plasma membrane permease,
FT                   mediates uptake of the phosphatidylinositol metabolite
FT                   glycerophosphoinositol"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02662"
FT                   /db_xref="GOA:Q6CYB5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB5"
FT                   /protein_id="CAH02662.1"
FT                   /translation="MTYDRNHLEHPGTRDLPKSFSGYAHHLVSQINKEITWNKTYDVTE
FT                   ESEEISENDGVVGVNEFDSTGESLVAKADDSGKKSGSKTSFRSNLHIYWPIFTTGSGLF
FT                   SDGYINASIGTVSTCLAQIYGDQYSNSNAIQNVSSIAFVGIVLGQLSFGYIADYYSRRL
FT                   AMLMGNIILIVFSILAAGAWGVGTTTTQAGGIFAAITAYRFFLGVGIGSEYPAGSTAAA
FT                   EASALLPAKRRNRWFVWFTNFMIDWGFVIAAVVPLVLICIFGEHRLQWVWRLTMGLGAI
FT                   PPFSLFLMRLKFKENKSFTSTKFNKMMPYGLIFKFYWFRTIIISIIWFLYNFSSYAFGI
FT                   YSSLIIKNLLTNDSDEQVGLKESFAWNVLFNAFYLPGSFAGAIFADYIGPRLTLSLGLF
FT                   VQAMFGIGMTCGFKSLEKNIAAFTVVFGIFTSLGEFSVGDNIGLIASKSYATPVRGTLY
FT                   SISAAFAKVGAFVGTYAFPQIIKNAGGSDTTNGMRAPFWVATALCLVSCFLALFFLPEL
FT                   DPNAIVDEDRKFAEYLAQSGYDMSTLGTESDNTVEVEYSQEILKSDSIDKN"
FT   gene            complement(<152383..>153498)
FT                   /locus_tag="KLLA0_A01738g"
FT                   /old_locus_tag="KLLA-ORF10949"
FT   CDS_pept        complement(152383..153498)
FT                   /locus_tag="KLLA0_A01738g"
FT                   /old_locus_tag="KLLA-ORF10949"
FT                   /product="KLLA0A01738p"
FT                   /note="highly similar to uniprot|P25087 Saccharomyces
FT                   cerevisiae YML008C ERG6 Delta(24)-sterol C-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02664"
FT                   /db_xref="GOA:Q6CYB3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030384"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYB3"
FT                   /protein_id="CAH02664.1"
FT                   /translation="MSESNELRKRQAEFTKELHGNNVTKSGFSALVSKNKSAQTEAVAK
FT                   YLKHWDGKTDADAERRRLEDYNESTHSYYNVVTDFYEYGWGSSFHFSRFFKGESFSASV
FT                   ARHEHYLAYKAGIKENDLILDVGCGVGGPARTISRFTGCNIIGLNNNDYQIQKANYYAK
FT                   RDHLDSKLSFVKGDFMKMEFDENTFDSVYAIEATCHAPTFEGVYGEIYKVLKPGGTFAV
FT                   YEWVMTDKYDETNPEHRKIAYEIELGDGIPKMYSVDAARDALSKVGFEILEENDLADND
FT                   DEIPWYAPLTGEWKYVNSVADLATFFRTSRLGRAFTTSMVTVFEKLGLAPKGSVSVTNA
FT                   LEEAAVGLVAGGEKKLFTPMMLFVAKKPEQK"
FT   gene            <154859..>156610
FT                   /locus_tag="KLLA0_A01760g"
FT                   /old_locus_tag="KLLA-ORF10945"
FT   CDS_pept        154859..156610
FT                   /locus_tag="KLLA0_A01760g"
FT                   /old_locus_tag="KLLA-ORF10945"
FT                   /product="KLLA0A01760p"
FT                   /note="uniprot|P56095 Kluyveromyces lactis KLLA0A01760g
FT                   YAP1 AP- 1-like transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02665"
FT                   /db_xref="GOA:P56095"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR013910"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56095"
FT                   /protein_id="CAH02665.1"
FT                   /translation="MSTSTAKRPFDNKRAGSPDDGTDSDSGGNNSGSSPASKRRERKPG
FT                   RKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQV
FT                   TNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDSSTAISS
FT                   SNFQFEFPWKMDPSKIPSPSSDSTSPSASTSILDNANNKSVSSTNLNHSRSSISNSSSS
FT                   PSNVNGLSSRKHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPK
FT                   ASPVSTPSSSDLLKPKSNSNVNITNHNNNKINSKDLSSSAPLHDSASASALNNHDSVNA
FT                   VSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPI
FT                   TKQKDNNYSTTTNNTNSPAKADGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYDD
FT                   PLLDILKEEQENEQVEGDSDPIQALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIV
FT                   QDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQK
FT                   ALISHMQ"
FT   gene            complement(<157216..>158802)
FT                   /locus_tag="KLLA0_A01782g"
FT                   /old_locus_tag="KLLA-ORF10942"
FT   CDS_pept        complement(157216..158802)
FT                   /locus_tag="KLLA0_A01782g"
FT                   /old_locus_tag="KLLA-ORF10942"
FT                   /product="KLLA0A01782p"
FT                   /note="some similarities with uniprot|Q04233 Saccharomyces
FT                   cerevisiae YML006C GIS4 CAAX box containing protein of
FT                   unknown function proposed to be involved in the RAS/cAMP
FT                   signaling pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02666"
FT                   /db_xref="GOA:Q6CYB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB1"
FT                   /protein_id="CAH02666.1"
FT                   /translation="MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLK
FT                   RFLRDQFQATGPLNKKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGT
FT                   VYKHENHYLIQDKLTNFNDEWFLEMKKDVSISGNSSKDATDSAENCGQEMEDDSPRRDS
FT                   DSSDSYSILTGDTFDTESHSIVLNFKHPEVMVKPITKTTQRIVRISPGNNIGSPAESQV
FT                   SIVTHGDDLESYRGEALVQTVTRAIDEDEEDEDDDDHHHDVESADDMKSKDISIPPSIS
FT                   ISDNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQM
FT                   LSLYDILDFSKFLPKILFYSMIHVKDSVDDNTELSLQHLITVNNTLTNGNMYSPHEVDD
FT                   SMSELSSDNSIECYTGNSNDSIADEPVIGLYSPATAATAGHRSIRTVESIGAWALNRSN
FT                   TKKSMETVQNTVSRDSRGNFMNRIKSQPMPVLLQTLNSNIDEEAIKIKKNLAKVRARQR
FT                   KKSTSHNCSIM"
FT   gene            complement(<159689..>162526)
FT                   /locus_tag="KLLA0_A01804g"
FT                   /old_locus_tag="KLLA-ORF10941"
FT   CDS_pept        complement(159689..162526)
FT                   /locus_tag="KLLA0_A01804g"
FT                   /old_locus_tag="KLLA-ORF10941"
FT                   /product="KLLA0A01804p"
FT                   /note="similar to uniprot|Q04052 Saccharomyces cerevisiae
FT                   YDR421W ARO80 Zinc finger transcriptional activator of the
FT                   Zn2Cys6 family activates transcription of aromatic amino
FT                   acid catabolic genes in the presence of aromatic amino
FT                   acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02667"
FT                   /db_xref="GOA:Q6CYB0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYB0"
FT                   /protein_id="CAH02667.1"
FT                   /translation="MVSNGNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGP
FT                   PCVRCKRESRECMFTETKRGGFRVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKELD
FT                   TDLDRLQTHTKDDISINTDPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTD
FT                   AVSRQPSVSSYGNKQATGSMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRP
FT                   KPSMKLGDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLC
FT                   TILTISARYHTLHDLGLNEIDNTVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAF
FT                   LIFTEWNPRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWL
FT                   LTGNAVRLAQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEVRLNGFEDNDL
FT                   DNEQFFLERILQNDKSKERWARFLERVGERSKKGSLTDIEREFLNDEYLLYHYNTENPN
FT                   TQSDPEFRLKFSKIQRGKVELLKIVSLGYENVYNGKLSSHDRHQRLSMLSVLSPLIEGW
FT                   YNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDH
FT                   QDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIV
FT                   FMIKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRY
FT                   STILMYLCTEMKHRCKPNMQPPVPRSISNDYLDKTSNRSENVADNSARHFSVGGYQVSD
FT                   TANVSSSPFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSALGVASINSAPPAPVP
FT                   EPAPDTNPASAINTGPNSSGGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDD
FT                   SSYENWFNDFYTPPK"
FT   gene            complement(<163010..>167404)
FT                   /locus_tag="KLLA0_A01826g"
FT                   /old_locus_tag="KLLA-ORF10940"
FT   CDS_pept        complement(163010..167404)
FT                   /locus_tag="KLLA0_A01826g"
FT                   /old_locus_tag="KLLA-ORF10940"
FT                   /product="KLLA0A01826p"
FT                   /note="some similarities with uniprot|P41809 Saccharomyces
FT                   cerevisiae YDR420W HKR1 Serine/threonine rich cell surface
FT                   protein that contains an EF hand motif involved in the
FT                   regulation of cell wall beta-1 3 glucan synthesis and bud
FT                   site selection overexpression confers resistance to
FT                   Hansenula mrakii killer toxin HM-1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02668"
FT                   /db_xref="GOA:Q6CYA9"
FT                   /db_xref="InterPro:IPR039295"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA9"
FT                   /protein_id="CAH02668.1"
FT                   /translation="MHVRRNTYHYPLLWLFALIICCEGRILPSWFWHSSSISKHFGTTS
FT                   AANEQTQAAELIFTSKPIIAVRRRDVTVNSTQSDLELASSSFPDDYSTTEVTSTDLSDT
FT                   DVDTSTEVPTSTDLSDTDVDTSIEDSSISTTELSTSSELYANVADLSSEDFGTQTTPLL
FT                   EFFSFHLETSTSSPDTTTSSSPFIGSDMKIVTTSSNGNLISDFLQSSDVSASSDEHTSS
FT                   EVLTSSEAEDTTPITSSIEEITSSAPSAGASFDSQDAVSSSDSVSVSPSPSQSESFFTD
FT                   TSSEDVPSLSATVASTVDVDTTISYTPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSP
FT                   SPSPSPSPSPSPSPSPSESHLTETSTEPGSSSSFVGVPIDNDTSTPDDIISPDTTLPET
FT                   SSPVTTTPETTPPDTTTSITTAPVTTTPVTTTPDTTTPVVTTPITTTPETTSPEATTSS
FT                   TTDTAQAAVSSTSSYSTTLSTADTVPVTIETTPSTSQLDTIPTTATSSEVNDTPTTTTS
FT                   QVNTNPFTTLSTNILPSETGTTSESLLILVSTVESTPESTIIMDVSTSSPDMVSPTSGE
FT                   ISSIVPVSTSVILQDTDVSSSTSTEMVVISSEAPGASSILQESTTFTDITSGSDIQLER
FT                   STTSIIASSVTSGTTASESTNVFTVFSSTESASTHHSLASSSIITQTINSGASASFISE
FT                   TRQPMATSVSATLDGSIVNSGLTSNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQ
FT                   AINPASDVPLPDGYTVITVGFKEPLNYPFLIANPLASAQIFNFLPKVLVRPFQLTTTGA
FT                   APVYRRSWNIFKKGINTHLLSSSLPTYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESV
FT                   HTLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGDSDGN
FT                   GNGSGEGTGGNGAEKDNSSNNAALWGSLDAGLTSGFPNHDTVIRFVCMVTVLTAFILCL
FT                   VGLILVFLKNLYKRTNCAQRMHLTEKNWPEIPTFYSHHMNGSTDSPMRNMFYSGSQFSD
FT                   SDTTEEDSHSAEYIDDDLIITGENTVYSISQGITYYVDEDGNFFFAGVGKDVHTSEPEK
FT                   LEKIIHDKTETVTVEPILPYYNEKDDDLTDETEPFDMGELEVDEDGNIALPESDLENTI
FT                   LQVASDREEIRSRSPIGTNDGSYLQHQIPNIFPSVTSNSAHVNSDTMATAVTQTLLSSN
FT                   GSGGILDLTGNNGTYDEYLYDATQDEIDDPPIITNSGLEEFSSGHISSIDLDDEIDIDI
FT                   EDYDDDVSDVNVGDYDEFDEEMYRHLSRSDILQNFGSGSSTGLASRLASLQGTSTDSGT
FT                   SFNMHNVGSYIGAHTSTLSSNGRNPSDNSYGGVPPKRPERSSLVFDFNGLYDETPLLNR
FT                   SASMVSPSQTPEKHTGSKRTSRNLSKEFAAELGITEEQLKTMERHPSAVPSYNSQSRTS
FT                   NKK"
FT   gene            complement(<167886..>169823)
FT                   /locus_tag="KLLA0_A01848g"
FT                   /old_locus_tag="KLLA-ORF10931"
FT   CDS_pept        complement(167886..169823)
FT                   /locus_tag="KLLA0_A01848g"
FT                   /old_locus_tag="KLLA-ORF10931"
FT                   /product="KLLA0A01848p"
FT                   /note="similar to uniprot|Q04049 YDR419W Saccharomyces
FT                   cerevisiae RAD30 DNA polymerase eta involved in the
FT                   predominantly error-free bypass replication of DNA lesions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02669"
FT                   /db_xref="GOA:Q6CYA8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA8"
FT                   /protein_id="CAH02669.1"
FT                   /translation="MSKYRWRDLIDLNDKEKSFLSPLACIAHIDVNAFFAQVEQVRCGF
FT                   SRDDPVVAVQWTSILAVSYAARKYNVSRMESILDAIKKCDKIIPIHTAVFRKGEDYWQY
FT                   HDGCGSWVEDESKKLSPTNYKVALEPYRRESRKLIKLFQDEYDLVEKASVDEAFIELGR
FT                   KLFYELLMDDSYTDFADIRGIFQDGRYDLNDHLPSLPTKLSIQFSGEVFNSQNRPLFED
FT                   WDDVLMCLASNSTNTIRNQIDDMLGYTTSCGISMTKNLSKLASNYKKPNAQTIVKNNCI
FT                   DDFLDCGKFEINSFWTLGGIRGKELIDLMELPKEHSIKFIRDSWPVSSDDIRKFMLKKI
FT                   ICRDIQRSREYNINEADVAKISAKIYQLVRGQFRLPVEPRPLPKSMMSKKNLRNDDCAS
FT                   VIDCIEWLEIFCSELNYRVHDLEQEYEKVIMPRTIVIMIKGKAGMKYTQTRRITTASSS
FT                   ITSRELFINATKLINEIDKQHGKLAGVYPLRELSLTLSNFDIIDKGKTVLDMFGNRAIS
FT                   KSSSTDNNVVKIEGEDIHSDSKGGPYDASVSETLEGEPPSASSPPTMAENLTCKQCGET
FT                   LQDKKLFQEHVDYHLSVQLSEQINGVSENSTMLTHAERILLFGKKAKKNAASVQKPKKK
FT                   DGGIMKFFKK"
FT   gene            complement(<170104..>170985)
FT                   /locus_tag="KLLA0_A01870g"
FT                   /old_locus_tag="KLLA-ORF10930"
FT   CDS_pept        complement(170104..170985)
FT                   /locus_tag="KLLA0_A01870g"
FT                   /old_locus_tag="KLLA-ORF10930"
FT                   /product="KLLA0A01870p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02670"
FT                   /db_xref="GOA:Q6CYA7"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA7"
FT                   /protein_id="CAH02670.1"
FT                   /translation="MPLPLQESTMSDDSVDRVFEKAIVTIQTLSSQKGYHSLPRPPANV
FT                   RIQLYALFKQSTEGDVSHILDKPDGNPTSPDYNLALRKWEAWKSKEGLSKTEAKRAYIE
FT                   LLIHTMKTYAMGTIVARELLSELEFMWWQISHSNTFDGNEGPEYQDETNSVLMLTNDND
FT                   MDNGSEKIRREVYETLATLRPNSIQNGISLAPIGSGLSDKSEEFYAIWITLKRILTKLL
FT                   TISRGIVTYLGKRIMSQSLILLFMLFVVKYSDKSIDLALDKVDSRHSSWISKLIQLLSQ
FT                   FTGISKVSLQVQ"
FT   gene            complement(<172232..>172729)
FT                   /locus_tag="KLLA0_A01903g"
FT                   /old_locus_tag="KLLA-ORF10927"
FT   CDS_pept        complement(172232..172729)
FT                   /locus_tag="KLLA0_A01903g"
FT                   /old_locus_tag="KLLA-ORF10927"
FT                   /product="KLLA0A01903p"
FT                   /note="highly similar to uniprot|P17079 YEL054C
FT                   Saccharomyces cerevisiae RPL12A or uniprot|P17079
FT                   Saccharomyces cerevisiae YDR418w RPL12A Protein component
FT                   of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01903g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02672"
FT                   /db_xref="GOA:Q6CYA5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA5"
FT                   /protein_id="CAH02672.1"
FT                   /translation="MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGED
FT                   IAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKDKNVKHSGNL
FT                   QLEDIIEVAKQMREKSFGKNLASVTKEILGTAQSVGCRVNYKNPHDIIEAINAGEIEIP
FT                   EN"
FT   gene            complement(<173617..>175977)
FT                   /locus_tag="KLLA0_A01925g"
FT                   /old_locus_tag="KLLA-ORF10924"
FT   CDS_pept        complement(173617..175977)
FT                   /locus_tag="KLLA0_A01925g"
FT                   /old_locus_tag="KLLA-ORF10924"
FT                   /product="KLLA0A01925p"
FT                   /note="similar to uniprot|Q02197 Saccharomyces cerevisiae
FT                   YEL053C MAK10 Non-catalytic subunit of N-terminal
FT                   acetyltransferase of the NatC type"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01925g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02673"
FT                   /db_xref="GOA:Q6CYA4"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA4"
FT                   /protein_id="CAH02673.1"
FT                   /translation="MVVENNIAELANLTLDHRMDPKNEAQFIDITDHLKALAAKLAPET
FT                   VVKEATFNLFEGTYALEVCNVKLDTSLIELCPEELEFDCNVPYGDSNNGERLDYVTAVC
FT                   DRLCRSLMNWLHDYQTLPTTVLSCRYVEFLMELYTSNPVSSLQSFQGLRTRDPLYDQVL
FT                   CSFVIGVCSFIKFTSKVLKDGGVYEEEDLNCNVMSLDMLSGVDTKEVIDLLNSSLQLLV
FT                   QSYSESTHLQKLVDLVKHLLHLPNYHYPSCQSSVSSDLLPLQKSLDIISSLVQDDYTTK
FT                   QHSYPPGCFSKGIQKRRDNNFPPKDLFEPKGDEYVSYTEFMRDIIAALSVKDCNTAFEI
FT                   RQYVWFFNRIRQRTVMARALLQSYLIREDTILDKFRFNTFKDMHLYEFSLAGTALYDVI
FT                   SSREQTTDRDNMIEALNELSYCLLRWYQNMPQNSCRHRQGFNRLLLDWDSVQAQFEQYE
FT                   TQWQSMGIVDSITNMGNIPLMPVSTWIYTTKLLMMIEFTLEGFHLEVYKPWESFTQYWF
FT                   CYYLSSHLESNLKRLHEFLLQKISYILNYNKRIKKLKAGEKKENAKARYRHLTDNVLPQ
FT                   LRLNERTVNFFFMKCTIFKSLSLAQVFQFALLKSFNVIDSKNDVSTRFSSDRLIHKLRF
FT                   KTFSSIGIPEIPTFEQFQKSLNDFVIEPPSIHSKIPKLLNFMNTELESAKSALSTIIQT
FT                   IETGETDDSPVSTGTKHVKEPALQWYKSMLNSTVALSVNASVLKTKLSEDLKSHDLHAT
FT                   YDVELKFTPNGCYYFPLLTISPKKARNALPHTT"
FT   gene            <176815..>178338
FT                   /locus_tag="KLLA0_A01947g"
FT                   /old_locus_tag="KLLA-ORF10923"
FT   CDS_pept        176815..178338
FT                   /locus_tag="KLLA0_A01947g"
FT                   /old_locus_tag="KLLA-ORF10923"
FT                   /product="KLLA0A01947p"
FT                   /note="similar to uniprot|P32317 YEL052W Saccharomyces
FT                   cerevisiae AFG1 Putative ATPase of the CDC48/PAS1/SEC18
FT                   (AAA) family localized to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01947g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02674"
FT                   /db_xref="GOA:Q6CYA3"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA3"
FT                   /protein_id="CAH02674.1"
FT                   /translation="MLIFSQGCKKVLVSRVGSGLVERPGYTFGLFQQVLAQRWVSQSAD
FT                   VTETPLSKYDELVKLGKLRDDPYQRSIIKSLGHLHDSLVSYNPEPVQPPSVLDQVGWKT
FT                   GFLGKLFARKEKYSTEGVPKGIYLYGDVGCGKTMLMELFYLTVPPALSKKRIHFHQFMQ
FT                   YVHKRSHDIISEQNFDALGEAKGRDIDPIPFLAAEIANTSRVLCFDEFQVTDVADAMIL
FT                   RRLITTLLSKEYGVVLFATSNRKPDDLYINGVQRESFVPCIELIKERTEVVLLDSPTDY
FT                   RKIPRPISSVYYYPSHNLSYFSKECELARKLHVQQWYSYFAQLHRPSKSENGHDIVYNY
FT                   PLTIWGRQLLVPKCTPGRVAQFTFKQLCGEPLAAGDYLTLANSFKSFVVTDLPYLTIYV
FT                   RDEVRRFITFLDAVYDNGGKLATTGADDFTSLFVEPEDIVNDYELKPADQMKHEDEPEV
FT                   EDELVSKHGFSKDIAKKAQIFALDEERFAFARALSRLSHMSSTDWVEKQ"
FT   gene            complement(<178458..>180854)
FT                   /locus_tag="KLLA0_A01969g"
FT                   /old_locus_tag="KLLA-ORF10921"
FT   CDS_pept        complement(178458..180854)
FT                   /locus_tag="KLLA0_A01969g"
FT                   /old_locus_tag="KLLA-ORF10921"
FT                   /product="KLLA0A01969p"
FT                   /note="similar to uniprot|Q04048 Saccharomyces cerevisiae
FT                   YDR416w SYF1 synthetic lethal with CDC40"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01969g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02675"
FT                   /db_xref="GOA:Q6CYA2"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CYA2"
FT                   /protein_id="CAH02675.1"
FT                   /translation="MEIDKFVKEEDIPFEYGVVRERDNAVSWSRYLATKRSAGDELNLD
FT                   WLYERCLKEIKDDWHLWKEFLKWRIELLNDCDIFRHKDEYNKISLLFEQCLTSCGKVGD
FT                   AWIMYMEWVIQFKDLKRIRELLGKALRSMSWEYHEAIWRVVIDFIINELLIDNKRYELS
FT                   LEDSIYYFVHGEHSTNFDTDLWSSSILQRYSLICDDIEPLLIYIFKTHDWSTIVRVFEK
FT                   HLSPNLKPSQTSLFELYVSYITSMILVDNSAGVAAVVDQCIELFPFKKGELKTYLIFNL
FT                   IRQGKITEAELYLEKVISETKDIIEFSVLYDFWIRMEELLTQELIQKMKDDNSEKQRLF
FT                   ANIRLHADTLTSLIKNHTIRLNDLELRREPNNIKLWLERVKLFDTISDKAKVYADAVLT
FT                   VDYRLQTTPGLLGELWCQYCRLFEEDIEKSEVLLDKATNVPFKFLVDLENVWLYWCEYR
FT                   LKRSIDDAIKVLSVVLEIPDNHELLLQKFEKGESPAQAAIFSSKRLWAMYLDLLEVKGN
FT                   YGTAVNAYETAILIKAATPAMFINYALLNESSGHQAEALAVFERSVEIFPPSVSKSIWD
FT                   IYLDVALKADITKEQKRDIFESAIKLAASGVACVSFFEKYSDFELNLGFHERSVEILHK
FT                   GAKNISDLESKCTLWEECINRSEKQLDVNHTRKLYEECIETLPNSKAIKFLLPFAILEE
FT                   SRNEVARCRALLDYGSKLLKPAQNEELWDFWRNFETMHGTKDSFKNMLKARRFLEDTMK
FT                   VNTEEVSRHADSIEFRASTAKISGSGPPSAEDKGYSNTAEIDLGL"
FT   gene            <181274..>182104
FT                   /locus_tag="KLLA0_A01991g"
FT                   /old_locus_tag="KLLA-ORF10918"
FT   CDS_pept        181274..182104
FT                   /locus_tag="KLLA0_A01991g"
FT                   /old_locus_tag="KLLA-ORF10918"
FT                   /product="KLLA0A01991p"
FT                   /note="highly similar to uniprot|P32610 YEL051W
FT                   Saccharomyces cerevisiae VMA8 vacuolar ATPase V1 domain
FT                   subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A01991g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02676"
FT                   /db_xref="GOA:Q6CYA1"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA1"
FT                   /protein_id="CAH02676.1"
FT                   /translation="MSSNREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFRD
FT                   ITKRIDDSKQKMGRVMQTAAFSLAEVTYATGENIGYQVQENVANARFKVRATQENVSGV
FT                   YLPQFESFIDSNINDFKMTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILDEVI
FT                   KVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQIQTAQLDAEMK
FT                   QKKLDEANAESEGKPDSQEATKTGVEAADTQEQEEQSGPQVEALITEQEEDVIF"
FT   gene            <182326..>183447
FT                   /locus_tag="KLLA0_A02013g"
FT                   /old_locus_tag="KLLA-ORF10916"
FT   CDS_pept        182326..183447
FT                   /locus_tag="KLLA0_A02013g"
FT                   /old_locus_tag="KLLA-ORF10916"
FT                   /product="KLLA0A02013p"
FT                   /note="similar to uniprot|Q04033 Saccharomyces cerevisiae
FT                   YDR415C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02013g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02677"
FT                   /db_xref="GOA:Q6CYA0"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CYA0"
FT                   /protein_id="CAH02677.1"
FT                   /translation="MKFGWFLLAASVAALPFDSLHVLEIEEGKTIMVRETEKWSLKRKG
FT                   VQFMDITNFPKLLKSKDEKAVVPVYRYPKETQCDEIVNSLSKGVDKVSMHDNLAKFTSF
FT                   YTRYYKSDTGYESAVWLSEKLSNITSPLNNDVVIEHVQHKGWKQFSIIVSIKGAQTPEN
FT                   IVVMGSHQDSMNLLLPSILAAPGADDDGSGTVTNLEALRLYVEHLSTTGYRPNNTIEFH
FT                   FYSAEEGGLLGSLDVFTRYAEENKKVVAMLQQDMTGYVEDPENEHVGVITDYTTPGLTE
FT                   FIKLIIRRFLDIPYVETECGYACSDHGSATKNGFPASFVIESEFNKSNKYIHSTMDTLD
FT                   RLSFDHMAQHVRLVVGSLFELGNWEFKLEEETK"
FT   gene            complement(<183620..>184825)
FT                   /locus_tag="KLLA0_A02035g"
FT                   /old_locus_tag="KLLA-ORF10915"
FT   CDS_pept        complement(183620..184825)
FT                   /locus_tag="KLLA0_A02035g"
FT                   /old_locus_tag="KLLA-ORF10915"
FT                   /product="KLLA0A02035p"
FT                   /note="similar to uniprot|P32611 YEL050C Saccharomyces
FT                   cerevisiae RML2 Mitochondrial ribosomal protein of the
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02035g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02678"
FT                   /db_xref="GOA:Q6CY99"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY99"
FT                   /protein_id="CAH02678.1"
FT                   /translation="MFKQFNLRCLTPLASGVSSRVQVPWNVSMIMSLNNTSLGGIRSMA
FT                   SITPTGNEEQSSVDDVNVHMLKIVPNNTDVVALEKQDELLRRRRKLAKEVTQMKKLKPV
FT                   SPGLRWYRAPIYPYLHKGRPVKSLTLAKRGNGGRNHSGKITVRHRGGGHKRRLRTVDFS
FT                   RFESGMQTVERIEYDPGRSAHIALIKHNDTGALSYILACDGLRAGDTIESYRKGIPPSF
FT                   LKEMGGKIDPAILSVRTAQRGNCLPISMIPIGSIVHNIGITPTGPGKFCRAAGSYARIL
FT                   SKIPEKNKAVVRLQSGEHRYVSLEAAATMGVVSNIDHQNRSLGKAGRSRWLGIRPTVRG
FT                   VAMNKCDHPHGGGRGKSKSKKLSMSPWGQLAKGYKTRRGKHQNKMKVKDRPRGKAGRKA
FT                   RQ"
FT   gene            <185546..>185668
FT                   /gene="SNR67"
FT                   /locus_tag="KLLA0_A02042r"
FT                   /old_locus_tag="Klla0A_snoRNA_58"
FT   ncRNA           185546..185668
FT                   /gene="SNR67"
FT                   /locus_tag="KLLA0_A02042r"
FT                   /old_locus_tag="Klla0A_snoRNA_58"
FT                   /product="snR67"
FT                   /note="C/D snoRNA polycistronic Cluster 4 SNR67"
FT                   /ncRNA_class="snoRNA"
FT   gene            <185795..>185926
FT                   /gene="SNR53"
FT                   /locus_tag="KLLA0_A02049r"
FT                   /old_locus_tag="Klla0A_snoRNA_59"
FT   ncRNA           185795..185926
FT                   /gene="SNR53"
FT                   /locus_tag="KLLA0_A02049r"
FT                   /old_locus_tag="Klla0A_snoRNA_59"
FT                   /product="snR53"
FT                   /note="C/D snoRNA polycistronic Cluster 4 SNR53"
FT                   /ncRNA_class="snoRNA"
FT   gene            <186220..>187374
FT                   /locus_tag="KLLA0_A02057g"
FT                   /old_locus_tag="KLLA-ORF10912"
FT   CDS_pept        186220..187374
FT                   /locus_tag="KLLA0_A02057g"
FT                   /old_locus_tag="KLLA-ORF10912"
FT                   /product="KLLA0A02057p"
FT                   /note="uniprot|P41771 Kluyveromyces lactis KLLA0A02057g
FT                   ERD1 Protein ERD1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02057g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02679"
FT                   /db_xref="GOA:P41771"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41771"
FT                   /protein_id="CAH02679.1"
FT                   /translation="MDAESVEPFLVYLPIPQRVVVLVLLGLWLWTWFLKVSVSYYDVSK
FT                   VIVSNESTGLPYFNTSTKIHQSSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKLLW
FT                   FFLNVSPLLELFYIFAMILRSSAMVARCFKRILWVADIEPKPYRNNYIIISDTLTSYSK
FT                   PLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQSLREFTRGRS
FT                   QKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMFWNSAYSFWWDVTMDWK
FT                   LELFDFVNGDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDFILRFVWFWEYISG
FT                   HSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIATTEGGKMDE"
FT   gene            complement(<187421..>188152)
FT                   /locus_tag="KLLA0_A02079g"
FT                   /old_locus_tag="KLLA-ORF10911"
FT   CDS_pept        complement(187421..188152)
FT                   /locus_tag="KLLA0_A02079g"
FT                   /old_locus_tag="KLLA-ORF10911"
FT                   /product="KLLA0A02079p"
FT                   /note="similar to uniprot|Q04031 YDR412W Saccharomyces
FT                   cerevisiae RRP17 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02079g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02680"
FT                   /db_xref="GOA:Q6CY97"
FT                   /db_xref="InterPro:IPR019186"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY97"
FT                   /protein_id="CAH02680.1"
FT                   /translation="MVAKSNREILTGGKSYKQKAAKKFGADEVKFDKDSRLEYLTGFHK
FT                   RKLDRQKKAKEFIQEQERKARLEERAKIRADKKKALEKQLEDFKQAMKDVGDYVGVEDD
FT                   DEEAENGKQGSDEEAEEWTGFSDDNGDATEEEEEDSDSVSVKPILKKYVQTYLDDTTVD
FT                   IEPLEPNDNFEYLAELNNVKLEKSEQILDQSIERAKKYAKFLGVEEKSGNKSKKNKKFR
FT                   YLTKNERRQNQRKANNNKRRK"
FT   gene            <188671..>189519
FT                   /locus_tag="KLLA0_A02101g"
FT                   /old_locus_tag="KLLA-ORF10909"
FT   CDS_pept        188671..189519
FT                   /locus_tag="KLLA0_A02101g"
FT                   /old_locus_tag="KLLA-ORF10909"
FT                   /product="KLLA0A02101p"
FT                   /note="similar to uniprot|Q7LIJ5 Saccharomyces cerevisiae
FT                   YDR411C DFM1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02101g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02681"
FT                   /db_xref="GOA:Q6CY96"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY96"
FT                   /protein_id="CAH02681.1"
FT                   /translation="MTMRNELIQFVGQIPPVTRGICLLMVLICLIQRLNVLPYYFSDFK
FT                   WSLRGVLFKFQIWRLFTSFLILPNDAMKACFDLYAVYSKSLHLELVHFSNKSIDYLFYI
FT                   CFNFALIVVLVEACQISYPVFTNAFIGMILYTWTLDNSNVKVMFYGLFPILGKYLSLVH
FT                   LFVSFLFDDGTDGYSRFCVTMVGFCAGYVYSCLDTWTYGPLYGYLMGKDPAYGFSGRGH
FT                   FRSPRWFSSIILWIGRVLSITSKPVSSSNRTDPVTRRRLRTPLKKSTFAGTGNRLGTKI
FT                   D"
FT   gene            <190132..>192165
FT                   /locus_tag="KLLA0_A02123g"
FT                   /old_locus_tag="KLLA-ORF10906"
FT   CDS_pept        190132..192165
FT                   /locus_tag="KLLA0_A02123g"
FT                   /old_locus_tag="KLLA-ORF10906"
FT                   /product="KLLA0A02123p"
FT                   /note="similar to uniprot|P32796 YML042W Saccharomyces
FT                   cerevisiae CAT2 Carnitine acetyl-CoA transferase present in
FT                   both mitochondria and peroxisomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02123g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02682"
FT                   /db_xref="GOA:Q6CY95"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY95"
FT                   /protein_id="CAH02682.1"
FT                   /translation="MRSMAFRSSAGISMGMRRMGQGNKKSSILRQMSGKMQYSGYQKFP
FT                   FETGTNDEYIAERPNSYYQEKRPGFKGATYSKQQDMPSLPIPELKSTLDKYLKSIKPFC
FT                   QTDAEYEKQIQLCYSFLSDQGPALQERLLSYSQERRNWMQELWDSQIYLGDRSPVVPFV
FT                   SYFYGHKPLPTSHRAIDGDMLVKATAIISSVVKFVESLKDEALPAEVVKGKPFCMNGFQ
FT                   YMFNNSRVPQFNIDTNHFYSIYEHGYLTVAYKDNFFKVYTHDKAGAVLSNAVIYQQLNQ
FT                   IVNHLGSQGSLINANAGIGALTTLPRDEWAGAYQQLQLEPVSSSSLETIHKSSFVLCLD
FT                   QDTAPITLEDKSRVCWHGDGTNRFFDKPLQFFVTGNGFSGFLAEHSKMDGTPTLFLNHY
FT                   VVDQLTKLNPSAFVESLHSNVSAYPSVNSEHLPFIITPTLRNTIESAKLQFITTVERED
FT                   LRVWHYNRYGKRIVKTFKVSPDAYIQQVIQLAVFKYLKKQLPTYEAASTRAFFQGRTET
FT                   GRPVTESSSKFVKTWESPTSTTEEKIAAFYDAAKDHVEYLKMASNGEAVDRHFFGLKNM
FT                   VHESDEPVPLFQDALFKYSSTWLISTSQLSSENFECYGWSQVYDNGFGLAYMINNEFLH
FT                   INITNKPEASGFSVDELHYYLTKAADEMYETLSLHNSAKAKL"
FT   gene            <192493..>193242
FT                   /locus_tag="KLLA0_A02145g"
FT                   /old_locus_tag="KLLA-ORF10905"
FT   CDS_pept        192493..193242
FT                   /locus_tag="KLLA0_A02145g"
FT                   /old_locus_tag="KLLA-ORF10905"
FT                   /product="KLLA0A02145p"
FT                   /note="similar to uniprot|Q03433 Saccharomyces cerevisiae
FT                   YML041C VPS71 Protein of unknown function component of the
FT                   Swr1p complex that incorporates Htz1p into chromatin
FT                   required for vacuolar protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02145g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02683"
FT                   /db_xref="GOA:Q6CY94"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR039723"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY94"
FT                   /protein_id="CAH02683.1"
FT                   /translation="MRSVEEINVRTYNPNIYFSSLNQTHQSARVSKQSQTSARNKRVNY
FT                   SLADLEAKIYNQPKGSDKDDINQLTGSDKHALPDLLRSNKRFMELDTENYQDLREVTTL
FT                   LSNITGLNKDKIDQTSTGILSEQQSGSGSSRQRMAKFDLPKSMNLLYKSSKPPRKSKKS
FT                   SNRISALRKVLSSRRSLHSYLETLDQVNHTLIYSNVQNKKFFRVLPMIVTCSMCGGYSS
FT                   ISNCVVCNDKICSLRCYELHSETRCNN"
FT   gene            <193623..>194369
FT                   /locus_tag="KLLA0_A02167g"
FT                   /old_locus_tag="KLLA-ORF10903"
FT   CDS_pept        193623..194369
FT                   /locus_tag="KLLA0_A02167g"
FT                   /old_locus_tag="KLLA-ORF10903"
FT                   /product="KLLA0A02167p"
FT                   /note="similar to uniprot|P32584 Saccharomyces cerevisiae
FT                   YDR410C STE14 Farnesyl cysteine-carboxyl methyltransferase
FT                   mediates the carboxyl methylation step during C-terminal
FT                   CAAX motif processing of a-factor and RAS proteins in the
FT                   endoplasmic reticulum localizes to the ER membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02167g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02684"
FT                   /db_xref="GOA:Q6CY93"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="InterPro:IPR025770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY93"
FT                   /protein_id="CAH02684.1"
FT                   /translation="MSSRDDESEDVLVIIDGKTFPNIQKNELDEISLTAFMLGVIFGVS
FT                   LITLCLSPFWNFNIYMISLSIFHLLEFWITAKYNPGKLNTNSFLINNGVGYFLAHSVAL
FT                   IETIIERLLFPSFKSTTYSFYNEFIVTVGVVLLLLGQYVRSSAMITAGQSFSHVVKVTK
FT                   NSDHTLVTSGIYSKSRHPSYFGFFWWSVGSQLMLLNPVSLVIFIVVLWKFFNSRIAFEE
FT                   RYLVQFFGNQYITYRETVGVGIPFIK"
FT   gene            complement(<194500..>196848)
FT                   /locus_tag="KLLA0_A02189g"
FT                   /old_locus_tag="KLLA-ORF10901"
FT   CDS_pept        complement(194500..196848)
FT                   /locus_tag="KLLA0_A02189g"
FT                   /old_locus_tag="KLLA-ORF10901"
FT                   /product="KLLA0A02189p"
FT                   /note="some similarities with uniprot|Q04195 YDR409W
FT                   Saccharomyces cerevisiae SIZ1 SUMO ligase that promotes the
FT                   attachment of sumo (Smt3p small ubiquitin-related modifier)
FT                   to proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02189g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02685"
FT                   /db_xref="GOA:Q6CY92"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR023321"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR038654"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY92"
FT                   /protein_id="CAH02685.1"
FT                   /translation="MQHLLDDTSIDSVKQEIMLLKVAELKNVCRSIGLPISGRKTELQD
FT                   RLSSFLMAPSRAGMNDPFRIPAVNILVKKAGAGDPVPKFETLLHALATGSFMHPVATGH
FT                   QDASALIGNNRLAGKPHLRFQQSPFYNLKRLVGSESAPEAPSKRGVANISFKLVEEEMK
FT                   LLKSSPKIKLYVFCGINNSFGASNDIPIQFPLRNEIKFNGIQIKDNVHGLKNKIGTAKP
FT                   ADLTPYINWPPKSNLLQLVYAFTKDDHMVYVYLVELIETEELLQKTLSSPKIVRPATLQ
FT                   YIKQTLSEEEDEDMMTTSTVMSLQCPISYSRMKYPVKSIHCRHLQCFDAQWFIESQRQI
FT                   PTWQCPVCQKQIRIEDLAICEFVQEIISSTDEEVEQVEISKDGSWVIKDETENHNQEAS
FT                   TAPNIKQEATPDIKPEDSHAVEQHDEHPPPEHVIISLDSDEEDEIEQATSKTNPPNRQS
FT                   TSQNSDNTSSSTDLNQDNDLLDDEDMAFIEELANSIIDRVPRRSQHENNVTSTSNLNVN
FT                   GLIDPNTRNEVPERRTSLDPRMNDYDLLNLAAEQPTNFRQMRGRLLSENNQENSRPPVP
FT                   NLLGKAPLNTDSHKVGPQLPNMSQLTNADSMLFNGNGQAHPQAPSGSFSDSNSRIVVQP
FT                   MGSSPRGQTSDKVTQVSIQPTEPPSMGVPVLPPLPTLPVRSTTSTMSPNLPQPPPIHDP
FT                   RRRKPEVSPFLPKKNFKNVLPKKRAHSNGNAQNVHSEINGNHDSGTLPAPSPISNVQVS
FT                   PSPAIMNSNNVPPPNDSLNSDDLIDLTSD"
FT   gene            <197863..>198510
FT                   /locus_tag="KLLA0_A02211g"
FT                   /old_locus_tag="KLLA-ORF10896"
FT   CDS_pept        197863..198510
FT                   /locus_tag="KLLA0_A02211g"
FT                   /old_locus_tag="KLLA-ORF10896"
FT                   /product="KLLA0A02211p"
FT                   /note="similar to uniprot|P04161 YDR408C Saccharomyces
FT                   cerevisiae ADE8 Phosphoribosyl-glycinamide transformylase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02211g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02686"
FT                   /db_xref="GOA:Q6CY91"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY91"
FT                   /protein_id="CAH02686.1"
FT                   /translation="MAPKVVVLISGSGSNLQALIDAKKEGKLPIDICRVISSSKKAYGL
FT                   TRSSDNGIPTIVQSLYSYTKDLSKDDKKGRAEARNKFEADLADLILKDSPDLVVCAGWL
FT                   LILGPTFLKRLNGLPIINLHPALPGAFDGTTHAIEMAWNKCQEQKRPLIAGCMVHYVIE
FT                   EVDRGESLVIKELEIVPGKESLEEYGTRVHAAEHVAIVEATIIALKESNKLI"
FT   gene            complement(<198766..>199554)
FT                   /locus_tag="KLLA0_A02233g"
FT                   /old_locus_tag="KLLA-ORF10895"
FT   CDS_pept        complement(198766..199554)
FT                   /locus_tag="KLLA0_A02233g"
FT                   /old_locus_tag="KLLA-ORF10895"
FT                   /product="KLLA0A02233p"
FT                   /note="highly similar to uniprot|P25043 YOR157C
FT                   Saccharomyces cerevisiae PUP1 Endopeptidase with trypsin-
FT                   like activity that cleaves after basic residues"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02233g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02687"
FT                   /db_xref="GOA:Q6CY90"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR024689"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035216"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY90"
FT                   /protein_id="CAH02687.1"
FT                   /translation="MSGGLSFENYQRNVHLAEKSHKQPNATSTGTTIVGVKFNGGVIIA
FT                   ADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISSNIELHSLYTGREP
FT                   RVVSSLQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYQSLGSGSLA
FT                   AMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVDVCVMEVGKDAQLLRNYLC
FT                   PNVREPKQQSYKFARGTTGVLKESILKVCDIDEETVNITA"
FT   gene            <199863..>203495
FT                   /locus_tag="KLLA0_A02255g"
FT                   /old_locus_tag="KLLA-ORF10893"
FT   CDS_pept        199863..203495
FT                   /locus_tag="KLLA0_A02255g"
FT                   /old_locus_tag="KLLA-ORF10893"
FT                   /product="KLLA0A02255p"
FT                   /note="similar to uniprot|Q04183 YDR407C Saccharomyces
FT                   cerevisiae TRS120 Component of the targeting complex
FT                   (TRAPP) involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02255g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02688"
FT                   /db_xref="GOA:Q6CY89"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY89"
FT                   /protein_id="CAH02688.1"
FT                   /translation="MESTIEPCKVRTLVVPVGTWKKDAYLAAVDELERHGEIRLVDVTP
FT                   LPDCTFNPQLFPHGRVLYSFLTREHDSNSMMFLHDFEPYRKLFVVIGLCNDGLISTEAC
FT                   VNELRERYGSAISYAVIYNDRSKVVEQSTKYGFSRSEEPLETIMCDITRNFLESLHVYY
FT                   SSYKHVTLRSPGAIGGPSVLKTTLTKKSQTTAPITNPRSKKGSSLSSKDDSSSSSLSIS
FT                   DDSIKDKSKRYSSLNALSGGTSDKSMQRSKARQLKLLANLQLLAGQYLLSMNNFAEAAR
FT                   ILHKIHDYIWLGSSLEGILTCIILISYLQLPFQVPPIIHSLCSLSQNSNSILSPTTSRR
FT                   SSMQSVASPRNSVSTITAASLDHTNIDIPKLVKKIADKALYYYDYSLSYSVEFTPQVVY
FT                   CKSILRTLTFMSLCYKANGFDQRALQEMIFSDMSSSAVQNQDSLQDECIFTKSEIYQYS
FT                   TKIFELQLKSMDLSSQIQIYLTLCMVYDNLNMFRKKSFVLRILFISILSQLTNDYLSEN
FT                   YHSLIDDLMKNYRISGWEPEHKLQDASSYNWVTLQKNVLMLIIKISAHFKNYKNVVEHS
FT                   QLLLKRFSHTLTKLEQIDLLNQYILPHQNEYPVEYMDPFLIRDICFSRTRSEEMPMLKV
FT                   LRDEESRTFNDPHQIFNPFASVHHKTKENETENSNYFLVAETVQMVITFQNPFKFDVRI
FT                   NSINFTEDDAQFMKIADLDLTSCTIPASSKKQFCVGVTFVRSTLTLHQLKGLSVSVLGL
FT                   PSKFWGICKQPGKFNTQERCTLYSVPITIIDQQPTLCFLSTTLVDNRVMLLDGTETEFK
FT                   VFLRNSSLSSPINYCSVSWITNVETELKENYWTSLAPDDLYDVDSQLKWLRENFISISS
FT                   IPNEVGINESFHFSVNLDVTKAPFTLKWARITIQYGYKKSPEDLAVYVKSLTIPIEITL
FT                   QRVLEVSNVNFIPIPEAFEAASDIGWIKYLRSHQSVQSDYVLMLIDMRNSWLLPVSFSF
FT                   HYDEYVSERESLDSNETRRFVVPIRKIANYDDSPNFKDKLIPRIDESKQYLTSGLTLTQ
FT                   ENEMREKFWCREHILNRLKCTWDTALNEHTEGSVEFRQFVEKLDKQVISLVYPPSNVFD
FT                   IKVSASETTVKVGTPVRLNVTVNTTLHTDLVPIRYYILDYFTGKSVLSDHPKSIVFQGQ
FT                   TSTLVRPRITTEFNILPLKKAKFQIEIEVPGNILTREPIIITAG"
FT   gene            <203818..>204732
FT                   /locus_tag="KLLA0_A02277g"
FT                   /old_locus_tag="KLLA-ORF10890"
FT   CDS_pept        203818..204732
FT                   /locus_tag="KLLA0_A02277g"
FT                   /old_locus_tag="KLLA-ORF10890"
FT                   /product="KLLA0A02277p"
FT                   /note="similar to uniprot|P17558 Saccharomyces cerevisiae
FT                   YOR158W PET123 Mitochondrial ribosomal protein of the small
FT                   subunit PET123 exhibits genetic interactions with PET122
FT                   which encodes a COX3 mRNA-specific translational activator"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02277g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02689"
FT                   /db_xref="GOA:Q6CY88"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY88"
FT                   /protein_id="CAH02689.1"
FT                   /translation="MGKGAAKYGYKSGILPSTRRILKNPTVNQTGILERVKEAKPKGIN
FT                   GVGYAKGIKHPKGSHRNPPPLKFIDVEEVIYNTVKPKSENTTAASEQQLLKQNQAELRR
FT                   KYLSESLRNEEQRLLKQEELLKKKERVLQEQREAELKELNKERSSNLTIPTLEGIMNQP
FT                   LMRQRTAEEQEILDLKRKHNKELIEFKAKERKLANLVQLCHAADHFIVTEEQLVASVEK
FT                   AFASDNQDVLRNKLSLSTSQQTARNEGEISDALFGTLGNGKYVGLPIVKEFLSGEMEQF
FT                   NQEINTKLDELTKQAEERKDSVL"
FT   gene            complement(<205013..>205294)
FT                   /locus_tag="KLLA0_A02299g"
FT   CDS_pept        complement(205013..205294)
FT                   /locus_tag="KLLA0_A02299g"
FT                   /product="KLLA0A02299p"
FT                   /note="similar to uniprot|Q12330 YOR159C Saccharomyces
FT                   cerevisiae SME1 Required for pre-mRNA splicing, cap
FT                   modification and U1 U2 U4 and U5 snRNA stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02299g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02690"
FT                   /db_xref="GOA:Q6CY87"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY87"
FT                   /protein_id="CAH02690.1"
FT                   /translation="MSGSKVGAPMVPPINCIYNYLHHQTTVTFWLYEQVQTRIRGKIRG
FT                   FDEFMNVVIDDAFEIAVDPKSGKESDDKAVFLGRIMLKGDNITLVVAN"
FT   gene            <205567..>208452
FT                   /locus_tag="KLLA0_A02321g"
FT                   /old_locus_tag="KLLA-ORF10888"
FT   CDS_pept        205567..208452
FT                   /locus_tag="KLLA0_A02321g"
FT                   /old_locus_tag="KLLA-ORF10888"
FT                   /product="KLLA0A02321p"
FT                   /note="similar to uniprot|Q99189 Saccharomyces cerevisiae
FT                   YOR160W MTR10 Nuclear import receptor mediates the nuclear
FT                   localization of proteins involved in mRNA-nucleus export"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02321g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02691"
FT                   /db_xref="GOA:Q6CY86"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY86"
FT                   /protein_id="CAH02691.1"
FT                   /translation="MLYQIPDIKSALICTQSVSEQEKKIQALQFLEQFQKSIEAWQICF
FT                   EVLSKHEADNLQLQMFACQTLVNKVTYDLNQVNTELESFKGKLFEFIAMYEEKIIVTQL
FT                   NVALARFTIQYLDWRNPLVEIINTLNGLPGKLLLFLKILPEETLDIKSTPLSQDEFECR
FT                   THELIDNIGEDVLKFLISCLDRVGTEGISASKIISCFGSWCYEFPIEQVLQVTPLINTV
FT                   FQVLHTSYDTDSDSFEAAVECLCVLLRETRDAANDTIIHALYEQLLALQQKLLPITTIS
FT                   DWEEYEEIMDPLTRLFVEAGEAWCVFLAKNPALFKPLVEVILVLTCKNTDLDIVSYTFP
FT                   FWFNLRQMLVLQRYAQQRKEYQDVFINLTNGLITHLHYPETVFENKEDEDKFKDFRYNI
FT                   GDVLKSCAAVLGSTVALQQPYNLINQYLQKEDPNTVWQPLEAALFAVRTMAHEISHTEN
FT                   VVLPQLFKQLCIHPLTHPKLVYSTILVFSRYTEWTSKHEDLLEIQLNYIFNGFEAGQSN
FT                   HDLSVAASNALMYFCQDCSSLLVNYCGQLVDFIWKIERAVDNYSMFEMCQGLSSVINEQ
FT                   ETAKIGGIFNSFTSQHNKRFDIIIQQFISNPSDPDLSAKVAHYIDLLYAILENIVPKFE
FT                   YPEQGVEEPLIASISEHITKLINLLDAYAISNVIIVDRTMKFFRRVFEKYHLFTQPILP
FT                   AVSEFVAKGYSTSGLGAYLWFSGSIIYVYGDDEYYPVDVQVKEAVWQFACQQCSTFFNN
FT                   FKSMQTLDKFFEMVHDFFLMCNDLLMFFPEHMMNTPVLISSLIQWDLESLPKLDNFEAY
FT                   MTLIRFLDDLSSWGFKTPPISVTSITEVPDAWRCTILEQVVSKNGSNIVTALINGLVTN
FT                   FDSRAHQEIISLIVKIFRLATENNNNDPSVCLEWLDSALRKMGTIESNERSKLMSIGNA
FT                   LIQRDYRRCRGNIKDFIDWYLRKHISSRMYT"
FT   gene            complement(<208673..>210334)
FT                   /locus_tag="KLLA0_A02343g"
FT                   /old_locus_tag="KLLA-ORF10886"
FT   CDS_pept        complement(208673..210334)
FT                   /locus_tag="KLLA0_A02343g"
FT                   /old_locus_tag="KLLA-ORF10886"
FT                   /product="KLLA0A02343p"
FT                   /note="similar to uniprot|Q12412 YOR161C Saccharomyces
FT                   cerevisiae PNS1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02343g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02692"
FT                   /db_xref="GOA:Q6CY85"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY85"
FT                   /protein_id="CAH02692.1"
FT                   /translation="MFGEGNKPTEPVPAYDAGQDPFQGPNASKNQYQGSAADYNGAPPP
FT                   PASQPGNQYQFRQDQYYNLNAEGEGAPIGSFEEKFPVEGEDSKPKWNDWPFTIFFAGCV
FT                   IAFIVVAAITLRAWSQNSSSQGSGVYDGANTGTLTTNSAIMLAISCIIAFVFSIIGIVL
FT                   ARMFPKFFIIAGILFNIIAGLATAIMYLSLKYYSAGIVFLVFTAICALFYWRMRHRIPF
FT                   TVAVLKTVMDVMKSYPQTWFVTLIGSIIATAFSILFSAVIVATYMKYDDKANNPGCSTN
FT                   GGSCSNAKLIGLLVLVFFCGYYIAEVIRNVIHCTVSGIFGAWYYFSKSDQGMPKWPGFG
FT                   ALKRSLTYSFGSICFGSLIVTIIETLKAVLRLAVDGVMGGGGADNGWMQCLALIANWIF
FT                   SFLEWLARYFNHYAYVFIALYGKPYLRAAKETWYMLREKGIDALINDNLVNVALSFFTL
FT                   FTCYITTLFAYLYLRYTDPNYNDNNNFTPALMAFAFVIAMEICNVITETIRSGTATFFV
FT                   ALGNDPEVFHLSYPERFDEIFRAYPEVLKKLSHQNV"
FT   gene            <211300..>212568
FT                   /locus_tag="KLLA0_A02365g"
FT                   /old_locus_tag="KLLA-ORF10883"
FT   CDS_pept        211300..212568
FT                   /locus_tag="KLLA0_A02365g"
FT                   /old_locus_tag="KLLA-ORF10883"
FT                   /product="KLLA0A02365p"
FT                   /note="similar to uniprot|Q99312 YOR155C Saccharomyces
FT                   cerevisiae ISN1 Inosine 5'-monophosphate (IMP)-specific 5'-
FT                   nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02365g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02693"
FT                   /db_xref="GOA:Q6CY84"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY84"
FT                   /protein_id="CAH02693.1"
FT                   /translation="MSSRYRVEYNLKVHKKDAFIEWIKGLLAVPFVLQAGTDSGAERTY
FT                   KQYCSIFSDIENLVSQKIEIQNRRRQLGSLEEARLDQLVPQVGTFFTHLPLVEAFEVQN
FT                   RRRAICSRKMVSPSFNDIRHILNSAQILALLKSKELKLVTFDGDVTLYEDGGSIERGGK
FT                   IVTRIITLLKRGINVGVVTAAGYDDPDKYKERLYGLCFALFSDKSMSLEQKSKLTVMGG
FT                   ESNYLFQYFETSEQFGFKSIDDDEWVPSSVKAWSDDDIDATLDVAQTCFGELSHLLALP
FT                   SKCQIIRKKRAVGFVPGFIFDDELEVNVKIKIPREALEEMVLVVQKKLESYPPAQNIQF
FT                   SCFDGGSDVWCDIGGKDLGVSILQNFYQTDSPITAAQTLHIGDQFAPKGSANDFKARSA
FT                   GCTLWISSPRETIEVLDDLLPYL"
FT   gene            <213276..>213779
FT                   /locus_tag="KLLA0_A02387g"
FT                   /old_locus_tag="KLLA-ORF10881"
FT   CDS_pept        213276..213779
FT                   /locus_tag="KLLA0_A02387g"
FT                   /old_locus_tag="KLLA-ORF10881"
FT                   /product="KLLA0A02387p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02387g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02694"
FT                   /db_xref="GOA:Q6CY83"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY83"
FT                   /protein_id="CAH02694.1"
FT                   /translation="MYPILLRYWCSVALFKALRPVWYFIPFGFVIFPLGLLSLSKEAYL
FT                   QLKIYQLQKSELDSRTVASAFLSRYNWFWNSAPVLNTDKYIFGDLSLRIASLLETLSLL
FT                   PEIMEPLYGSIESLVNFTSTNSAKMTESRQDKADKKSESSFYKDYDLLEDILFEFKTNT
FT                   PEGT"
FT   gene            complement(<214096..>214177)
FT                   /locus_tag="KLLA0_A02409r"
FT   tRNA            complement(214096..214177)
FT                   /locus_tag="KLLA0_A02409r"
FT                   /product="transfer RNA Ser (AGA) cove"
FT   gene            complement(<214580..>215095)
FT                   /locus_tag="KLLA0_A02431g"
FT                   /old_locus_tag="KLLA-ORF10879"
FT   CDS_pept        complement(214580..215095)
FT                   /locus_tag="KLLA0_A02431g"
FT                   /old_locus_tag="KLLA-ORF10879"
FT                   /product="KLLA0A02431p"
FT                   /note="weakly similar to uniprot|Q2ZX20 Shewanella
FT                   putrefaciens CN-32 Sputcn32DRAFT_3504 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02431g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02695"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY82"
FT                   /protein_id="CAH02695.1"
FT                   /translation="MDIDWESAHHELLQFLIHEVKEYLSFDPNSTFYALALDIEFDHLR
FT                   VSIALNTIAKHERILKQYYLGDETNSEEKFDIKYNTGDWEDGIFANKFLVDSETFDNFT
FT                   RVASDEQVESVNAKFRATAWSVLKKFVDTNEYESIPKVRPFVAFVIDHDEEVEDALRLA
FT                   KEAGTSEL"
FT   gene            complement(<215305..>216177)
FT                   /locus_tag="KLLA0_A02453g"
FT                   /old_locus_tag="KLLA-ORF10877"
FT   CDS_pept        complement(215305..216177)
FT                   /locus_tag="KLLA0_A02453g"
FT                   /old_locus_tag="KLLA-ORF10877"
FT                   /product="KLLA0A02453p"
FT                   /note="similar to uniprot|P49954 Saccharomyces cerevisiae
FT                   YLR351C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02453g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02696"
FT                   /db_xref="GOA:Q6CY81"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY81"
FT                   /protein_id="CAH02696.1"
FT                   /translation="MSAVLKSKLKVALVQLAGSSPDKSANLSRAAQFVAKAMDAQPDTK
FT                   LVVLPEFFNAPYAVDKFREYAEVITPDATSVKALSEIARKWKVTLVGGSIPELEPSTDK
FT                   IYNTSLIFNEDGEIIGTHRKAHLFDIDIPNGITFKESVTLSGGNKNTLIDDPKIGKFGV
FT                   GICYDMRFPELAMVSARKGAFAMIYPSAFNTTTGPMHWHLLARSRSIDNEIYTILCSPA
FT                   RSGGSGYQAYGHSLVVNPRGEIIAEAGEGEEIVYAELDPQLIKEVRQAIPVTFQRRFDI
FT                   YPDVSKTDK"
FT   gene            complement(<216566..>217687)
FT                   /locus_tag="KLLA0_A02475g"
FT                   /old_locus_tag="KLLA-ORF10874"
FT   CDS_pept        complement(216566..217687)
FT                   /locus_tag="KLLA0_A02475g"
FT                   /old_locus_tag="KLLA-ORF10874"
FT                   /product="KLLA0A02475p"
FT                   /note="similar to uniprot|Q9HGY3 Candida boidinii DAO1 D-
FT                   amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02475g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02697"
FT                   /db_xref="GOA:Q6CY80"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY80"
FT                   /protein_id="CAH02697.1"
FT                   /translation="MSNKSQPLITVVGAGISGLYVTYCLTELYGVPGENICIVADYLPG
FT                   DQSPTGYTSPWAGGVWSCISPDDKNVMWYDRFTYENLPTLSEKLLDFYKGKDAEWLGLA
FT                   RRPSTELWDYQPPKAKINSLSQYLEEYKVLSKEELAKFKPEGAQFGIAFNSWNFNCPVF
FT                   IVNLANFLKQKHNVRFLKQKLTHIAQAKSFANKASKTDNGTHVVFNCTGLGSKKLSGVA
FT                   DHNLYPTRGQVAVISAPHIAESCLRYGKDYVTYIIPRPGKVHELVLGGFLQVDNWNAQD
FT                   TSKEETDDILKRTTTLLPKIGNPENLPILKIAAGLRPSRYGGPRVEKEIKEESEHLVVV
FT                   HNYGASGYGYQSGLGMAFKAVSLAFDKQRPSKL"
FT   gene            <218592..>219680
FT                   /locus_tag="KLLA0_A02497g"
FT                   /old_locus_tag="KLLA-ORF10872"
FT   CDS_pept        218592..219680
FT                   /locus_tag="KLLA0_A02497g"
FT                   /old_locus_tag="KLLA-ORF10872"
FT                   /product="KLLA0A02497p"
FT                   /note="highly similar to uniprot|P14681 Saccharomyces
FT                   cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
FT                   (MAPK) involved in signal transduction pathways that
FT                   control filamentous growth and pheromone response"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02497g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02698"
FT                   /db_xref="GOA:Q6CY79"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY79"
FT                   /protein_id="CAH02698.1"
FT                   /translation="MPRTITYDIPSHYQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQ
FT                   PFSRSMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKI
FT                   INQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCL
FT                   ASSDQSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFP
FT                   GKDYHHQLWIILEVLGSPTLEDFEQIKSKRAKEYISQLPMKKGIPWANVLNKEVNPLAI
FT                   DLLSKMLTFNPDKRISAVEALEHPYLATYHDPDDEPDYPQLNLEDNFWKIDNEARDKNE
FT                   EDDIPLELLKKMLYGEVMKPLN"
FT   gene            <220146..>222500
FT                   /locus_tag="KLLA0_A02519g"
FT                   /old_locus_tag="KLLA-ORF10871"
FT   CDS_pept        220146..222500
FT                   /locus_tag="KLLA0_A02519g"
FT                   /old_locus_tag="KLLA-ORF10871"
FT                   /product="KLLA0A02519p"
FT                   /note="similar to uniprot|Q06479 Saccharomyces cerevisiae
FT                   YLR352W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02519g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02699"
FT                   /db_xref="GOA:Q6CY78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY78"
FT                   /protein_id="CAH02699.1"
FT                   /translation="MISETSTMRLPSEIVYEILSYQFKDLMSNDHSATSEKYHSNIKTF
FT                   LGSNSTVNRTFHHVCRVLIYRYLNFTTARSFHKLLNTLKEDDPGLRKLVEVADFQELTS
FT                   IGLGRTGEMNRMIKNLTNETLWEFLLLTKNTLREFLASEHIQGDIDERIVHFLLSPGTV
FT                   LSVVDFCGCSGSVFTKQFVTAVEKMAAHPSSRENFQITCLGLNDCTDIPDNTLSKLLNL
FT                   LPELQKLDLTHTAIDDGTLINNLPHWKNLTHLSFGECLQLTPRGILEFFSYHPAVTDEN
FT                   NNSTLQWLNVQVHPHTSTWTDTQTLFLLKKLCQYGHNKTLEYLNIGGLPLHYSDDRTLI
FT                   KTPHYYQCHDSLQFIKLNFPALKSLNIKDTNVPYDRIIQFLSPVHDSDIEVEQKLKFLN
FT                   ISNNSYINRWTIQDPALFTCSDSLVSLELSFDSWQQIENLNDRHELNCFKNKTGRTSII
FT                   QDIKNMESVKWKCYIDSSYGRRYWLYKCDPYLNRENIDQAASLTRYDSDGRKIIEIVKQ
FT                   PDFLKFAQNKIMLGCGIVPMNSARRRLIYKDMKPPISRFFNRDGRFATPGTHAMPILSP
FT                   RLPPGGWRLIRNDDEDTTTEDDASTIEENSPIIHNSFQSLTSIPETRPPLVRENTRDAI
FT                   YWDRSATSADPTLTESEYENAETDYDYLNDPELQRRRSQMSLFNSYHRSSSKNNLNNNN
FT                   NGNTSNLTNAFKQHSQSQSQSQTSLPHYLSTPSSEHYKKNDKNKLSADYVYDPNEPEMN
FT                   KRYRIHYEQLQEYKVFGTVERGMYRYYSLKT"
FT   gene            <223318..>224913
FT                   /locus_tag="KLLA0_A02541g"
FT                   /old_locus_tag="KLLA-ORF10867"
FT   CDS_pept        223318..224913
FT                   /locus_tag="KLLA0_A02541g"
FT                   /old_locus_tag="KLLA-ORF10867"
FT                   /product="KLLA0A02541p"
FT                   /note="some similarities with uniprot|P41698 Saccharomyces
FT                   cerevisiae YLR353W BUD8 Protein involved in bud-site
FT                   selection diploid mutants display a unipolar budding
FT                   pattern instead of the wild-type bipolar pattern and bud at
FT                   the proximal pole"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02541g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02700"
FT                   /db_xref="GOA:Q6CY77"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY77"
FT                   /protein_id="CAH02700.1"
FT                   /translation="MVSLSENEDVSSSSGGSVEDEILRRPLRQDSFFKEEHLISTGSRT
FT                   GTEFSVILNDTYIPESSDESKDRSISMEGPSVAYSKVSHSFSNSNSNSNSSTSSKQRKL
FT                   ANNRNSQYMRLSLNSTSSGSAHSTPLIGVNLQSDKFSSANTSRDTVNTEALLDPRRSFS
FT                   NTPLVHSTQTESPQLSTSNDVGNATFPQDSSRDNAENMKRSSKAVSTPALGSSDQVLDE
FT                   RIVEETESDETSDKKNRTSSFYPAHTESLQADETHDIIDDYEYGDTKPAIEEAVKLFKM
FT                   EARRANLLELNHGDNKNLHRRQTSLLSSILVPPPKSASKSSPAEGNSQEPKTLIPALRK
FT                   VSGSSTPTARQGQFQPYEEQTANVNPFIAPIPAQPTSVPIEREISNHDYESDALHYIRA
FT                   SRKRLDEFNDMERNLPMQRVDVSSVNSEKSKISAWSQFSDLFSITRLLCLFLTCLIVPP
FT                   LFFFIGFGEVTGFDDEKLMKFIMHSQHRYGLMPGFIWAVDLSWIRRIFIISGFLETVVL
FT                   FACIGVGFGVGLSR"
FT   gene            <225343..>226095
FT                   /locus_tag="KLLA0_A02563g"
FT                   /old_locus_tag="KLLA-ORF10866"
FT   CDS_pept        225343..226095
FT                   /locus_tag="KLLA0_A02563g"
FT                   /old_locus_tag="KLLA-ORF10866"
FT                   /product="KLLA0A02563p"
FT                   /note="similar to uniprot|Q75CW0 Ashbya gossypii ACL194C
FT                   ACL194Cp and some similarites with YGR042W uniprot|P53227
FT                   Saccharomyces cerevisiae YGR042W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02563g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02701"
FT                   /db_xref="InterPro:IPR018838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY76"
FT                   /protein_id="CAH02701.1"
FT                   /translation="MSFVIKEFTCQYSDQIRKKHKTWHDGKLKYSEFNNRFQLFTEDGV
FT                   QLSSKLLTNSKQVADILNDEGYGIEEHRIFGSYFVIILELSSEYIRDESKSANSAIIKS
FT                   EYGNRNKTPIGSVKQSQHIELNQKRASKTIASVSDTAKKPFKRPIILSHSQSNLQNTHI
FT                   KADPDRRLTEDTRLRQEASDKASAERITAISQECFRSSLNVSQTTELNEVSAASLDPVE
FT                   YIRQTNSILKTGRLRQKNYVIRNSPIVL"
FT   gene            complement(<226562..>227674)
FT                   /locus_tag="KLLA0_A02585g"
FT                   /old_locus_tag="KLLA-ORF10864"
FT   CDS_pept        complement(226562..227674)
FT                   /locus_tag="KLLA0_A02585g"
FT                   /old_locus_tag="KLLA-ORF10864"
FT                   /product="KLLA0A02585p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02585g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02702"
FT                   /db_xref="GOA:Q6CY75"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY75"
FT                   /protein_id="CAH02702.1"
FT                   /translation="MVNGSRSSAELPTIKRRVSKACDACRKSKTKCDGERPCSRCLKEN
FT                   KLCTYSNSNIGYAESKCKKLYNQEYVDLLETRNSLLTKALSYLFRQFDRCVDSGLVQIH
FT                   PERFSEFRQLQMQSMILNQRSDMDDLDSDEYDEWEQVGSSQNPELSVRDGPAAAWMNLR
FT                   KNKNLFINKETGKLNVNEVVYSIIPTNVDMAVKSLNYIHGGREQIDRAALEAGSNNKTS
FT                   SHVYDKLLARGYVDSETLFTSDHSKEGIPEDANIELPKRKRRKMLSPNEARGIPNSSQI
FT                   QQSDSMVQILPIPAMADTVTMKQDVDGRVPTDYNSNSRMIQRSGNISLDNAANQLSYSN
FT                   QAQQWYPKLEYGQFDLLESFSSDYKKQSTK"
FT   gene            complement(<231111..>232115)
FT                   /locus_tag="KLLA0_A02607g"
FT                   /old_locus_tag="KLLA-ORF10858"
FT   CDS_pept        complement(231111..232115)
FT                   /locus_tag="KLLA0_A02607g"
FT                   /old_locus_tag="KLLA-ORF10858"
FT                   /product="KLLA0A02607p"
FT                   /note="highly similar to uniprot|P15019 Saccharomyces
FT                   cerevisiae YLR354C TAL1 Transaldolase enzyme in the pentose
FT                   phosphate pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02607g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02703"
FT                   /db_xref="GOA:P34214"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P34214"
FT                   /protein_id="CAH02703.1"
FT                   /translation="MSEPSAKKQKFANSLEALKATGTTVVADTGDFESIAKFTPQDATT
FT                   NPSLILAAAKQQAYAKLIDSAVQYGKKQGQNIDEQVEIAVDKLLVEFGTAILKVVPGRV
FT                   STEVDARLSFDKDATVKKALEIIKLYEAEGISKDRVLIKIASTWEGIQAAQELEKEHDI
FT                   HVNLTLLFSFAQAVAAAEANVTLISPFVGRILDWYKASTGETYTAETDPGVISVKSIYN
FT                   YYKKHGYNTIVMGASFRNVGEIKALAGVDFLTISPKLLDELLSSDEPVAKILDPESAKA
FT                   EGSERVSFINDEPKFRFELNEDAMATEKLSEGIRKFSADIVTLFDLIKAKIQA"
FT   gene            complement(<233822..>235501)
FT                   /locus_tag="KLLA0_A02629g"
FT                   /old_locus_tag="KLLA-ORF10853"
FT   CDS_pept        complement(233822..235501)
FT                   /locus_tag="KLLA0_A02629g"
FT                   /old_locus_tag="KLLA-ORF10853"
FT                   /product="KLLA0A02629p"
FT                   /note="some similarities with uniprot|P32338 Saccharomyces
FT                   cerevisiae YGR044C RME1 mediates cell type control of
FT                   sporulation negatively regulates IME1 and sporulation zinc
FT                   finger protein negative regulator of meiosis directly
FT                   repressed by a1-a2 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02629g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02704"
FT                   /db_xref="GOA:Q6CY73"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY73"
FT                   /protein_id="CAH02704.1"
FT                   /translation="MVTIYSPVAEEENTSNDSHLYSTVDSNYGISRVLGLESSLRNSDR
FT                   FTSRNEKRIDRNLNTEEFGFNYFEHAFRENVNQPHFSTTRGSVYQVSPEYENIHKERGV
FT                   QDVKVSSIPNWYDFDLAENGNAFEHSNYSTSDRNSFFINEKGGRKKHARSVDGFERDNA
FT                   IVSHVFESRASMPQVITPITPNHPKSFKEYQSLMAMNMHMNNGMNHFISENMNFNNSSM
FT                   EHLEIQQPRVKSYRSYQNTANLAYANARSKFNSVPNLSLSSFEQTPASLHQEHHYVLQN
FT                   HQHHNNFIPDFEVDHFHDHKHEEVHESAHDHMHKVEHFRSCSNDHEPSSSDLDSTSLSY
FT                   EELRNSIIEKFTFNTAEEHTNNDVILNVHGCGSHYAEASTMNPDGTKKSVLQQILDDKP
FT                   LMEAISKKQKRGAYKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKILGLPKL
FT                   QELKRHCLNQHIDELTPEQQYLIHGKSGAVSEVYHCESPYCDKAFHRKDSYRRHVKMVH
FT                   KNPKSRFNIRLVKAMKSCPEYLNKDLVAKERFLVEKMNSRRR"
FT   gene            complement(<238735..>239409)
FT                   /locus_tag="KLLA0_A02651g"
FT                   /old_locus_tag="KLLA-ORF10850"
FT   CDS_pept        complement(238735..239409)
FT                   /locus_tag="KLLA0_A02651g"
FT                   /old_locus_tag="KLLA-ORF10850"
FT                   /product="KLLA0A02651p"
FT                   /note="similar to uniprot|P34227 Saccharomyces cerevisiae
FT                   YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with
FT                   thioredoxin peroxidase activity, has a role in reduction of
FT                   hydroperoxides; induced during respiratory growth and under
FT                   conditions of oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02651g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02705"
FT                   /db_xref="GOA:Q6CY72"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY72"
FT                   /protein_id="CAH02705.1"
FT                   /translation="MRNILPKQAIYIGAKAPNFQAMTSLGPMDFYQYTQGKWCVFFSHP
FT                   ADFTPICTTEIGAFGALQDEFTNRDCVLLGLSTNNRASHLRWIQDIEAITGVKINFPII
FT                   CDEEKKVATQFSMIDVNALTNGEPALTPLRAVYIIDPNKIVRLIQLYPLSTGRNTAEVL
FT                   RCLDSLQLVYKTDGKIMTPINWIPGDDIVVVPDLENCSMFPHRRTIRDYLQLSPLDPNS
FT                   LD"
FT   gene            complement(<240153..>241346)
FT                   /locus_tag="KLLA0_A02673g"
FT                   /old_locus_tag="KLLA-ORF10849"
FT   CDS_pept        complement(240153..241346)
FT                   /locus_tag="KLLA0_A02673g"
FT                   /old_locus_tag="KLLA-ORF10849"
FT                   /product="KLLA0A02673p"
FT                   /note="highly similar to uniprot|P06168 Saccharomyces
FT                   cerevisiae YLR355C ILV5 Acetohydroxyacid reductoisomerase
FT                   mitochondrial protein involved in branched-chain amino acid
FT                   biosynthesis also required for maintenance of wild- type
FT                   mitochondrial DNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02673g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02706"
FT                   /db_xref="GOA:Q6CY71"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY71"
FT                   /protein_id="CAH02706.1"
FT                   /translation="MFRQAARQLIANSRVITAKRAISFAARQSTVSGLRSTAFASKPLV
FT                   ATRGIKQINFGGVEETVYERADWPTEKLLQYFKDDTLALIGYGSQGYGQGLNLRDNGLN
FT                   VIVGVRKNGASWKAAIEDGWVPGENLFDVNEAVQKGTIVMNLLSDAAQSETWSSLKPLL
FT                   TKGKTLYFSHGFSPVFKDLTHVEPPTDIDVILVAPKGSGRTVRSLFKEGRGINSSYAVW
FT                   NDVTGKAHEKAQALAVAVGSGYVYQTTFEKEVNSDLYGERGCLMGGIHGMFLAQYEVLR
FT                   ENGHSPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPIFKDALKPV
FT                   FQDLYESTKNGSETKRSLEFNSQPDYREKLEAELQIIRNMEIWKVGKEVRKLRPENN"
FT   gene            <242521..>243228
FT                   /locus_tag="KLLA0_A02695g"
FT                   /old_locus_tag="KLLA-ORF10845"
FT   CDS_pept        242521..243228
FT                   /locus_tag="KLLA0_A02695g"
FT                   /old_locus_tag="KLLA-ORF10845"
FT                   /product="KLLA0A02695p"
FT                   /note="weakly similar to uniprot|Q06485 Saccharomyces
FT                   cerevisiae YLR356W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02695g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02707"
FT                   /db_xref="GOA:Q6CY70"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY70"
FT                   /protein_id="CAH02707.1"
FT                   /translation="MSVCLTATKSIALVSAGLNSGLCFGGVLSPEPTDVTAKRTTNNFD
FT                   LNREIAIGVLSSLSTGFYAASYFGAPTQWKHPYLLYTGALALISTGITAFKLIRRMVWP
FT                   IVYKRIRCHSKESHVDEKSSAHINQDITDSVQEQDNDESDHGQDDSVVLVSESSNHSID
FT                   SGANDAPSTLPLLPTHTENKSSRLSTTDQCGWSSLLSAFTSDAVLDTVRTISSVGLLLL
FT                   GTVGGLGEPLALI"
FT   gene            <245082..>246380
FT                   /locus_tag="KLLA0_A02717g"
FT                   /old_locus_tag="KLLA-ORF10843"
FT   CDS_pept        245082..246380
FT                   /locus_tag="KLLA0_A02717g"
FT                   /old_locus_tag="KLLA-ORF10843"
FT                   /product="KLLA0A02717p"
FT                   /note="weakly similar to uniprot|P53233 Saccharomyces
FT                   cerevisiae YGR052W FMP48 The authentic non-tagged protein
FT                   was localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02717g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02708"
FT                   /db_xref="GOA:Q6CY69"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY69"
FT                   /protein_id="CAH02708.1"
FT                   /translation="MHKYQPIDVIQTGSFSTVYRAYDSKTGSYVAMKVVSKPADPVKLE
FT                   AISKLVRNEYRVLKKLGNRHPNICAMLDFYQDHEKFVFVLEYCHNGDLYDYMKRIKESG
FT                   GTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLGIAHRDFKPENILVTNTG
FT                   KIKLTDFGLSYFGEVASDHGIGTEKYLAPETFSHNDTYNTYSADLWSLGISVLYIVFGS
FT                   CPFKSANIDSPTKNTNFIVFNDNPVKFVKQYYLPNLLEGSNRSNNCSESSRHAIVGSQD
FT                   YWLELVPNLSHPEHLLLLISRLVIAHLLCPPTHRNIDTFYANIDYFTNDVQMIKCCPEI
FT                   TPPLSSSSSSSSASLSAQKYNQKQCATYPPSPASLKSTSFSFLNFEPAAESISFEDWIP
FT                   RDNSRNSWTYDWDANTTWPIDSESFAVLSSNSV"
FT   gene            complement(<246644..>247255)
FT                   /locus_tag="KLLA0_A02739g"
FT                   /old_locus_tag="KLLA-ORF10841"
FT   CDS_pept        complement(246644..247255)
FT                   /locus_tag="KLLA0_A02739g"
FT                   /old_locus_tag="KLLA-ORF10841"
FT                   /product="KLLA0A02739p"
FT                   /note="some similarities with uniprot|Q45U33 Saccharomyces
FT                   cerevisiae YGR053c"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02739g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02709"
FT                   /db_xref="InterPro:IPR031342"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY68"
FT                   /protein_id="CAH02709.1"
FT                   /translation="MSTTIRRLGFLRSVRRYSGTSGCADIGNNGKMSTENIRRVNLGCT
FT                   ITYLQSNVPHLLQTSLHEPRLSKDIELKIMPITHPYLPSFSGITKYYAVWNSIRFLLNT
FT                   FAFSVENRVRIKSLDVEKHEVIMRWETHPLAADNLGSIKKAESETKISGIFIFGLNENC
FT                   DKITSHLIDDVEIIEKDKKIDFSSKVQNGAIAYFKTWSGP"
FT   gene            <247871..>249628
FT                   /locus_tag="KLLA0_A02761g"
FT                   /old_locus_tag="KLLA-ORF10839"
FT   CDS_pept        247871..249628
FT                   /locus_tag="KLLA0_A02761g"
FT                   /old_locus_tag="KLLA-ORF10839"
FT                   /product="KLLA0A02761p"
FT                   /note="similar to uniprot|P53235 Saccharomyces cerevisiae
FT                   YGR054W yeast homolog of mammalian eIF2A"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02761g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02710"
FT                   /db_xref="GOA:Q6CY67"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY67"
FT                   /protein_id="CAH02710.1"
FT                   /translation="MSFQLFAKTNSTVEVFQGYPSFEEISSSKSGNDGTEGKVIQSLLS
FT                   PCGRFMAKSYESKVVLLIGETWEITLVELPLKNVYDLKFSPSGNFLSTWERPLVDDTEH
FT                   LNCKIWNLNESPLSTEPKYSYKASTQSSWTLQFSKLDDYAIKSFGKELRIIKLSGEDTF
FT                   KFDKPFATLTPDQPFTTYQISPAEHPTICTFTKEKSGKPAQLTIWPITTGKITKQIVTK
FT                   QFFKADSCHLKWSDLGNAILCLTTTDFDHSNKSYYGENNLYLLSFQGVNGALGGESVRV
FT                   SLGKEGPIHDFNWSPTSRQFGVIYGFMPATITFFDLKGNAIHSLNEQRKNTLEFSPNGK
FT                   YILVGGFGNLQGSVDILDRHDKFRCISKFSATNTSVCKWSPGGEFILTATTSPRLRVDN
FT                   GLKIWHYSGTLVFVKEYKELLKVDWRTNCPFRIIKDGYVTNGNKLKDEELKQDPKIRKH
FT                   QLEIHPVVTQFNLKNPNKSSTNLGAKKTTGAYKPPHARKATVVPGTTKTRAPQSTPTPP
FT                   LQQSAASQTSPEEKKIRSLLKKLRAIESLKVKQTEGVKLENTQVTKIQSEPKILKELEL
FT                   LGWKGELDS"
FT   gene            complement(<249870..>249975)
FT                   /locus_tag="KLLA0_A02783r"
FT   tRNA            complement(join(249870..249905,249938..249975))
FT                   /locus_tag="KLLA0_A02783r"
FT                   /product="transfer RNA Gln (CTG) cove"
FT   gene            <250872..>252191
FT                   /locus_tag="KLLA0_A02827g"
FT                   /old_locus_tag="KLLA-ORF10836"
FT   CDS_pept        250872..252191
FT                   /locus_tag="KLLA0_A02827g"
FT                   /old_locus_tag="KLLA-ORF10836"
FT                   /product="KLLA0A02827p"
FT                   /note="highly similar to uniprot|P38755 Saccharomyces
FT                   cerevisiae YHR001W OSH7 Member of an oxysterol-binding
FT                   protein family with seven members in S. cerevisiae family
FT                   members have overlapping redundant functions in sterol
FT                   metabolism and collectively perform a function essential
FT                   for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02827g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02711"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY66"
FT                   /protein_id="CAH02711.1"
FT                   /translation="MPFKLKSKISASTGDISSTAHPQVADPNIVEDTDDIDENDDAGQS
FT                   ILMGIITQLKPGCDLSRITLPTFILEKKSMLERIANQLQFPDLLLEAHKEKDELERFIK
FT                   VVKWYLSGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAFYIAEQTSHHPPKSSYFYM
FT                   IPESNIRVDGTTIPKSRFLGNSTAAMMEGLSVLQFLDITDPKTGKPEKYTLTQPNMYAR
FT                   GILFGKMKLELGDHMLIKGPKYQIDIEFKTKGFISGTYDAIEGIIKDYNEKEYYEITGK
FT                   WNDLIYYKDLREKHSKKAVLFDTNTAVPLKPSVRPLEEQGEFESRRLWKKVTDALAKRD
FT                   HVEATDEKFKIENNQRILAKKRIEDGVEFHPKLFRTASPGDDLEFYVYKSIPPGTDHES
FT                   HEDQIKSILEIAPIVPGQKFTEKFSIPAYQKHDIQQKELN"
FT   gene            complement(<252275..>253204)
FT                   /locus_tag="KLLA0_A02849g"
FT                   /old_locus_tag="KLLA-ORF10835"
FT   CDS_pept        complement(252275..253204)
FT                   /locus_tag="KLLA0_A02849g"
FT                   /old_locus_tag="KLLA-ORF10835"
FT                   /product="KLLA0A02849p"
FT                   /note="weakly similar to uniprot|Q02202 Saccharomyces
FT                   cerevisiae YKR004C ECM9 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02849g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY65"
FT                   /protein_id="CAH02712.1"
FT                   /translation="MVRSLTQKVINALQADYDTSEVQFLIYPTTPPEVKDELIVVQHEQ
FT                   RTEVVCFKKTMMKIFIECHKLFYQLDSLDDDEKLLVISGLLLTTTENRTALNMFLAKLN
FT                   KLRANEINREILFVERLLSCNSARLNKSSSLWDLYKKLYTAYGSNLKFKVWDTVTISCE
FT                   RHFANYYCCNFIRWFHSQLNDSHRQNFVDNFLRFSKKHVNDPSIWSALGIMIGKTDFDQ
FT                   VIIFIDSLPVTTWSPFLAVLEFGSRNTQIIPSLMKHWTKDDTISFYNGTPIIPDYIEND
FT                   LNSKSKFMSNAWKTHLLEKLQRLQLDAT"
FT   gene            complement(<253619..>255511)
FT                   /locus_tag="KLLA0_A02871g"
FT                   /old_locus_tag="KLLA-ORF10834"
FT   CDS_pept        complement(253619..255511)
FT                   /locus_tag="KLLA0_A02871g"
FT                   /old_locus_tag="KLLA-ORF10834"
FT                   /product="KLLA0A02871p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02871g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02713"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY64"
FT                   /protein_id="CAH02713.1"
FT                   /translation="MLKRICSGIAIWAALGAAQFEQQISQCKDLESSISALDLSQCSPG
FT                   LEQCLLATMGVGNENCAACVQVSGDLQLESNCACIECIISNLNSKCFTAYCSSSGTNHA
FT                   VLQKLNEELGKDSKLTIPVIAENHELQYYVDNNEEIHRPLLDLEKQRLVHNFLTFAKYQ
FT                   LGNTFAGLGKRDFPCDQVDCERLDALIDEHGDEHSDEVQDAKFWKKLKKLKEKKGKKGG
FT                   DDDDDDDDDDDESGKPPCSEKECTTTFVSTSYKPKKRIMTSWKPIKITITETLTGKDCK
FT                   GKVITKTLWDTETQTETETDWATTTKWKWKKEHTVTATKTEQTPVTKVIYKHDKLTVTE
FT                   TEFEVSTRTKYKHDKATITETELEEVTKTKRVATDTTTIVKWKTDTEWDTTTKIKKKTI
FT                   PTTETETETETETETETATTTATTTSLTTVTTTASKVKMPLLSGLGFDLLNANNIQNVS
FT                   VTDYVLGYTTSKTATPGNKSSSVIATPSSEPLPNSVSGHEKTMRYSNDSNSSNSDTFES
FT                   SSSTSTDVTKSWIISSIAALAGIVFIYTMSEQRVRPENPGGNQGQEPASNDDGDSENSS
FT                   VTISKVSDFEMDTEDLIDSDIRKLLNNSIPHAGSTKENLASQLVEDPLGIIEVA"
FT   gene            <256320..>258233
FT                   /locus_tag="KLLA0_A02893g"
FT                   /old_locus_tag="KLLA-ORF10831"
FT   CDS_pept        256320..258233
FT                   /locus_tag="KLLA0_A02893g"
FT                   /old_locus_tag="KLLA-ORF10831"
FT                   /product="KLLA0A02893p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02893g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02714"
FT                   /db_xref="GOA:Q6CY63"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY63"
FT                   /protein_id="CAH02714.1"
FT                   /translation="MTTKSPVKRQQQDTLFSSSPSVSESRKRQSKRDEAIRRKLENDLS
FT                   KKKAGKSSTKKGQNSGKKNRNASSPGTVLSLSPSEPVVCKPSATVYEAAQLMSAKRENC
FT                   ILVVDYDDDTNLEDDSSISGALLGIFTAKDLAFRVVGTGLKASSVTIDQIMTPHPLCAT
FT                   SDTLASDALNLMVERGFRHLPVIDEDTHAIISVLDITKCYQEAMEKLERMYEHSKKLHD
FT                   AFNSISNEIGGLSGGSQPFEVVKYFEHMKSVMNGPTLESVLHDETTVPSYVNVKTSVHE
FT                   AALTMKDNHTTAVLVKNEVNEVSGIFTSKDVVLRVIAAGLDPKTVSVIRVMTPQPDVAP
FT                   KTLSIQQALRKMFEGHYLNLPVVDDGEIVGIVEVLKLTYATLSQINLISDAESHNSQSQ
FT                   RSSVPTTPSKNAAPGPAWNKFWNGFDLMNDSSSVHSESVFSNGPPEISQTELNQFQLDN
FT                   GMHLNDSVSFVNGETSSLMGSSHITSQEDIRTCLHSFKFKTLTNNKTHRVSLRPIEGVS
FT                   KLVELIGEKLGGSDDVEILYVDDENDLVSITHDQDLIDCVLVHKNMNLDKIDLLVHYRY
FT                   ETVPQDAVNRLIQNRFKKNVPSHPKPSNQLIPGIPNETLLPAVIVALGASIAVIFSLSR
FT                   KH"
FT   gene            complement(<258504..>259265)
FT                   /locus_tag="KLLA0_A02915g"
FT                   /old_locus_tag="KLLA-ORF10830"
FT   CDS_pept        complement(258504..259265)
FT                   /locus_tag="KLLA0_A02915g"
FT                   /old_locus_tag="KLLA-ORF10830"
FT                   /product="KLLA0A02915p"
FT                   /note="similar to uniprot|Q758P2 Ashbya gossypii AEL289W
FT                   AEL289Wp and weakly similar to YKR006C uniprot|Q02204
FT                   Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial
FT                   ribosomal protein of the large subunit not essential for
FT                   mitochondrial translation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02915g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02715"
FT                   /db_xref="GOA:Q6CY62"
FT                   /db_xref="InterPro:IPR018305"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY62"
FT                   /protein_id="CAH02715.1"
FT                   /translation="MMLASRYVPVVRSSRQFTSSAVRSDFLSWFRRNKNKDAGVVSTQP
FT                   ELQRDTKEVINEIESGKTTVVKSSTVTRLELTDDDFVGIDSSRREELIRLQKLDVVPFN
FT                   EWLSQDKLSTEQQLEQVVLESYQETFGDVPTEEQLGKPFENLVNKFKFSKLLQCKSGHI
FT                   IPDYELTRLQTPLEFKSWFEIKVLSGQLGKFKESEPNAIDLSNIKFPPNVYVVPDVKPS
FT                   VKKQKVKKILEEVAALEAQYERDAIEKAKRD"
FT   gene            <259865..>260296
FT                   /locus_tag="KLLA0_A02937g"
FT                   /old_locus_tag="KLLA-ORF10828"
FT   CDS_pept        259865..260296
FT                   /locus_tag="KLLA0_A02937g"
FT                   /old_locus_tag="KLLA-ORF10828"
FT                   /product="KLLA0A02937p"
FT                   /note="some similarities with uniprot|Q02205 Saccharomyces
FT                   cerevisiae YKR007W MEH1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02937g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02716"
FT                   /db_xref="GOA:Q6CY61"
FT                   /db_xref="InterPro:IPR028209"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY61"
FT                   /protein_id="CAH02716.1"
FT                   /translation="MGNVLSCCFRQDSDENDPLLQEQDRYGSQAQLDYNEMEQRQKERV
FT                   LARELELTEIVNNTNDKLIDIGMISNSGIVASSHDLGSSYVQDQREILHDVPLTVLPSS
FT                   KIKQDTRKAIQEFHKKYFANLVKNLTVEYNKPLVANIES"
FT   gene            <260627..>262306
FT                   /locus_tag="KLLA0_A02959g"
FT                   /old_locus_tag="KLLA-ORF10826"
FT   CDS_pept        260627..262306
FT                   /locus_tag="KLLA0_A02959g"
FT                   /old_locus_tag="KLLA-ORF10826"
FT                   /product="KLLA0A02959p"
FT                   /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
FT                   YKR008W RSC4 One of 15 subunits of the 'Remodel the
FT                   Structure of Chromatin' (RSC) complex found in close
FT                   proximity to nucleosomal DNA displaced from the surface of
FT                   nucleosomal DNA after chromatin remodeling"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02959g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02717"
FT                   /db_xref="GOA:Q6CY60"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR027180"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY60"
FT                   /protein_id="CAH02717.1"
FT                   /translation="MAVKRSRSEDPSEEPEQKHSKQNYVPRYTPGKRPRSGALPKVDYV
FT                   HPLDPTEELIVDLDWTIPKLNLFIAFTLDNLVEAHKALFKHFIKLPSRKFHPQYYYKID
FT                   QPISINEIKSRDYEYSGGETKFLLDCELIYKNCLAYNDPDSLIVKNAKQVVYFIKNEVL
FT                   KVKNATRNFLVNDDVKTRFIAIFDTLLNVTDKQMAEILAEDDDVKLEAASNNNLDDTLN
FT                   ICQPFLELVDKDEYPEYEEVIRLPNSLNLVKNNLELGYYHKIYDFITDVNLTFQNALVF
FT                   NDEDTTIYSDALKLMKCFSVLIQRRFFPELETAREKGEITLEYDKIEYKQFVQEEEEEE
FT                   PILSDDDETNEEYNYIEGLGNGYNRGPMSRDYLLGPSKTSKTADSKVENNEPDKPLPLK
FT                   FNILPVIKKHNIEPKTEPVPYKVIEKIQISSSRSFYEQSIRPLKGLYQNSDNITWFEYI
FT                   FADGALTQTSHEYAITLPPKQNSITVVSQLSSPVSEDSPAVLIANKDKVNPIPVLDGDK
FT                   FDESKARYDIKLAEGLNTVTFSVRDSENDRLETAKFWISVLP"
FT   gene            complement(<262440..>264356)
FT                   /locus_tag="KLLA0_A02981g"
FT                   /old_locus_tag="KLLA-ORF10823"
FT   CDS_pept        complement(262440..264356)
FT                   /locus_tag="KLLA0_A02981g"
FT                   /old_locus_tag="KLLA-ORF10823"
FT                   /product="KLLA0A02981p"
FT                   /note="weakly similar to uniprot|Q12188 Saccharomyces
FT                   cerevisiae YPR007C REC8 Meiosis-specific component of
FT                   sister chromatid cohesion complex maintains cohesion
FT                   between sister chromatids during meiosis I maintains
FT                   cohesion between centromeres of sister chromatids until
FT                   meiosis II homolog of S. pombe Rec8p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A02981g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02718"
FT                   /db_xref="GOA:Q6CY59"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY59"
FT                   /protein_id="CAH02718.1"
FT                   /translation="MAEVGVRIAQDQNIATVWLLSSLGASHSVNVKKREIVKVSIPHAC
FT                   QILASGQVSMPLRHTGQLLYGVTVCYERKTGFILADVTSLRDALQRQWIGLKPLGKSTG
FT                   GSGGHNKTKMVQNQVITETGDNFLQDDPNFDMMMQLKMDNNLDFLLNGNNNTNDRQILT
FT                   NSTRAPVLADKQAIRQDDMWREMEIGNEPYLNARSRGNTVNSGHDFHINGDADEYEDDD
FT                   LAPIDVELNFRLDEVLTDNEAETANLSSVHSDLGLNYDNDATHGIDLGMPVLDETETSN
FT                   PHLQQMKRRLGLDNEDEDEDGNTLNEVEVNAKSTKNKKRRTVANWFQKIKVDSTIGLLT
FT                   DTLRYNHENYKDIMRDLHARRSSKSKPMISDWKELFTDEDRPRQMLNFYSELFQPLSSI
FT                   NFPQGRRGRVMHSAGDTSRSSSVLSLEHGRRMDFSNVSSSGDSNRIHLHNLPEQINEYP
FT                   EYMDMPMDDPQFMELDIPPSSFGRSTNRNYTANSDNLENLRGYPNRRRGAIRGDSGSAD
FT                   YLSGSDSIPQTFNENQQQLIVHDKQTEKFFQYIVERGQHIGKRTAAFPGYSRKFLFEDI
FT                   IPSKLSQEEDEEIIPVTKRIACNAFLSLLQLATSSKLKIDLYNVEPEKVFRVLNGDDII
FT                   VYC"
FT   gene            <264785..>265393
FT                   /locus_tag="KLLA0_A03003g"
FT                   /old_locus_tag="KLLA-ORF10822"
FT   CDS_pept        264785..265393
FT                   /locus_tag="KLLA0_A03003g"
FT                   /old_locus_tag="KLLA-ORF10822"
FT                   /product="KLLA0A03003p"
FT                   /note="weakly similar to uniprot|P43592 Saccharomyces
FT                   cerevisiae YFR008W FAR7 Protein involved in G1 cell cycle
FT                   arrest in response to pheromone in a pathway different from
FT                   the Far1p-dependent pathway interacts with Far3p Far8p
FT                   Far9p Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03003g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02719"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY58"
FT                   /protein_id="CAH02719.1"
FT                   /translation="MESGKDAENQPVLFMGAQTENLDYMYELVHELSAQLKTNENMRDA
FT                   VLQDVDLLSRQLNHGNVDVSPDINVTKQFIYKRLKDEELSIQDEEEEDGNEEDNMLHHV
FT                   TKQNEQLKEILKNQQRRNAVALQALRHHDEGLEICVTMLRNEIYSYHVTVLSRSRDLIE
FT                   NQLYKAEDSQFNQYLESVTDLQQLLDLCKLYRTLLRAHP"
FT   gene            <266917..>268077
FT                   /locus_tag="KLLA0_A03025g"
FT                   /old_locus_tag="KLLA-ORF10821"
FT   CDS_pept        266917..268077
FT                   /locus_tag="KLLA0_A03025g"
FT                   /old_locus_tag="KLLA-ORF10821"
FT                   /product="KLLA0A03025p"
FT                   /note="similar to uniprot|P40088 Saccharomyces cerevisiae
FT                   YER145C FTR1 High affinity iron permease involved in the
FT                   transport of iron across the plasma membrane forms complex
FT                   with Fet3p expression is regulated by iron"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03025g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02720"
FT                   /db_xref="GOA:Q6CY57"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR005217"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY57"
FT                   /protein_id="CAH02720.1"
FT                   /translation="MAANKVFNVAVFFVVFRECLEAAVIVSVLLSFLKQSIGSNDMATY
FT                   KRLRMHVWIGVVAGFIICMAIGGGFIGAYYRYENDIFGSAEDLWEGVFCIIATLMISVM
FT                   GIAMLRVNKMQAKWRVKIAKAMLEVPKDRRKKWSLKYWATRYSMFLLPFITVLREGLEA
FT                   VVFVAGAGITTKDSKATAYPLPVVIGLIAGIIVGTLLYYGTSKSSLQIFLVISTCVLYL
FT                   IASGLFSRGVWYFDNYYFNKKTGGDASESGDGNGSYNILRTVYHVNCCNPELDNGWDIF
FT                   NSLLGWQNTGYLSSILAYNLYWLVLMIVIGLMMYEERNGHLPFCKNLKLRQLKPSYYLK
FT                   RKQNEELTAAEQEELFKQVNNLGVDEEGNVVVNKGDTTKVNVELVK"
FT   gene            <269553..>271256
FT                   /locus_tag="KLLA0_A03047g"
FT                   /old_locus_tag="KLLA-ORF10818"
FT   CDS_pept        269553..271256
FT                   /locus_tag="KLLA0_A03047g"
FT                   /old_locus_tag="KLLA-ORF10818"
FT                   /product="KLLA0A03047p"
FT                   /note="similar to uniprot|Q758P8 Ashbya gossypii AEL295C
FT                   AEL295Cp and some similarites with YPR008W uniprot|Q12753
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03047g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02721"
FT                   /db_xref="GOA:Q6CY56"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY56"
FT                   /protein_id="CAH02721.1"
FT                   /translation="MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPSTTCAH
FT                   CKELRKNRNANPSGQCTCGRQEKKRIAQKAREESGCVCKNDPDHCPCHKKRAPRRKKQS
FT                   HQGNSAVGLDINGKISKHTNSGYSHQSLHSLDSSHSVDQDLSNFLASPISMNTSFSTGW
FT                   DNASLSSSNRSPPGNGPDSKNTIGLEPLSTMKPITPKTRTKVGEVFIPLTEYVPTNIAS
FT                   SEDQADHINPLLMGEHVSIYNDVSADAPNVTYFADTSKSLSYNQLKEQRKALSEQHLRN
FT                   NVDNISKSGSTQRVPLSVAGRSSSFVSNISSHDSVASSNNDFISSLNSSDSLSSMLHSG
FT                   NAHHYQDMLHHSNNGRGYLNPVQVDQSQNVYGFDTDSVRSVEVLSITPSFMDIPESKPP
FT                   SIGSNSSTNPFISWKSVNSRRERSVSIHKNHRYDNENKRKRHPKNVPNTSTPQIKSMVS
FT                   PAETNSTALPASGNHFNSPADSTNTVLSANTQYGDPSVFSIEKVGVAPSFVEPSFTTDF
FT                   NQALKQSNMVNQNIIDNNSLFSGTSEGNNPSPNDLFPVEFADIDDLMTHL"
FT   gene            complement(<271516..>274203)
FT                   /locus_tag="KLLA0_A03069g"
FT                   /old_locus_tag="KLLA-ORF10817"
FT   CDS_pept        complement(271516..274203)
FT                   /locus_tag="KLLA0_A03069g"
FT                   /old_locus_tag="KLLA-ORF10817"
FT                   /product="KLLA0A03069p"
FT                   /note="highly similar to uniprot|P32863 Saccharomyces
FT                   cerevisiae YGL163C RAD54 DNA-dependent ATPase stimulates
FT                   strand exchange by modifying the topology of double-
FT                   stranded DNA involved in the recombinational repair of
FT                   double-strand breaks in DNA during vegetative growth and
FT                   meiosis member of the SWI/SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03069g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02722"
FT                   /db_xref="GOA:Q6CY55"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013967"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY55"
FT                   /protein_id="CAH02722.1"
FT                   /translation="MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFK
FT                   VNKTDHAKRYGVRSSRRSQTTYANMDSSLDSDLHVKRKDALSLSRLNAEPSRLDTIYST
FT                   LRRSFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGDIPEQH
FT                   EDLESFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTLKELL
FT                   GSSEDNTSKKFPNVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKTVLDSS
FT                   SQSMEKADTQADSNITGSKSPVETDVSSLKDVIKINENSRNRGAYGCIMADEMGLGKTL
FT                   QCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLAIDGKKSS
FT                   LNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLADEGHRLKNA
FT                   DSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFRKNFELPILQ
FT                   SRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIFINLTPFQQS
FT                   LYQHFIESRAVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGSEELIPDDYQSS
FT                   VDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDLIEKMCFSNH
FT                   YGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILLDPDWN
FT                   PAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDEKEDVERL
FT                   FSSDNLKQLFKLDTKTICDTHETYNCKRCKNGKQILKAPVMLYGDATSWNHLNHDALAK
FT                   TNDHLLKNEFNHKDISFAFQYISH"
FT   gene            <276333..>277484
FT                   /locus_tag="KLLA0_A03091g"
FT                   /old_locus_tag="KLLA-ORF10812"
FT   CDS_pept        276333..277484
FT                   /locus_tag="KLLA0_A03091g"
FT                   /old_locus_tag="KLLA-ORF10812"
FT                   /product="KLLA0A03091p"
FT                   /note="some similarities with uniprot|Q12286 Saccharomyces
FT                   cerevisiae YPR009W SUT2 Involved in sterol uptake
FT                   homologous to SUT1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03091g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02723"
FT                   /db_xref="GOA:Q6CY54"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY54"
FT                   /protein_id="CAH02723.1"
FT                   /translation="MSSIIIDNCNNTSLPPLLLPAVVHHDERNTYLNKLSASNFKQDKS
FT                   VSGLNLISNSSSWSKPSANYTTSKTAVLLTPPNSNINSSTATASSSLDDLASLASVAAA
FT                   TNNVALPKDTIGSSYNSHQHPLIHDCLQRKRSNSSADEESLAAPVAFKKRGRKNSRKNS
FT                   MRMSSNTSFTLSSAVSSNTTSSTTSRSSSRSKSPLSRAQSVSNSPSSVEEDAGVTRGFD
FT                   DNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDE
FT                   SLHCPLSIDTCRPDILMKIPTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKKKDRDC
FT                   SFSKGFTRNDIAVFSTLNKKLGKRNSLGDFTVKDYLNVGYSLD"
FT   gene            complement(<277880..>278677)
FT                   /locus_tag="KLLA0_A03113g"
FT                   /old_locus_tag="KLLA-ORF10810"
FT   CDS_pept        complement(277880..278677)
FT                   /locus_tag="KLLA0_A03113g"
FT                   /old_locus_tag="KLLA-ORF10810"
FT                   /product="KLLA0A03113p"
FT                   /note="weakly similar to uniprot|P53108 Saccharomyces
FT                   cerevisiae YGL161C YIP5 Protein that interacts with Rab
FT                   GTPases computational analysis of large-scale protein-
FT                   protein interaction data suggests a possible role in
FT                   vesicle-mediated transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03113g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02724"
FT                   /db_xref="GOA:Q6CY53"
FT                   /db_xref="InterPro:IPR039765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY53"
FT                   /protein_id="CAH02724.1"
FT                   /translation="MSAKKDLIDRDDDDINPFEDDSFVPQVTPGLKPFEPELQDITLET
FT                   TREAPQPAITTGKASIFSKLSPYFQVDETTLKQKLITALKLGELKSLRDPESQADAQLD
FT                   LYSTVWITATVIMVLFLSYSGKSVIGSLITNSFSDVIDFQIMINCLFLFYIYVLGVPIL
FT                   AFLICKFVFKEPFDVITAIDTYGVSNVVWVPIGFISVVTGLVGPFENIIEWVLVAIGGA
FT                   YSGGIIYIQLKNVVTELQNGKVLLLAMIGVHILFTLLVRWIIL"
FT   gene            <279951..>281165
FT                   /locus_tag="KLLA0_A03135g"
FT                   /old_locus_tag="KLLA-ORF10809"
FT   CDS_pept        279951..281165
FT                   /locus_tag="KLLA0_A03135g"
FT                   /old_locus_tag="KLLA-ORF10809"
FT                   /product="KLLA0A03135p"
FT                   /note="similar to uniprot|P32579 Saccharomyces cerevisiae
FT                   YGL169W SUA5 Protein required for respiratory growth null
FT                   mutation suppresses the Cyc1p translation defect caused by
FT                   the presence of an aberrant ATG codon upstream of the
FT                   correct start"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03135g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02725"
FT                   /db_xref="GOA:Q6CY52"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY52"
FT                   /protein_id="CAH02725.1"
FT                   /translation="MLRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLL
FT                   EAAGIIRDTSETVAFPTETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLN
FT                   RVIYSDISDDCKPLSHVPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTF
FT                   ACRIPANPIARALIALSDTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSV
FT                   GVESTVVDGLVTPPMLLRPGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKY
FT                   RHYSPKAKVILLVPEGDSQIISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKHFID
FT                   GKCIHESLGTTGKEIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAASN
FT                   NIINF"
FT   gene            complement(<281313..>284129)
FT                   /locus_tag="KLLA0_A03157g"
FT                   /old_locus_tag="KLLA-ORF10806"
FT   CDS_pept        complement(281313..284129)
FT                   /locus_tag="KLLA0_A03157g"
FT                   /old_locus_tag="KLLA-ORF10806"
FT                   /product="KLLA0A03157p"
FT                   /note="uniprot|O74296 Kluyveromyces lactis KlPMR1 Ca++
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03157g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02726"
FT                   /db_xref="GOA:Q6CY51"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY51"
FT                   /protein_id="CAH02726.1"
FT                   /translation="MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQL
FT                   GTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISF
FT                   LMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASN
FT                   LVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGS
FT                   IIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKL
FT                   GQDLSYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLR
FT                   MAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKV
FT                   KERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVN
FT                   KINEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKA
FT                   IINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRS
FT                   AIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVI
FT                   DHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAK
FT                   EASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPL
FT                   NAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIV
FT                   GTIYVFVKEMAEDGQVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNY
FT                   AVSLSLLGQLCAIYIPFFQGIFKTESLSLGDLLFLLTLSSSVFIGDEIRKYYVKKNRYL
FT                   DSYSSSIV"
FT   gene            complement(<285228..>286244)
FT                   /locus_tag="KLLA0_A03179g"
FT                   /old_locus_tag="KLLA-ORF10799"
FT   CDS_pept        complement(285228..286244)
FT                   /locus_tag="KLLA0_A03179g"
FT                   /old_locus_tag="KLLA-ORF10799"
FT                   /product="KLLA0A03179p"
FT                   /note="weakly similar to uniprot|P36027 Saccharomyces
FT                   cerevisiae YLR332W MID2 Protein required for mating"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03179g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02727"
FT                   /db_xref="GOA:Q6CY50"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY50"
FT                   /protein_id="CAH02727.1"
FT                   /translation="MQFVIPLLLLVSAIKPVLGQQSAAENDGGITASNGTTSTLSPSSS
FT                   LASSSEEQSTFTVITSSSDGEVSSTEEPFVSSSEAPEETSMSEVSTSFISTDISSSSEL
FT                   PSNTTTSSSSSSSSESSTSSSSTSSSTSSSTSTSSDLDETTTSSEEETTSTSVESSSDP
FT                   TTTHPPTTITSVINGVTILSDRYTTVTFTPTSTSDPDSREGQHTGLSDKNKRIVIGVVV
FT                   GLGVPILLVLLALIYIFCIKPKRTNFLNSEGKVVTAYTSGKVSKWWKAFMGKQTDDYVT
FT                   ESPESGIDEPSVLAPTRNNTVGRNNTDGHRKSHSNELMLDEEKYYDDDGNELNGRNY"
FT   gene            complement(<287031..>288167)
FT                   /locus_tag="KLLA0_A03201g"
FT                   /old_locus_tag="KLLA-ORF10795"
FT   CDS_pept        complement(287031..288167)
FT                   /locus_tag="KLLA0_A03201g"
FT                   /old_locus_tag="KLLA-ORF10795"
FT                   /product="KLLA0A03201p"
FT                   /note="some similarities with uniprot|Q04951 Saccharomyces
FT                   cerevisiae YMR305C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03201g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02728"
FT                   /db_xref="GOA:Q6CY49"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY49"
FT                   /protein_id="CAH02728.1"
FT                   /translation="MRLNYVLSKTLALASVVSAAAVHKHHAAEEKRDVTVVVTNFVDQN
FT                   GQVLVDGQTSATDATTTLQPVTDIGGGKSVETTTVTSSSGSSSSLSGSSTSSSGGTSSS
FT                   SSSTSSSSDASSSSSGEYGGALGITYSPYTSSGSCKSSDTIKSDIQNLSQFSVIRIYDT
FT                   DCDAMEAILSQLQSGQKIFVGIYDIDNIASSVSAIESAFNGDFSKVYAISVGNELINAG
FT                   TSTVSQLSSAVESAKSKLSAIGYTGDVVTVDTLVATENNSGLCSMSDFIAVNCHPYWDG
FT                   NVEPSNCGPWVKQQLDNLSSTCNNGKKIIVTETGWPTKGDTYGSCVPSKSNQETCVQSI
FT                   IDTLGSQAILFTTYNDYWKDAGAQGVEQYWGIFGDSSV"
FT   gene            <290002..>292035
FT                   /locus_tag="KLLA0_A03223g"
FT                   /old_locus_tag="KLLA-ORF10790"
FT   CDS_pept        290002..292035
FT                   /locus_tag="KLLA0_A03223g"
FT                   /old_locus_tag="KLLA-ORF10790"
FT                   /product="KLLA0A03223p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane, subject to glucose-induced inactivation, strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03223g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02729"
FT                   /db_xref="GOA:Q6CY48"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY48"
FT                   /protein_id="CAH02729.1"
FT                   /translation="MSDSTDKDRHNKNSSRGIVNTDIEDDNSPSPLDTTDKKGAPELQK
FT                   PGNPSLFKESALKNSDQLQFRNSFNIPNAVGGTNGIVIPPNVQPLDQQRIPPSYTDHLQ
FT                   VKDTYLTGRTLLYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGTMVS
FT                   ILEIGALVSSLLVSNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIG
FT                   VGLLSTIVPIYQSEISPPHNRGKLACIEFTGNIVGYASSVWVDYACSYIESDTSWRLPL
FT                   FIQCVMGLLLFLGSFVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHEEYKLIK
FT                   ETVLISRLEGEKKSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVG
FT                   REALLMTGINSIIYILSTILPWKLVDKWGRKPILLSGALVMGTSLLAIAMSLWANVAAT
FT                   PRLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTATNWLFNWLVGIMTP
FT                   ILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDRSSTFSFQSGTSA
FT                   EIEQQSHLVSGGGEVAPSTRSRKSVYSNAQSMFNKDEIQPPTLTQVLQWKEERTQTKPL
FT                   KKFIRRGSETVCLIYNKVRNLRSTNDTNQIEYGAVSNNQPPN"
FT   gene            complement(<292179..>293015)
FT                   /locus_tag="KLLA0_A03245g"
FT                   /old_locus_tag="KLLA-ORF10789"
FT   CDS_pept        complement(292179..293015)
FT                   /locus_tag="KLLA0_A03245g"
FT                   /old_locus_tag="KLLA-ORF10789"
FT                   /product="KLLA0A03245p"
FT                   /note="highly similar to uniprot|Q12009 Saccharomyces
FT                   cerevisiae YDL201W TRM8 Subunit of a tRNA methyltransferase
FT                   complex composed of Trm8p and Trm82p that catalyzes 7-
FT                   methylguanosine modification of tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03245g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02730"
FT                   /db_xref="GOA:Q6CY47"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY47"
FT                   /protein_id="CAH02730.1"
FT                   /translation="MSFSTRRQAYRAEKQDHRKELKHVKIDESVIEKVDKLSLPKKKFY
FT                   RQRAHSNPFSDHQLEYPISPAHMDWSKLYPHFYDSEKKKMTKDVTIADIGCGYGGLMID
FT                   LSPEFPDEMILGMEIRVQVTNYVEDRIIALRTNHAKENGYQNINVLRGNAMKFLPNFFN
FT                   KGQLSKIFFCFPDPHFKQRKHKARIVTDTLLSEYAYVLKEGGIIYTITDVLDLHEWMVK
FT                   HLEEHPLFERLSEEWEAQDKCVSIMRNATEEGKKVERNKGDKYIACFVRLPTPDII"
FT   gene            complement(<293329..>294066)
FT                   /locus_tag="KLLA0_A03267g"
FT   CDS_pept        complement(293329..294066)
FT                   /locus_tag="KLLA0_A03267g"
FT                   /product="KLLA0A03267p"
FT                   /note="similar to uniprot|P36521 Saccharomyces cerevisiae
FT                   YDL202W MRPL11 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03267g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02731"
FT                   /db_xref="GOA:Q6CY46"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY46"
FT                   /protein_id="CAH02731.2"
FT                   /translation="MLSLLLRSPVVVSRVSYASPFLVRRFASTQIERTVSDAVRRTVKP
FT                   LDSRKTFLIDSYKNLMETSPVMLFCHHNNLMKGENAHFREEINKVGGKLTILRNNLFQV
FT                   YLRNSRKNDPAAPAKRSEQDWKHPLLPLFKGPTAAISFPETDPAKVKKVMKLLEKAQDK
FT                   LFVIGAKVENDAYDLRQLDSFKDLPTKSQLQSELLGLLHVLSGAGLVQTLEAGSNMLYL
FT                   TLKSHEDNINPDKQKNENDSEGN"
FT   gene            complement(<294825..>295898)
FT                   /locus_tag="KLLA0_A03289g"
FT                   /old_locus_tag="KLLA-ORF10786"
FT   CDS_pept        complement(294825..295898)
FT                   /locus_tag="KLLA0_A03289g"
FT                   /old_locus_tag="KLLA-ORF10786"
FT                   /product="KLLA0A03289p"
FT                   /note="weakly similar to uniprot|P47177 Saccharomyces
FT                   cerevisiae YJR149W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03289g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02732"
FT                   /db_xref="GOA:Q6CY45"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY45"
FT                   /protein_id="CAH02732.1"
FT                   /translation="MSTKKALTEILGIKYPILVAPMAGVSTPELAAAVSNSGGLGSLGL
FT                   GASSVEKARNAIIATQKLTKSPFQVNFFCHEPEELNVEVARNWIEYLKPIFARFHTKPE
FT                   KELTKIYNSFLEDPEMLAVVLELKPKVVSFHFGVPSASTLKSLKQAGVVTMASVTQLSE
FT                   AELAIGHGIDILIAQGVEAGGHRGMFNASLDPAISTRDLVKLLKAKLGTTIPIVAAGGI
FT                   MSGQDIKGMMEVGASGAQLGTAFVQCKESAASENYRKLLFDKTRNDITQITSSISGRPA
FT                   RALLNSWHTEVDIPTRVIHPGYPFTYDVGKQLNAVSIPDHDGTANSFAAHWAGSNVSRI
FT                   RDMDARQLMQTLVDEMR"
FT   gene            <296290..>297294
FT                   /locus_tag="KLLA0_A03311g"
FT                   /old_locus_tag="KLLA-ORF10785"
FT   CDS_pept        296290..297294
FT                   /locus_tag="KLLA0_A03311g"
FT                   /old_locus_tag="KLLA-ORF10785"
FT                   /product="KLLA0A03311p"
FT                   /note="uniprot|O60012 Kluyveromyces lactis Putative sulfate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03311g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02733"
FT                   /db_xref="InterPro:IPR035189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY44"
FT                   /protein_id="CAH02733.1"
FT                   /translation="MLTDLFSALFSIEDGTTESVTPKYGHGVQEDDIDLQLRALIYCYQ
FT                   RLKVKEMSPFYPVDSTTEDGETLGDGSVALDKVYNLEQFIAMLQEDPHHILVDWCKNKA
FT                   RLMCILSSTPVRTVNKLPKGFSYLILEPDSSEDLYFQRLVYDSKLYHEHDVPLSWKIQC
FT                   LREIIKKQYTLVPTRRKSFNKQDRWQIMIRYLSKLAEHVQIERVYKAYRSQPPATRRLS
FT                   NSSDGSEQSMLTRGLKSKPSMTILRLDRSVTSRSTTHTSALSRNQPNSPLILSRSPSPK
FT                   KSSNYNAFTNTHNSTNNDSLLYQQSRNCVIKRLEREKQRRESESEQALISTSL"
FT   gene            complement(<297542..>299665)
FT                   /locus_tag="KLLA0_A03333g"
FT                   /old_locus_tag="KLLA-ORF10784"
FT   CDS_pept        complement(297542..299665)
FT                   /locus_tag="KLLA0_A03333g"
FT                   /old_locus_tag="KLLA-ORF10784"
FT                   /product="KLLA0A03333p"
FT                   /note="highly similar to uniprot|Q01574 Saccharomyces
FT                   cerevisiae YAL054C ACS1 Acetyl-coA synthetase isoform
FT                   expressed during growth on nonfermentable carbon sources
FT                   and under aerobic conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03333g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02734"
FT                   /db_xref="GOA:O60011"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60011"
FT                   /protein_id="CAH02734.1"
FT                   /translation="MSPAVDTASTAKDPISVMKSNASAAAADQIKTHEYEHLTSVPIVQ
FT                   PLPITDRLSSEAAQKYKPNLPGGFEEYKSLHKESLENPAKFYHERAQLLNWFKPYDQVF
FT                   IPDTEGKPTFENNAWFTNGQLNACYNLVDRHAFTQPNKVAILYEADEPGQGYSLTYAEL
FT                   LEQVCKVAQILQYSMNVKKGDTVAVYMPMIPQALITLLAITRIGAIHSVVFAGFSSNSL
FT                   RDRINDAYSKTVITTDESKRGGKTIETKRIVDEALKDTPQVTNVLVFKRTHNENIKYIP
FT                   GRDLDWDEEVKKYKSYTPCEPVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQALLSMK
FT                   YTFDIQNDDIFFTAGDIGWITGHTYCVYGPLLQGCTTLVFEGTPAYPNFSRYWEIVDKY
FT                   QVTQFYVAPTALRLLKRAGDSFTEGFSLKSLRSLGSVGEPIAAEVWEWYSEKIGKNELP
FT                   IVDTYWQTESGSHLVTPLAGGATPMKPGAAAFPFFGIDLAVLDPTTGIEQTGEHAEGVL
FT                   AIKRPWPSFARTIWKNNDRFLDTYLKPYPGYYFTGDGVARDKDGFFWILGRVDDVVNVS
FT                   GHRLSTAEIEAAIIEDDMVAECAVVGFNDELTGQAVAAFVVLKNKSSLTAASESELQDI
FT                   KKHLIITVRKDIGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSN
FT                   PGIVKHLIDSVKL"
FT   gene            <301465..>303819
FT                   /locus_tag="KLLA0_A03355g"
FT                   /old_locus_tag="KLLA-ORF10781"
FT   CDS_pept        301465..303819
FT                   /locus_tag="KLLA0_A03355g"
FT                   /old_locus_tag="KLLA-ORF10781"
FT                   /product="KLLA0A03355p"
FT                   /note="similar to uniprot|P39719 Saccharomyces cerevisiae
FT                   YAL053W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03355g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02735"
FT                   /db_xref="GOA:Q6CY42"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY42"
FT                   /protein_id="CAH02735.1"
FT                   /translation="MRAFSLLVGFLTTLVILPFTNGLKHIKTSSLLTCMEDSQFSASFF
FT                   EVTFFPDNKTAVFDIDATTTISENVTAKIELIIYGLNVLNEEFNLCDLDQASMCPLSAG
FT                   RIEVKSTYSLDEDNDMVGNIPGVAYTVPDIDAQVRVIVYSTNDTSFEEPLACVQAALSN
FT                   GKTVQTKYAAWPIAAISGLGVITSAIVSVIGHSTTAAHIASNSISLFVYFQNLAITSMM
FT                   GVARVPPIAAAWTQNFQWSMGMIKVGFMQNIFDWYVTATGGTPVVVVANKDILSISVQK
FT                   RGFTTQFNDFAKRSLDSLTTGLYKRISADDGYDFTKLLSESDLYTSDERNIDDISSKVI
FT                   VFTGIKRVAYLAGIELSNVFLTGIVFTLFFVFCMVIGMAVFKAVIELLMRAGYMKQTSK
FT                   FYEYRRSWASIIKGTLFRICIIAFPQVSILSIWEFTQIDSVAVVIAAVVILIVVSGLLL
FT                   YGVVRVIIRGRESTRLYKTPAYMLYGDAPFLNRFGFLYVQFKAEMYWWLMPLLAYMFFR
FT                   SLFVAVLQEHGKPQAMIIFVIELAYFIALCWLRPYLDKRTNAFNIVIHAVNLFNSILFL
FT                   FFSNLFRQPTVVSSVMAVILFVVNAIFALFLMIFTIVTCVLALVHKNPDARYQPMKDDR
FT                   VSFIPKVQTKGETGELFDLGRAAMHTNEPPLKDEFEMKQSNNSARLLFDEDIDDSNTTY
FT                   DTSSRIRRFDSSSGNEPLQPSSAVMGDNTTSYNRVPTAPSTTNLRKPENSFSANTQYQG
FT                   FSGSNPYLNENPSYNSFTRQTNNKSDNVPYL"
FT   gene            complement(<304117..>304863)
FT                   /locus_tag="KLLA0_A03377g"
FT                   /old_locus_tag="KLLA-ORF10779"
FT   CDS_pept        complement(304117..304863)
FT                   /locus_tag="KLLA0_A03377g"
FT                   /old_locus_tag="KLLA-ORF10779"
FT                   /product="KLLA0A03377p"
FT                   /note="similar to uniprot|P39721 Saccharomyces cerevisiae
FT                   YAL049C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03377g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02736"
FT                   /db_xref="GOA:Q6CY41"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY41"
FT                   /protein_id="CAH02736.1"
FT                   /translation="MASNPPGKCCAQGFYHEGTPAGTTTSLYGFETYVAGPESLKNEHV
FT                   LVIVTDIYGIKVNNVLLIADQLAAAGFRVYVPDFLFNDEVVALDGSFDFKSWLERHSAE
FT                   KTHGLVQDFLTKLKEDTNPKKIGVIGHCFGAKYALLQINEKVGLADAAALAHPSFVEIE
FT                   EVEAVGKKPVLISAAETDNIFPEELRYKTEEALKKQGSYYQINVFGGVSHGFAVRGDLS
FT                   IPAVRYAQDKTIEDQISFFKFFFNCI"
FT   gene            <305616..>308153
FT                   /locus_tag="KLLA0_A03399g"
FT                   /old_locus_tag="KLLA-ORF10778"
FT   CDS_pept        305616..308153
FT                   /locus_tag="KLLA0_A03399g"
FT                   /old_locus_tag="KLLA-ORF10778"
FT                   /product="KLLA0A03399p"
FT                   /note="weakly similar to uniprot|P39720 Saccharomyces
FT                   cerevisiae YAL051W OAF1 Oleate-activated transcription
FT                   factor acts alone and as a heterodimer with Pip2p activates
FT                   genes involved in beta-oxidation of fatty acids and
FT                   peroxisome organization and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03399g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY40"
FT                   /protein_id="CAH02737.1"
FT                   /translation="MGTNATLKELEKEVEYWRNLALGIEPEQDPVSNVSTTIRTSVARL
FT                   SATKDLAKTDGIRLNFYESFPHLVTKGIIREDIGPFAVNYMLFPDPYISIFIKFVFQTP
FT                   YRKTLNTYLGTPDSYQEFNVSSILKILKLNPSAFEKLNPLKKKKVSAFIEQILAQNQPA
FT                   SENSNSELFLATLNTMTAPRFIEDKCLYGQYSPILLAYIGRIQNDLPSLPNIRLLLDNF
FT                   YHHIYPIWPCIDIDLFEENLNEVIHMDSHNPERIIVNPGTTNIKMKLVNISILYLILQL
FT                   SISHWKLRLFDQRAMEQDVQHKYDGDRAWIEGFAELEKKLTSSAAELVSILNIYQSRTE
FT                   EVISWHMLLWNILAHQPDLCSIFYDSTSEGVIGMMGPLVSDLGLDRDPSQFLEPTGNMR
FT                   IDPRYKNYRRRLWLCYCLISRFEITVKGRTPQKSTANVQAIPGIMDQKNGWEEYSCLYK
FT                   KDMLKQNEAELELLGLFYRHLQFMTLFLPYDKLLKDNLNSLTLTEVEQVYEGLERYLEK
FT                   DVNGTFTHSQKWARHSTIDYSYNLNDVDNVFNMAKQLIARSVRLTICDLLIRFFNSRKV
FT                   HNSFDMEQSLLYCQKALADNCEGIGYLIKYFALVYNENIRTTGKFFTNRISQILLSRCT
FT                   LHTTLTILRVDHMLGLSKRRSNQESFLYEDQSAFSRLSGINEQRQQCVRIRMQLFSLLE
FT                   NLCSASSEELRYNYISGFRYALLTDCAMHFLKQNGKRFLMRDILMSNIGTNEDSAGFME
FT                   TSFHLLSSEEKENILLSANEFVHFDEAGFRLLLDTVNTFCTNSGSPNNRNTMPEQLFGY
FT                   TATSSNVLINQFSVDLAGLSANFDFVFDGGNLP"
FT   gene            <308414..>311056
FT                   /locus_tag="KLLA0_A03421g"
FT                   /old_locus_tag="KLLA-ORF10777"
FT   CDS_pept        308414..311056
FT                   /locus_tag="KLLA0_A03421g"
FT                   /old_locus_tag="KLLA-ORF10777"
FT                   /product="KLLA0A03421p"
FT                   /note="weakly similar to uniprot|P39720 Saccharomyces
FT                   cerevisiae YAL051W OAF1 Oleate-activated transcription
FT                   factor acts alone and as a heterodimer with Pip2p activates
FT                   genes involved in beta-oxidation of fatty acids and
FT                   peroxisome organization and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03421g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02738"
FT                   /db_xref="GOA:Q6CY39"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY39"
FT                   /protein_id="CAH02738.1"
FT                   /translation="METNQEANLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLN
FT                   KPCIYDLEYQPLPRKPNKDAALARLQKELEYWKYFANARLSEMKKMDSTGSEALSETSS
FT                   DYLPKHKINLSAFKPQLVYQEFRFMELKVFTNMSQIKHDCFLSTFLGTFFASASKEELL
FT                   HNVSPYLSYHANNDNSKYIDRVLHLRQNLLMRFTTEAQSNRIQDFTDRLLTGREVLVNY
FT                   RTAFFVTMLRNVFFQGKFEDSKKQEDPCPPLLERLVSEANILLPKKDALLLYKSYFYRR
FT                   LYHIYPYFDIGMFEETLDKILVDDSERPDRMIFDIGIENFRYKLTNIALLMLVLKISYG
FT                   ALQAVIDTDYNAEICDSDFIKQNPVVDQCIVFAEICLAKMCIFSGTNEVQISCMLFIWN
FT                   FFCVGNGDDDSVFGRATDIVTEMVFTLAMNNGLGRDATQYQQYQMHPSVQIELQNLRRK
FT                   LSLNVISTSVFSGILTGNFPTNIWSNAKNFLNLNGGRDEFMGLVKRSMKEIDPFELKIH
FT                   NVLFKTYKILVLLMDLEDLVKKGSPGMDLIRIDFITNAITEALNLNFSMDFDFIGGPKS
FT                   YKVELSNGKILECDVIDSYHNVQTQIIVRNLMIHLNKTLFLYFEDLCVKGNMDNLIYYK
FT                   KYLIESTRHTLELAKLSILILEGDFDRVLTDGFNMEKCKMSTEIVFPTILYSLLAFGIR
FT                   LAHAELSLTETIETFDASIIDVSALQNRLKLLTNLRKNTLYAIGRLADAMSASFQYKNF
FT                   CTFRSLLFIDAVIKLDMSRGLMDMMFYALNPQNGVFDKLNSEMKELLTHTLGVNHEKLR
FT                   EELDNLERAQFLSIVDEKFLLEIQSMMQALRFSYVDISNEADPEILPMTRPPSMPHGVS
FT                   VLNDYFKQP"
FT   gene            <311628..>314555
FT                   /locus_tag="KLLA0_A03443g"
FT                   /old_locus_tag="KLLA-ORF10774"
FT   CDS_pept        311628..314555
FT                   /locus_tag="KLLA0_A03443g"
FT                   /old_locus_tag="KLLA-ORF10774"
FT                   /product="KLLA0A03443p"
FT                   /note="similar to uniprot|Q758X5 Ashbya gossypii ADR403C
FT                   ADR403Cp and weakly similar to YAL051W uniprot|P39720
FT                   Saccharomyces cerevisiae YAL051W OAF1 Oleate-activated
FT                   transcription factor acts alone and as a heterodimer with
FT                   Pip2p activates genes involved in beta-oxidation of fatty
FT                   acids and peroxisome organization and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03443g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02739"
FT                   /db_xref="GOA:Q6CY38"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY38"
FT                   /protein_id="CAH02739.1"
FT                   /translation="MAMKEESIEPADDEKSREDQTSNGACKRQRISFVCQACRKNKTKC
FT                   DREKPRCGRCVKYHLKCVYDVEQQKPPRVPSKDAIIKRLTSEVEYWKSKAEGFQVSSNV
FT                   STTSPSDVESLHTSKRQRTGDGAPLLADVSVLSPTPVISKNSSFLVPDPQDLQFNFYKE
FT                   FPQLTMKYAMKRDIKPVSAFAHVYRDKLLSLFVASIFSSASKSALIHSISSDEINPFQK
FT                   SQIQFRQNAIFLRDSMVQLCETSMEKQKVHEFTERIMGEQIEQKEQSTLFVSLLKARLE
FT                   NKHVEDSCSHGVVSPELTRLKDSLEKALPSREDIDLYKMHFYQYIYPIIPFLDIELFEE
FT                   GLDELLNPSDGTDGRKVTICFGTRNIRSKICLLSALINILRISYLCMLFTLNSSKEDVF
FT                   DDSTLKVLTTSPITPSLVMLSQECISSVNILSWTTENGLLALMYHWAVFVFTPEEGDCY
FT                   LGQTTDALISLVSNLAVNIGLHRDPNEYKVLQDPTICDPRVFNLRKRLWLCIYIMCRHE
FT                   TTLKARYHQNTHMSSFAYASPECETKNFWCYDFGDPNRLGPYNVNMIDKIKKRHQIFLL
FT                   LSETDAVTMNLDTHMTLSDLDAWFKKVKSFLDEEFPLDGLINGVNTPQFYDLVLKNGKR
FT                   VSVNFTYFGNALCFQTHLIARMSMLRISACLMVHFENRLSDMTHDYSQYFTKYFIESFK
FT                   SLLEIAKIYQSYLTGDYNASLSPCMLFATDKICEVCLPSILLTFLGMLIRITHTESFLI
FT                   KQTVDRKGLYGLSSYIPEELKENENKLVAVTAIRKGLEVVMQNWLTLITKRLRFAFFST
FT                   FKVSIFFDYVLQIIKKQDILNVLKRVFDLNFSPKVRREIYMGTGIDINDKHAVLLSLEK
FT                   GNRVSVVSAESFEEILAMMDALQICNHYPEISTEHNDPNGVLPEEPNSVNVTEKIAHKP
FT                   SPIPMPNDNTEPTENELLEPTNMTSLLNGATFDFFDYDFLLGPTE"
FT   gene            complement(<314573..>316552)
FT                   /locus_tag="KLLA0_A03465g"
FT                   /old_locus_tag="KLLA-ORF10772"
FT   CDS_pept        complement(314573..316552)
FT                   /locus_tag="KLLA0_A03465g"
FT                   /old_locus_tag="KLLA-ORF10772"
FT                   /product="KLLA0A03465p"
FT                   /note="highly similar to uniprot|P39722 Saccharomyces
FT                   cerevisiae YAL048C GEM1 Evolutionarily-conserved tail-
FT                   anchored outer mitochondrial membrane GTPase which
FT                   regulates mitochondrial morphology cells lacking Gem1p
FT                   contain collapsed globular or grape-like mitochondria not
FT                   required for pheromone-induced cell death"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03465g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02740"
FT                   /db_xref="GOA:Q6CY37"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY37"
FT                   /protein_id="CAH02740.1"
FT                   /translation="MTKTRIRIVVCGDSGVGKTSLIACLVKDQFISWLQDVLPPITIPK
FT                   DFSSSRYSPENTVVVDTGNSDLATLHKELKNADVIWLVYSDHDSYERIALYWMMMFRSL
FT                   GVNLPVVLCRNKCDDEVEFLSSANIMDSDDDQLDNKIEDEEFIPILREFKEVETCIKAS
FT                   AKFKFNVNQAFYLCQRTITNPVAPLFDARIGELKPLGVLALKRVFVLSDMDQDGFLNDD
FT                   EITKLQKKCFSKAVDVNELQFLKDTLTSISSPNQEYEDYILNVPGKGITKDGFLVLNKI
FT                   YAEKGRHETTWGILRAFHYTDTLTINEKILRPKIDIPQSSSVELSPLGYRFFVDTFLKY
FT                   DKDNDGGLNNDELHLLFKTTPGLPHLWIETNFPFLTVVNNSACITLQGWLALWSMTTFI
FT                   DYSVTTEYLIYLGFDKDAKNALQITKPRRKRRRNGVYYRAPVFDRKVLNCYMLGKGNSG
FT                   KSSLLESFLGRSFSEAYSPTIRPKISVNSLELKGGKQYYLILQELGEQETPILENKGKL
FT                   DECDVLCLCYDSSDPESFSYIVSLIDKFDYLKELPIVFVALKADLDKQQQRCHIQPDDF
FT                   ADQLFIDHPLHISSTWPSSLNELFIKLTEVALEPITSTAGLGPAVLTNDIDYRQTIVAI
FT                   SSVVGFASLFTFTALKIYSSFKNT"
FT   gene            <316951..>317940
FT                   /locus_tag="KLLA0_A03487g"
FT                   /old_locus_tag="Klla0A.mRNA.132.p"
FT   CDS_pept        join(316951..316953,317116..317940)
FT                   /locus_tag="KLLA0_A03487g"
FT                   /old_locus_tag="Klla0A.mRNA.132.p"
FT                   /product="KLLA0A03487p"
FT                   /note="similar to uniprot|P21242 Saccharomyces cerevisiae
FT                   YOR362C PRE10 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03487g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02741"
FT                   /db_xref="GOA:Q6CY36"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY36"
FT                   /protein_id="CAH02741.2"
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDG
FT                   VVLAVEKLITSKLLVPGKNKKIQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYS
FT                   TPIPIPAFADRVGQYVQAHTLYNSVRPFGVTAIFGGVDSDGAHLYMLEPSGTYWGYKSA
FT                   ATGKGRQSAKAELEKLSNKNPNLTAREAVKEAARIIYAAHEDNKEKEFELELSWCSLSE
FT                   TNGLHKEVPKDLFDEAVDYAKKELGDDSDSDSDDSDGDDTKEKKDEEGDIEIS"
FT   gene            complement(<318067..>320397)
FT                   /locus_tag="KLLA0_A03509g"
FT                   /old_locus_tag="KLLA-ORF10769"
FT   CDS_pept        complement(318067..320397)
FT                   /locus_tag="KLLA0_A03509g"
FT                   /old_locus_tag="KLLA-ORF10769"
FT                   /product="KLLA0A03509p"
FT                   /note="weakly similar to uniprot|P39723 Saccharomyces
FT                   cerevisiae YAL047C SPC72 Component of the cytoplasmic Tub4p
FT                   (gamma-tubulin) complex binds spindle pole bodies and links
FT                   them to microtubules has roles in astral microtubule
FT                   formation and stabilization"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03509g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02742"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY35"
FT                   /protein_id="CAH02742.1"
FT                   /translation="MSDSDSVIIETKLRSGSDLDEGIRNLSLLDTDDNLKFELESGKKE
FT                   RQQEYDGSCNQIAIDTSKDDYVNKYYCNVPRRINSAVSEEDEEETTTDNTTSETDTVIS
FT                   SGDIFQLISSDNRWIKEDGRVPAVIGRNNDTHEKYRFPNDSRKVSTQRLQRGTINDFYP
FT                   PNIADSHLMTSETDVLKRQLVQYRVKVKALTEILKQVNFNNDQKLQATQNTENITNDFE
FT                   SHANTNIEEVEDSPLLREQNVKLVITLEDKNKELIRLKEELVRNKDEYETMLEEVNDYL
FT                   QHNENISNDVSNILKFLLDNMDLTAEERDNLIKAAGFESTFIDIKIKALSVNVDKIVRE
FT                   LRTIKNSDQSSGNLLADQGTISPLNDSRLDNSEVLDSKLELAIETMHEKYHDFLQSIQL
FT                   KLEKNDNLEKALKDKFQQQKLLLESMSNIEHERTSQQIPPLYLQRSQSDLFSSIDDLSK
FT                   RASIELSKSYQDHVDALNSMLQNYKRELEDKEKQLGELRSQLRNSYNTNTELDLANKIK
FT                   EQSLTLEENSARWHTQRIEYESRIEVLQDEKKDLSQKLIDAQAQMQMLEARTEEDVMEL
FT                   RKKLKTALRKSTYYMDDNQLLQEQLEELGNDHHILQDEIIKLREHVNKFSDADKGSQQL
FT                   TIIKSKLLDHLRAIFGSFEKVLQKESIDQAFNKLHNLEQLDSAKFFKKTIAKLDSVFFF
FT                   IESAIESIVTEHVDLLLNEKEEWSGSSQNDEVEKQSKLKIDELRKKWIGERERRKLESE
FT                   AATNRINMLQLENQRLREQLGIQ"
FT   gene            <320828..>323026
FT                   /locus_tag="KLLA0_A03531g"
FT                   /old_locus_tag="KLLA-ORF10767"
FT   CDS_pept        320828..323026
FT                   /locus_tag="KLLA0_A03531g"
FT                   /old_locus_tag="KLLA-ORF10767"
FT                   /product="KLLA0A03531p"
FT                   /note="similar to uniprot|P06103 Saccharomyces cerevisiae
FT                   YOR361C PRT1 Subunit of the core complex of translation
FT                   initiation factor 3(eIF3) essential for translation part of
FT                   a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of
FT                   mRNA and tRNA(i)Met to ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03531g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02743"
FT                   /db_xref="GOA:Q6CY34"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY34"
FT                   /protein_id="CAH02743.1"
FT                   /translation="MTTLESLKIEDIPVDDIDFSDLEREFQIQDGGVNFDNFLVVDGAP
FT                   VAPEAKVPVLEKVLTKLFSQAGKVLDMQIPVEDGKTKGHLFIEMESVSAAKEAIQLFNG
FT                   KKLDAKHRLLVNSLNDMEKYGSDDFESQSHEPVVPDFAPTDFLRSWLQNQDGRDQFVLQ
FT                   KGDMTRVFWNRLAHQPDGVGEARKNWSNDVVKFSPKGTYLLSFHDQGVTSWGGPNFDRL
FT                   KRFFHPDVSRLDVSPTEKFLITFSMNPIKPGEDTPFGPESEGHQICVWDLATGFLMKTF
FT                   GIPPNAKLQWPLIRFSYDDKYCGRLGPNALAIYDIENNFQLLDGKLHKVEGIQDFSFAP
FT                   KGVQLTYNRRKSDPTTLLAYWTPETNNQSCKAFLMTLPNKRIVKTVNLVQVSNVSIHWH
FT                   EQADFVCFQVDRHTKSKKTFFTNLEICKLNESEIPVEKIEMKDRVLELAWEPKGTRFVT
FT                   ISKMDNGGEENPMYPKNFVKFFAPEKKDNKDKDLAVLPDQLKWKLVKTVDQQFANCISW
FT                   SPAGRFVAVCTIVNGKEIKKASLDFYDFDFTGEKTLNEVQDVKASLQAVAHIDNQFFTD
FT                   LEWDSSGRFLTAWSSYSKHKLENGYTIYNCCGEAVRKEIVDQFRNFVWRPRPESLLSNA
FT                   EKKKARKNLKQWSVKFEEQDAMESDSALRDLILKRRAELSAWVSYREQSKERLESEDSY
FT                   TIFDNFESDKADETQYVTVEEVKEEILEETQEEVESFE"
FT   gene            complement(<323382..>323657)
FT                   /locus_tag="KLLA0_A03553g"
FT                   /old_locus_tag="Klla0A.mRNA.ml.369.m"
FT   CDS_pept        complement(323382..323657)
FT                   /locus_tag="KLLA0_A03553g"
FT                   /old_locus_tag="Klla0A.mRNA.ml.369.m"
FT                   /product="KLLA0A03553p"
FT                   /note="similar to uniprot|P39724 Saccharomyces cerevisiae
FT                   YAL046C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03553g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02744"
FT                   /db_xref="GOA:Q6CY33"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY33"
FT                   /protein_id="CAH02744.1"
FT                   /translation="MFRKTLTTLGRRLYSLTPEEKLITDKLSKELNPSSISVNDISGGC
FT                   GSMFSINITSDKFKGLSIVKQHKLVNEILKDDIKRWHGLQLRTKKE"
FT   gene            <323999..>324361
FT                   /locus_tag="KLLA0_A03575g"
FT                   /old_locus_tag="KLLA-ORF10765"
FT   CDS_pept        323999..324361
FT                   /locus_tag="KLLA0_A03575g"
FT                   /old_locus_tag="KLLA-ORF10765"
FT                   /product="KLLA0A03575p"
FT                   /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
FT                   YAL044W-A Similar to pombe uvi31 putative DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03575g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02745"
FT                   /db_xref="GOA:Q6CY32"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY32"
FT                   /protein_id="CAH02745.1"
FT                   /translation="MSFRSIFRQMSSVAANRSIDGPIAQRITKKVKDTFPDLSHFAIFN
FT                   DSYKHSGHHGIQDAANKIESHFRLEIVSGLFKGKSLPMRHRMVYGMLNEEFDDGVHALQ
FT                   LTTKTPEEYAKKHAEN"
FT   gene            complement(<324491..>325018)
FT                   /locus_tag="KLLA0_A03597g"
FT                   /old_locus_tag="KLLA-ORF10764"
FT   CDS_pept        complement(324491..325018)
FT                   /locus_tag="KLLA0_A03597g"
FT                   /old_locus_tag="KLLA-ORF10764"
FT                   /product="KLLA0A03597p"
FT                   /note="similar to uniprot|P39726 Saccharomyces cerevisiae
FT                   YAL044C GCV3 H subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03597g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02746"
FT                   /db_xref="GOA:Q6CY31"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY31"
FT                   /protein_id="CAH02746.1"
FT                   /translation="MFSSSISRTAFVSSRIAKSTVSRLFLRAQSTNALNQSQLPFTFSQ
FT                   TGPKTVKYTTQHEWVAAHPDGSAFIGITKYAADALGDATYVELPDVDTELEAGDSFGSV
FT                   ESVKSASEIYSPVAGTVVEVNEALSDSPQLINSDPAGEGWIIKIKINDEADLQSDELLS
FT                   LEQYEAHLKEDH"
FT   gene            <326530..>328080
FT                   /locus_tag="KLLA0_A03619g"
FT                   /old_locus_tag="KLLA-ORF10760"
FT   CDS_pept        326530..328080
FT                   /locus_tag="KLLA0_A03619g"
FT                   /old_locus_tag="KLLA-ORF10760"
FT                   /product="KLLA0A03619p"
FT                   /note="similar to uniprot|P06776 Saccharomyces cerevisiae
FT                   YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
FT                   component of the cAMP-dependent protein kinase signaling
FT                   system protects the cell from extracellular cAMP contains
FT                   readthrough motif surrounding termination codon"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03619g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02747"
FT                   /db_xref="GOA:Q6CY30"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY30"
FT                   /protein_id="CAH02747.1"
FT                   /translation="MTVHVCCVGPCVEVIKRLSRDSDHVSIQKFDSVTQVMMWFFQKRL
FT                   QDKSMTFEGSCLFICYDPIRTKLRSTSVLNSMDPETLSCFISDMFPCFNVMCVPSANFI
FT                   DYYESVILNTDMIGNDDSDEDMDRISSVYRWMYSGSESLTDGSEEHHDLPCSNNLYTMA
FT                   SHLAYVNSNDRLKRERVPIWDYIDITDMIKSNLSHNDAYYWKCLDSWDFCAHSLNCTEL
FT                   IWCAYLLFHKLNTESNLSHAPPSTNRLLLMLLNIEAAYHQGNKFHNFRHAVDVLQATYQ
FT                   LCHLLELPKLASFLLCIAAIGHDVAHPGTNNMLFNKYVSPISKYYKEQSVLENFHADIY
FT                   LDILSHYWPELSQEFTGIKDSIIATDMALHNHYVETIKQETGPNLTGLTSLIIKAADIS
FT                   NVTRPLLISAKWAALISMEFKECAVLEKNLVELADAKDDEKKRISYKLDLDFDSYSELP
FT                   SNIDDILKEFPNIPKGQAFFIDTFALSLFSGLGLKYKQLQFLVDNVENNRKFWMERGD"
FT   gene            complement(<328807..>330186)
FT                   /locus_tag="KLLA0_A03641g"
FT                   /old_locus_tag="KLLA-ORF10759"
FT   CDS_pept        complement(328807..330186)
FT                   /locus_tag="KLLA0_A03641g"
FT                   /old_locus_tag="KLLA-ORF10759"
FT                   /product="KLLA0A03641p"
FT                   /note="some similarities with uniprot|Q08831 Saccharomyces
FT                   cerevisiae YOR359W VTS1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03641g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02748"
FT                   /db_xref="GOA:Q6CY29"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR037635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY29"
FT                   /protein_id="CAH02748.1"
FT                   /translation="MSSQNMLSSLPGRTQSPVNLPRGAHPGAVLLSPKGSSANLQALGT
FT                   NPTSPSQQPLFLNDLLNQQQFSLDSQLHLRDDLGRPSNMVSPLSNSAMNPTASNGSTFL
FT                   DTFSRPTSSMAINHQPLPLQHSNSNANVMVNFTNDVNQLCNWISMLTPSQQNTVMDNLL
FT                   SSLNEEVLHSTKLKLDSLVHSGYISPQLGPIASPIPNKVQSQVHQAENPQPLNLDSVLN
FT                   GDNIYRQWSPLPQNTASPMQQPMYDYLADIPRPRSADPYNAFKKGGLSSGNANNNSNNG
FT                   NAISNLNSSNPFGTNTVSSTNMSNSNSSSSATGRKNMNQNQHQNQYLNRPQSPTNIKAN
FT                   VFNKTSLATSSSNSGNALTTVNSASSTTSNFNCTNNSMNAKGLCDPKLLKNVPAWLKSL
FT                   RLHKYSEALGSKPWFELIYLDDEALENMGVSALGARRKLLKAFSIVREYKANDMIDSSA
FT                   F"
FT   gene            complement(<331039..>333513)
FT                   /locus_tag="KLLA0_A03663g"
FT                   /old_locus_tag="KLLA-ORF10756"
FT   CDS_pept        complement(331039..333513)
FT                   /locus_tag="KLLA0_A03663g"
FT                   /old_locus_tag="KLLA-ORF10756"
FT                   /product="KLLA0A03663p"
FT                   /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
FT                   YAL043C PTA1 Subunit of holo-CPF a multiprotein complex and
FT                   functional homolog of mammalian CPSF required for the
FT                   cleavage and polyadenylation of mRNA and snoRNA 3' ends
FT                   involved in pre-tRNA processing binds to the phosphorylated
FT                   CTD of RNAPII"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03663g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02749"
FT                   /db_xref="GOA:Q6CY28"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY28"
FT                   /protein_id="CAH02749.1"
FT                   /translation="MSTSVDPLVQLQQAAAMAMQHMPEQMLPKVLETGITLFLNDKRNL
FT                   GFSRFSTQLLLDILVHDKIPSSEKPFIVCQNITALWEMAETRDYVTYKNCILCLGNIYD
FT                   RLFDLVAKTSDDKLWSVMLKFKELIIANWKTCYPLDLSDNDLNNHSRGTGVKLASVKLI
FT                   SKIIIVHTSGPGISVGSIPENHPVISNKQALEAEAKYLLDKLLTFLIEEPMMCAPWFTG
FT                   ALHSLSFIMKQRPLATIRIASALLKFNIDMKFQRDDEPTLQYRLAKRFVERCYRNLVQF
FT                   GIKSQLLKNSGSMTQYRNKLAKISQTLFVIGEETKAKGILNYDPAAIEHKMTPADKKKY
FT                   TRVKEVNDSSSDSSSGTFSATTKSPSPIQMPPIVSPMIGNTMMNTASTPPLLNNFQPQI
FT                   HAPVKNIPAPPPPPPDLSVLQSLQSYAFTKSTTKHPHFLNPAHTSVDNSYSAVFALMNP
FT                   VTSGFDVSKLSQDTMVKICTEALSNTNTGTAINGLSIVASRYTDLINKWLQNNAQQQSA
FT                   TISNDSSPVPFNNSSQSQASKRPREENSAALPIKQEVAMKNEEPLQQPADDRYVIDDSA
FT                   PIQPPESKRAKIERVEDAEPSSSHTVSLGVPTLTYDEKLTHLQRIVQNILLIPTKTDVS
FT                   TPMTQLQSTNPLDKVLLMNWDNKTSWVFLLSRLCSRGVSSNQDVRDIVTNAIFDYFCED
FT                   FQNRITLVLEWLSEEWYHEELISDGKDHTIYNEWSVKVLDFMIPKLDDSHRRLFIRMVS
FT                   EMPLLTQEHIEKMKSLCLDPTRSVLGFQSLKFMLMFRPPVKPFIKVALESMAEVDESIK
FT                   PQCDSLLNKYFS"
FT   gene            complement(<334065..>334535)
FT                   /locus_tag="KLLA0_A03696g"
FT                   /old_locus_tag="KLLA-ORF10754"
FT   CDS_pept        complement(334065..334535)
FT                   /locus_tag="KLLA0_A03696g"
FT                   /old_locus_tag="KLLA-ORF10754"
FT                   /product="KLLA0A03696p"
FT                   /note="highly similar to uniprot|Q758Y6 Ashbya gossypii
FT                   ADR391W ADR391Wp and some similarites with uniprot|Q02516
FT                   Saccharomyces cerevisiae YOR358W HAP5 Subunit of the heme-
FT                   activated glucose-repressed Hap2/3/4/5 CCAAT-binding
FT                   complex a transcriptional activator and global regulator of
FT                   respiratory gene expression required for assembly and DNA
FT                   binding activity of the complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02751"
FT                   /db_xref="GOA:Q6CY26"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR027170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY26"
FT                   /protein_id="CAH02751.1"
FT                   /translation="MDQPAANNQENVTNEQGPLMDLEEDEEIDVFHNVGQGLAGRYREI
FT                   MIQYWQELINEIESTNEPGSQFQDDFKSHSLPLARIKKVMKTDEEVRMISGEAPILFAK
FT                   ACEIFITELTMRAWCVAEENKRRTLQKQDIADALQKSDMFDFLIDIVPRNVQ"
FT   gene            <334828..>335322
FT                   /locus_tag="KLLA0_A03718g"
FT                   /old_locus_tag="KLLA-ORF10752"
FT   CDS_pept        334828..335322
FT                   /locus_tag="KLLA0_A03718g"
FT                   /old_locus_tag="KLLA-ORF10752"
FT                   /product="KLLA0A03718p"
FT                   /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
FT                   YOR357C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02752"
FT                   /db_xref="GOA:Q6CY25"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY25"
FT                   /protein_id="CAH02752.1"
FT                   /translation="MCPQRQFQSFTTTAESTLSHTTHKQLSGATIYDEPENFLEIEVCN
FT                   PKTHFPSGDAKGMYTDYEIICRTNLPGFSKRSSSVRRRYSDFELFRKLLIKELQLSNHP
FT                   KVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPLLQTGSKVLVRFIQDPTFQ
FT                   G"
FT   gene            complement(<335548..>337287)
FT                   /locus_tag="KLLA0_A03740g"
FT                   /old_locus_tag="KLLA-ORF10751"
FT   CDS_pept        complement(335548..337287)
FT                   /locus_tag="KLLA0_A03740g"
FT                   /old_locus_tag="KLLA-ORF10751"
FT                   /product="KLLA0A03740p"
FT                   /note="similar to uniprot|P38925 Saccharomyces cerevisiae
FT                   YOL122C SMF1 Divalent metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02753"
FT                   /db_xref="GOA:Q6CY24"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY24"
FT                   /protein_id="CAH02753.1"
FT                   /translation="MPENKFEVTEEYLDPQSMLELSMPGGASKLSVRQKLILKCRRAMR
FT                   MRDTEKKGSSSTDPVQSQYSLSLSSAEDKKRGFFGSVQDVLRKYMRFVGPGLMVSVAYM
FT                   DPGNYATDVSAGASNEFSLLCIVLVSNIIAIFLQSLCIKLGSVTGLDLSRACKKHLPKW
FT                   LNLTIYVFAECAIIATDVAEVIGTAVALNILLRIPLPAGVVITCIDVLFVLIAYKPGSS
FT                   SMRFVRMFEYAVALLVFGVVICFCVELAYIPKTPVGHIFRGFVPSKQMFEHNGMYTATS
FT                   ILGATVMPHSLFLGSGLVQPRLLEYDVDHGYYDLLAEEDEDNVIEETEDTHSAVKEKED
FT                   IEVIRERRYFNYQPTNSAIKYAMKYSIFELAITLFTFALFVNSAILIVAGATLYGSEEA
FT                   VDADLYTIHSLLSKNLAPIAGTVFMLALLFSGQSAGIVCTIAGQIVCEGHLDWNFKPWK
FT                   RRLITRGISIIPCLIISLTIGRSALSKALNASQVVLSILLPFLVAPLIFFTCKKSIMKV
FT                   KVNNKDKLNAPTVIGEEEQPDEYIDMSNNWITTIIAFLVWIFISLLNVYTIVQLGISHG
FT                   DIS"
FT   gene            <337927..>338000
FT                   /locus_tag="KLLA0_A03762r"
FT   tRNA            337927..338000
FT                   /locus_tag="KLLA0_A03762r"
FT                   /product="transfer RNA Ile (AAT) cove"
FT   repeat_region   338075..338509
FT                   /locus_tag="KLLA0_A03773t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR"
FT   gene            <338524..>338594
FT                   /locus_tag="KLLA0_A03784r"
FT   tRNA            338524..338594
FT                   /locus_tag="KLLA0_A03784r"
FT                   /product="transfer RNA Gly (GCC) cove"
FT   gene            complement(<338807..>340615)
FT                   /locus_tag="KLLA0_A03806g"
FT                   /old_locus_tag="KLLA-ORF10746"
FT   CDS_pept        complement(338807..340615)
FT                   /locus_tag="KLLA0_A03806g"
FT                   /old_locus_tag="KLLA-ORF10746"
FT                   /product="KLLA0A03806p"
FT                   /note="highly similar to uniprot|P06782 Saccharomyces
FT                   cerevisiae YDR477W SNF1 Protein serine/threonine kinase
FT                   required for release from glucose repression invertase
FT                   expression sporulation and for expression of catabolite-
FT                   repressed genes when glucose is limiting regulates Adr1p-
FT                   dependent transcription primarily at the level of chromatin
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02754"
FT                   /db_xref="GOA:F2Z677"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR032270"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z677"
FT                   /protein_id="CAH02754.1"
FT                   /translation="MSHDPNQQQPHGGSGQGHHQRQLTNHAQGQHIGKYQIIKTLGEGS
FT                   FGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKS
FT                   KDEIIMVIEYAGNELFDYIVQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENL
FT                   LLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVIL
FT                   YVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIM
FT                   QDEWFKVDLPDYLVPAESTHQENSESKTEDGGPSVPLELIDDSLVQTLSNTMGYDVDEI
FT                   YEALESDEDHPSLNEIRDAYQLIKENRNLINDIKVNKQQSNDLDTFLSQSPPTFEQSLH
FT                   APPGSKNRHSHRHSKRTQQRTYQYHYGNGSQDGDSTIAILPSSLPQIHRANMVAQGSQA
FT                   AAKISPLSVKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIRVRW
FT                   RYNIDMPDDEMKNKQIPDLMKMVIQLFQIETNNYLVDFKFDGWESSNGVVYSSRNDDEM
FT                   STFSAYPFLHLATRLIMELAVNSQGS"
FT   mobile_element  complement(341014..344221)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLLA0_A03844t"
FT                   /note="DNA transposon of KLLA part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:
FT                   degenerate copy with probably 2 frameshifts"
FT   gene            <344642..>345098
FT                   /locus_tag="KLLA0_A03883g"
FT                   /old_locus_tag="Klla0A.mRNA.154.p"
FT   CDS_pept        join(344642..344725,344850..345098)
FT                   /locus_tag="KLLA0_A03883g"
FT                   /old_locus_tag="Klla0A.mRNA.154.p"
FT                   /product="KLLA0A03883p"
FT                   /note="highly similar to uniprot|P33328 Saccharomyces
FT                   cerevisiae YOR327C SNC2 mediate the targeting and transport
FT                   of secretory proteins vesicle-associated membrane protein
FT                   (synaptobrevin) homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03883g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02758"
FT                   /db_xref="GOA:Q6CY19"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY19"
FT                   /protein_id="CAH02758.1"
FT                   /translation="MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKVA
FT                   ERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCLVLVVIILLIVIIVP
FT                   IAVHFS"
FT   gene            complement(<345818..>350470)
FT                   /locus_tag="KLLA0_A03905g"
FT                   /old_locus_tag="KLLA-ORF10740"
FT   CDS_pept        complement(345818..350470)
FT                   /locus_tag="KLLA0_A03905g"
FT                   /old_locus_tag="KLLA-ORF10740"
FT                   /product="KLLA0A03905p"
FT                   /note="similar to uniprot|P19524 Saccharomyces cerevisiae
FT                   YOR326W MYO2 One of two type V myosins involved in
FT                   polarized distribution of mitochondria required for
FT                   mitochondrion and vacuole inheritance and nuclear spindle
FT                   orientation moves multiple cargo"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03905g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02759"
FT                   /db_xref="GOA:Q6CY18"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036103"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY18"
FT                   /protein_id="CAH02759.1"
FT                   /translation="MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKV
FT                   ELLVSSLDETKEPSLPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSG
FT                   IVLIATNPFDRVDQLYSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVS
FT                   GESGAGKTVSAKYIMRYFASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIR
FT                   NDNSSRFGKYLEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDD
FT                   EKSQLKLTDIQDYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAA
FT                   LLHIGNIEVKKVRNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSL
FT                   PYHQAIVSRDSVAKFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKN
FT                   SFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGIL
FT                   SLLDEESRLPAGTDEGWTHKLYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDG
FT                   FIEKNRDTVSDGHLEVLKASNNETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRK
FT                   IVRKPTLGSMFKQSLIDLMETINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVL
FT                   ETIRISCAGFPSRWTYTEFALRYHILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDD
FT                   TAKYQAGNTKIFFKAGMLAHLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRL
FT                   QANVSGKIIRLRTENEFKNNAALLIQSAYRGISVRDNVSSIIISIIRIQSMARKQITCK
FT                   ELLERRRGDAAVTIQKSVRSFQPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKS
FT                   VNHLQEVSYKLENKVIELTESLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEG
FT                   HTKALADQKSIHEEEYGKVNDQLIAAKEEIISAKAEVDELLNKQKNLKDEIASTLEELT
FT                   SARDELLTSQSENADLKKEVFSLKEEVARLQSSMRSGVYVGGGINATPVKNRRFSANST
FT                   LNDGSSPKQLNVVSINNNFNTEDVSALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKV
FT                   PPTGVSVNLTRKEVLYPSRVLIIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDV
FT                   MIEHGAFWYTNVRELHSFVVYAYESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALS
FT                   FNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTF
FT                   FNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRI
FT                   EEWCKSHHISEVSVCLQHILQAAKLLQLKKRIVADIDIIWDICNCLKPIQLKQLITQYS
FT                   VADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVDNGPFEDPYQKVEVRAFGKIE
FT                   AYIPAWLNLPITRRIVELVTQFVAVQEQAE"
FT   gene            <351240..>352502
FT                   /locus_tag="KLLA0_A03938g"
FT                   /old_locus_tag="KLLA-ORF10738"
FT   CDS_pept        351240..352502
FT                   /locus_tag="KLLA0_A03938g"
FT                   /old_locus_tag="KLLA-ORF10738"
FT                   /product="KLLA0A03938p"
FT                   /note="some similarities with uniprot|P39734 Saccharomyces
FT                   cerevisiae YAL028W FRT2 Tail-anchored endoplasmic reticulum
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02761"
FT                   /db_xref="GOA:Q6CY16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY16"
FT                   /protein_id="CAH02761.1"
FT                   /translation="MEVSHREHTNHIGSQVNPLFRGSVFHKNDAADLRVPWDGKRRKSG
FT                   ASINSKTQMGDLTEFNPSHHASNKNIYHDDITCGSLRFSDALLDGSFKCQDEHSSNRSG
FT                   HMASSKPGSGNSSLGLLKNQSYSNISISSTQSFKKTHTKLLNFSQLKPDLTTASSFESQ
FT                   PSKGNSLARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALDYLSSGFTDKLFPIF
FT                   NSKETDPKDMKIDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQ
FT                   NINHVSNLSKSVTQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVS
FT                   RLQALEGKTVDFQNELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGDV
FT                   TVLALSISLIMYLFRRWFASE"
FT   gene            <352856..>353796
FT                   /locus_tag="KLLA0_A03960g"
FT                   /old_locus_tag="Klla0A.mRNA.158.p"
FT   CDS_pept        join(352856..352866,352938..353796)
FT                   /locus_tag="KLLA0_A03960g"
FT                   /old_locus_tag="Klla0A.mRNA.158.p"
FT                   /product="KLLA0A03960p"
FT                   /note="similar to uniprot|P39735 Saccharomyces cerevisiae
FT                   YAL027W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02762"
FT                   /db_xref="GOA:Q6CY15"
FT                   /db_xref="InterPro:IPR021624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY15"
FT                   /protein_id="CAH02762.2"
FT                   /translation="MVPTSALIQINSKCVLSVRVFINRNKVLKSITNSDTIFEAPILSN
FT                   NSIIRLKTPAIRLHLSNEDMKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFMDF
FT                   ADVLEILKKGSSLETRSTDVYNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILIENI
FT                   DKLHHWRKLLTLLDSVQSVSNTGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSEDPPI
FT                   LIEPEDDGLGQVPRDEIEMVDQDPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLG
FT                   RPKRGKKN"
FT   gene            <354208..>355551
FT                   /locus_tag="KLLA0_A03982g"
FT                   /old_locus_tag="KLLA-ORF10733"
FT   CDS_pept        354208..355551
FT                   /locus_tag="KLLA0_A03982g"
FT                   /old_locus_tag="KLLA-ORF10733"
FT                   /product="KLLA0A03982p"
FT                   /note="highly similar to uniprot|P54885 Saccharomyces
FT                   cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
FT                   catalyzes the second step in proline biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02763"
FT                   /db_xref="GOA:Q6CY14"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY14"
FT                   /protein_id="CAH02763.1"
FT                   /translation="MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIE
FT                   AANKLDLEQAKSTNLSDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDE
FT                   NLTLYQITAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVN
FT                   DVVEQNEKTTHVPVGAVQLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPV
FT                   LGHADGICSIYVDESADIGKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLI
FT                   ENGVTLHVSKEVKKQYKEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHI
FT                   NTHSSKHTDAIVTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIH
FT                   ARGPVGLDGLVTYQYQLRGNGQIASDYLGAGGKKAFVHKDLDVKSISI"
FT   gene            complement(<355624..>359655)
FT                   /locus_tag="KLLA0_A04015g"
FT                   /old_locus_tag="KLLA-ORF10731"
FT   CDS_pept        complement(355624..359655)
FT                   /locus_tag="KLLA0_A04015g"
FT                   /old_locus_tag="KLLA-ORF10731"
FT                   /product="KLLA0A04015p"
FT                   /note="highly similar to uniprot|P39524 Saccharomyces
FT                   cerevisiae YAL026C DRS2 Integral membrane Ca(2 )-ATPase
FT                   potential aminophospholipid translocase required to form a
FT                   specific class of secretory vesicles that accumulate upon
FT                   actin cytoskeleton disruption mutation affects maturation
FT                   of the 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04015g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02765"
FT                   /db_xref="GOA:Q6CY12"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY12"
FT                   /protein_id="CAH02765.1"
FT                   /translation="MKPKYFEREIQSQRGATHRSTCFPMSGSTKHGDSDALFDVDFLDD
FT                   SYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQETIDLSDNIENDIENPFNDRYSASFA
FT                   DTNPRNSVLPQPSGFNRFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESSTRKF
FT                   DIKVLFNRYILRKGKTSCKSDEPRTILLNDSSANSRFGYRDNHISTTKYNAATFLPKFL
FT                   FQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADK
FT                   ELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCYIET
FT                   ANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTFPL
FT                   SPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFGV
FT                   LIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVT
FT                   VEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEF
FT                   KSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLA
FT                   TCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQ
FT                   LLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYA
FT                   AEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAI
FT                   EDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKED
FT                   TRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICC
FT                   RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFA
FT                   IGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWT
FT                   LTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYH
FT                   SAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQWTKFTLV
FT                   AIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFV
FT                   WKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFSQSE
FT                   EGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPAQVEPSSNVGLRQSFESTNPFKDV
FT                   "
FT   gene            complement(<359981..>360889)
FT                   /locus_tag="KLLA0_A04037g"
FT                   /old_locus_tag="KLLA-ORF10729"
FT   CDS_pept        complement(359981..360889)
FT                   /locus_tag="KLLA0_A04037g"
FT                   /old_locus_tag="KLLA-ORF10729"
FT                   /product="KLLA0A04037p"
FT                   /note="some similarities with uniprot|P10962 Saccharomyces
FT                   cerevisiae YAL025C MAK16 Essential nuclear protein required
FT                   for normal concentration of free 60S ribosomal subunits
FT                   required for maintenance of M1 satellite double- stranded
FT                   RNA of the L-A virus"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04037g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02766"
FT                   /db_xref="GOA:Q6CY11"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY11"
FT                   /protein_id="CAH02766.1"
FT                   /translation="MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPL
FT                   ANSKYATVKNVDGTLYLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFL
FT                   IHKCKQRMTKLTQVMITERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIE
FT                   KELLERLKSGVYGDKPLNVDEKIWKKVMGRVEDEDLDEEENDWDEEEESDEGEVEFVED
FT                   EDAEDEMVDMEDLEKWLGGSDTSDYSSDEDSDEDSSDEDSDEEENPSKRQKKSTQTRKR
FT                   HPKVEIEYEQELNSNQQELAQ"
FT   gene            complement(<361328..>365428)
FT                   /locus_tag="KLLA0_A04059g"
FT                   /old_locus_tag="KLLA-ORF10727"
FT   CDS_pept        complement(361328..365428)
FT                   /locus_tag="KLLA0_A04059g"
FT                   /old_locus_tag="KLLA-ORF10727"
FT                   /product="KLLA0A04059p"
FT                   /note="similar to uniprot|P07866 Saccharomyces cerevisiae
FT                   YAL024C LTE1 Putative GDP/GTP exchange factor required for
FT                   mitotic exit at low temperatures acts as a guanine
FT                   nucleotide exchange factor (GEF) for Tem1p which is a key
FT                   regulator of mitotic exit physically associates with Ras2p-
FT                   GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04059g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02767"
FT                   /db_xref="GOA:Q6CY10"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CY10"
FT                   /protein_id="CAH02767.1"
FT                   /translation="MSEVVEKADENVVPLFSRPELYPVPSESVLTVDLRDGTVRILKCT
FT                   LPALLVQLSSPLDKVDYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAIDLRQSDPSSQE
FT                   KITSEVILVRMFVLVRHWLSNYFAQDFVVDTSLRRQFLQFINGYSPVDRFLDNIIISLK
FT                   KLWVQNVQIMWEDLENLIVENNVVSRDDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIA
FT                   LQNINNPVLRNESLLSLLHTREKIPLPQQSEDESKKQSTRIKQRTGSMLLFPENASNGL
FT                   SINEKLTASGVSPEATPKQEREITDPKNSKDNKHILPQLSRVTNVSYMMKDLEYPSTPS
FT                   VDIFVPPTPAKNIEFILQTSYMETDLPEQSNGSDSTNTVNGNNTNHKGILGLLSKWKLN
FT                   HQRKPTVNPVQNPPRVENLIKYVFSISSLDNHANPLPDSLSSMFDILSARTIDEVEYLV
FT                   SVESDLLAKLEAKKLTTEISKLETNEDESQDYSVIDNLNLYKTVSSIANSVISLSKTLN
FT                   VRTNKSTTHLLSPSTSALERKNIRNSAPMLYSYNNSRYSITNALMGLPNTNDNSSPKRL
FT                   VFHDPTRNSPTKKAILANNLNNIGEYNGERDSITSIVTYDSAFSDISSSGNILSQHKGS
FT                   SNIFMESAPTLKRKLNVNDLRRFNFEKSDSTDDRSCSPQNREATETSATSMESDANDNA
FT                   IQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRPTSGRISITRNYSVASPNSLR
FT                   SILPKSPLILGNEVFIERDKALAANQDIISELEETTSLLLNDNDRKFTVSRGSVCNDSD
FT                   SQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQPISKLSETPSIKSI
FT                   GSRDSEESFDLTSIASKPNRAQSTTLREKYHLEKQATNDIFEEDVENLNPENNKYLFSP
FT                   DTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIATQDNENKDHGIDKKKLEDIMN
FT                   GIDDTADTSMDPVNLALMKLEGTYDKGEKEIDDKSPSINSELAREVENFQIVQTAALPE
FT                   SARKRQSMFIQRRRNTMIDFSVRDSLIDKDSSCTRLENTDEQIRNLLNQYTLTDSRLKI
FT                   DNLEQHIPFILMYDSKSVANQLTLIEKEILSEVDWKDLLDLTMSEQLPQFTSWLQLLVQ
FT                   NENLSGIDLAIARFNLTVDWIISEIVMTQDIRLRRNTIQRFIHIAEHCKELQNYNTLME
FT                   IILALNSIVVQKFTETWRLVEPGDLLTWETLKAIPSLEKNYSNIRQLIDEVEPLSGCIP
FT                   FIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQIVKNFVQKMQWSKFYNIDIDHELL
FT                   SKCVYITSLSHDEINSISHKSPI"
FT   gene            <366969..>368552
FT                   /locus_tag="KLLA0_A04081g"
FT                   /old_locus_tag="KLLA-ORF10724"
FT   CDS_pept        366969..368552
FT                   /locus_tag="KLLA0_A04081g"
FT                   /old_locus_tag="KLLA-ORF10724"
FT                   /product="KLLA0A04081p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04081g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02768"
FT                   /db_xref="GOA:Q6CY09"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY09"
FT                   /protein_id="CAH02768.1"
FT                   /translation="MTSEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEHA
FT                   VGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYSMK
FT                   EDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHIGAT
FT                   NYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGALLAY
FT                   GLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVIDHVSK
FT                   NQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFGFSGLNA
FT                   TLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIPLSEKWSL
FT                   VGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSKIMYANEAP
FT                   RYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGVINGFKDLTD
FT                   FQNQFFRYVY"
FT   gene            <369258..>371615
FT                   /locus_tag="KLLA0_A04103g"
FT                   /old_locus_tag="KLLA-ORF10721"
FT   CDS_pept        369258..371615
FT                   /locus_tag="KLLA0_A04103g"
FT                   /old_locus_tag="KLLA-ORF10721"
FT                   /product="KLLA0A04103p"
FT                   /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
FT                   YOR322C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04103g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02769"
FT                   /db_xref="GOA:Q6CY08"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR024391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY08"
FT                   /protein_id="CAH02769.1"
FT                   /translation="MGFPKFGSSKHNSSSSSLQALDYTNHDDHPIELSINIESPPCVLY
FT                   GSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNSLTTSLSHLSLS
FT                   HAHHAHHQKSGDNLKRLASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVL
FT                   NTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYE
FT                   LIAVATYKHPFKGKGESAKRVLQLNLPISITRSILRGSDKTSLRVFPPTELTANAVLPN
FT                   VVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVK
FT                   QDEERDRQIRKSSKPIKRSVDMGPQVKMTVNTFHDVLLQQLSRANTEAEDVDNPEDTTT
FT                   APSDEALRDEDHDTIPDTPTDFIHPNDDAMRQEIMQQQQRVRQQQIEEELKQESALYTE
FT                   EVRTIANGEIKSGWKSDFSDKGTIELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDN
FT                   VNVSCDMEDTNLGVYVSHLLFVEVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNN
FT                   ADQRLAELSPIFADRENKPQPVIDNQPGNNVGPKIVGVPTGAARVLRMQFRVIMTERSG
FT                   LGISWDDEVPPAYQDIRMLTPPRYQDVSTTLLHSTLSSPTITPPGESSLFTLETGNGAE
FT                   RAVTGSAPETRSNSSVRLNVNNAEYIRPPPALHHSANTSSTSIAFQFSDLDHVMSTQGA
FT                   EPGFNSALTPQTTRMINVPTISELLDTDRITQ"
FT   gene            <372826..>374589
FT                   /locus_tag="KLLA0_A04125g"
FT                   /old_locus_tag="KLLA-ORF10717"
FT   CDS_pept        372826..374589
FT                   /locus_tag="KLLA0_A04125g"
FT                   /old_locus_tag="KLLA-ORF10717"
FT                   /product="KLLA0A04125p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04125g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02770"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY07"
FT                   /protein_id="CAH02770.1"
FT                   /translation="MINSAKTDKITQKINDLSFDEKDNTLIDSTNPAPFPGAQESAAQH
FT                   PTATPSNNKEPKPRTKSFLNNDGIDQLTPVTRKKRVSSLSLSDQWSASQGGIAPLTSMT
FT                   PLNTAEGSNGQNGSSGAAGAQSASADAAAAAAADSRSVGISRSSSVRTKREVIDHERVA
FT                   SYAFAFDIDGVIVRGPETIPEARQALRLLNGDNKYNIKVPYIFITNGGGRSERARCKDL
FT                   SKRLGITVTEDQVIQGHTPMKDLVPVYKNVLVVGGVLNSCRDVAKGYGFENVYIPIDIM
FT                   KWKPSVTPYYTLSDEEKEAAVDADFSKISIDAILVFADSRNWAADQQIILELLLSKNGV
FT                   MGTVSETADEGPGLYFAHSDFVWATDYGLSRYGMGALQVSIAALYQEHTGKELQVTRFG
FT                   KPQRGTFRFAEKVLSKWRKNTLEEHVEQLGISFQKQQKTLQQQQQSSDSPFGPDSETDQ
FT                   ETDLTSTEDDDDLEDDEDDEGIVINKTSSVLLDLPPASTVYFVGDTPESDIRFANSHDS
FT                   SWYSILVKTGVYQEGTTPKYKPKQICENVLEAVRFAIEREHQKELQEWNHSAEVSVPVV
FT                   KEETETVKKTN"
FT   gene            complement(<374897..>375985)
FT                   /locus_tag="KLLA0_A04147g"
FT                   /old_locus_tag="KLLA-ORF10714"
FT   CDS_pept        complement(374897..375985)
FT                   /locus_tag="KLLA0_A04147g"
FT                   /old_locus_tag="KLLA-ORF10714"
FT                   /product="KLLA0A04147p"
FT                   /note="similar to uniprot|Q7LIE3 Saccharomyces cerevisiae
FT                   YDR214W AHA1 Activator of Heat Shock Protein 90 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04147g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02771"
FT                   /db_xref="GOA:Q6CY06"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036338"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY06"
FT                   /protein_id="CAH02771.1"
FT                   /translation="MVVHNPNNWHWVDKNCIDWAKKYFQEKLVGLTTGESTDELYAEIT
FT                   KLSSLEGDCEVNQRKGKVISLFDLKLNVGIAGHVGENKLEGSITVPEVAFDSDPEDYQF
FT                   DISIFKETSKLFEIKPVIREKLIPQLRDIFSNFGKQLLLTHGNDIQVSSDKVTSKFTKA
FT                   NQQSSFSTSGSTKEDANKDSATGNTSTANASSSTKAAVTSSETQQKNSGNAAKYNTTKV
FT                   HLESSFQVPAIELYNTFIDKRRIEAWSRSPIQPEANTGDFSGSTLQLNDAFKLFGGNIT
FT                   MKFLSGEPGKKIVFQWRLNDWKQGHYSELSLEFHESQEYHETKLVVNWSGIPVGEEDRV
FT                   RGNFEEYYIRSIKVTFGFGAIL"
FT   gene            complement(<376273..>378600)
FT                   /locus_tag="KLLA0_A04169g"
FT                   /old_locus_tag="KLLA-ORF10712"
FT   CDS_pept        complement(376273..378600)
FT                   /locus_tag="KLLA0_A04169g"
FT                   /old_locus_tag="KLLA-ORF10712"
FT                   /product="KLLA0A04169p"
FT                   /note="similar to uniprot|Q05958 Saccharomyces cerevisiae
FT                   YLR228C ECM22 Sterol regulatory element binding protein
FT                   regulates transcription of the sterol biosynthetic genes
FT                   ERG2 and ERG3 member of the fungus-specific Zn[2]-Cys[6]
FT                   binuclear cluster family of transcription factors
FT                   homologous to Upc2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04169g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02772"
FT                   /db_xref="GOA:Q6CY05"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY05"
FT                   /protein_id="CAH02772.1"
FT                   /translation="MSSSNINSNPMPSVETGSNGRSKSSSEKVELIELHGKTVSKTATG
FT                   KRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDCVYTPVQPRSRKNSAATAPKH
FT                   SSKVSKPATVSTPTEPISLNQVDILVNTMKADAELEQHQQQHQQVRQQQQQQQQQLQQQ
FT                   DQNVKVKSERSAAASPNKQAMGQDNLLLPPIAQNSNFLQHLHHQIQQQPYLLPQLMTLT
FT                   NSEKFAAQFEVPNSPSTGMQSQPMNVSNSIASILAGGKLPSHLSSNLALLQQLTQSPQR
FT                   PSTKLPSNNGAASIPGGFNLKQLGTFPTAGIGGVTYDFQELLGLKSPPNTSTTETVPTV
FT                   SHDNDPLKQESAAEVLASLQMKQQQKTSNPLDSNNLDIGTPSLPNNPTISPAAPMSPLT
FT                   KLDDSQARGNADSKSVGPNGGIVNSNATSMSKSNTQESQASSDTELSRIGTIASMIDFS
FT                   TNTNLNLIDLKLFHHYCTNVWPTITAAGISEKKIWSVDVPEIAFEYPFLMHALLAFSAT
FT                   HFSRTESGLERYVTQHRLEALRLLREAVLEINESNTDALVASAIILIMDSLANAATPTA
FT                   SGVNSPLNSGSISTSAWIFHVKGAATILTAVWPLTEKSRFYNLINVDLSDLGDVINQEN
FT                   GSIAELVCFDESIADLYPVELNSPYLITLAYLDKLNKEKGQPGFILRVFAFPALLDKTF
FT                   LALLMTGDLGAMRIMRSYYQLLRGFASEMKDEVWFLEGMTQVLPQDVDEYSGGGGMHMM
FT                   LDFLGGGLPSMTTTNLTDFGIF"
FT   gene            complement(<379492..>381171)
FT                   /locus_tag="KLLA0_A04191g"
FT                   /old_locus_tag="KLLA-ORF10710"
FT   CDS_pept        complement(379492..381171)
FT                   /locus_tag="KLLA0_A04191g"
FT                   /old_locus_tag="KLLA-ORF10710"
FT                   /product="KLLA0A04191p"
FT                   /note="highly similar to uniprot|P12612 Saccharomyces
FT                   cerevisiae YDR212W TCP1 tailless complex polypeptide 1
FT                   chaperonin subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04191g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02773"
FT                   /db_xref="GOA:Q6CY04"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY04"
FT                   /protein_id="CAH02773.1"
FT                   /translation="MAQVYGNSRSDTLFLGGEKISGDDIRNQNVLASLAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILALLDVQHPAGKILVDLAQQQDREIGDGTTSVVII
FT                   ASELLKKANDLVKNKIHPTTIITGYRVALREAIRYIDEVLSVPVDTLGKDTMLNIAKTS
FT                   MSSKIIGSDSEFFSNMVVDALLAVRTQNAKGDVKYPVKAVNILKAHGKSARESVLVQGY
FT                   ALNCTVASQAMPKQITGGNVKIACLDMNLQKARMAMGVQINIDDPEQLEEIRKREAGII
FT                   LDKVKKIIDAGAQVVLTTKGIDDLCIKEFVNAKVMGVRRCKKEDLRRIARATGATLVSD
FT                   MSNLEGDEVFESSYLGTCQEVVQTKFSDDECILIRGTQKHSSSSIVLRGPNDYSLDEME
FT                   RSLHDSLCVVKRTLESGNVVPGGGCVETALNIYLDNFATTVGSREQLAIAEFANALLVI
FT                   PKTLAVNAAKDSSELIAKLRSYHAASQQAKPDDIKRRKYRNYGLDLIKGKIVDEVHAGV
FT                   LEPTISKVKSLKSALEACIAILRIDTMITVDPEPEKEGDACA"
FT   gene            complement(<382243..>382818)
FT                   /locus_tag="KLLA0_A04213g"
FT                   /old_locus_tag="KLLA-ORF10709"
FT   CDS_pept        complement(382243..382818)
FT                   /locus_tag="KLLA0_A04213g"
FT                   /old_locus_tag="KLLA-ORF10709"
FT                   /product="KLLA0A04213p"
FT                   /note="highly similar to uniprot|P19073 Saccharomyces
FT                   cerevisiae YLR229C CDC42 Small rho-like GTPase essential
FT                   for establishment and maintenance of cell polarity mutants
FT                   have defects in the organization of actin and septin"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04213g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02774"
FT                   /db_xref="GOA:Q6CY03"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY03"
FT                   /protein_id="CAH02774.1"
FT                   /translation="MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVM
FT                   IGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHH
FT                   CPGVPCLIVGTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPVIKKSKKCIIL"
FT   gene            complement(<383275..>385485)
FT                   /locus_tag="KLLA0_A04235g"
FT                   /old_locus_tag="KLLA-ORF10708"
FT   CDS_pept        complement(383275..385485)
FT                   /locus_tag="KLLA0_A04235g"
FT                   /old_locus_tag="KLLA-ORF10708"
FT                   /product="KLLA0A04235p"
FT                   /note="similar to uniprot|P32501 Saccharomyces cerevisiae
FT                   YDR211W GCD6 Catalytic epsilon subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2 activity subsequently regulated by
FT                   phosphorylated eIF2 first identified as a negative
FT                   regulator of GCN4 expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04235g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02775"
FT                   /db_xref="GOA:Q6CY02"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035543"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY02"
FT                   /protein_id="CAH02775.1"
FT                   /translation="MSGKKTKSGKANQNKKQEVVQDERLQAIVLTDSFETRFMPLTSVK
FT                   PRCLLPLANIPLIEYTLEFLAKAGVNEVYLICASHGEQIQEYIDQSKWSLPWAPFKVNT
FT                   IMSLESRSVGDAMRDVDNRGLITGDFVLVSGDLVTNMDFEKALDIHKQRRKADKDHIVT
FT                   MCLSKATQFHKTRSHEPATFIFDKSNDRCIYYQDIPLASSREKTTIDIDPELLEGVDEF
FT                   VLRNDLIDCHVDICSPHVPAIFQENFDYQFLRRDFVRGVLSSDLLKKHIYGYITDEYTT
FT                   RAESWQTYDAISQDFIARWCYPLVLNANLLKGQTYSYESQHIYKEKDVVLAQSCKIKKN
FT                   TAIGSGSKIGEGTVIENSVVGRNCKIGSNIRIKNSYIWDNVVIDDNTTIEHSLVASDVK
FT                   LGSNVTLNDGSIIGFNVVIDDNVTIPVGTKISAVPVQRNTAQFLDTAHNLSSSDEDEEG
FT                   STFTRNSSSLSISNSDEVADAKIKLSKQLVGPNGRGVLYESDDEDEDEDGSTEKGIANT
FT                   LTYRDDDIYLSDTSISSITQKHRKRRTMSMTSIYTDYEGEEDEEEDFEKEAIATVERAI
FT                   ENNHDLDTSMLELNTLRMSMNVTYHEVRNASVIAIFRRVYHFVATQTLGPKDAVTKVLQ
FT                   QWGPVFKRQAFDSDEFIDLMNIILDRVLDQKFDKPDFILFHVYNVLYDLDILEEDVIYK
FT                   WWDSVSGDSKYSEVTALLAKWVDWLKTADEESSDEEDSDEDE"
FT   gene            complement(<385847..>385985)
FT                   /locus_tag="KLLA0_A04257r"
FT   tRNA            complement(join(385847..385883,385947..385985))
FT                   /locus_tag="KLLA0_A04257r"
FT                   /product="transfer RNA Ile (TAT) cove"
FT   gene            complement(<387006..>389165)
FT                   /locus_tag="KLLA0_A04301g"
FT                   /old_locus_tag="KLLA-ORF10706"
FT   CDS_pept        complement(387006..389165)
FT                   /locus_tag="KLLA0_A04301g"
FT                   /old_locus_tag="KLLA-ORF10706"
FT                   /product="KLLA0A04301p"
FT                   /note="similar to uniprot|Q750P3 Ashbya gossypii AGL096W
FT                   AGL096Wp and weakly similar to YDR208W uniprot|P38994
FT                   Saccharomyces cerevisiae YDR208W MSS4 Phosphatidylinositol-
FT                   4-phosphate 5-kinase involved in actin cytoskeleton
FT                   organization and cell morphogenesis multicopy suppressor of
FT                   stt4 mutation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04301g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02776"
FT                   /db_xref="GOA:Q6CY01"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY01"
FT                   /protein_id="CAH02776.1"
FT                   /translation="MTAVHMVQDPGPPTVPHLSDDKNETAAYIIETTIGKGQDQPLIPK
FT                   RLSNVSVVDDGDISPKHLPSTSSPIKRTDSAVANHTTAVPTTLDTNGGTKSDSNVLLHS
FT                   RHRMSSKSLPMQRRRSTRDSIRQGPYHPGKHARIIPMDSNSSSASSSSSSLRSLEHRRT
FT                   QSTSSQRSVPNSTHNITTSSKAANQRMARSSTDLHSHSRSSARFNPDLPNKALTRSLAS
FT                   LDLQHYEGPENNINGNNTSDTTHHGTSKQLNNDGALKRSESAALEIQKMRQSLLQKREM
FT                   RRKQKKFLDDDRVLVGNKVTEGHVNFIIAYNMLTGIRVAVSRCSGIMKPLTDKDFKLTK
FT                   KLAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLMSLTSKYILSELNSP
FT                   GKSGSFFYFSRDYKYIIKTIHHSEHKHLRKILKRYYEHVKQNPDTLISQFYGLHRIKMP
FT                   YSFRSKIKYRKIYFLVMNNLFPPHLQIHKTFDLKGSTWGRYTKCEKTEDPQHSPVFKDL
FT                   NWLEMNEKINFGPLKSKKFLQQLQQDVLLLSELNIMDYSLLLGIHNIETGNDLIEEGNK
FT                   NDLVDPLEDSNAMPNLLPSQSSRRTIHQHKSHHHRRHTHHSVNPPINNTQVVKHFFQQD
FT                   EGGIRASDQFNNDLNQIYFVGIIDCLTNYSMLKRMETLWRSMNHDLKVVSAVPPKVYGD
FT                   RFYHFIENSVNKHYDENQQQPGYHD"
FT   gene            <391590..>392201
FT                   /locus_tag="KLLA0_A04323g"
FT                   /old_locus_tag="KLLA-ORF10701"
FT   CDS_pept        391590..392201
FT                   /locus_tag="KLLA0_A04323g"
FT                   /old_locus_tag="KLLA-ORF10701"
FT                   /product="KLLA0A04323p"
FT                   /note="some similarities with uniprot|Q04433 Saccharomyces
FT                   cerevisiae YDR534C FIT1 Mannoprotein that is incorporated
FT                   into the cell wall via a glycosylphosphatidylinositol (GPI)
FT                   anchor, involved in the retention of siderophore- iron in
FT                   the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04323g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02777"
FT                   /db_xref="GOA:Q6CY00"
FT                   /db_xref="InterPro:IPR035323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CY00"
FT                   /protein_id="CAH02777.1"
FT                   /translation="MKFSTVAATALAASSSALAAQTVITATNDGVVYTKTIDLAETDAT
FT                   LAPGEYLTSIVVTRGDTVYTKVITESSAAATEETTAAAEETTAAAETTSAAAETTTAAP
FT                   AEETSSAQESETITLTLSKNGHWFTKTVTQAVGYVWTGEDTANWTGTPSWLSNITTSTS
FT                   AAETTEAASSTAEVATYTGAAALASVGTGLLGVAVAGLLI"
FT   gene            <394997..>395902
FT                   /locus_tag="KLLA0_A04345g"
FT                   /old_locus_tag="KLLA-ORF10696"
FT   CDS_pept        394997..395902
FT                   /locus_tag="KLLA0_A04345g"
FT                   /old_locus_tag="KLLA-ORF10696"
FT                   /product="KLLA0A04345p"
FT                   /note="some similarities with uniprot|Q04433 Saccharomyces
FT                   cerevisiae YDR534C FIT1 Mannoprotein that is incorporated
FT                   into the cell wall via a glycosylphosphatidylinositol (GPI)
FT                   anchor, involved in the retention of siderophore- iron in
FT                   the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04345g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02778"
FT                   /db_xref="GOA:Q6CXZ9"
FT                   /db_xref="InterPro:IPR035323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXZ9"
FT                   /protein_id="CAH02778.1"
FT                   /translation="MKFSTVAATALAASSSALAAQTVITATNDGVVYTKTIDLAETDAT
FT                   LAPGEYLTSIVVTRGDTVYTKVITESSAAATEETTAAAEETTAAAETTAAAAEEEASTT
FT                   EYETVTLTLSKNGHWFTKTVTQAVGFVWTGEATTYTGVAPWATSSAADEEITSSGFSNS
FT                   TEVTETVTDKTKTTATITSCEDDICQKTTEEEASSSTVITTVIEGVTVVTTVPCTTTST
FT                   VECTEEQCQKTSTNAPVNPTTVVPTTEAPGKTSSGIVTVSSSSAETAQPSVTVSTYTGA
FT                   AAMASVGTGLFAAAVGAMLL"
FT   gene            complement(<397648..>398133)
FT                   /locus_tag="KLLA0_A04367g"
FT                   /old_locus_tag="KLLA-ORF10693"
FT   CDS_pept        complement(397648..398133)
FT                   /locus_tag="KLLA0_A04367g"
FT                   /old_locus_tag="KLLA-ORF10693"
FT                   /product="KLLA0A04367p"
FT                   /note="similar to uniprot|Q08906 Saccharomyces cerevisiae
FT                   YOR382W FIT2 Mannoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04367g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02779"
FT                   /db_xref="GOA:Q6CXZ8"
FT                   /db_xref="InterPro:IPR035323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXZ8"
FT                   /protein_id="CAH02779.1"
FT                   /translation="MKFSNTAFFAATVSVVAAEAATTVSTIKTIVATNGDHVYTKVVTD
FT                   SAAPVYTESTTVTTTITNNGASYVKTLTIAPQTTIGSSTTSKITITNSDNGATYTKTNV
FT                   VAISSSSDDDDETSSSSSSSSSSSSTSSESSTSDDAAGMLPINVGGALIAGAVACLL"
FT   gene            <400113..>400775
FT                   /locus_tag="KLLA0_A04389g"
FT                   /old_locus_tag="KLLA-ORF10691"
FT   CDS_pept        400113..400775
FT                   /locus_tag="KLLA0_A04389g"
FT                   /old_locus_tag="KLLA-ORF10691"
FT                   /product="KLLA0A04389p"
FT                   /note="weakly similar to uniprot|Q04734 Saccharomyces
FT                   cerevisiae YMR063W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04389g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02780"
FT                   /db_xref="GOA:Q6CXZ7"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXZ7"
FT                   /protein_id="CAH02780.1"
FT                   /translation="MSHFKIVFLTSLSLALVFELFNTISVPITSHLFISEYNGYKFGVF
FT                   GWCKVDGSICSPIRMGYSLDDILLFNDNEYLHLPNHAKYALSKLLLVHVLSFVCVLVFW
FT                   LFAILICIKWLNTSKSVLLFAVGWSMVTFMVSLLGFLIDVLMFASHVTWSSWLMLVSAF
FT                   FVALSGILLCLMIRDLSYRRFVKLQGEVDVCVPMTEPRDPDELNEIWKKKTSKREIL"
FT   gene            complement(<400945..>401796)
FT                   /locus_tag="KLLA0_A04411g"
FT                   /old_locus_tag="KLLA-ORF10689"
FT   CDS_pept        complement(400945..401796)
FT                   /locus_tag="KLLA0_A04411g"
FT                   /old_locus_tag="KLLA-ORF10689"
FT                   /product="KLLA0A04411p"
FT                   /note="similar to uniprot|Q05892 Saccharomyces cerevisiae
FT                   YLR290C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04411g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02781"
FT                   /db_xref="GOA:Q6CXZ6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXZ6"
FT                   /protein_id="CAH02781.1"
FT                   /translation="MMRRIALSKRVLCIPEAIDMSRKLIVLGGTGFLGKRICEAAVGAN
FT                   FQVVSLSRSGKATSSEPWANEVEWRSCDIFNPDTYAPVLRNATDVVHSLGILLENENYK
FT                   KQINGSFWSVPKLSFGGFGKNPLAPKKPERSRFTYDMMNRYSATLLADTYMKVNGGQAQ
FT                   TFSYISADRGFPSIPSGYIDSKRQAEEHISQYGKQIRSIILRPGFMFDERNSESDGRTQ
FT                   IRNFLQMLNCGNEMVLRQKIPFVNDLVRPLISTQQVAHSLILALQDPNCEGVLTLDEML
FT                   KM"
FT   gene            complement(<402462..>403532)
FT                   /locus_tag="KLLA0_A04433g"
FT                   /old_locus_tag="KLLA-ORF10688"
FT   CDS_pept        complement(402462..403532)
FT                   /locus_tag="KLLA0_A04433g"
FT                   /old_locus_tag="KLLA-ORF10688"
FT                   /product="KLLA0A04433p"
FT                   /note="highly similar to uniprot|Q74ZF9 Ashbya gossypii
FT                   AGR292C AGR292Cp and similar to YLR291C uniprot|P32502
FT                   Saccharomyces cerevisiae YLR291C GCD7 Beta subunit of the
FT                   translation initiation factor eIF2B the guanine-nucleotide
FT                   exchange factor for eIF2 activity subsequently regulated by
FT                   phosphorylated eIF2 first identified as a negative
FT                   regulator of GCN4 expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04433g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02782"
FT                   /db_xref="GOA:Q6CXZ5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXZ5"
FT                   /protein_id="CAH02782.1"
FT                   /translation="MSDINVVIDSFVDRLKRKQVVESYQAGLETLQILMRYVSAIRWTS
FT                   TEDLILQIKKFGYSLEKAQPYEYTCGNVVRRVLSMIRDETEEEQTSAEPMISSMFNLLQ
FT                   KPMTDTKTKKVQDNKLDVRQTIVQSIRDLIDEIKNIDEGIQQIAIELIHDREILLTPTP
FT                   DSKTVLRFLLKAREGNNRNFTVLVTEGFPNNATVAHEFAKKLSEHDIETIVIPDSAVFA
FT                   LMSRVGKVIIGAKTVFTNGGTISSTAGVSSVCECAREFRTPVFAVAGLYKLSPLYPFDV
FT                   EKMVEIGGSQNVLPTTENDRVGTVALETINPIADYIPPENIDIYITNIGGFAPSFIYRV
FT                   VWDNYKQEDVNLGEKI"
FT   gene            <403763..>404062
FT                   /pseudo
FT                   /locus_tag="KLLA0_A04466g"
FT                   /old_locus_tag="pseudo-Klla0A-403763-404062"
FT   gene            complement(<404732..>405376)
FT                   /locus_tag="KLLA0_A04499g"
FT                   /old_locus_tag="KLLA-ORF10685"
FT   CDS_pept        complement(404732..405376)
FT                   /locus_tag="KLLA0_A04499g"
FT                   /old_locus_tag="KLLA-ORF10685"
FT                   /product="KLLA0A04499p"
FT                   /note="highly similar to uniprot|P32836 Saccharomyces
FT                   cerevisiae YOR185C GSP2 GTP binding protein (mammalian Ranp
FT                   homolog) involved in the maintenance of nuclear
FT                   organization RNA processing and transport interacts with
FT                   Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p homolog
FT                   that is not required for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04499g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02785"
FT                   /db_xref="GOA:Q6CUG0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CUG0"
FT                   /protein_id="CAH02785.1"
FT                   /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVH
FT                   PLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRD
FT                   LVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR
FT                   KLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
FT   gene            complement(<405802..>406581)
FT                   /locus_tag="KLLA0_A04521g"
FT                   /old_locus_tag="KLLA-ORF10684"
FT   CDS_pept        complement(405802..406581)
FT                   /locus_tag="KLLA0_A04521g"
FT                   /old_locus_tag="KLLA-ORF10684"
FT                   /product="KLLA0A04521p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04521g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02786"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CUF9"
FT                   /protein_id="CAH02786.1"
FT                   /translation="MSKKFSSIADAVKYINDELTKKGYLKDDKLQCSASNESSSEKEQL
FT                   DRDKLVVNVINKLLQRVDNLQDRLKDQDLQLRKAQDKLIERTHFIKSEHNKSANTPEKE
FT                   RKVTKITKIQYREKDTKYLEAKIRKLRLELEDQSSQLRQYADGDRPNITWGTSLGHLTV
FT                   GKLMYSRDAVEANQIDMLSDKLSDVIDINTSLSQDLDAATRLISNMNKTIYTKFVLQIP
FT                   DTTSKTVTVDKSDHHEASSQALNELTRDWEDIKSQLP"
FT   gene            complement(<406920..>407249)
FT                   /locus_tag="KLLA0_A04543g"
FT                   /old_locus_tag="KLLA-ORF10683"
FT   CDS_pept        complement(406920..407249)
FT                   /locus_tag="KLLA0_A04543g"
FT                   /old_locus_tag="KLLA-ORF10683"
FT                   /product="KLLA0A04543p"
FT                   /note="similar to uniprot|Q12349 Saccharomyces cerevisiae
FT                   YLR295C ATP14 Subunit h of the F0 sector of mitochondrial
FT                   F1F0 ATP synthase which is a large evolutionarily conserved
FT                   enzyme complex required for ATP synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04543g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02787"
FT                   /db_xref="GOA:Q6CUF8"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CUF8"
FT                   /protein_id="CAH02787.1"
FT                   /translation="MFRAVPLTLRASRGFSTSFIRRNVIQDLYLKELKAVNLKPITAAD
FT                   AQGAVKPWTTPAAPKLPELELQSADALKEYASSGVETVSEANEQSAEVEEGDWLVLEEL
FT                   EDAHH"
FT   gene            complement(<407581..>408150)
FT                   /locus_tag="KLLA0_A04565g"
FT                   /old_locus_tag="KLLA-ORF10681"
FT   CDS_pept        complement(407581..408150)
FT                   /locus_tag="KLLA0_A04565g"
FT                   /old_locus_tag="KLLA-ORF10681"
FT                   /product="KLLA0A04565p"
FT                   /note="weakly similar to uniprot|Q05900 Saccharomyces
FT                   cerevisiae YLR298C YHC1 U1 snRNP protein required for pre-
FT                   mRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04565g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02788"
FT                   /db_xref="GOA:Q6CXY9"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY9"
FT                   /protein_id="CAH02788.1"
FT                   /translation="MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYRNISLIE
FT                   ESKKLKRTKNRKPHEKEVTESRNAPRCVIHCPTNRRKRMMKITKNKDTLDDLDVLDAIY
FT                   KGSPGYERIFRPENRIDIGHLLKVSKQPQRGNVNRNSVAKPTLNESTSVLPPPRTLAWN
FT                   NTYSMKFHDPSLLQKSINHTVKQLKR"
FT   gene            <408699..>409991
FT                   /locus_tag="KLLA0_A04587g"
FT                   /old_locus_tag="KLLA-ORF10680"
FT   CDS_pept        408699..409991
FT                   /locus_tag="KLLA0_A04587g"
FT                   /old_locus_tag="KLLA-ORF10680"
FT                   /product="KLLA0A04587p"
FT                   /note="highly similar to uniprot|P02992 Saccharomyces
FT                   cerevisiae YOR187W TUF1 Mitochondrial translation
FT                   elongation factor Tu comprises both GTPase and guanine
FT                   nucleotide exchange factor activities while these
FT                   activities are found in separate proteins in S. pombe and
FT                   humans"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04587g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02789"
FT                   /db_xref="GOA:Q6CUF6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CUF6"
FT                   /protein_id="CAH02789.1"
FT                   /translation="MSFLAPRFLTTKVFRPMSIGARTFSSSIRVSAAAFDRSKPHLNIG
FT                   TIGHVDHGKTTLTAAITKTLAERGGADFLDYSSIDKAPEERARGITISTAHVEYETDKR
FT                   HYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVF
FT                   VNKVDTIDDPEMLELVEMEMRELLTQYGFDGDNTPVIMGSALCALEGKQPEIGEQAIMK
FT                   LLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEIVGHNT
FT                   TPFKTTVTGIEMFRKELDQAMAGDNAGVLLRGVRRDQLKRGMVLAKPGTVKAHTKFLAS
FT                   LYILTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPEAVEDHSMQVMPGDNVEMECEL
FT                   VHPTPLEAGQRFNIREGGKTVGTGLVTRILE"
FT   gene            complement(<411494..>412765)
FT                   /locus_tag="KLLA0_A04609g"
FT                   /old_locus_tag="KLLA-ORF10674"
FT   CDS_pept        complement(411494..412765)
FT                   /locus_tag="KLLA0_A04609g"
FT                   /old_locus_tag="KLLA-ORF10674"
FT                   /product="KLLA0A04609p"
FT                   /note="weakly similar to uniprot|Q6Q5F4 Saccharomyces
FT                   cerevisiae YPR015C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04609g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02790"
FT                   /db_xref="GOA:Q6CXY7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY7"
FT                   /protein_id="CAH02790.1"
FT                   /translation="MNLNFNQTHHMVLDSDVPYRRHSSLEAKYAHSSKNVMYQLVRDKT
FT                   AELRRLVEGFVTDETVNSTEHNVIQTEVLQILNILHASTYVPTTAFPSPLSTSWNTNQT
FT                   TVANNNTSNTRNSVSQVVTDTSSNLPTSNDNSMDYTPMRSVGSFVNFQSNYSYRTLPQS
FT                   VNDRESIEAKRCVAEKPKSDLSAANNVRVLIQLPPVNTLLMKENDINNSHQHYPLSQPA
FT                   NMYHQNQQHFPIQHHDSVSQESSQFQPLQDRHYHQTGTTPVPPMMVTTNDAAGPVIPST
FT                   ANASQIQEEQDGSVVNDKDDHSSGSTTERETTLRISKTELDGSITNAMPINDSSLPLKK
FT                   NQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFKSAA
FT                   AATAAGQRQHQTAPRTNEANFVNA"
FT   gene            complement(<413642..>413914)
FT                   /locus_tag="KLLA0_A04620g"
FT                   /old_locus_tag="KLLA-ORF10672"
FT   CDS_pept        complement(413642..413914)
FT                   /locus_tag="KLLA0_A04620g"
FT                   /old_locus_tag="KLLA-ORF10672"
FT                   /product="KLLA0A04620p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65217"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI4"
FT                   /protein_id="CAR65217.1"
FT                   /translation="MHGNVWSTKTLDVSVSVSVSGSKKKCFMANMKEKIHSQDTKRQHH
FT                   VSYLVSHVWYDMGRPMLVESRYRQSTCLTHNRHPLPEMQKKKSTA"
FT   gene            complement(<415070..>416809)
FT                   /locus_tag="KLLA0_A04631g"
FT                   /old_locus_tag="KLLA-ORF10670"
FT   CDS_pept        complement(415070..416809)
FT                   /locus_tag="KLLA0_A04631g"
FT                   /old_locus_tag="KLLA-ORF10670"
FT                   /product="KLLA0A04631p"
FT                   /note="weakly similar to uniprot|Q04602 Saccharomyces
FT                   cerevisiae YDR119W Uncharacterized transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04631g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02791"
FT                   /db_xref="GOA:Q6CXY6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY6"
FT                   /protein_id="CAH02791.1"
FT                   /translation="MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESEDE
FT                   AREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATA
FT                   YLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGG
FT                   GGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAFLVQ
FT                   VPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAF
FT                   MLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGAS
FT                   FANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR
FT                   YYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPH
FT                   EHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIK
FT                   QASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSM
FT                   ERK"
FT   gene            complement(<417313..>419415)
FT                   /locus_tag="KLLA0_A04653g"
FT                   /old_locus_tag="KLLA-ORF10668"
FT   CDS_pept        complement(417313..419415)
FT                   /locus_tag="KLLA0_A04653g"
FT                   /old_locus_tag="KLLA-ORF10668"
FT                   /product="KLLA0A04653p"
FT                   /note="similar to uniprot|P48234 Saccharomyces cerevisiae
FT                   YGR145W ENP2 Essential nucleolar protein of unknown
FT                   function contains WD repeats interacts with Mpp10p and
FT                   Bfr2p and has homology to Spb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04653g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02792"
FT                   /db_xref="GOA:Q6CXY5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY5"
FT                   /protein_id="CAH02792.1"
FT                   /translation="MVLKSTSASEISVYQVSGTNVARSLPDWIAKKRKRSLKNDLEYQN
FT                   RVELIQDFEFSEASNKIKVTPDGNYVMATGTYKPQIHVYDFSNLSLKFERHTDAENIDF
FT                   CILSEDWTKSVHLQNDRTIQFQNKGGIHYTTRIPKFGRSLAYNKVNCDLYVGASSNELY
FT                   RLNLEQGRFLNPFKLDTEGVNHVSINEVNGLLAASMETNVVEFWDPRSRSRVAKLHLEN
FT                   NLDSADFQVTCSSFKNDGLNFACGTSNGYSYIYDLRTSEPSIVKDQGYGFAVNKIIWLD
FT                   SVEDSNKILTCDKRIAKIWNKNDGKAYASMEPSVDINDIEHVPGTGMFFTANEGIPMHT
FT                   YYIPNLGPAPRWCSFLDSITEELEEKPSDSVYSNYRFITKADVKKLNLTHLIGSKVLRA
FT                   YMHGFFINTELYDKVALIANPNSYRDEREREIRRRIEKERESRIKSTGAITTSKVKVNK
FT                   MLVDKLSEKRGDKVAGKVLEDDRFKEMFEDDAFQVDEDDYDYKQLNPVKSARETSEGAA
FT                   KRIRALTAAEESDEERIAARDGKSNYSDESDSESESESDEGNGERDQDMSEKEKKAIAK
FT                   QVAVVKRRREAKEKEQKFMNELTVGQIESREQDAINMTFDKKVKQLNKEIGSSRSKDAI
FT                   VRKNHRGEAELTFVPKKAPQKKKKVKFENNSDGDDDDETAKVDNGRTKPRFDGRRRASK
FT                   NVFRGM"
FT   gene            <420025..>420096
FT                   /locus_tag="KLLA0_A04686r"
FT   tRNA            420025..420096
FT                   /locus_tag="KLLA0_A04686r"
FT                   /product="transfer RNA Arg (TCT) cove"
FT   gene            complement(<420317..>421372)
FT                   /locus_tag="KLLA0_A04708g"
FT                   /old_locus_tag="KLLA-ORF10666"
FT   CDS_pept        complement(420317..421372)
FT                   /locus_tag="KLLA0_A04708g"
FT                   /old_locus_tag="KLLA-ORF10666"
FT                   /product="KLLA0A04708p"
FT                   /note="highly similar to uniprot|P53290 Saccharomyces
FT                   cerevisiae YGR163W GTR2 Cytoplasmic GTP binding protein
FT                   functions as a negative regulator of the Ran/Tc4 GTPase
FT                   cycle downstream of its binding partner and homolog Gtr1p
FT                   homolog of human RagC and RagD proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02794"
FT                   /db_xref="GOA:Q6CXY3"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY3"
FT                   /protein_id="CAH02794.1"
FT                   /translation="MDNNTVDASKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLEST
FT                   TSPTQEHFSTLIDLAVMELPGQLNYFEPNYESEQLFKSVGALVYVIDSQDEYLNALTNL
FT                   AMIIEYAKNVNPYLNIEVLIHKVDGLTEDFKMDIQRDIMQRIGDELLDLGIEGIQLSFY
FT                   LTSIFDHSIYEAFSRIVQKLIPELPFLENMLDNLVQHSKLEKCFLLDINSKIYVSTDSS
FT                   PVDIQTYEVCAEFVDVTIDLQDLYKGKLQNSNNKDGTDMKSVSVLNNGVVIYLKQMIRG
FT                   LALVTLMRPDDTDIEARLTVMDYNVDIFKRGLEKIWEKSKLISNSQDNDDNKDNCEHVA
FT                   PMTNGNASATY"
FT   gene            complement(<421863..>424928)
FT                   /locus_tag="KLLA0_A04730g"
FT                   /old_locus_tag="KLLA-ORF10665"
FT   CDS_pept        complement(421863..424928)
FT                   /locus_tag="KLLA0_A04730g"
FT                   /old_locus_tag="KLLA-ORF10665"
FT                   /product="KLLA0A04730p"
FT                   /note="some similarities with uniprot|P39935 Saccharomyces
FT                   cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
FT                   mRNA cap-binding protein (eIF-4F) 150K subunit highly
FT                   homologous to Tif4632p homologs of mammalian p220"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02795"
FT                   /db_xref="GOA:Q6CXY2"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="InterPro:IPR036211"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY2"
FT                   /protein_id="CAH02795.1"
FT                   /translation="MGEPTSDQQPAVEAPVVQEETTSSPQKNSGYVKNTAGSGAPRNGK
FT                   YDGNRKNSRPYNQRGNNNNNNGSSSNKHYQKYNQPAYGVSAGYIPNYGVSAEYNPLYYN
FT                   QYQQQQQLYAAAYQTPMSGQGYVPPVVSPAAVSAKPAKVEITNKSGEHIDIASIAHPHT
FT                   HSHSQSHSRAVPVVSPPANVTVAAAVSSSVSPSASPAVKVQSPAANGKEQSPAKPEEPK
FT                   KDTLIVNDFLEQVKRRKAALAAKKAVEEKGPEEPKESVVGTDTDASVDTKTGPTATESA
FT                   KSEEAQSESQEKTKEEAPAEPKPLTLAEKLRLKRMEAAKQASAKTEELKTEESKPEETK
FT                   TEELKTEESKPEETKTEELKTEETKSEELKTEEPKAEESKAEEPKPEEPKTEEPTTEQP
FT                   KSDEPKSEESKTEEPKTEVLKTEEPKSEESKPAEPKTEETATEETATEANAEEGEPAPA
FT                   GPVETPADVETKPREEAEVEDDGKITMTDFLQKLKEVSPVDDIYSFQYPSDITPPNDRY
FT                   KKTSIKYAYGPDFLYQFKEKVDVKYDPAWMAEMTSKIVIPPKKPGSSGRGEDRFSKGKV
FT                   GSLRSEGRSGSRSNSKKKSKRDDRKSNRSYTSRKDRERFREEEVEEPKVEVAPLVPSAN
FT                   RWVPKSKMKKTEVKLAPDGTELYDAEEASRKMKSLLNKLTLEMFEPISDDIMKIANQSR
FT                   WEEKGETLKIVIQQIFNKACDEPHWSSMYAQLCGKVVKDLDDSIKDSETPDKTGSHLVL
FT                   HYLVQRCQTEFQTGWTDQLPTNEDGTPLQPEMMSDEYYKMAAAKRRGLGLVRFIGFLYR
FT                   SNLLTSRMVFFCFKRLMKDIQNSPTEDTLESVCELLETIGEQFEGARIQVTAEAVIEGS
FT                   SLLDTLFDQIKNVIENGDISSRIKFKLIDIVELREKRNWNSKNKNDGPKTIAQIHEEEA
FT                   LKRALEERERERDRHGSRGGSRRMNSERNSSRRDFSSHSHSHNQNRDGFTTTRSSSVRY
FT                   SEPKKEEQAPTPTKSSGGAANMFDALMDAEDD"
FT   gene            complement(<425610..>426824)
FT                   /locus_tag="KLLA0_A04752g"
FT                   /old_locus_tag="KLLA-ORF10657"
FT   CDS_pept        complement(425610..426824)
FT                   /locus_tag="KLLA0_A04752g"
FT                   /old_locus_tag="KLLA-ORF10657"
FT                   /product="KLLA0A04752p"
FT                   /note="highly similar to uniprot|Q01939 Saccharomyces
FT                   cerevisiae YGL048C RPT6 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02796"
FT                   /db_xref="GOA:Q6CXY1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXY1"
FT                   /protein_id="CAH02796.1"
FT                   /translation="MSAVQISSIPLTSHDSGIKPFFDQKIQESELRIREKTSNLRRLEA
FT                   QRNALNDKVRFIKDELRLLQESGSYVGEVLKVISEKKVLVKVQPEGKYIVDVAKDINVK
FT                   DLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRTMLELLNQLDGF
FT                   ETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKMNLTRGI
FT                   NLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKNDETAISV
FT                   AKLFK"
FT   gene            <427263..>427856
FT                   /locus_tag="KLLA0_A04774g"
FT                   /old_locus_tag="KLLA-ORF10655"
FT   CDS_pept        427263..427856
FT                   /locus_tag="KLLA0_A04774g"
FT                   /old_locus_tag="KLLA-ORF10655"
FT                   /product="KLLA0A04774p"
FT                   /note="similar to uniprot|P53178 Saccharomyces cerevisiae
FT                   YGL047W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02797"
FT                   /db_xref="GOA:Q6CXY0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXY0"
FT                   /protein_id="CAH02797.1"
FT                   /translation="MNNTVLVTCGATVSFPRLVETVLDRSVTEKLKVLGYGRIVIQYGR
FT                   GFSDTFLQLVEKHLGLFTEKKSCGIKVLDKIENLKVISVDGIEICGFEFSHDIEKLIAN
FT                   NIDLVISHAGTGSILDSLRVGKKLIVVVNDTLMDNHQQLIADKFEQQKLLWSVHANTEE
FT                   LLRALDRSENEELLKIDNTYNKQFEKLLYNVAID"
FT   gene            complement(<427861..>428502)
FT                   /locus_tag="KLLA0_A04796g"
FT                   /old_locus_tag="KLLA-ORF10654"
FT   CDS_pept        complement(427861..428502)
FT                   /locus_tag="KLLA0_A04796g"
FT                   /old_locus_tag="KLLA-ORF10654"
FT                   /product="KLLA0A04796p"
FT                   /note="similar to uniprot|Q754R6 Ashbya gossypii AFR006C
FT                   AFR006Cp and weakly similar to YGL020C uniprot|P53192
FT                   Saccharomyces cerevisiae YGL020C MDM39 Protein involved in
FT                   determination of mitochondrial structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02798"
FT                   /db_xref="GOA:Q6CXX9"
FT                   /db_xref="InterPro:IPR027538"
FT                   /db_xref="InterPro:IPR028945"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXX9"
FT                   /protein_id="CAH02798.1"
FT                   /translation="MESWLLVILAFLVLERLWPLIDSLIQRFAQANSTKLKELMHQRQA
FT                   ILAEQKEISAQDQYVKWTKNNRTLEKINKQIEEEKKQLLSQVDRTKASLKKVKLVLITV
FT                   PFTILKFYKGKMPIYDLPKGLFPNYLQGLFQHGWVYLALGPLNIKKVGDGTHVTVSLAI
FT                   WLFALLKVVSTLGNIWESLTAPAIPAPTITTDPIDQTNESEKPPVDQPVD"
FT   gene            <429275..>430108
FT                   /locus_tag="KLLA0_A04818g"
FT                   /old_locus_tag="KLLA-ORF10653"
FT   CDS_pept        429275..430108
FT                   /locus_tag="KLLA0_A04818g"
FT                   /old_locus_tag="KLLA-ORF10653"
FT                   /product="KLLA0A04818p"
FT                   /note="similar to uniprot|P43639 Saccharomyces cerevisiae
FT                   YGL019W CKB1 beta (38kDa) subunit of protein kinase CK2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02799"
FT                   /db_xref="GOA:Q6CXX8"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX8"
FT                   /protein_id="CAH02799.1"
FT                   /translation="MSFIEPSNDSSDSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDFN
FT                   LTGLSQEVAYYRKALDTILDLESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLY
FT                   GLIHARFILTKAGLQAMAEKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPS
FT                   CQDLYIPQSSRHLSLEGAYWGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKE
FT                   AICGPRMQWLRQYPKTDEEWEEFKKCEFEIPKELLEDNPGSQSSDDNNMSSTVTN"
FT   gene            complement(<430541..>431113)
FT                   /locus_tag="KLLA0_A04840g"
FT   CDS_pept        complement(430541..431113)
FT                   /locus_tag="KLLA0_A04840g"
FT                   /product="KLLA0A04840p"
FT                   /note="similar to uniprot|P53193 Saccharomyces cerevisiae
FT                   YGL018C JAC1 Molecular chaperone involved with partner
FT                   Ssq1p in assembly of Fe/S clusters and in mitochondrial
FT                   iron metabolism contains a J domain typical to J-type
FT                   chaperones localizes to the mitochondrial matrix"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02800"
FT                   /db_xref="GOA:Q6CXX7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX7"
FT                   /protein_id="CAH02800.2"
FT                   /translation="MHRLLLRSYSNASSKTSKTLFQWFPKTFTSGKPQWEVDLKKLRKE
FT                   YRQLQSEHHPDVITSTVDNVSSELNRAYKTLSKPLPRSQYILSLHGIDLTQDGEAQKVM
FT                   SKDPQLLMLVLDVHEQLEDINSEEDLKQIEQENKQRLNECEQKLKKAHESQDWETAAML
FT                   TVELRYWSNLDNAIKEWEPGKPILLTH"
FT   gene            <431710..>433221
FT                   /locus_tag="KLLA0_A04862g"
FT                   /old_locus_tag="KLLA-ORF10651"
FT   CDS_pept        431710..433221
FT                   /locus_tag="KLLA0_A04862g"
FT                   /old_locus_tag="KLLA-ORF10651"
FT                   /product="KLLA0A04862p"
FT                   /note="similar to uniprot|P16639 Saccharomyces cerevisiae
FT                   YGL017W ATE1 Arginyl-tRNA-protein transferase catalyzes
FT                   post-translational conjugation of arginine to the amino
FT                   termini of acceptor proteins which are then subject to
FT                   degradation via the N-end rule pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02801"
FT                   /db_xref="GOA:Q6CXX6"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX6"
FT                   /protein_id="CAH02801.1"
FT                   /translation="MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFY
FT                   KGDEDKVELQSSTVGFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTN
FT                   EKYLTMSKELKTSLKRFKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFT
FT                   DEKYDLYVRYQHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGE
FT                   RVTKNGPAHECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALV
FT                   SKIGRPYYYLGYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFVGLNS
FT                   TVASPDSEILITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPD
FT                   LQRSIYKEIPNDGNSTSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVV
FT                   LFDTKINALRIVRDFISEKPEIKTVITDVIRLIGLDNTKKAIIII"
FT   gene            <433581..>436760
FT                   /locus_tag="KLLA0_A04884g"
FT                   /old_locus_tag="KLLA-ORF10649"
FT   CDS_pept        433581..436760
FT                   /locus_tag="KLLA0_A04884g"
FT                   /old_locus_tag="KLLA-ORF10649"
FT                   /product="KLLA0A04884p"
FT                   /note="similar to uniprot|P32767 Saccharomyces cerevisiae
FT                   YGL016W KAP122 Karyopherin beta responsible for import of
FT                   the Toa1p-Toa2p complex into the nucleus binds to
FT                   nucleoporins Nup1p and Nup2p may play a role in regulation
FT                   of pleiotropic drug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02802"
FT                   /db_xref="GOA:Q6CXX5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX5"
FT                   /protein_id="CAH02802.1"
FT                   /translation="MDINHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANAL
FT                   LSQENGSTNVKYFGALTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASN
FT                   LLVTITKLMSNLSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTD
FT                   NSEIAERLVRTCLNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSN
FT                   VYEMVHNHLYISTMAILNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLT
FT                   EMFNNMINVMCMASNGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRH
FT                   SMNTSNDWMLAYMNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQS
FT                   LEDYIRVLLQLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMF
FT                   NQVVQIYLPKISLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVL
FT                   IRGVGQADTNNVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAIGENHLIDNLLFLLQTG
FT                   CKQKEHSKTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLETSRQYNPI
FT                   EYSIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIG
FT                   NIIQMCVSEGPEAQANHISNMVDMIGGLIQTTDAKSDMLSLLACLSELGSGLSQLPNDD
FT                   EFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSKYGTDPEFVEVSCLIIGKA
FT                   ITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQLTSHEFD
FT                   EMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPEFLKYLQ
FT                   AKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQRSDVP
FT                   QYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRATLSTVTEW
FT                   WLDCNGLPNLQ"
FT   gene            <437523..>438965
FT                   /locus_tag="KLLA0_A04906g"
FT                   /old_locus_tag="KLLA-ORF10643"
FT   CDS_pept        437523..438965
FT                   /locus_tag="KLLA0_A04906g"
FT                   /old_locus_tag="KLLA-ORF10643"
FT                   /product="KLLA0A04906p"
FT                   /note="similar to uniprot|P53090 Saccharomyces cerevisiae
FT                   YGL202W ARO8 Aromatic aminotransferase expression is
FT                   regulated by general control of amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02803"
FT                   /db_xref="GOA:Q6CXX4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX4"
FT                   /protein_id="CAH02803.1"
FT                   /translation="MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGA
FT                   GMPSGNMFPFESISFKSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRG
FT                   QPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSS
FT                   LEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTL
FT                   HEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLG
FT                   RSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTL
FT                   INGMFQRWGQIGYMKWLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYI
FT                   DPHKHPKFEREFKSKVDLLEEHLYNSFVQNGMLLACSSWFRVDPNHNKILAFRGSYASV
FT                   DAEKMQNGIIMLGNVIKAEFCL"
FT   gene            <439349..>441934
FT                   /locus_tag="KLLA0_A04928g"
FT                   /old_locus_tag="KLLA-ORF10642"
FT   CDS_pept        439349..441934
FT                   /locus_tag="KLLA0_A04928g"
FT                   /old_locus_tag="KLLA-ORF10642"
FT                   /product="KLLA0A04928p"
FT                   /note="similar to uniprot|P32479 Saccharomyces cerevisiae
FT                   YBL008W HIR1 Non-essential transcriptional corepressor
FT                   involved in the cell cycle-regulated transcription of
FT                   histone H2A H2B H3 and H4 genes contributes to nucleosome
FT                   formation heterochromatic gene silencing and formation of
FT                   functional kinetochores"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02804"
FT                   /db_xref="GOA:Q6CXX3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXX3"
FT                   /protein_id="CAH02804.1"
FT                   /translation="MKLLKLPWLQHREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIWS
FT                   IPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWE
FT                   LEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIIIWNG
FT                   STFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHVITEP
FT                   FKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGTWESPVSLVGHDQPTEVA
FT                   SFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARPLIVAQD
FT                   ICGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAIPLEQNIEYLHRYGVDKDS
FT                   LVFPETVEQLILEDQAKNLKKSNVDMNLLENRLGKPGTIAEPNILQVRSKKRAQLTGTG
FT                   NHTDNNTTSKAEPPHVNILQVKRKNKVTGVTEVLHDTVVKNGKKRVAPTLITMGHSPDK
FT                   SRKRVILSTAQSLNNTVQPTTKPAPEEKSTLAKLQSTKLSKPSFSIPRLGIHTLIMGFK
FT                   ERTRENFINQGSTDSTVDESNVNIDEGPQQLEQNSAEEHLLTLNSKTTLEKIWRDEPNT
FT                   RYLEFNSILPDADAVLREMGTIDDLYVLEVRNGVERSIQFDTEALYDNSTRVLGYHAGQ
FT                   RSFELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLCTSQ
FT                   SHVIAITETALIYVWDLVSMSLTLKNIPLLPLLARDPITGNRARFTSKIKSAKMTENKD
FT                   LQLVMTDIAPDSDSNPSTLHFLYSSSLSCWCSPKEALLVDASVEQVITS"
FT   gene            <442461..>444818
FT                   /locus_tag="KLLA0_A04961g"
FT                   /old_locus_tag="KLLA-ORF10639"
FT   CDS_pept        442461..444818
FT                   /locus_tag="KLLA0_A04961g"
FT                   /old_locus_tag="KLLA-ORF10639"
FT                   /product="KLLA0A04961p"
FT                   /note="highly similar to uniprot|P07264 Saccharomyces
FT                   cerevisiae YGL009C LEU1 Isopropylmalate isomerase catalyzes
FT                   the second step in the leucine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04961g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02806"
FT                   /db_xref="GOA:Q6CXX1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX1"
FT                   /protein_id="CAH02806.1"
FT                   /translation="MTAPAATESNGPQTLYDKVFQDHIVHKDESGSYLLYIDRHLVHEV
FT                   TSPQAFEGLKNAGRKVRRVDCTLATVDHNIPTESRKNFVDTASFIKQADSRLQVQTLEQ
FT                   NVKDFGVTFFGMTDARQGIVHIIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTS
FT                   EVEHVLATQTIIQAKSKNMRIYVDGPLSPSVTSKDLILHIIGVIGTAGGTGCVIEFAGQ
FT                   AIEELSMEARMSMCNMAIEGGARAGLIQPDQTTFDYIKGRPLAPKGAEWNKAVAYWKTL
FT                   HTDEGAQFDYDITIKSTDVIPTITWGTSPQDALPITASVPDPATISDPAVKATVERALK
FT                   YMGLTPNVPLKELSIDKVFIGSCTNARIEDLRAAAAVVKGHKKADNVKLAMVVPGSGLV
FT                   KKQAESEGLDKIFEEAGFEWREAGCSMCLGMNPDILDPEERCASTSNRNFEGRQGALSR
FT                   THLMSPAMAAAAGIAGHFVDIRDHEYRNSDVPKVSIEQEAEDKILQNAVYEHEKEPIEE
FT                   GESVDEQVDDQQLDIPPSDHVTKETPLKDAPTSAPKGMDPFLKLDGIAAPVDKANVDTD
FT                   AIIPKQFLKTIKRTGLKSGLFYEWRFTKGPDGKDVETDWVLNVEPWRNAEILVITGDNF
FT                   GCGSSREHAPWALKDFGIKCMIAPSFGDIFYNNSFKNGLLPIRLPEDLIVEKLSPLAEA
FT                   GAKLIVDLPSQKIMDAEGNVLVDHFDVEPFRKHCLVNGLDDIGITMQKEEYIAKYEAMR
FT                   RDRFSFLEGGSKLIKPIKGTKKSPFGNRAQEW"
FT   gene            complement(<445032..>448787)
FT                   /locus_tag="KLLA0_A04983g"
FT                   /old_locus_tag="KLLA-ORF10634"
FT   CDS_pept        complement(445032..448787)
FT                   /locus_tag="KLLA0_A04983g"
FT                   /old_locus_tag="KLLA-ORF10634"
FT                   /product="KLLA0A04983p"
FT                   /note="similar to uniprot|P32790 Saccharomyces cerevisiae
FT                   YBL007C SLA1 Cytoskeletal protein binding protein required
FT                   for assembly of the cortical actin cytoskeleton contains 3
FT                   SH3 domains interacts with proteins regulating actin
FT                   dynamics and with proteins required for endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A04983g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02807"
FT                   /db_xref="GOA:Q6CXX0"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXX0"
FT                   /protein_id="CAH02807.1"
FT                   /translation="MTVFLGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVK
FT                   KRVIGSDQDEPVGLVPKTYIEEAPVIGSVVALYDYEQVQNANEELVFHENDTFQLYDDR
FT                   DADWFLVKNTKNSEVGFVPGNYVEKQSQQAGGPAAGVTQSKHQAPAVLPLSELPAPPQR
FT                   LDRVNSQPSFRSGSTPAGAASTADAPGAPSTSTPPPASNAGVASHTTMPVDVSLLPPPP
FT                   KRNDTATTEVQRESAVAEPPAMPQRPSNTEHQTSYRDDPRDNNRTSQITRDYSDDERDY
FT                   DFDDDEEDQPPLPSRNGRPSASTAEHVWSVSEVDGRKKCKATLTVSAERIHFFSAKTKV
FT                   DQEWAVKDLINYNNEKKHLFLEFKNPYINLELHTGSNDLANEIMGVLGEIKGAQTAVGL
FT                   REVEAASRPAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGK
FT                   RGIVPAQFVETRGSGSSRPSDESPSRSKSKTRSRSNTSNFTQNLVGSWKEDADQDVSKK
FT                   KSKTSSFFSKKKKTDDKEFPDPKKVRIWVDRSGTFKVEAQFLGCVDGKVNLHKVNGVKI
FT                   AVAADKLSEDDILYVERLTGMSMEKFKHKPKSSNNDSSAVNAERERRRKAKERERELEE
FT                   RERDRQLREQELKELKRARDLLESEREKLRSAQDKELPPVKPPRPGSEASKTHPVTKSS
FT                   KNPEYDWFEFFLNAGVDVNNCQRYTINFEREQISEEILPDIEPSLLRNLGLREGDILRV
FT                   MKYLDNKFGRTKEASPSTGLFTEADGSLKVNHTGAPASAGVSHNLLPDSNSSNRDDDAW
FT                   TVRPAAKASDSSNKAQDFSGSLQDLLDLQPLEPKKKETPAPDVKHLESVTTNGSNKKEE
FT                   TPLSANKTGTSLVPLDPFKTGGNNLIPITTGGFIMMPVATGGLMPFQPTGGLVPLQRTG
FT                   GMIAPQTTFGMQPTGTVLPVQKTANGLIPANTGGLMPQTTFGVQPQTAFPATTFGSSIT
FT                   GGAMPLQRTGGALPPTSFNTQMPGAMPLQSTNTFGNQLTGGANLLPSTTFGNQFTGGAN
FT                   LQPATTFGNQFTGGANIQPATTFGNQFTGGANIQPNFNSGNLFTGNQMNIQPQTTFGNQ
FT                   FTGGINLQNQPSLGNQLTGGALLQQSQLSFGNQLTGGANVQQPFNSNLPQTSFGLSQTT
FT                   TGGFQPQSSFGINLQRTGGMNTAPQTSFNNQGGVNQVTNSFQNMNLSQQPLQNQPTGFG
FT                   FGNGPQAQQQRQANIFNASSSNPFGF"
FT   gene            complement(<449590..>450111)
FT                   /locus_tag="KLLA0_A05005g"
FT                   /old_locus_tag="KLLA-ORF10630"
FT   CDS_pept        complement(449590..450111)
FT                   /locus_tag="KLLA0_A05005g"
FT                   /old_locus_tag="KLLA-ORF10630"
FT                   /product="KLLA0A05005p"
FT                   /note="similar to uniprot|P25338 Saccharomyces cerevisiae
FT                   YGL010W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05005g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02808"
FT                   /db_xref="GOA:Q6CXW9"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW9"
FT                   /protein_id="CAH02808.1"
FT                   /translation="MSPSLLDLETQLAFYKAYHNNTGNVLIHSIFVPTILFTSMRILND
FT                   VKIWNGYTLTHLLALSFGLFYILLRVGTGILASLILALTCKFLNDGTIKMTQTTAWILF
FT                   VISWIFQFIGHGVFEKRKPALLDNLVQSLVLAPYFILYELLFILGFMPELKKNLQARVD
FT                   KELDRMRASK"
FT   gene            <450398..>451138
FT                   /locus_tag="KLLA0_A05027g"
FT                   /old_locus_tag="KLLA-ORF10629"
FT   CDS_pept        450398..451138
FT                   /locus_tag="KLLA0_A05027g"
FT                   /old_locus_tag="KLLA-ORF10629"
FT                   /product="KLLA0A05027p"
FT                   /note="highly similar to uniprot|P21243 Saccharomyces
FT                   cerevisiae YGL011C SCL1 Proteasome subunit YC7alpha/Y8
FT                   (protease yscE subunit 7)"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05027g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02809"
FT                   /db_xref="GOA:Q6CXW8"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW8"
FT                   /protein_id="CAH02809.1"
FT                   /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTAS
FT                   VVISQKKVPDKLLDPKTVSYIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGY
FT                   DIPCSVLAKRMANLSQIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKAT
FT                   ATGPKQQELNSALEKHFKKLKDDKIDEESWEKTVEFGITTLIDSLGTDFSKNDLEVGVA
FT                   IKDKFFTLTADEIEERLVSIAEQD"
FT   gene            complement(<451480..>451926)
FT                   /locus_tag="KLLA0_A05049g"
FT                   /old_locus_tag="KLLA-ORF10628"
FT   CDS_pept        complement(451480..451926)
FT                   /locus_tag="KLLA0_A05049g"
FT                   /old_locus_tag="KLLA-ORF10628"
FT                   /product="KLLA0A05049p"
FT                   /note="weakly similar to uniprot|P38210 Saccharomyces
FT                   cerevisiae YBL006C LDB7 Protein of unknown function null
FT                   mutant shows a reduced affinity for the alcian blue dye
FT                   suggesting a decreased net negative charge of the cell
FT                   surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05049g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02810"
FT                   /db_xref="GOA:Q6CXW7"
FT                   /db_xref="InterPro:IPR013895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW7"
FT                   /protein_id="CAH02810.1"
FT                   /translation="MGYYDAICTLDTLDGAEQVSFTKNQLAFLVEEEIQQRKDRDELKP
FT                   KDTVEGRRVPVHEYLGPLSPKQAEAAAFAEYHWDHQLLGPYVPKSKLESLSANEFAAYF
FT                   RKRQFEEGRKALERVSMVPAIDLPIMGGGNPYGAAPHKQKHYRN"
FT   gene            complement(<452333..>453730)
FT                   /locus_tag="KLLA0_A05071g"
FT                   /old_locus_tag="KLLA-ORF10627"
FT   CDS_pept        complement(452333..453730)
FT                   /locus_tag="KLLA0_A05071g"
FT                   /old_locus_tag="KLLA-ORF10627"
FT                   /product="KLLA0A05071p"
FT                   /note="similar to uniprot|P25340 Saccharomyces cerevisiae
FT                   YGL012W ERG4 C-24(28) sterol reductase catalyzes the final
FT                   step in ergosterol biosynthesis mutants are viable but lack
FT                   ergosterol"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05071g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02811"
FT                   /db_xref="GOA:Q6CXW6"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW6"
FT                   /protein_id="CAH02811.1"
FT                   /translation="MSDSTEEIKVAVRKPFLPQGKYLKLEEIEYEFGGIPGVIGMMVGF
FT                   PALMYYMWLSAQFYNGAPAWPKDGETWGQFLGHLLQLVKDHGVPSLYAWTIFLTFWVAQ
FT                   IVFYYTLPGVWTKGQPLDHLQGKQLPYYCNAMWTFYVSNALIITLHLTGIFKLYTILDM
FT                   FGEIMTCAIISGFAFSIYLYVYTLTVSKDYHRMTGTHIYDLFMGAPLNPRIGYLDLKMF
FT                   FEVRLPWYTLYFLTLGACFKQAEVYGRVSPQLWLILFAHWSYANACSKGEELIVPTWDM
FT                   AYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYQWSTIYNVSLFVVLMIAYYFFDT
FT                   TNAQKNSFRKQIAGDKTIRKTFPFLPKQVLKNPKYMITENGSYLLIDGWYKLARKIHYT
FT                   ADWTQSLIWGLSCGFNSPFPWFFPVFFFVVLVHRALRDDAKCKKKYGADWDKYCKECPY
FT                   LFIPYVF"
FT   gene            <454423..>455211
FT                   /locus_tag="KLLA0_A05093g"
FT                   /old_locus_tag="KLLA-ORF10625"
FT   CDS_pept        454423..455211
FT                   /locus_tag="KLLA0_A05093g"
FT                   /old_locus_tag="KLLA-ORF10625"
FT                   /product="KLLA0A05093p"
FT                   /note="highly similar to uniprot|P32379 Saccharomyces
FT                   cerevisiae YGR253C PUP2 Alpha subunit of the 20S proteasome
FT                   involved in ubiquitin-dependent catabolism human homolog is
FT                   subunit zeta"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05093g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02812"
FT                   /db_xref="GOA:Q6CXW5"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW5"
FT                   /protein_id="CAH02812.1"
FT                   /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEG
FT                   IVLGVEKRVTSALLESDSIEKIVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYD
FT                   EKITVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGT
FT                   FYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAESLVLKILKQVMEEKLDENNAQLSSI
FT                   TKEGFQIYSDEKTAEIIKELKEKEKEEKPPGSEHSDVEME"
FT   gene            complement(<455456..>457006)
FT                   /locus_tag="KLLA0_A05115g"
FT                   /old_locus_tag="KLLA-ORF10624"
FT   CDS_pept        complement(455456..457006)
FT                   /locus_tag="KLLA0_A05115g"
FT                   /old_locus_tag="KLLA-ORF10624"
FT                   /product="KLLA0A05115p"
FT                   /note="highly similar to uniprot|Q03330 Saccharomyces
FT                   cerevisiae YGR252W GCN5 Histone acetyltransferase
FT                   acetylates lysine 14 on histone H3 catalytic subunit of the
FT                   ADA and SAGA histone acetyltransferase complexes founding
FT                   member of the Gcn5p-related N-acetyltransferase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05115g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02813"
FT                   /db_xref="GOA:Q6CXW4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037800"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXW4"
FT                   /protein_id="CAH02813.1"
FT                   /translation="MPPKRRHHGAGRVQNKRGKVDTVKEEIKPKDEPVETEIDGGSAVD
FT                   EDVTDDLEHKTSKEDQKEDQKEEDGPIDAQNGTSETKVAGESVKTVEDKIESVTTNEEV
FT                   VESPVNDYNASSTTTKAEEKQLEEEANEKTDTSPIVENEVVDEEAGTTKFDFDGQEYSY
FT                   KDRPSVIEEKEGKIEFRVVNNDNSKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSH
FT                   LSMAVVRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATS
FT                   PIKYFLTYADNYAIGYFKKQGFTKEITLDKNVWMGYIKDYEGGTLMQCSMLPRIRYLDA
FT                   AKILLLQEAAIRRKIRSISQSHIVRPGLKQFLDLDNIKPIDPMTIPGLKEAGWTPEMDE
FT                   LAQRPKRGPHYAAMQNLLTELQNHAAAWPFLQPVNKEEVPDYYEFIKEPMDLSSMEMKL
FT                   NGNRYEKMENFIYDARLIFNNCRAYNGENTSYFKYANRLEKFFNSKVKEIPEYSHLVD"
FT   gene            complement(<457440..>459251)
FT                   /locus_tag="KLLA0_A05137g"
FT                   /old_locus_tag="KLLA-ORF10622"
FT   CDS_pept        complement(457440..459251)
FT                   /locus_tag="KLLA0_A05137g"
FT                   /old_locus_tag="KLLA-ORF10622"
FT                   /product="KLLA0A05137p"
FT                   /note="similar to uniprot|P38862 Saccharomyces cerevisiae
FT                   YHR171W ATG7 Autophagy-related protein that is a member of
FT                   the E1 family of ubiquitin-activating enzymes mediates the
FT                   conjugation of Atg12p with Atg5p a required step in the
FT                   formation of autophagosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05137g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02814"
FT                   /db_xref="GOA:Q6CXW3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR006285"
FT                   /db_xref="InterPro:IPR032197"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR042522"
FT                   /db_xref="InterPro:IPR042523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXW3"
FT                   /protein_id="CAH02814.1"
FT                   /translation="MLNDLKFSPAFKSFVDTSFFHELSRLKLEVFKLDSAEKELFSALD
FT                   LENITSNTVSLSLRDDSFDPVLNNEAVTLKGSVLNFNTIESFKSCDKVKFIKEKGQQLL
FT                   EQGLKNGLKECVRFYVISFADLKKYKFYYWVCMPTFQSEGSSYEIISTKSIEDGVKKDI
FT                   WEQNSFISCVVDGKIQEASPQYLKVCQKVIFKDFSRLKGIPAAVTKNFLTVWSQISTRN
FT                   TYTICFLRDDNSSFAAEIRVTGSNTGCLKVSGWEKNGLGKLAPKSADLSSLMDPVKIAE
FT                   QSIDLNLKLMKWRIAPDIDLERIKNIKALILGSGTLGCYVARALLAWGTRHVTFVDNST
FT                   VSFSNPVRQPLFNFEDCGRPKAEAASDSLKKIFPSVVSAGYQLEIPMIGHPVSNESKQR
FT                   KDYEILDELIRTHDVIFLLMDARETRWLPSVLGRMHEKIVINAALGFDSYLVMRHGNNN
FT                   DNLGCYFCNDIVAPSDSLTDRTLDQMCTVTRPGVALLAASQAVELLVTYLQPSTNVLGS
FT                   APHQIRGFLNEFKTVKLETPAYQHCCASNENVILTLKENGWNFVKQALDDYKCVEQLSG
FT                   LSKVQEEAELAIQEDISFDDDEELSIE"
FT   gene            complement(<459573..>461117)
FT                   /locus_tag="KLLA0_A05159g"
FT                   /old_locus_tag="KLLA-ORF10619"
FT   CDS_pept        complement(459573..461117)
FT                   /locus_tag="KLLA0_A05159g"
FT                   /old_locus_tag="KLLA-ORF10619"
FT                   /product="KLLA0A05159p"
FT                   /note="similar to uniprot|P38861 Saccharomyces cerevisiae
FT                   YHR170W NMD3 Protein involved in nuclear export of the
FT                   large ribosomal subunit acts as a Crm1p-dependent adapter
FT                   protein for export of nascent ribosomal subunits through
FT                   the nuclear pore complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05159g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02815"
FT                   /db_xref="GOA:Q6CXW2"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW2"
FT                   /protein_id="CAH02815.1"
FT                   /translation="MNYTPLDQNHMQHQHATVLCCSCGVPMDGSSGLVMCYDCIKLNVD
FT                   ITEGIPREANVSFCRNCERFLQPPSQWIRASLESRELLALCLRRLKGLNKVRLVDASFI
FT                   WTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVIAMQCPDCARSYTTNTWRANVQIR
FT                   QKVPHKRTFLYLEQLILKHNAHVDTISISEAKDGLDFFYSQKNHAAKMLDFLNAVVPIK
FT                   CKKSEELISQDIHTGSSTYKFTFSVEIVPICRDDLVVLPKKLAKSLGNISQFVICSKVS
FT                   NSLQFLDPTTLQTCDLTAPMYWREPFSALAEVSQLVEFIILDVEPTGQVRNKWVLADVT
FT                   VARSSDLGSNDQVYYVRTHLGGIIHPGDSVMGYFIANSNYNSELFDGLNIDYVPDIVLI
FT                   KKLYQRKTKKNRKWKLKRMAKEHKDIEASQDYTSRQQKQEMERAERDYEIFLQELEEDE
FT                   EMRQTINLYKSNKPAEHEGEMEEDEDEDAPQIDIDELLDELDEMTLEDQQQGEEML"
FT   gene            complement(<461373..>461966)
FT                   /locus_tag="KLLA0_A05181g"
FT                   /old_locus_tag="KLLA-ORF10618"
FT   CDS_pept        complement(461373..461966)
FT                   /locus_tag="KLLA0_A05181g"
FT                   /old_locus_tag="KLLA-ORF10618"
FT                   /product="KLLA0A05181p"
FT                   /note="similar to uniprot|P53317 Saccharomyces cerevisiae
FT                   YGR251W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05181g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02816"
FT                   /db_xref="GOA:Q6CXW1"
FT                   /db_xref="InterPro:IPR022592"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXW1"
FT                   /protein_id="CAH02816.1"
FT                   /translation="MSRAQEIKEKQALLAKFQNGFSSSTAKVLGWIEDSKTSSNDLAKE
FT                   DSNESKKEFFQLPVIQIGSGLSFENAQSTDDTDIHTIGEFIKSDKKVSSLAKKKRATKD
FT                   VQQRNSIHRVRKDDSQAMVSLKHKIRNQERQKIRNELPRGTNVSKDHSKNQYYTKSTSS
FT                   HSDSSSDEEDMEPKVQKHSKKQFGLLFAGKKSKR"
FT   gene            complement(<462167..>463474)
FT                   /locus_tag="KLLA0_A05203g"
FT                   /old_locus_tag="KLLA-ORF10617"
FT   CDS_pept        complement(462167..463474)
FT                   /locus_tag="KLLA0_A05203g"
FT                   /old_locus_tag="KLLA-ORF10617"
FT                   /product="KLLA0A05203p"
FT                   /note="highly similar to uniprot|P38719 Saccharomyces
FT                   cerevisiae YHR169W DBP8 Putative ATP-dependent RNA helicase
FT                   of the DEAD-box family involved in biogenesis of the 40S
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05203g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02817"
FT                   /db_xref="GOA:Q6CXW0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXW0"
FT                   /protein_id="CAH02817.1"
FT                   /translation="MSNSEFKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCI
FT                   GGANTGSGKTIAFAAPMLTKWSEDPQGMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVA
FT                   IVVGGESIVQQAIELQKRPHFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILL
FT                   TETFSKDLATCVSILPPKNKRQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVESVDN
FT                   VAIPKTLETTYLLVPEHVKESYLYQILTSEKYVKSSCIIFVNRTVTAEILRRTLKSLDV
FT                   RVTSLHSQMPQQERTNSVQRFRAQAARVLIATDVASRGLDIPIVELVVNYDIPGNPDTF
FT                   IHRAGRTARAGRHGESLCFVTEKDIQRVEAIEERINKKMEEFTDVGDTAVIRKSLTKVT
FT                   AAKRESLMAMDKEGFGERRKLQKRKNESKEKTHRRT"
FT   gene            complement(<463760..>465448)
FT                   /locus_tag="KLLA0_A05225g"
FT                   /old_locus_tag="KLLA-ORF10615"
FT   CDS_pept        complement(463760..465448)
FT                   /locus_tag="KLLA0_A05225g"
FT                   /old_locus_tag="KLLA-ORF10615"
FT                   /product="KLLA0A05225p"
FT                   /note="similar to uniprot|P38860 Saccharomyces cerevisiae
FT                   YHR168W MTG2 Putative GTPase member of the Obg family
FT                   peripheral protein of the mitochondrial inner membrane that
FT                   associates with the large ribosomal subunit required for
FT                   mitochondrial translation possibly via a role in ribosome
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05225g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02818"
FT                   /db_xref="GOA:Q6CXV9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV9"
FT                   /protein_id="CAH02818.1"
FT                   /translation="MDTRRKSIRTGAIVMLGRPIFRRISRVNRCRFFSDVPDNAPGAID
FT                   NEIWLQELASSRSKQKAPTAAVESTQNLSIKEEKKTSVQPMKGLRNKITFNIISTPPDT
FT                   QYIEIKSPLSNFTKLSYLQKNKNIRVQQSNFVDLRIIKCASGNGGDGCISFFRDRGRAI
FT                   GPPDGGDGGGGGSVYVQAIEGINSLSKLQTTYIADNGSNGTSAQADGSKGKDVMITVPV
FT                   GTVVTWCLDPKVVREHVDQKIKEQGGGSLRTILDTSNIILNCTGRFYMDQKPNRIQMFR
FT                   ESYEPGKGWIFKGKDEEYHLSKDWFQDLSKNVTEYDHNLLQTELESDRFPLYGLDLSKP
FT                   TEKPICLLKGGKGGLGNMHFLTSLIRNPRFCKEGRSGLQQHFMFELKSIADLGLVGLPN
FT                   AGKSTILNQISNATPRVGHWEFTTLHPTIGTISLGIDKPKFTVADIPGIIKDASQDKGM
FT                   GLEFLRHIERSKGWVFVISLEKDDPSQDLQILIEEVGGKEVVSLKNILVVCNKADIDEK
FT                   STFKKYQKIQAQCQENNWDVVPISALKGENIDVLLHKMAQCAGKL"
FT   gene            complement(<465702..>466481)
FT                   /locus_tag="KLLA0_A05247g"
FT   CDS_pept        complement(465702..466481)
FT                   /locus_tag="KLLA0_A05247g"
FT                   /product="KLLA0A05247p"
FT                   /note="some similarities with uniprot|O13539 Saccharomyces
FT                   cerevisiae YHR167W THP2 affects transcription elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05247g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02819"
FT                   /db_xref="GOA:Q6CXV8"
FT                   /db_xref="InterPro:IPR018557"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV8"
FT                   /protein_id="CAH02819.2"
FT                   /translation="MSNIYLDKLDEQEDQMRVTHTVATDIINSLEELVGALEREETTEG
FT                   LETLKVLKSKNDELLKSIAVTRVLQINSSEIRANLMKDPDLTASKIFLSSDDRDDPNNL
FT                   FNYFEETKGLHEAWMRHLSLVANLSDDLVHKLESSDESNKVLVNKNPLPAVLKETVKQY
FT                   EEIGDEQQRIENIRAKLFQYLDEIKAGRAKYALENKYILNSTLQQITKEVSEWSQRWTH
FT                   IENSLFGDSPTSLKKLVQKAENIKELLTVESTDYQME"
FT   gene            <466776..>468674
FT                   /locus_tag="KLLA0_A05258g"
FT                   /old_locus_tag="KLLA-ORF10612"
FT   CDS_pept        466776..468674
FT                   /locus_tag="KLLA0_A05258g"
FT                   /old_locus_tag="KLLA-ORF10612"
FT                   /product="KLLA0A05258p"
FT                   /note="similar to uniprot|P16522 Saccharomyces cerevisiae
FT                   YHR166C CDC23 Subunit of the anaphase-promoting
FT                   complex/cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02820"
FT                   /db_xref="GOA:Q6CXV7"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV7"
FT                   /protein_id="CAH02820.1"
FT                   /translation="MERLVFEDVQQQLRQSSTDLSRWKLFQSSKWSAEALMGMRPTDSE
FT                   DSLSADMSLATDGDDESPLKKRQILSSRCVLLDFCDNENQSETLPDVIPLMGKELDLYL
FT                   LASSMFDCKEYDRCAFFLKDTSHDGLEFLYLYSRYLLWDKKVTESTEDVMIKDPEIFSA
FT                   DLSESLQAAEYGNDAEGKCRSGISLSNRDVDVGNGEKINLPKLHHEITDFLEKNKSLSK
FT                   LGTALLMYLLGIIQKKQGVPSGAMSYFLKSLKLYPYNWTCWCELLSCISRTDESILLLK
FT                   YLNDNFSIVKENGIIHEHLMLRFFKLAVFKEFGGDFDKYIEELGEIMKVFPNFSFLRAQ
FT                   HALINYKYMDYANAEIVFDELVTMDPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVD
FT                   IYRPETCCIIANYFSSKQQHEKSILYFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIE
FT                   CYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACALKPLDKRMWFASASCYEK
FT                   LDKTVQAIKCFQRSSQLSGEQDISILYRLAKLHEKNNDVSSCKHYMAKCVELDEVKKAQ
FT                   QIDEIGKAKLWLAKHEFKHRNYSDAYNYANGVIHGTSQEIEEARAILAECRKRIDI"
FT   gene            <469130..>476365
FT                   /locus_tag="KLLA0_A05280g"
FT                   /old_locus_tag="KLLA-ORF10610"
FT   CDS_pept        469130..476365
FT                   /locus_tag="KLLA0_A05280g"
FT                   /old_locus_tag="KLLA-ORF10610"
FT                   /product="KLLA0A05280p"
FT                   /note="highly similar to uniprot|P33334 Saccharomyces
FT                   cerevisiae YHR165C PRP8 Component of the U4/U6-U5 snRNP
FT                   complex involved in the second catalytic step of splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02821"
FT                   /db_xref="GOA:Q6CXV6"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV6"
FT                   /protein_id="CAH02821.1"
FT                   /translation="MSGLPPPPPPPPGFPSYDITSKNHKSKGNEMEKHRSPVGAPPPPP
FT                   PGFSRVDLGPPPPPPPGIQPGIDILSDKAKNNLPPPPPPPPSSSSTSMIDEAQNDDQHY
FT                   NGLSRDTKKIRKGKKRVAQKKSGLVHSHKVEMPPEHLRKILNDHMDMTSSRFNSDKRAH
FT                   LNALRYLPHAILKLLENMPQPWEQVKAVKVLYHVSGAITFVNEIPRVIEPVYTAQWSTM
FT                   WIAMRREKRDRKHFKRMRFPPFDDDEPPLTYSDTIENLEPSEAITLDLDNYAHDGVKDW
FT                   IYDTRPLEDNAKAVNGSSYKRWKLDNGVMCSLYRLAKPLIEESNSDKNAKYLFEQKAFF
FT                   TSKALNNSLPGGPKFEPLYPNEEEEDYNEFNSIDRVIFRIPIRTEYQIAFPQIYAARPR
FT                   SVETLWYHDPLSCTVKSEMEHSSATFFFGQSLNPTISHSLPHFHTTAENTRDNSFRIPM
FT                   DVRPLMETQELFFPTTNEAMSLYHAPYPYNKRSGKTTRAQDVALIKRWYQEHPDERYPN
FT                   KVKSSHQRLLKNIVANELHTDDHTSKKKVKLLQSLANTKFFQETTIDWVEAGLQVCKQG
FT                   HSMLNLLIHKKGLTYLHLDYNFNLKPTKTLTTKERKKARFGNAFHLIREILKIIKLLVD
FT                   SHVQYRMGNVDAFQLADGLYYILNHTGQLTGIYRYKYKVMHQIRTCKDLKHVVYYRFNK
FT                   IIGKGPGCGFWQPAWRVWIFFLRGIIPILERWLGNLLTRQFEGRSTDVVKTTTKQRLDA
FT                   YYDLELRASVMNDILDMIPDGIKQSKARTILQHLSEAWRCWKANVPWEVPGMPEPIKNI
FT                   IERYVKAKADGWTSQAHYNRDRIKSGAHVEKIVLKKNLGRLTRLWIKHEQERQKEIEKA
FT                   GPEVTPAEASAVFSAMVDWLDARNFSPIPFPPLTYKNDTKILVLALENLKEQYVSKVRL
FT                   NAQEREELALIEEAYDNPHDTLNRIKKLLLTQRLFKPIQLTMMDHYQHISPVYNVDPLE
FT                   KITDAYLDQYLWYEADRRQLFPSWIKPGDSEIPPLLVYKWCQGINNLDSVWDISKGQST
FT                   VLLQTDLQEFVEKMDLTLINRLLRLIIDPTLADYITAKNNVSLIFKDMNHVNKYGLIRG
FT                   LQFAPFVYQFYGLMIDILILGHERAQELAGPPNEPSEFLQFPDKATETKSPIRLYSRYL
FT                   DKIHILFHFEESESDELIQDYLMENPDPNFENSVGYNNKKCWPRDARMRLIRHDVNLGR
FT                   AVFWELTSRVPKSLVNITWENTLSSVYSKNNPNLLFTMCGFEVRILPKSRMEDVISHDE
FT                   GVWDLVLDSTKERTAKAFLQVSQEAIDEFRGRIQSILMGSGSTTFTKIVGKWNTALIAL
FT                   FTYFRESIVTTEPLLDLLVKSETRVQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMLS
FT                   ASHILIPASDLRWSKHTDTGITHFRAGMSHEDEKMIPTIFRYITTWENEFLDSQRVWAD
FT                   YAAKRQEAIKQNRRLAFEELEGSWDRGIPRISTIFQKDRHTLAYDKGHRIRRQFKEYSV
FT                   ERSNAFWWTNNRHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFKSWEGLFWEKA
FT                   SGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGK
FT                   IPTLKISLIQIFRAHLWQKIHESVVFDICQILDGQMDILQIESVQKESIHPRKSYKMNS
FT                   SAADITLNSIYKWKVSRPTLLHQTKDSFDATTTDKMWIDVQLRYGDYDSHDISRYVRAK
FT                   FLDYTTDNVSLYPSPTGIMIGIDLAYNIYDSYGTWFEGLKPLIHNGMKTIMKANPALYV
FT                   LRERIRKGLQIYQSQVQEPFLNSSNYAELFSNDTKFFIDDTNVYRVTVHRTYEGNVATK
FT                   PINGCVFTLNPKTGELYLKIIHTSVWAGQSRLAQLAKWKTAEEVSALVRSLPKEEQPKQ
FT                   IIVTRKAMMDPMEVHMLDFPNISIRPTELRLPFSSVLNIEKLNDVVLSATEPQMVLFNI
FT                   YDDWLTRVSAYTAFSRLILLLRALKTNEEKAKMILLEDPTIPTRANHLWPSFTDDQWIE
FT                   IETKMRDLILLEYGQKYNVNIASLTQTEIKNLILGQNIRAPSVQRQKMAELEAARNQKT
FT                   DESSQSATAAMKLKTINAQGEEITVVSSSNYESQSFSSKNAWRSNAISNSLLHLKLKNI
FT                   YVTAEDFVEDKDVLVFPRNLLKKFVTIADVDVQIAGYMYGSPVKDHPNVKEIKTIALVP
FT                   QLGSSATVRISPPPSSSKYLNDMELLGWIHTQKVDSKFMSPSEVITHSKMFSDHNESAV
FT                   DLCINLIPGAVSITGYTLSTTGFNWGLQSKDITDPSPEGFEASFSETAQILLSERIMGN
FT                   FLVPSSSIWNYAFMGTAFSEDLPYELKLDIPLEFYNELHRAPHFIQFSELAGDEELEPD
FT                   QENLFA"
FT   gene            <476757..>477878
FT                   /locus_tag="KLLA0_A05302g"
FT                   /old_locus_tag="KLLA-ORF10609"
FT   CDS_pept        476757..477878
FT                   /locus_tag="KLLA0_A05302g"
FT                   /old_locus_tag="KLLA-ORF10609"
FT                   /product="KLLA0A05302p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02822"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV5"
FT                   /protein_id="CAH02822.1"
FT                   /translation="MARTTTKRNVSAATRPQRKNPLRFKPGNSGPKYNRPNAAGPKKTD
FT                   HMIAATSTNANQTSNSDKSSKFLPMSGHEMNAAKYIMELTRLGYSFDKVQKGSKSNYNF
FT                   LSKMYNALRLPVNIDSGDISSNEENDVKIAVKENLLTKPTAFQNSIEKQETPKLSQNET
FT                   EATEFNQSTSAPNVSNTKNRSFALPEERELTAIDSIASEMNEEKLGMALYEQTSRILMK
FT                   TRLNLLKLKAAANKRVPKFSKELEASLKKKKDLLISDIESFYSTIGLRDEFAPGMNDDF
FT                   IELGDSFMDKSNHDEHIVNDENELPKRLQSPDQHISMANSKTYQLNLNQASNGLVEPST
FT                   IIQDSVIKLKKSTPDHFTPYQSLNLTKRTQPNT"
FT   gene            <478337..>482674
FT                   /locus_tag="KLLA0_A05324g"
FT                   /old_locus_tag="KLLA-ORF10608"
FT   CDS_pept        478337..482674
FT                   /locus_tag="KLLA0_A05324g"
FT                   /old_locus_tag="KLLA-ORF10608"
FT                   /product="KLLA0A05324p"
FT                   /note="weakly similar to uniprot|P38859 Saccharomyces
FT                   cerevisiae YHR164C DNA2 Essential tripartite DNA
FT                   replication factor with single-stranded DNA-dependent
FT                   ATPase ATP-dependent nuclease and helicase activities
FT                   required for Okazaki fragment processing involved in DNA
FT                   repair pathways potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02823"
FT                   /db_xref="GOA:Q6CXV4"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV4"
FT                   /protein_id="CAH02823.1"
FT                   /translation="MVSTPKKKRTASVSISPFKKDTDAISVDYKGKPKKKPSKSYHFAP
FT                   LNRLSSEEPILKSIPISRVRNVEAGSSVKDTVNAKTSGKTKLASKRIINSTKTRREKST
FT                   EAVPETRYSDGPSEEVIWRYSPRKIDEQLCNHYNTGNDDNNSDELSQDMPLGQSSTPLI
FT                   NDKFKDVIDFENMDPNSIDKECRKIAQGSPVKRGEKDVTPMRDIHEILNDLEGPKLLPP
FT                   SSPICSEPVVIDDDPVENLPELASESISNHKHTTTNGIERTFTMYPPQINIDDDEDEDD
FT                   SLIDILTQRFTKPVITECNEESEESDASLLELLDEEKPATLPQLQVRKIERIEVMLESE
FT                   DENVEDSVKSNENQTDHLLNNKADVVERYVNLAKFPFPQRGCQRLCIFEIKEMKSPAQI
FT                   ILTCFNQDAGKVNLILRDPWIRFRYEQGMIIHLIEGDHFPNKRLLSNDKDPKTGLENDN
FT                   LLIVYPDVLLSATAIGTAMDCERRAVLSSKFNEPGEYSLAAVLGNIIHALVQEVLKLKL
FT                   LEPNQFLSKGLALEILDKVIKPFTTEVNMCGESVESVIKTISDEHLPFIIEFVNIYVTK
FT                   DNSRSWIQVIGTKNKRKLSVSQIVDIEENIWSSKYGLKGYIDVTVETNVDSDGKKLLAP
FT                   VEIKTGKWKSNAHEAQGLIYTLLLQDRYDIPVNLHMMLYTKLREFSLQPKILISLKHLL
FT                   NLRNKLATYLQVMNEEMSDWGGPQHELPAMIQNSKCDQCFMKTSCMVLNKLSDKEQTPG
FT                   LLKHEYTDLTRHLEAQGSQVLELFRSFYGKYDRLLMMEETSITSVTKDTFLMSGTDREA
FT                   QTGHCISQLTIKNVQDQGNGRYLYTFCRENDIQGSFATSNAEQQETKKLKSAPPSMLSS
FT                   DIHKGDYIMISNDTSGQLAIGTGHVSEIANDFIVINCARNILANNIHGDSFDRNTRQVV
FT                   RSVLLKQKEPLNEKQSLTNSHRYRIDKNESATGLTLARYNLLNLFLPEVLIEAEFSPQK
FT                   SGEKLQLPVKRSLGGYSRGRRLIVELSEPKWTTHAARIPTLNDSFNENQKMAIERSLTC
FT                   RDYNLILGMPGTGKTSVICELVSILVNQGKSVMVTSYTNSAVDNIIMKLTSRIPRSKMV
FT                   RLGSGRRVHDLVKPYCITEMLDGDNENLSEIIDAAQVVGVTCLGINDPWLQMRNGDFDY
FT                   VILDEASQVSLPVAIGPLRFGYKFILVGDHYQLPPLVKNSFARDNGLQESLFEKLCHSH
FT                   PQSVVELQLQYRMNAEIMSLSNVLIYGGKLQCGTDEIRRQVLQFPNNYKCSQDTWLQKA
FT                   INPEQPVVILDHDGFQSTSNQQFVEQNDHGQLSNVGEANVVNEVVRELLAHGIEVDQIG
FT                   VMSMYKAQMSLLKTTLEDLDIDVLTADQFQGRDKDCIIISMVRSNPDQASGVLLRDLRR
FT                   INVAVSRAKKKLIIICSWKCISKIHPLKPFVDHVARNNWITKM"
FT   gene            <485886..>488510
FT                   /locus_tag="KLLA0_A05346g"
FT                   /old_locus_tag="KLLA-ORF10604"
FT   CDS_pept        485886..488510
FT                   /locus_tag="KLLA0_A05346g"
FT                   /old_locus_tag="KLLA-ORF10604"
FT                   /product="KLLA0A05346p"
FT                   /note="some similarities with uniprot|P53316 Saccharomyces
FT                   cerevisiae YGR250C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02824"
FT                   /db_xref="GOA:Q6CXV3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV3"
FT                   /protein_id="CAH02824.1"
FT                   /translation="MTSASRKNSEVKETSPSRDVANGNGSNDNATSTNSTEYFANTNVL
FT                   TCRLKWVDPDTFITDPKKSQLLTSLNQLVHSNKGLLINPKEMENYQYFSDHERIAHLKE
FT                   NLDVYLFERGNAEVDSWYRDSDLENEKTTWFYDVVIQAQFKPYKDLQATKEGFLSELTK
FT                   FSGNGNKSSSILECWSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKI
FT                   ILDSNTNESMGFGFVSYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQW
FT                   KQNEQEESTKFKGVFVGNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQT
FT                   NVEYSETDEDSKSESPLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGD
FT                   EDIVMKNDATTSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFFRFATHEMA
FT                   LKCIETFNDSQWYGHQLVVNKAIQKFHQHQHSYHGNSSSSLSSMNNNGNNNHYHNHHHQ
FT                   QQQQQQQQQQQQQQYNNNNHHYSGPHQTHHGHSSPHQPYYQQSFFPPMYSFRLSRRHSD
FT                   RSISSRQSNAPGFSPPPITPLPLNEPSYNRNNSSNSRSISRQNSITNIQYGSRDQAYDH
FT                   HSPSSSTQNSIPPPSMSQPVYPVSIPPPPTGIPGQALPPLVTQSIPVLTNSSTNSTGSP
FT                   RNNSIYGPMNMPLTYSSSNPMFNTPLPIPRSDEQESNLYVKHLPLDWRDEDLYQFFEKF
FT                   GEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYGFVCFQNPLDASRAMYHTDGLKLN
FT                   SDNTLFVSFAQRRSKSIDSIKGPVSNNVNYNKKFLNAMYQQQQQQYHPWMVPVPMHYPP
FT                   PSH"
FT   gene            complement(<490032..>491270)
FT                   /locus_tag="KLLA0_A05368g"
FT                   /old_locus_tag="KLLA-ORF10599"
FT   CDS_pept        complement(490032..491270)
FT                   /locus_tag="KLLA0_A05368g"
FT                   /old_locus_tag="KLLA-ORF10599"
FT                   /product="KLLA0A05368p"
FT                   /note="weakly similar to uniprot|P53050 Saccharomyces
FT                   cerevisiae YGR249W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02825"
FT                   /db_xref="GOA:Q6CXV2"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR033049"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV2"
FT                   /protein_id="CAH02825.1"
FT                   /translation="MHSKTFIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSK
FT                   VLKRFFKHGNVSSFVRQLHMYGFHKLPHSASSTLAASGADNNGATASTNNATSKSEIEW
FT                   KFTHHSHDFCKSASEAQLKRIHRKSNNLGKDGKRRNVLSPVCVSYLGSSQDPTANANLP
FT                   AELSRKSSGPVQPTHMSQTSNSPVHPLPSGSPLLQQPQPIHQHQLSIPTSVPGPIRQAS
FT                   LPTTNPTIPAMPTIPPPPMNGAPLPITSPIPRMLGTPYYSISPYPSVSSHAGLGPSSTA
FT                   LQTHTLFQYEQNLGILLRSMLQMCDVLSADDSNIQEHLQRLKLFKLELMTTESNWNTLM
FT                   ANNSMTTKSSTASASTTASAVNRFNSYGSLESQKNSIFSNPRFSKVQKVSLGGTTTQFP
FT                   EGSGSVSQEYGPK"
FT   gene            complement(<495847..>496617)
FT                   /locus_tag="KLLA0_A05390g"
FT                   /old_locus_tag="KLLA-ORF10592"
FT   CDS_pept        complement(495847..496617)
FT                   /locus_tag="KLLA0_A05390g"
FT                   /old_locus_tag="KLLA-ORF10592"
FT                   /product="KLLA0A05390p"
FT                   /note="similar to uniprot|P38858 Saccharomyces cerevisiae
FT                   YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
FT                   multicopy suppressor of los1-1 mutation homologous to Sol2p
FT                   and Sol1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02826"
FT                   /db_xref="GOA:Q6CXV1"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXV1"
FT                   /protein_id="CAH02826.1"
FT                   /translation="MVSVHEYSNSSELASSVGEFIVAEQNKALESHGRFNVAISGGSLI
FT                   NVLRKALVDDPSVSKQIQWAKWHVYFSDERLVPLEDKDSNYGAFKQAVLEELTRKQVIG
FT                   PVVYTINESLVQEGGSENEKVSNEYESLLPKEPFDLILLGCGPDGHTCSLFPGEAHKYL
FT                   LEENKRKVLWCHDSPKPPSDRITITLPVLSASKSLAFVAEGSGKKPILDEIFNKQNQEL
FT                   PCTIVNKENDAKTRWFVNSDAVEGLGLHAEKYSA"
FT   gene            complement(<496866..>497507)
FT                   /locus_tag="KLLA0_A05412g"
FT                   /old_locus_tag="KLLA-ORF10590"
FT   CDS_pept        complement(496866..497507)
FT                   /locus_tag="KLLA0_A05412g"
FT                   /old_locus_tag="KLLA-ORF10590"
FT                   /product="KLLA0A05412p"
FT                   /note="similar to uniprot|P53314 Saccharomyces cerevisiae
FT                   YGR247W CPD1 Cyclic nucleotide phosphodiesterase hydrolyzes
FT                   ADP-ribose 1'' 2''-cyclic phosphate to ADP- ribose
FT                   1''-phosphate no detectable phenotype is conferred by null
FT                   mutation or by overexpression"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02827"
FT                   /db_xref="GOA:Q6CXV0"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXV0"
FT                   /protein_id="CAH02827.1"
FT                   /translation="MGISLWLCPYGHSPEYETFKTLIESLQTLFPNSPVFEPHVTVCSG
FT                   LSCENMEEVHKVLEMAHHAINAVKSKVDSENALVEFDGFNIGKKYFEKCRLECKPNPML
FT                   YSLAKLIRSMFVGELNIDTWLFEEFHPHLSLAYSDIYPMDQAMIRLIRQRIEDLFDVTT
FT                   EEIESHSRDQDAYKLQHTLKGWSFPLTFKVVRCEGPVEEWEVLSEVTVHG"
FT   gene            <497874..>499544
FT                   /locus_tag="KLLA0_A05434g"
FT                   /old_locus_tag="KLLA-ORF10589"
FT   CDS_pept        497874..499544
FT                   /locus_tag="KLLA0_A05434g"
FT                   /old_locus_tag="KLLA-ORF10589"
FT                   /product="KLLA0A05434p"
FT                   /note="similar to uniprot|P29056 Saccharomyces cerevisiae
FT                   YGR246C BRF1 TFIIIB B-related factor one of three subunits
FT                   of RNA polymerase III transcription initiation factor
FT                   TFIIIB binds TFIIIC and TBP and recruits RNA pol III to
FT                   promoters amino-terminal half is homologous to TFIIB"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02828"
FT                   /db_xref="GOA:P46070"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46070"
FT                   /protein_id="CAH02828.1"
FT                   /translation="MASTLQVSSRKCKNCGSTDFVRDISNTTNELICKVCGLVTEENSI
FT                   VSEVTFGEASNGAAVIQGAFVSANQAHPTFMSHSGQNALMSRETTLNNARRKLKAVSYA
FT                   LNIPEYVTDAAFQWYRLALSNNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSRLQV
FT                   SVYSIGATFLKLAKKLQIVKLPLADPSLFIQHFAEKLELGDKKIKVIRDAVKLAQTMSR
FT                   DWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETLQQRLNEFKNTTSAKL
FT                   SVKEFRDDETEVNEGERSAESKPPSFDKNRLKEKKIKDSLDTKEMLETSEEAVSRNPIL
FT                   TQVLGAQELSSKEVLYYLKKLSERRKAEFSRIKATHGIDGEDLHKTEKDKKRSLDEIDG
FT                   YSLEKDPYRPRNLHLLPTTASLLSKVSDHPENLDDVDDAELDSHLLDEEASKLKERIWI
FT                   DINGDYLIEQESKRLKQEADLASGNTSLRKKRSKRTNRNQSSASIVKVQVDGLPLDVSV
FT                   DDADAVDVVAAGGVKNLLQKTTFSKKINYDAINGLFGQK"
FT   gene            <500097..>502376
FT                   /locus_tag="KLLA0_A05456g"
FT                   /old_locus_tag="KLLA-ORF10588"
FT   CDS_pept        500097..502376
FT                   /locus_tag="KLLA0_A05456g"
FT                   /old_locus_tag="KLLA-ORF10588"
FT                   /product="KLLA0A05456p"
FT                   /note="highly similar to gnl|GLV|CAGL0F08129g Candida
FT                   glabrata CAGL0F08129g and similar to YGR245C uniprot|P53313
FT                   Saccharomyces cerevisiae YGR245C SDA1 Severe
FT                   Depolymerization of Actin"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02829"
FT                   /db_xref="GOA:Q6CXU8"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR027312"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU8"
FT                   /protein_id="CAH02829.1"
FT                   /translation="MVRRSRAAILPTNIILLQNLVKRDPESYREEFLQQYAHYQSLRDI
FT                   FMLNSVNNESTDESAMAEFMGAIGFVSQVCSCYPRETANFPNELKQLVLDHHKSLPFDV
FT                   KEKIITSLTMLRNKNVISPETLIQTMFPLLIAYSSPSNSMVQNSHAKELRTLIYNTLVQ
FT                   LMKSCNTSGKNQKLNKSTHALCFNLLEQPDSQGIWASKLTRELWRRGIWDDSRSVEIMT
FT                   HAALHNDVKIAYSGVLFFLDADKEREEAFEENDDEDEIDTTALKHKLQINKKSSKRGKK
FT                   LEQALKVVKKKSAKGVQQNNFLNFSAIHLLRDPQGFAEKLFERHLSGKNSNKFDFEQKT
FT                   AIMQLLSRLTGTHKLMVLGLYSYFLKYLTPKQRDVTKILSAAAQSCHDLVPPETIEVMV
FT                   RKIANEFVSDGVSNEVATVGLNTVREILTRAPLAIDETLLQDLTEYKGSKAKSVAIAAK
FT                   GLIALYREVAPEMLKKKDRGKTASMGLQDDKRNGRESKRVKFGVETTNVQGIDGIELLA
FT                   KWKRENGNEEDDDDEAAWDLNNRDELSDASDVEGEWVTIESDKEYEVDMDSDDEESKNK
FT                   TGHKGKKRSHDEVEPEAGEDSDLELSGDEEEPKVGEEQKEESESADPEEAFRELASSRI
FT                   LTPADFAKLQELRTEKGVTKLMGINNEETIEHYKLMGPAKHKKQNKEERMASIMEGRED
FT                   REKYGSKRGKRDSSMRSTTNKEKSRKKNFVMMIHKRSVKGKQKMSLRDKQKVLRAHITK
FT                   QKKKGN"
FT   gene            <503729..>504997
FT                   /locus_tag="KLLA0_A05478g"
FT                   /old_locus_tag="KLLA-ORF10583"
FT   CDS_pept        503729..504997
FT                   /locus_tag="KLLA0_A05478g"
FT                   /old_locus_tag="KLLA-ORF10583"
FT                   /product="KLLA0A05478p"
FT                   /note="highly similar to uniprot|P53312 Saccharomyces
FT                   cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA ligase
FT                   which is a mitochondrial enzyme of the TCA cycle that
FT                   catalyzes the nucleotide-dependent conversion of
FT                   succinyl-CoA to succinate"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02830"
FT                   /db_xref="GOA:Q6CXU7"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU7"
FT                   /protein_id="CAH02830.1"
FT                   /translation="MLSQAYKLRSCLHKSSSVVRQQVRNLSIHEYRSAELLRQYGVGTP
FT                   KGAAAHTVDEATKIAKELGGKNLVVKAQALTGGRGKGHFDNGMQSGIHMIDSVQDATEV
FT                   SGKMLGYHLITKQSGIKGKLVSGVYIVERVNAKHEAYLSILMDRKTKKPLIICSSEGGM
FT                   NIEDVAKTNPDAIKKFYVEDSVGLTPETAAEIAASLGFSKEAEADAKDAVLKLYKIFKE
FT                   KDATQIEINPLSEVLDQDKKVMCMDAKFGFDDNASFRQKDVYSWRDLTQEDPDEVTAKK
FT                   SDLNFVKLKGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAFKLIL
FT                   SNDNVDAIFVNIFGGIVRCDFVAQGLVAATKNLSVKVPIVARLQGTNLEQGRRIIAESG
FT                   LKIYSFDELDPAAEKVVELTNSK"
FT   gene            complement(<505579..>505989)
FT                   /locus_tag="KLLA0_A05500g"
FT                   /old_locus_tag="KLLA-ORF10581"
FT   CDS_pept        complement(505579..505989)
FT                   /locus_tag="KLLA0_A05500g"
FT                   /old_locus_tag="KLLA-ORF10581"
FT                   /product="KLLA0A05500p"
FT                   /note="similar to uniprot|P53311 Saccharomyces cerevisiae
FT                   YGR243W FMP43"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02831"
FT                   /db_xref="GOA:Q6CXU6"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU6"
FT                   /protein_id="CAH02831.1"
FT                   /translation="MSSAAGNAFRRFMNSETGPKTVHFWAPTLKWGLVFAGFSDTKRPV
FT                   DKLSGTQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYQIGRIIKYRIEEGD
FT                   SASQIVKYIINGAEKPVVEKIVDKATPSAATQ"
FT   gene            <506882..>507130
FT                   /locus_tag="KLLA0_A05511g"
FT                   /old_locus_tag="KLLA-ORF10579"
FT   CDS_pept        506882..507130
FT                   /locus_tag="KLLA0_A05511g"
FT                   /old_locus_tag="KLLA-ORF10579"
FT                   /product="KLLA0A05511p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05511g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65218"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI5"
FT                   /protein_id="CAR65218.1"
FT                   /translation="MNSNHWSALTMSLGKRPRVVYDEVSSSGCYGPTLKKGNIGSRSDC
FT                   DGQDDRKGNVYDVRILMLNARILAKTKNTAEQPVDSV"
FT   gene            <507778..>509481
FT                   /locus_tag="KLLA0_A05522g"
FT                   /old_locus_tag="KLLA-ORF10577"
FT   CDS_pept        507778..509481
FT                   /locus_tag="KLLA0_A05522g"
FT                   /old_locus_tag="KLLA-ORF10577"
FT                   /product="KLLA0A05522p"
FT                   /note="similar to uniprot|P53309 Saccharomyces cerevisiae
FT                   YGR241C YAP1802 Yeast Assembly Polypeptide, member of AP180
FT                   protein family, binds Pan1p and clathrin; member of
FT                   clathrin assembly polypeptide AP180 family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02832"
FT                   /db_xref="GOA:Q6CXU5"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU5"
FT                   /protein_id="CAH02832.1"
FT                   /translation="MTTYHRLVKGATKIKMAPPKTKYTDPILLGTTNERDFGEIVNALE
FT                   ERINDSAWTVVFKSLAVAHLMIRDGDKDIALKYFSRNLDFFELRGLARSYPARSGDVQA
FT                   LDRYRLYLKVRSEEYGKVRKDYVRNSNTNLKKFDDNRSSECLEHVESLELQIGALIKNR
FT                   YSQCDLNNDLIMFAFKMLVQDLLALYNALNEGIITLLESFFELTRSNAERTLKLYKRFV
FT                   QLTENVVRYLKSAKAVGLKIPVIKHITTKLINLLEDHLREDTENKGNTFSKDDQTQVQS
FT                   ELERIRHQRIALENQLKHQSVQQIQQTQTGYNPFATSPMSMASPQFDTRPAQVANTSNP
FT                   FQQYQQVQPQMTQQMPQQVPQQVQPQMTQQIPQQVPQQMQQQMPQQVAQQTGYNPFLQD
FT                   LQMQQRAPQQTGQQQMPQQMQQQMQQQMQQQMPQQMAPPLQNTVTGIQPLQTGMMPLNN
FT                   AATAPIIPSKTGPNNPFSLENVNRQQLQRQQTNPFSVQNYSQVSNNPFSTAPESSPLIV
FT                   PPNRATTGNNTFGGLELLPTVPVFPQTQIQQGFQAVANQRSQNEPNLIDI"
FT   gene            <510371..>513349
FT                   /locus_tag="KLLA0_A05544g"
FT                   /old_locus_tag="KLLA-ORF10572"
FT   CDS_pept        510371..513349
FT                   /locus_tag="KLLA0_A05544g"
FT                   /old_locus_tag="KLLA-ORF10572"
FT                   /product="KLLA0A05544p"
FT                   /note="highly similar to uniprot|P16861 Saccharomyces
FT                   cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis indispensable
FT                   for anaerobic growth activated by fructose-2 6-
FT                   bisphosphate and AMP mutation inhibits glucose induction of
FT                   cell cycle-related genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02833"
FT                   /db_xref="GOA:Q03215"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="InterPro:IPR040712"
FT                   /db_xref="InterPro:IPR041914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03215"
FT                   /protein_id="CAH02833.1"
FT                   /translation="MNNSVYGVAFRSLSTGDEKLYKEATRFYHSLGFQTVKLYDNFKNH
FT                   DDSNLIVGTSKNSVKECWLESFKLSELDSQGFRVPQQEASNQLQTDGVMIKLRLVDTEP
FT                   LNQTADTVVYYTVSLDEVSKIGERVDDHNVKLVDPLGNVVLVTDSHDGKELNASEFIAP
FT                   KDSSVEQKITVELVDKDSKKKKIAVMTSGGDSQGMNAAVRAVVRSSIYYGCDVYAVYEG
FT                   YEGLVKGGDYLRKMEWKDVRGWLSEGGTLIGTARSKEFRERWGRKQACSNLIDQGIDAL
FT                   VVIGGDGSLTGADLFRSEWPSLVEELVKDGKFTEDEVALYQNLTIVGMVGSIDNDMSGT
FT                   DSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLGLMSGIATAADYIFIP
FT                   ERAAPHGKWQDELKRVCQRHREKGRRNNTVIVAEGALDDQLNPITAEQVKDVLVELGLD
FT                   TKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAILNMTPETPSPLIGILENKVIRMPLV
FT                   ESVKLTKQVAAAIEAKDFDKAISLRDTEFIELYSNFMSTTVNDDGSQLLPEADRLNIAI
FT                   VHVGAPSAALNAATRAATLYCLAHGHRPYAITNGFSGLIQTGQVKELSWIDVEDWHNLG
FT                   GSEIGTNRSVAAEDMGTIAYHFQKNKFDGVIILGGFEGFKSLKQLRDGRDQYPIFNIPM
FT                   CLIPATVSNNVPGTEYSLGSDTCLNALVKYTDAIKQSASSTRRRVFVVEVQGGHSGYVA
FT                   SFTGLVTGAVSVYTPENAINLKTIQEDLALLKESFKHEQGETRNGKLVIRNEMASDVYT
FT                   TELLADIITEQSNDRFGVRTAIPGHVQQGGVPSSKDRVIASRFAVKCVKFIEQWNKKNT
FT                   AADNEDFKILRFNYVNGVKQYTVLDEDLSAAVICVNGSKISFKPIAHIWENETNIELRK
FT                   GQEIHWEEYNEIGDILSGRSMLRRKIQKEQQEESSLPSVADTPLSSVTVSTSAAKEDSA
FT                   LYV"
FT   gene            <514368..>514619
FT                   /locus_tag="KLLA0_A05566g"
FT                   /old_locus_tag="KLLA-ORF10570"
FT   CDS_pept        514368..514619
FT                   /locus_tag="KLLA0_A05566g"
FT                   /old_locus_tag="KLLA-ORF10570"
FT                   /product="KLLA0A05566p"
FT                   /note="weakly similar to uniprot|Q3E7A3 Saccharomyces
FT                   cerevisiae YJL133C-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU3"
FT                   /protein_id="CAH02834.1"
FT                   /translation="MFANYSAKVSRTVTKAIPSVATIASVSIPSKVATTKANTALFNAG
FT                   NSFKSFKEYREVATKYGPLSAKLAIKRQLAYPNGAPQL"
FT   gene            <514934..>516267
FT                   /pseudo
FT                   /locus_tag="KLLA0_A05593g"
FT                   /old_locus_tag="pseudo-Klla0A-514934-516267"
FT   gene            complement(<516514..>528711)
FT                   /locus_tag="KLLA0_A05621g"
FT                   /old_locus_tag="KLLA-ORF10567"
FT   CDS_pept        complement(516514..528711)
FT                   /locus_tag="KLLA0_A05621g"
FT                   /old_locus_tag="KLLA-ORF10567"
FT                   /product="KLLA0A05621p"
FT                   /note="similar to uniprot|P36022 Saccharomyces cerevisiae
FT                   YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
FT                   motor protein required for anaphase spindle elongation
FT                   involved in spindle assembly chromosome movement and
FT                   spindle orientation during cell division targeted to
FT                   microtubule tips by Pac1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05621g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02837"
FT                   /db_xref="GOA:Q6CXU0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR024317"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR035706"
FT                   /db_xref="InterPro:IPR041589"
FT                   /db_xref="InterPro:IPR042219"
FT                   /db_xref="InterPro:IPR042222"
FT                   /db_xref="InterPro:IPR042228"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXU0"
FT                   /protein_id="CAH02837.1"
FT                   /translation="MIHQEQNIVEPVLDFIHGVSVLYFKNCETLEGFRDQNTDQIQNWL
FT                   SEKTDAEPLFLVHDLDTLRVGLLLQIDSENLKKNNVLMVMKNQSVIDSDASIESQFNII
FT                   MLPQDSQFDTLKTLVDVGLYQIFDKVVINRSRDSKTVPDSLLNTKRKIKDLSLSLQNLD
FT                   KEIQLPNIEESIHPLVKQLVIDGATAHNVDEHLPPDQLNDSSFLNALQKTSNSWIKAVH
FT                   SISRLENNLADGTALDEVNFWRNYCTALRELEKMLSCKEVEITISILVSAKRFYSSTSF
FT                   INDTGLSNMIAETQSFSTFLDGLAIQNISSATSMPDLNIAIEKFAYEIRKLKITQYPLE
FT                   KAIKLIEKVSDDICIKAEELLPNLLLMDYEQFLNIKENALMVLDNFEDKLKDFTLMIRE
FT                   LMRKKAAKFIFLKLNCSTEGLKQRISNVSTFREQHHIFLEALTAVDNRPLRERTERIYD
FT                   KVKPVNVLKADVVSWVHLQKNYSQQISLIEDELIAILRKELENCHSSKEMFSIFERYEL
FT                   LTKRIRVLNAVREYQHQLLDNVKTDTNFIRDSISSWTPTNAAEEQFDIQSIIHDIVWRK
FT                   KLLKKLKLITSKLTVILGSDWDKTTIGSQISKECTSIQSSLSTDKIYESWIWNAQNTEF
FT                   SLDQSVFKVILSKTDYELKVNFNFSSGSLFKALRNLIWQGYDIPSDIVRKSRITRNTYP
FT                   YAAIIAEKLQTFFLVVDGVKQLSYTTPLLRNSVNDVWKSLSTLITESWETVPIDTIVDG
FT                   SNISGDLARFEEGVDRLLRDYENFSTMEFQVKEYYLNLDNFSLDEASGNITEQLQYIVD
FT                   KFRLEVTEDNVLFVSMLNHRLRMTLIQKFKDFIQSLILEPIEQRITFSNGVFQFEPSFC
FT                   AVKSSWINRLSFIVNKIQNQPKLIVCSFGTALNTATFTDILSDIQPTIVEYMDSIDRFH
FT                   ASLGKILSKWKTTEYLWTLTEEQFVANVSTDIEICLAFMTNIYEQRKTMNYISFNTEAE
FT                   SSINVKVSEEQALLQCCAKFDQWHAFGLRHLILLYTQLSTDLHHRLTMDRKFFEDLPLS
FT                   FSSLKSITDMIIHLDNVGSKSEVTYKQFAILKSSQRLFLQVRANLPADFIYCEQLKTDL
FT                   DSLKEICMKRENLVTENRDIIATKLDSEIERLKLVSESLIQGWKNRKPVGSETDPAEAL
FT                   AVIASFEDSVNATKNQIHDLLKTAKVLLIPTTVNFHLQDILTEIQNYKAMWLSVGTLWN
FT                   SMQDILNQTWNSVAIGDVKQRLQTLYDDTNNLPSNVLQYSVFQNLLQSINSVLSAMKTL
FT                   QNLKSAPLKAKHWCCIFQKFGSWEPPATTLDSQSFSLIDVLSLSVSVNENELNNIVNQA
FT                   KDEEVLASTLKDMRDKWKEVTIDSFIHQSGHKLIKNWSSLFTTATDDINTLLSMKNSQF
FT                   YKIFDQEIYELETKLTDFSEILMTGLEIQKQWCYLYGVLNEGSSLKALLSVEAAQFSVL
FT                   TSDLNILFNTLQTAKIAMDVLYHSDYINALRSLLESLTRVRKSLNDFLESQRELFPRFY
FT                   FIGNEDLLQLIGFSTDFEFLSNQMRKMFGSVGRLEIVDNSITAIYSIEGERLSLINDVK
FT                   VTPQTPAYQWLSSLEKELKHTLSTLATACYRKYSLKDLDSLIDEYPFQVIWLCMLVNWT
FT                   ERAQTMRPDDLGNLIDDFTDAIKRLSIRKRAADGMCRHTLIDSLLSEMFGLKEMTLLLK
FT                   TAENKEVTWNETQKFYIDTSAAALETVKIVQTGIEVQYGFEYVGVPETLVQTPTLQTFF
FT                   ATMLHALSNNLGGSPFGPAGTGKTESVKYLAKRLGRFVLVFNCDDTFDYRSMARILFGI
FT                   AQVGAWGCFDEFNRLKADLLSAVSSQIEAIQSSMISEDRKLSILERNGLIHRNTAIFIT
FT                   MNLGYAGRSQLPGNLKRMFREFTMSAPQTVIIIETLLNTMGFEDAKGTSSQLVSFFAEL
FT                   ESKTSCQSHYDFGLRAIKSVIRNCNLQLMQNEGIPNHAILLRSIWNIITPKLLEEDEAI
FT                   FETAWNRFFPKNFSSVKGHDLEEIVIEFCEKQHITFNDSFYKKCQQLYEVQKSQQGVIL
FT                   VGEAGCGKTTVLNATMEMVQNTTKKSNVIYTIDSKALKKEQLYGNLDPVTFEWQDGLFT
FT                   TILREINEDYLDEYENANIWIIFDSDLDPIYAETLNSALDDNKVFTLPNGERLDIPHHL
FT                   HIVFEVEDLTFATPATISRCGMLWFNKNIISPHNLFCSTYNRLFNSTPNYGPSATKLKD
FT                   SMLEISDSIFCPEDFELILRKSADLNHILDFDINRIAKVYSNLICNPYVSYFNDLSKMT
FT                   SSIFKLFILRHSALSIVWAFAGDCPVDDKIVFSSFIQSHLQSHGLPPVNGLILDYEVSP
FT                   VSAELLPHKRNLQNTELEAHQVLLPDLIIPTVDTYRHEAILFTLLKQHQPLILCGPPGS
FT                   GKTMTLQSALKQSEDHMLVGMNFSKDTTVESFLKTIEQHTTYKSTAEGLIMQPVSFGKQ
FT                   LVFFCDEINLPKPDKYGSQPIILFLRQLLEKNGFWSPKDNKWVSLKNIQIVAACNPSSD
FT                   PGRSKMTKRFTRHAAIIMVDYPSKESLLHIYQTFFRSVLKASSIKKDYADNLARVSVEI
FT                   YFECKKQFTVQQQYHYIFSPRELTRWVRGVYHAISSSEMVDLPQLIKIWAYESRRIFSD
FT                   RLVSEEERHLFDKFLVDAVSSEFPLQNITDIIQPSFVFCNWLNMKYEQSDLNKIRSFVS
FT                   ERLKTFCEEVLSYDIILHNEMLYAMLNVDRILKQVQGHGILVAPSGSGKTTITRFVAWL
FT                   NGIDVRIPLVHRNYNLLEFDAFLRHVLVESGVENKKVCMILDESNMVEASFVERLNTLL
FT                   ANSDIPGLFQAEDYDSLIAKIRGSPFLPRTVLDTEQSMYDWFTEQISKNLHVVIKISDP
FT                   KKSNSANIMTSPALFNRCVLTWMGTWKNGTLIQVAKHFIDKIPLDQTMEASDTVGQISS
FT                   DSLRSKVTEIFYSVFKDYYSSYDVPYPSPALFLDSLKVLRIEYTKKLTESDNNQRFIRN
FT                   GLIKLKESVIMVKKLNKEMESKKNILQEKKIEARKTLDQMLHDQNESERKQEASIEIQK
FT                   ILNLQEQEISKRRDVVMNDLAKAEPAILEAQRGVKNIKKQQLTELRTMINPPEAVKITL
FT                   EAVCVLLGFQIGTWKDIQQTIRKDDFIARIVTFETETMLSQELKHYIQTHYLNRSNFKY
FT                   ENVLRASQACGPLYLWIEAQILFSDALTRVGPLQRDLQILEDEILRTRAKVLAADEMIN
FT                   ELQEQIEKSKELYSKIIRDIEVLKSEMSLVESKVSKSTTLLESLNSEKERWTFETRQFT
FT                   EVKKNLLGDTILSSLYSAYCFTHDFKTRAELVGKWKMILATSDIAYDQSFNNLAKRVSL
FT                   ENKSFWIENGLSEDEFAIETFSAVVSPTIEKYPLILDPEGNILDVLYAVYGSKLVMTSF
FT                   LDQNFSKSLENTLRFGGVLLIQDGEFFDPFVTKVLKQEFQNVGGRRSIELGDSIRDLDV
FT                   SNDFRMIIYSRDKSWRVPNYVLTKTKAFNFTITKGNLESQTLQDILTNELPTIQNERKL
FT                   LLEKDSTCQLRLRELGNRLLGLLNSSESNILENEELLKTLENLKVEAGTMSTEISKIQS
FT                   LVLEQESAITEFSPISTIAVQIFELLEWVRIKKHWFYDVEVNEFLTVFRYVLENSDELV
FT                   NSKPNKPNKILSVLIRLMFCAFGPMFLENDRLSFAARLMELQMYSMESTRTVEEWKMIR
FT                   SNIDLLRTQPQLSERFTEFKEGLLVGDAKDGLSQMILTIMKEQPWEISDFLSKNTRSNI
FT                   LLVGADKGVDGSFMIKKLAEQLQKKITTIAMGSSESCKIAEETLNDCVEVGGWVLLQNI
FT                   QMSLTWCNEILPKYLKQIISNSNENFKLFMTCSLQDSIHPSSQLLQYSTKIAYEGESGV
FT                   LYKVKKFWELIIQKKPVEGTGLYLKHLVCWIHSLLLERVKITTKDVEYHDLDLELAINA
FT                   VENCVDNEAIDWPKLRFIVGKLIYCNRLDKRDELYQWIMNLTASIMHEGSFKANSNIIG
FT                   DVGSPSSKHSMHGITEWLNNLPWTIEHKDIWLSVPKGNLERISFMQAVSCMSDLVAMDA
FT                   GSDQLDVK"
FT   gene            <528976..>529632
FT                   /locus_tag="KLLA0_A05643g"
FT                   /old_locus_tag="KLLA-ORF10564"
FT   CDS_pept        528976..529632
FT                   /locus_tag="KLLA0_A05643g"
FT                   /old_locus_tag="KLLA-ORF10564"
FT                   /product="KLLA0A05643p"
FT                   /note="similar to uniprot|Q00246 Saccharomyces cerevisiae
FT                   YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
FT                   subfamily of Ras-like proteins likely to be involved in the
FT                   establishment of cell polarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05643g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02838"
FT                   /db_xref="GOA:Q6CXT9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT9"
FT                   /protein_id="CAH02838.1"
FT                   /translation="MALIVDNFRRTLGDIPHYSQCGVKGRSAQYHLKIVVVGDGAVGKT
FT                   SLLISYTQGKFPEDYVPTIFENYVTNLEGPNGKIVELALWDTAGQEEYSRLRPLSYTDV
FT                   DVLMICYAINSKVSFYNIEEMWLPEVKHFCPDVPIMIVGLKSDLYAEDNISDFVDAFKA
FT                   EETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALYDELKPKKKKLNSRRKCVII"
FT   gene            <529964..>531700
FT                   /locus_tag="KLLA0_A05665g"
FT                   /old_locus_tag="KLLA-ORF10563"
FT   CDS_pept        529964..531700
FT                   /locus_tag="KLLA0_A05665g"
FT                   /old_locus_tag="KLLA-ORF10563"
FT                   /product="KLLA0A05665p"
FT                   /note="similar to uniprot|P33753 Saccharomyces cerevisiae
FT                   YKR056W TRM2 tRNA methyltransferase 5-methylates the
FT                   uridine residue at position 54 of tRNAs and may also have a
FT                   role in tRNA stabilization or maturation previously thought
FT                   to be an endo-exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05665g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02839"
FT                   /db_xref="GOA:Q6CXT8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025795"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT8"
FT                   /protein_id="CAH02839.1"
FT                   /translation="MQLARIIFQRGFLRTFGTVAKKEFINMSTQVELKRVATQDIQPVK
FT                   PKQSKKSKIRKYKPKPLDPTSALGVLQFEIDEILKEFSLARDAILNDVGCILNEERDGP
FT                   MHRLYHREVNSVEVLKMGANGEGLALIPNPVDLDKKQIALIPFALPGDVVRIKTFKTHP
FT                   HYVECDLLEVIKPSSKRNNDLIQCRYFGKCSGCQLQYLTYEDQLAFKKRTVMNAYKFFA
FT                   PRLMEDKLVPEIGETMRSPLEIGYRTKLTPHFDLPKRMKGNGERPALGFGHKGRPQWRG
FT                   NADGGSGPMLDIEECIIGTKIINQGMTNERARFEREFTKYNKGATILLREHTKVIDPEI
FT                   PVAEQLDDGSEDIEGKISYLQINDEENDKSLVKTCVTNTRQIVTEYINGYTFQFSAGEF
FT                   FQNNNSILPSVTAYVRKNLQIEGSKPEDPHYLVDAYCGSGLFSITSSKGVDRVIGVEVS
FT                   ADSVAFAERNAKANGVENCKFIVGKAEKIFGSIDTPCDRTSVILDPPRKGCDDIFMKQL
FT                   AEYNPARIVYISCNVHSQARDVEYFLKETENGKHYKIESLRGFDFFPQTHHVESVCVLS
FT                   RS"
FT   gene            complement(<531875..>532354)
FT                   /locus_tag="KLLA0_A05687g"
FT                   /old_locus_tag="KLLA-ORF10560"
FT   CDS_pept        complement(531875..532354)
FT                   /locus_tag="KLLA0_A05687g"
FT                   /old_locus_tag="KLLA-ORF10560"
FT                   /product="KLLA0A05687p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05687g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02840"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT7"
FT                   /protein_id="CAH02840.1"
FT                   /translation="METGAVNYEDSGIIVSNNNTTNQNSTSVRDIRFQMSLQKHVSFVE
FT                   CLRIQLDCPFGIRIQLKKRAVSQCRKVKKWFKKLRKNIHCKNDINSPIPNWYHNVFGND
FT                   AAEQPYVDDLQRNLFAAEDLSNESILTLGSSNTVVHSPKCAPLFIPVSGMLNREV"
FT   gene            <532965..>533756
FT                   /locus_tag="KLLA0_A05700g"
FT                   /old_locus_tag="Klla0A.mRNA.322.p"
FT   CDS_pept        join(532965..532988,533517..533756)
FT                   /locus_tag="KLLA0_A05700g"
FT                   /old_locus_tag="Klla0A.mRNA.322.p"
FT                   /product="KLLA0A05700p"
FT                   /note="highly similar to uniprot|P0C0V8 Saccharomyces
FT                   cerevisiae YKR057W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02841"
FT                   /db_xref="GOA:Q6CXT6"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="PDB:3J80"
FT                   /db_xref="PDB:3J81"
FT                   /db_xref="PDB:3JAM"
FT                   /db_xref="PDB:3JAP"
FT                   /db_xref="PDB:3JAQ"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="PDB:5IT9"
FT                   /db_xref="PDB:6FYX"
FT                   /db_xref="PDB:6FYY"
FT                   /db_xref="PDB:6GSN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXT6"
FT                   /protein_id="CAH02841.1"
FT                   /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHSSVQINIAQVDEEGRA
FT                   IPGEYVTYALSGYIRARGEADDSLNRLAQQDGLLKNVWSYSR"
FT   gene            <534438..>535670
FT                   /locus_tag="KLLA0_A05709g"
FT                   /old_locus_tag="KLLA-ORF10556"
FT   CDS_pept        534438..535670
FT                   /locus_tag="KLLA0_A05709g"
FT                   /old_locus_tag="KLLA-ORF10556"
FT                   /product="KLLA0A05709p"
FT                   /note="weakly similar to uniprot|P47011 Saccharomyces
FT                   cerevisiae YJL137C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05709g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02842"
FT                   /db_xref="GOA:Q6CXT5"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT5"
FT                   /protein_id="CAH02842.1"
FT                   /translation="MLGVVTLLYSLDYLPGALTLAYQLRKLLPKGSKEKQLCLILSKEL
FT                   IEEGQLSDDALKVLEILFDDIIEIDPIDLSDPVIRQNQVNLMMLENRSELAFTFMKLHL
FT                   WELTQYEKVLYLDSDVLPLDSDIFKIFDHVSNQTSDQIAAVPDCGWPDLFNSGVMVIKP
FT                   SKEKYQELHELATKELSIDGADQGILNQFFNPMCHDGDRLTEWIRLPFFYNVTSPNAGY
FT                   QYSPAIKFFANKLKLVHFIGKNKPWKHGSTGGQYNDKYRNQWWSLYMELCHEYFQSELD
FT                   IDIDHICRGVKDVDLSDIDLEDVKPTPVWNPAKEAPSDELPAEAPHLNISNSYTWESEL
FT                   VVIPDDTPAQEKVTVPSEDGADITADHDTIVEAELPVTEHRHKTYTRPKPIFPWELDTN
FT                   YKATRVFPEDE"
FT   gene            <536243..>537433
FT                   /locus_tag="KLLA0_A05731g"
FT                   /old_locus_tag="KLLA-ORF10554"
FT   CDS_pept        536243..537433
FT                   /locus_tag="KLLA0_A05731g"
FT                   /old_locus_tag="KLLA-ORF10554"
FT                   /product="KLLA0A05731p"
FT                   /note="highly similar to uniprot|P10081 Saccharomyces
FT                   cerevisiae YKR059W TIF1 translation initiation factor
FT                   eIF4A"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05731g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02843"
FT                   /db_xref="GOA:Q6CXT4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXT4"
FT                   /protein_id="CAH02843.1"
FT                   /translation="MSDGITDIDENQIQSTYDKVVYSFDDLKLKEELLRGIFGYGFVEP
FT                   SAIQQRAILPIIEGKDVLAQAQSGTGKTGTFSIAALQNIDEKIKAPQGLILAPTRELAL
FT                   QIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIIVGTPGRVFDMIDRRIFKTD
FT                   NIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDVLEVTSKFMKDPVR
FT                   ILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSISVTQAVIFCNTRRKVEELTERL
FT                   RENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPS
FT                   NKENYIHRIGRGGRFGRKGIAINFVTNKDIGAMRELERFYSTQIEELPSSISELFD"
FT   gene            <537889..>538701
FT                   /locus_tag="KLLA0_A05753g"
FT                   /old_locus_tag="KLLA-ORF10551"
FT   CDS_pept        537889..538701
FT                   /locus_tag="KLLA0_A05753g"
FT                   /old_locus_tag="KLLA-ORF10551"
FT                   /product="KLLA0A05753p"
FT                   /note="similar to uniprot|P36144 Saccharomyces cerevisiae
FT                   YKR060W UTP30 Possible U3 snoRNP protein involved in
FT                   maturation of pre-18S rRNA based on computational analysis
FT                   of large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05753g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02844"
FT                   /db_xref="GOA:Q6CXT3"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT3"
FT                   /protein_id="CAH02844.1"
FT                   /translation="MPIELDTDGATTKALRALTKQCEVDPKLANDTSIHLIINTQQPVG
FT                   IRNDHVPRIIPLKHSQMKSANDVRILLICKDPSTLYRDSLTKEKATAELFKEIISVKKL
FT                   KQRFRGKKLKELYNEFDMIVADYRVHHLLPSVLGSTFYRSNRKLPFVVRMSKQIKEKGS
FT                   KMKEDCDPKYVKAQVKSICKNTWFLPNKDNCLSIKIGEIGVHAEAELMANAEDVIDFLC
FT                   DRSKKPQGGCIKDGKISSIFVKTSNSLSLPIWKKLEQESIDDDEEIRL"
FT   gene            <538934..>540268
FT                   /locus_tag="KLLA0_A05775g"
FT                   /old_locus_tag="KLLA-ORF10549"
FT   CDS_pept        538934..540268
FT                   /locus_tag="KLLA0_A05775g"
FT                   /old_locus_tag="KLLA-ORF10549"
FT                   /product="KLLA0A05775p"
FT                   /note="similar to uniprot|P33550 Saccharomyces cerevisiae
FT                   YKR061W KTR2 Mannosyltransferase involved in N-linked
FT                   protein glycosylation member of the KRE2/MNT1
FT                   mannosyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05775g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02845"
FT                   /db_xref="GOA:Q6CXT2"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT2"
FT                   /protein_id="CAH02845.1"
FT                   /translation="MQTSCIYKMIYSDGSSLAGYSMFALRRVYLGAYAAIVSLSLTLYL
FT                   IRVGFAVIKEVYLHQRIEQGFFPRSEDVLHKYDNIRRFNKSFGELKPASNSYLDDLIIP
FT                   VERDSIIQERENATILMLCRNWEIPGVLQSMRSLEDRFNRRYKYDWTFLNDVPFDDYFI
FT                   EATSAMASGKTKYGLIPSEDWDRPAWIDEELFEERLQMLKEKKVIYGDSKSYRNMCRFN
FT                   SGFFFRQKLLDQYDYYFRVEPDVEYFCDFPYDPFKVMREKKKKYGFVISIFEYEDTVTT
FT                   LWDAVEEFMDTYPEILHPNNSLSFLTDTTMVGRFFPVVDSNTDYNLCHFWSNFEIGDLN
FT                   FFRSDEYLQYFNYLDSKGGFYYERWGDAPVHSIGASLLLDKNEIHHFDEIGYSHVPFET
FT                   CPTSISARLVLRCMCDPNGESNIPIHPNSCLMRWWKNGAGKLFIR"
FT   gene            complement(<540318..>540920)
FT                   /locus_tag="KLLA0_A05797g"
FT                   /old_locus_tag="KLLA-ORF10546"
FT   CDS_pept        complement(540318..540920)
FT                   /locus_tag="KLLA0_A05797g"
FT                   /old_locus_tag="KLLA-ORF10546"
FT                   /product="KLLA0A05797p"
FT                   /note="highly similar to uniprot|Q75BM1 Ashbya gossypii
FT                   ACR250W ACR250Wp and similar to YJL140W uniprot|P20433
FT                   Saccharomyces cerevisiae YJL140W RPB4 RNA polymerase II
FT                   subunit B32 forms two subunit dissociable complex with
FT                   Rpb7p dispensable under some environmental conditions
FT                   involved in export of mRNA to cytoplasm under stress
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05797g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02846"
FT                   /db_xref="GOA:Q6CXT1"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT1"
FT                   /protein_id="CAH02846.1"
FT                   /translation="MNTSTSTVQTKRRGLKKFVEEENAATLHLGEEFNLKQINHQGQEE
FT                   NLVALNLSESRLIIKETLQNRRKLFKTWASNGASNKDDDMDDEDNVNVHTQTQEKELQD
FT                   IDRLLEQTTGGQNQALKQTMIYLTNFSRFRDQETVTAVSQLLSSTGLHPFEVAQLGSLS
FT                   CEDADEAKTLIPSLGTKISDEDLERILKELSNLETLY"
FT   gene            <541545..>543659
FT                   /locus_tag="KLLA0_A05819g"
FT                   /old_locus_tag="KLLA-ORF10543"
FT   CDS_pept        541545..543659
FT                   /locus_tag="KLLA0_A05819g"
FT                   /old_locus_tag="KLLA-ORF10543"
FT                   /product="KLLA0A05819p"
FT                   /note="similar to uniprot|P14680 Saccharomyces cerevisiae
FT                   YJL141C YAK1 Serine-threonine protein kinase that is part
FT                   of a glucose-sensing system involved in growth control in
FT                   response to glucose availability translocates from the
FT                   cytoplasm to the nucleus and phosphorylates Pop2p in
FT                   response to a glucose signal"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05819g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02847"
FT                   /db_xref="GOA:Q6CXT0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXT0"
FT                   /protein_id="CAH02847.1"
FT                   /translation="MGDKNSLWNPAFMASQQGASSSNQNQNFSQTQANTQNQGPEIAPD
FT                   GPAGSSSNAGGNIYAGQQQGGNAAGGFQMQSPRQSIFKNPWQEIPQIPESQRSTMRKQS
FT                   NFPLPTTYEEDNAVDESSQQFRRRNSSLVIPPARAAGPDPFLYEKQPFPNYNDAQRRQS
FT                   VAVTGGSQLSPQQVTKPSQLRKPGINTAGYMAGSINSSVYPATAGAYMSTRGGSSSLPS
FT                   SRPPSPIIIVPKFNKIFTRQDLNPVIHSTPKYRRASLSSKTVSPLMALTKSLTTTYSLC
FT                   NDDFAYQTSKNPKRVLTKPNEGKYNNGHDNVNSDYILYVNDVLGVEHNRKYLVLDLLGQ
FT                   GTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNNEHHFLRLH
FT                   DTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVLKDSKLIHC
FT                   DLKPENILLVSNDRPDLKVIDFGSACEETRTIYTYIQSRFYRAPEVLLGIPYSTGIDMW
FT                   SFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMPPAWMCDMGKNSKKYFHKMNTTVEK
FT                   KFRMKTIDEFNLEFAANEESVKRYVKHILFDDIIRNARISKRISGNPALVEREIKNRDC
FT                   LLHFLRGVLNLNPLERWTPQQAILHPFITEEPFTGEWYPPGTIPKKSQTARNPSLQFDS
FT                   VALDKLQLGD"
FT   gene            complement(<543975..>544439)
FT                   /locus_tag="KLLA0_A05841g"
FT                   /old_locus_tag="KLLA-ORF10541"
FT   CDS_pept        complement(543975..544439)
FT                   /locus_tag="KLLA0_A05841g"
FT                   /old_locus_tag="KLLA-ORF10541"
FT                   /product="KLLA0A05841p"
FT                   /note="highly similar to uniprot|P39515 Saccharomyces
FT                   cerevisiae YJL143W TIM17 Mitochondrial inner membrane
FT                   protein involved in protein import 16.5 kDa inner membrane
FT                   protein required for import of mitochondrial precursor
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05841g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02848"
FT                   /db_xref="GOA:Q6CXS9"
FT                   /db_xref="InterPro:IPR005678"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS9"
FT                   /protein_id="CAH02848.1"
FT                   /translation="MSADHSRDPCPIVILNDFGGAFAMGVIGGCVWHGIKGFRNSPLGE
FT                   RRAGAVSAIKARAPVVGGNFGVWGGLFSTFDCGVKAVRKREDPWNAIIAGFFTGGALAI
FT                   RGGWKHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPDQPMQA"
FT   gene            complement(<544850..>545104)
FT                   /locus_tag="KLLA0_A05852g"
FT                   /old_locus_tag="KLLA-ORF10539"
FT   CDS_pept        complement(544850..545104)
FT                   /locus_tag="KLLA0_A05852g"
FT                   /old_locus_tag="KLLA-ORF10539"
FT                   /product="KLLA0A05852p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65219"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI6"
FT                   /protein_id="CAR65219.1"
FT                   /translation="MTKSYRSRTGIRTKRQTRRLAPPSQQAKEPDRNVLPTYQYHNQYE
FT                   NQFEPVPITFYYVVFPQGESQNEPDGGTNNSQTHPNPLP"
FT   gene            <545949..>547088
FT                   /locus_tag="KLLA0_A05863g"
FT                   /old_locus_tag="KLLA-ORF10536"
FT   CDS_pept        545949..547088
FT                   /locus_tag="KLLA0_A05863g"
FT                   /old_locus_tag="KLLA-ORF10536"
FT                   /product="KLLA0A05863p"
FT                   /note="highly similar to uniprot|P32451 Saccharomyces
FT                   cerevisiae YGR286C BIO2 Biotin synthase catalyzes the
FT                   conversion of dethiobiotin to biotin which is the last step
FT                   of the biotin biosynthesis pathway complements E. coli bioB
FT                   mutant"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05863g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02849"
FT                   /db_xref="GOA:Q6CXS8"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS8"
FT                   /protein_id="CAH02849.1"
FT                   /translation="MFVRRFSTSLIRAGAGATALKESVAGENVSAISYALSLNEPQHVW
FT                   TKEQLAEIYHTPLMELMHQAQLQHRKWHDPTKVQLCTLMNIKAGGCSEDCKYCAQSSRY
FT                   DTGLKAEKMISVEEVIKEAQIAKENGSTRFCLGAAWREMRGRKSALKRIGEMIGKINEM
FT                   GMESCVTLGMVDETQAKQLKDAGLTAYNHNIDTSREHYPKVISTRSYDDRLQTIKNVQD
FT                   AGIKACTGGILGLGETEDDHIGFVHTLANMSPHPESLPINRLVSIKGTPMHEELKKVSS
FT                   KKLEFDEILRTVALARIVMPQAIIRLAAGRYTMKETEQFLCFMAGCNAIFVGKKMLTTM
FT                   CTGWDEDKAMLSKWGLQPMESFSYSANKAPAEAACAGGQ"
FT   gene            complement(<547338..>548231)
FT                   /locus_tag="KLLA0_A05885g"
FT                   /old_locus_tag="KLLA-ORF10534"
FT   CDS_pept        complement(547338..548231)
FT                   /locus_tag="KLLA0_A05885g"
FT                   /old_locus_tag="KLLA-ORF10534"
FT                   /product="KLLA0A05885p"
FT                   /note="similar to uniprot|P47008 Saccharomyces cerevisiae
FT                   YJL145W SFH5 putative phosphatidylinositol transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05885g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02850"
FT                   /db_xref="GOA:Q6CXS7"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXS7"
FT                   /protein_id="CAH02850.1"
FT                   /translation="MPLNFETDEQKKCYELLRADVENIVKETGYDELYGHKLTPDDQFY
FT                   EEVIVDNLIYKFCRANQFEIEGAKSQLKKTLKWRKEFKPLHAAFSETHDSLLNDVCAIT
FT                   VSEENDPNQKVVSWNLYGLLVKHKEVFEDTDKFLRFRIGLMERGLQLLDFASEDNYLMT
FT                   QVHDYNNVSMWRLDPAIKKCSKAIIEVFQDFYPETLFSKFFVNVPYVMTWLYEIVKRFV
FT                   SEDTRKKFIVMSDGTQMKDYLKVLPKEYGGEATLNSSKLENIEPNAYVSYLLTQCGGEE
FT                   PAETTAPEQEKETATA"
FT   gene            complement(<548720..>549763)
FT                   /locus_tag="KLLA0_A05907g"
FT                   /old_locus_tag="KLLA-ORF10532"
FT   CDS_pept        complement(548720..549763)
FT                   /locus_tag="KLLA0_A05907g"
FT                   /old_locus_tag="KLLA-ORF10532"
FT                   /product="KLLA0A05907p"
FT                   /note="weakly similar to uniprot|P46958 Saccharomyces
FT                   cerevisiae YJL146W IDS2 Protein involved in modulation of
FT                   Ime2p activity during meiosis, appears to act indirectly to
FT                   promote Ime2p-mediated late meiotic functions; found in
FT                   growing cells and degraded during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05907g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS6"
FT                   /protein_id="CAH02851.1"
FT                   /translation="MNDQVENLSKELDISIDIANAVNKSLKETNVDPTFRSNTPIQSQS
FT                   EDSIQGSETADNTSYQLWNHHYVEAPSAADNSNITEILEDWNFIDDNVRNKRRTSMEDI
FT                   FKVRHYLNPRSSFTNSGTNSRCWVTIITQMAEISCAIALNSSLRAHDSKLILCVVIPKD
FT                   WNIPLPQLPFLTFVKLPKVTFADKELTLLTLWNHLDYEFCCFLSPFAILQTNIDEMLLN
FT                   DEIFLEIDNETCVFLTNDTYQRKEDIVFLLFKPSVEIGTAVDEFLKVYSGDSAKLAQLQ
FT                   ETDPYDALNTLFGEAWGFVGRDICQTLYDPSLSSNASILNYKKLEPWKGNHSGICQLWW
FT                   DMYKGDN"
FT   gene            <550666..>551748
FT                   /locus_tag="KLLA0_A05929g"
FT                   /old_locus_tag="KLLA-ORF10531"
FT   CDS_pept        550666..551748
FT                   /locus_tag="KLLA0_A05929g"
FT                   /old_locus_tag="KLLA-ORF10531"
FT                   /product="KLLA0A05929p"
FT                   /note="weakly similar to uniprot|P47007 Saccharomyces
FT                   cerevisiae YJL147C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05929g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS5"
FT                   /protein_id="CAH02852.1"
FT                   /translation="MLKRSFSILPRVLKSKDSAAVKRTIQYITEDKTFKSILGGSKADD
FT                   ENVFVDDVLKLLNSSLPDVKKHQKTMDVHYSVLMNKLRGMVDKEIVYATVDVNKRIADC
FT                   ADANDLYRLIWEIQMDPLLRDKATLKHYYHIINSPNFSVAKCAELLDCIDMIKYSKTDI
FT                   MIMAIYKLNNPTVTSKYVKELISIYPSLNQFSQKLTLRILRGANRLQELFDTQNDQIHT
FT                   ITGNHSQVVMIFQTLFRSAYKLPEHLIDESTELTPLQRSFCSSVRVLSEYSSAQPKLAK
FT                   CCSQMVKASFMNKVSHCNKESEHSININEYKFLKYMEETLEDCLNIAGLDDFFYDSCRR
FT                   ILCSVRKTYTEESQLSLRLI"
FT   gene            <552438..>553298
FT                   /locus_tag="KLLA0_A05951g"
FT                   /old_locus_tag="KLLA-ORF10529"
FT   CDS_pept        552438..553298
FT                   /locus_tag="KLLA0_A05951g"
FT                   /old_locus_tag="KLLA-ORF10529"
FT                   /product="KLLA0A05951p"
FT                   /note="highly similar to uniprot|Q75BM7 Ashbya gossypii
FT                   ACR244C ACR244Cp and similar to YKR062W uniprot|P36145
FT                   Saccharomyces cerevisiae YKR062W TFA2 TFIIE small subunit
FT                   involved in RNA polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05951g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02853"
FT                   /db_xref="GOA:Q6CXS4"
FT                   /db_xref="InterPro:IPR003166"
FT                   /db_xref="InterPro:IPR016656"
FT                   /db_xref="InterPro:IPR040501"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS4"
FT                   /protein_id="CAH02853.1"
FT                   /translation="MSNDLLANLNAFKNKVKTSPALTTRKVLANKDRDGQTNGNGKSTE
FT                   VIEVDDPNSDEKDMPLKKRAKSSSVAPTGQLDSTHLSTKMLIATEYIQERGEAVPVDQI
FT                   ESYLSLPKDNNVIPMLKGLQKFKFDPKRNTLQYVSIYDVHSAEELLQLLRSQATFKGIS
FT                   CKELKDGWPQCFDTIDELEAKNRILVLRTKKDNSPRFVWYNHAGPSRQIDEEFVTMWEA
FT                   CKLPQRSELPRKLQDLGLKPASVDPATIKNEQTTRKEVKKRRSRKGKVTNTHMAGILRD
FT                   YSDRV"
FT   gene            complement(<553403..>553987)
FT                   /locus_tag="KLLA0_A05973g"
FT                   /old_locus_tag="KLLA-ORF10528"
FT   CDS_pept        complement(553403..553987)
FT                   /locus_tag="KLLA0_A05973g"
FT                   /old_locus_tag="KLLA-ORF10528"
FT                   /product="KLLA0A05973p"
FT                   /note="weakly similar to uniprot|P47006 Saccharomyces
FT                   cerevisiae YJL148W RPA34 RNA polymerase I subunit A34.5"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A05973g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02854"
FT                   /db_xref="GOA:Q6CXS3"
FT                   /db_xref="InterPro:IPR013240"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS3"
FT                   /protein_id="CAH02854.1"
FT                   /translation="MAKVDKTLSKEYISDSDSDNDGSSETVTDVFVPPENYKKCTHLKS
FT                   FVKPKNLKQKELWLIKLPKSLDVSKLSKLPIDFTAESETGIEQKGKHFSVKEEIQQENS
FT                   TSGASSSSELTLLTPVDKTKLTVDSSASRSFDKIFTISETAKIPSIDYSKVRVDRKDVL
FT                   KVKGLKTRHFATGYYEDKDLKKVSKKKRKHD"
FT   gene            <554734..>554970
FT                   /gene="SNR190"
FT                   /locus_tag="KLLA0_A05987r"
FT                   /old_locus_tag="Klla0A_snoRNA_64"
FT   ncRNA           554734..554970
FT                   /gene="SNR190"
FT                   /locus_tag="KLLA0_A05987r"
FT                   /old_locus_tag="Klla0A_snoRNA_64"
FT                   /product="snR190"
FT                   /note="C/D snoRNA polycistronic Cluster 5 SNR190"
FT                   /ncRNA_class="snoRNA"
FT   gene            <555022..>555187
FT                   /gene="SNR128"
FT                   /locus_tag="KLLA0_A06002r"
FT                   /old_locus_tag="Klla0A_snoRNA_65"
FT   ncRNA           555022..555187
FT                   /gene="SNR128"
FT                   /locus_tag="KLLA0_A06002r"
FT                   /old_locus_tag="Klla0A_snoRNA_65"
FT                   /product="snR128"
FT                   /note="C/D snoRNA polycistronic Cluster 5 SNR128 (U14 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<555280..>556650)
FT                   /locus_tag="KLLA0_A06017g"
FT                   /old_locus_tag="KLLA-ORF10524"
FT   CDS_pept        complement(555280..556650)
FT                   /locus_tag="KLLA0_A06017g"
FT                   /old_locus_tag="KLLA-ORF10524"
FT                   /product="KLLA0A06017p"
FT                   /note="similar to uniprot|Q75BM9 Ashbya gossypii ACR242W
FT                   ACR242Wp and weakly similar to YKR063C uniprot|P36146
FT                   Saccharomyces cerevisiae YKR063C LAS1 Essential nuclear
FT                   protein possibly involved in bud formation and
FT                   morphogenesis mutants require the SSD1-v allele for
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06017g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02856"
FT                   /db_xref="GOA:Q6CXS1"
FT                   /db_xref="InterPro:IPR007174"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXS1"
FT                   /protein_id="CAH02856.1"
FT                   /translation="MRITPWRSRSELEQLKQWLFVDDTPASKRRAIQRIDAYLTRGPYL
FT                   PHIIEYTVRLMQCQLNDPGEAQDGDDMEYLKWQYCMVLIRFVNGMLDPVQQAQFAIPLH
FT                   TLAENIGLPSWFVELRHLSTHERELPSLEMLRLCCKEAIQWTWDNYWNNDEWEEEDQDF
FT                   DEAEDEDATDDNDDSEAKKRKSQSSVQLKSLFTQYTGLKRLLKENEYLWKRQRIARSTF
FT                   GEQDSTEDEEVSDWLTVLKTAWKQIHKSDFVEYMILHCDETLLEICFHSLDTFQVRCIE
FT                   WLIENYEKRIMNEETKITDRFSNHKKLLKFVNKCCSMVNGRKFLSNGLFSNVVDKYHNY
FT                   LVLHILKNLSNESGSSGNYSGSKSRKKKKANEIDAKKVIEEFEAKGIRNVELELYNSRK
FT                   RTSSEEIEPVSEDSPALDILKDLNELKNQFKKIKQSNAPISNWQEVTEWTPRPFGVL"
FT   gene            <557368..>559341
FT                   /locus_tag="KLLA0_A06039g"
FT                   /old_locus_tag="KLLA-ORF10521"
FT   CDS_pept        557368..559341
FT                   /locus_tag="KLLA0_A06039g"
FT                   /old_locus_tag="KLLA-ORF10521"
FT                   /product="KLLA0A06039p"
FT                   /note="weakly similar to uniprot|P36023 Saccharomyces
FT                   cerevisiae YKR064W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06039g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02857"
FT                   /db_xref="GOA:Q6CXS0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXS0"
FT                   /protein_id="CAH02857.1"
FT                   /translation="MVYEMLSPVPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLG
FT                   ETCVYSEDTDENASKKVRYEYMDDLGLPEFINMAPKGLHLLSKRSASWFNGLFSDIAIC
FT                   DRDPYLRITNAVIDILRKSASKGIDRSERDTVLQLPNSLKTVTMYNRSEKSEDQLYHQI
FT                   AREFSALRSAPIPETYVPYEYEFWSKYYPYFVDKIHPLVPVFNLIELKDLLEKFFQRQK
FT                   DHPGKLNDKVHESTLLMLTYLIINFFLLEFDSHNRLIQDHINIIKKWLVQSKWFQKTTL
FT                   LQLRVWLVLRFHNWCTYHDNDGNRMNANDGLMGLIMGHCASLGITWQLWTNVDSDECKN
FT                   IWINALHWDRKLAVLNGNDTFNGRTMRVPELPNDHLVLKFLKCCVDDPTHVNYKLAIEI
FT                   LNKLNFEEQNPMVTWEWKVIVAVTKLQINHGRLNHINEGISAVIASLEDLITLWNEHFI
FT                   RPLAPVSYSSRIIEISMNKALVLLPAIILRARNPCKQKILQLMDKILTTYFNEFPYYYH
FT                   VFKRLFKYKLTLNLINREDSLDHMLTILKHENHQVLEKLGITSKDAEMSDDDVIKVWNA
FT                   RFSFTEKVVNLKVEMMCKNYEPNLFSSSYQHALEKLEERHSAKADAIDVTQFLQQVFDS
FT                   TDFDLFYGMDVGELPKMDSILP"
FT   gene            complement(<559396..>560994)
FT                   /locus_tag="KLLA0_A06061g"
FT                   /old_locus_tag="KLLA-ORF10519"
FT   CDS_pept        complement(559396..560994)
FT                   /locus_tag="KLLA0_A06061g"
FT                   /old_locus_tag="KLLA-ORF10519"
FT                   /product="KLLA0A06061p"
FT                   /note="similar to uniprot|P47005 Saccharomyces cerevisiae
FT                   YJL149W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06061g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02858"
FT                   /db_xref="GOA:Q6CXR9"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR9"
FT                   /protein_id="CAH02858.1"
FT                   /translation="MIDTFPLESLPDELLAEVITHVPQRDRLNLCLVNKRVSKLALPIL
FT                   YRRIYLNDSNVVESDIVNLAINWTYLYMPPNEAECWSRGLANAKLDLLIRTLSRNSERL
FT                   NSIQWIRINWDLDKEKQAEVLRLLCTYSKSIIRLENVTDPDCNDIIANGIQSRHNVTSF
FT                   DSAPPNSMPEGEVSRTYLPNLAQYLKQRISSNLSHMTLFMDPIQLFNCIYPLQFKLQIH
FT                   DLKLHWRKEYYPPDQLKPLNQYPKLTKLSDVFDVRTLKVLTIISWNENLNKRELEILTE
FT                   FYEFTEIRDLSLISMRQNPAILIELFKRLKNLKRLKTDFLHEFTPHPVSTDVFLSILLN
FT                   CRELQFLDLRFENIDRQIISIEGSRFKFLHNCHCDDCNHVFQDILYGKFFNSSKDMVIR
FT                   DLSDLIAKDIFTMMKYLSLLPYSKAFDIYPSVRTQPMNLSDFVTKINEYNRHYKSMHRN
FT                   STPIEPITESDVIKCYHAMVHHNKKTYTTILSNLKRLRYLVLNDVPCIVLEREGARVPV
FT                   PVFFNNGYKSNMGNC"
FT   gene            <561559..>561933
FT                   /locus_tag="KLLA0_A06072r"
FT   tRNA            join(561559..561595,561884..561933)
FT                   /locus_tag="KLLA0_A06072r"
FT                   /product="transfer RNA Leu (CAG) cove"
FT   gene            complement(<562140..>562730)
FT                   /locus_tag="KLLA0_A06083g"
FT                   /old_locus_tag="KLLA-ORF10517"
FT   CDS_pept        complement(562140..562730)
FT                   /locus_tag="KLLA0_A06083g"
FT                   /old_locus_tag="KLLA-ORF10517"
FT                   /product="KLLA0A06083p"
FT                   /note="similar to uniprot|P36147 Saccharomyces cerevisiae
FT                   YKR065C FMP18 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06083g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02859"
FT                   /db_xref="GOA:Q6CXR8"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXR8"
FT                   /protein_id="CAH02859.1"
FT                   /translation="MLRLGINLQNRLLVGLNGQSLLKRAVTRNAVAIRMNSTNAGKTAS
FT                   HEMTWPEFFKLRKKERVFNTASSVATAIVFVNGSWFYFSTLEIDPTQTIFGFDPLMAIT
FT                   AGMITCAAVGWLLGPIVGTALFKATSGPKLLQFQEKQLSFLAKIQKNRVNPQSQSFSNP
FT                   VPDYYGEKINSIPQYRQWLRDCHSYKRKASEFL"
FT   gene            <563147..>564067
FT                   /locus_tag="KLLA0_A06105g"
FT                   /old_locus_tag="KLLA-ORF10516"
FT   CDS_pept        563147..564067
FT                   /locus_tag="KLLA0_A06105g"
FT                   /old_locus_tag="KLLA-ORF10516"
FT                   /product="KLLA0A06105p"
FT                   /note="some similarities with uniprot|P25623 Saccharomyces
FT                   cerevisiae YCR030C SYP1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06105g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02860"
FT                   /db_xref="GOA:Q6CXR7"
FT                   /db_xref="InterPro:IPR018808"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR7"
FT                   /protein_id="CAH02860.1"
FT                   /translation="MSDVLAFAEIVQGYIQSLEELKETKFDSNSELFSEVSQELVRSKE
FT                   LLLQLQERENILKLRESGPDSESPPLPEINGDIVETLSCVITDDNITNVSLVGEVAING
FT                   TKWDQRTSDLYMKFNNVSSVKINDTFLEPVDVVQNIYKLKREREWDNVVTGLVKYAVTN
FT                   LPQVQCPILVTPVWQFKEAEIISMINLRPLIPVNYTLLKVCIKIGTKAQDILSKPTGFY
FT                   NQVDGTIQWDLPMLEQDQILILRYKGGQRTDVVTSQAIGPPHVRIDFTASQLLTQVNVE
FT                   YGYSPTRLTDLPLNVMTISGNYKAQ"
FT   gene            complement(<564088..>564597)
FT                   /locus_tag="KLLA0_A06127g"
FT                   /old_locus_tag="KLLA-ORF10515"
FT   CDS_pept        complement(564088..564597)
FT                   /locus_tag="KLLA0_A06127g"
FT                   /old_locus_tag="KLLA-ORF10515"
FT                   /product="KLLA0A06127p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06127g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02861"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR6"
FT                   /protein_id="CAH02861.1"
FT                   /translation="MSFGVRRFSKRVVRTSARSDDILSEEAWLDLDIGEYHVVNDPLVL
FT                   SSSSDDDEMEQEDPTRRIERWMSTNAVVRMQTPDIASVDDDYYQDYSSNSSDAVCLVVP
FT                   YLSEKLSCLTEYQLRWVHDFVAEMLPLLPRKSVSPVSSVSTSSSSSEISFKSSRNEKYR
FT                   LPRVIV"
FT   gene            <565427..>565819
FT                   /locus_tag="KLLA0_A06149g"
FT                   /old_locus_tag="KLLA-ORF10513"
FT   CDS_pept        565427..565819
FT                   /locus_tag="KLLA0_A06149g"
FT                   /old_locus_tag="KLLA-ORF10513"
FT                   /product="KLLA0A06149p"
FT                   /note="similar to uniprot|P32445 Saccharomyces cerevisiae
FT                   YCR028C-A RIM1 Single-stranded DNA-binding protein that is
FT                   essential for mitochondrial genome maintenance Single-
FT                   stranded zinc finger DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06149g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02862"
FT                   /db_xref="GOA:Q6CXR5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR5"
FT                   /protein_id="CAH02862.1"
FT                   /translation="MFRLAQRRAFSATARTNDFAKMSIIGRIGSEYQEFTTANDTRYLK
FT                   YSIASQPRKDSNTNWFNVTVFNTNHINFMTQYVKKGALVYIEADASNYTFEREDGSRGQ
FT                   SLSLVQRDINLLKNPKAPETEEEQQA"
FT   gene            <566176..>566535
FT                   /locus_tag="KLLA0_A06171g"
FT                   /old_locus_tag="KLLA-ORF10511"
FT   CDS_pept        566176..566535
FT                   /locus_tag="KLLA0_A06171g"
FT                   /old_locus_tag="KLLA-ORF10511"
FT                   /product="KLLA0A06171p"
FT                   /note="similar to uniprot|P46984 Saccharomyces cerevisiae
FT                   YJL184W GON7 Protein of unknown function proposed to be
FT                   involved in the transfer of mannosylphosphate groups onto
FT                   N-linked oligosaccharides also proposed to be involved in
FT                   responding to osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06171g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02863"
FT                   /db_xref="GOA:Q6CXR4"
FT                   /db_xref="InterPro:IPR014849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXR4"
FT                   /protein_id="CAH02863.1"
FT                   /translation="MSLPHATYTGPKSTHEFEVDPSDPRYQTTEGRTTGASDYVLKQGH
FT                   QDVDKPSDPKKVDNVNSKTGIDQYTTLSQLRMQLTGLQDDINEYLTEKINHVKKPRNSK
FT                   QEQEINDLLDGSEET"
FT   gene            <566780..>568096
FT                   /locus_tag="KLLA0_A06193g"
FT                   /old_locus_tag="KLLA-ORF10510"
FT   CDS_pept        566780..568096
FT                   /locus_tag="KLLA0_A06193g"
FT                   /old_locus_tag="KLLA-ORF10510"
FT                   /product="KLLA0A06193p"
FT                   /note="similar to uniprot|P25621 Saccharomyces cerevisiae
FT                   YCR028C FEN2 Plasma membrane H -pantothenate symporter
FT                   confers sensitivity to the antifungal agent fenpropimorph"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06193g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02864"
FT                   /db_xref="GOA:Q6CXR3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR3"
FT                   /protein_id="CAH02864.1"
FT                   /translation="MGKLFRVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKEDLGFKS
FT                   NQFNIANTCFTVGYLLGMIPHNLILLRIKPRIWLSFCTFAWGILTLSMFSIDSVWQCYV
FT                   IRFFQAWFESCTFSGTHLILGSWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHDSLN
FT                   GKAGLPGWKWLFIIDGLITIPIALYGLFFFPEPDADARESNHKNSWIFTGKHKQQIDTL
FT                   DWSIFKRCGSRWHWWLFSFVWVLGGENISFASNSTFNIWLDNQGYSLADKNRFPVGIYA
FT                   VGIVSTVASSLYVHKYSHFAKHWHVALFISISMFIVSLLILTNPLNPKFMFAAQYLGGI
FT                   SYTGQTLFFAWCNVVCRGDLQERAIVLASMNMFSGAVNAWWSLLFYSTSMAPKFTNGCY
FT                   ALMATSISSGIVSLLIHYLQKRDDLDLSQYTDPEEQIKE"
FT   gene            <568689..>569927
FT                   /locus_tag="KLLA0_A06215g"
FT                   /old_locus_tag="KLLA-ORF10509"
FT   CDS_pept        568689..569927
FT                   /locus_tag="KLLA0_A06215g"
FT                   /old_locus_tag="KLLA-ORF10509"
FT                   /product="KLLA0A06215p"
FT                   /note="similar to uniprot|P46985 Saccharomyces cerevisiae
FT                   YJL183W MNN11 Subunit of a Golgi mannosyltransferase
FT                   complex that also contains Anp1p Mnn9p Mnn10p and Hoc1p and
FT                   mediates elongation of the polysaccharide mannan backbone
FT                   has homology to Mnn10p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06215g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02865"
FT                   /db_xref="GOA:Q6CXR2"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR2"
FT                   /protein_id="CAH02865.1"
FT                   /translation="MPFIPKNKKKWTKSFKVWISELKFYLHKRNKFSMLLLISVIIFLL
FT                   YELTSSLPSKSSAGYRIPKTHGMYQNEVQSSTPLIFPSVQDHGTLKELGVEGLFTLRID
FT                   VDGNREYVFKPEDTPMTEAERKELAETDKKKFVKRTFLDHGKLVYKNKANHPEVVIVTI
FT                   IDFENYSLDHIINTVQNRVDYAQRHNYGTYVRWAQEFLPQVQKQSMEASYEFIKPLAVR
FT                   AAMNAFPYAKYFWFFDQNGLIMQLDTSLQQQLLEPKVLDAAVLKSVPVFEKSNIKTYKH
FT                   FDAKTAKIIIPKTGAGKLDTSSFVVTPSIHGKAFLDYINDPLVRNYPWPSSFTSAIGHL
FT                   LQWHPRILKRTALVVPKTIASVYSPSAVKKQADDAERFNYMDGDFVITFTGCEASKTCE
FT                   IELDKHYQLVKQD"
FT   gene            <570630..>573071
FT                   /locus_tag="KLLA0_A06237g"
FT                   /old_locus_tag="KLLA-ORF10506"
FT   CDS_pept        570630..573071
FT                   /locus_tag="KLLA0_A06237g"
FT                   /old_locus_tag="KLLA-ORF10506"
FT                   /product="KLLA0A06237p"
FT                   /note="weakly similar to uniprot|P47101 Saccharomyces
FT                   cerevisiae YJR030C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06237g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXR1"
FT                   /protein_id="CAH02866.1"
FT                   /translation="MDNTVRLDQLHDEQYRRILPTLNGYFEQKDTSLSRLDPRNYRNEN
FT                   YKKMNAIIPVLLRAHQCHPTDWKLLFANAQTLNFYSALLEGLLMFMFQSFSTTVGFGSN
FT                   MEFLRCMLKTYEYLYTVAKTLPSPELGQRVMSFQNHFMRNWNKVQCESLLFDQVKDLLS
FT                   HAHDFVAPPLFNLESVIKRDYFKITCDKLRYENLCVELFHLDNGNMAIFKVNTQTLPLY
FT                   TNEQTHELLLRLTRNIDMGAYQDPLFQIGRTLLFPTIRPMDLRIADESRKSILLETKTG
FT                   NGVTLALTPYDTLAWSQHWRPFVQSLCAVADSPKAFLSDRNESTFGSPINKDTITSAGT
FT                   RGLGISLKKSEVRTNLDTGLRKSKPLASEALSISEIESLNMKKLMELNDSTDASTMNSS
FT                   MKSPVPTNIRHIQEPSNIIEQMSPVIGSRVDDIDSIISDDDGINNEGSLGGSPVFNLSA
FT                   EFHKPQLTKRKSSSFLNLFKKDKSKSQKNSTDSLAKLSDTKSIHPPESAMSSHASTPSS
FT                   TSKSSKSSKSSSTLSPSTCKLPSSVKLDTNNVLLDTLVKLSQWRNNSWRFFSSSWLQLQ
FT                   VVNSNQGRYMFVVQDDNSNLKLCIAIGERWTISRTTAQDIQIRFPPTDVVASVAEPVPT
FT                   LLSVRCPQVDNIANLLKHCKKNEVILTSSNNMSNSATQLTLGSNSSSILSNNVSNMSFS
FT                   RSSTASNDLSHGWSKPQVLDSSKDCKSLLLLSKIKVRLHKYDQQYGWKMTKVGLLNVYS
FT                   REYNGSVAGCKFEMDDTESFISSISDLKRIGRTGISAGERLVEFKNQNVADETYKLLGA
FT                   L"
FT   gene            complement(<573195..>574178)
FT                   /locus_tag="KLLA0_A06259g"
FT                   /old_locus_tag="KLLA-ORF10502"
FT   CDS_pept        complement(573195..574178)
FT                   /locus_tag="KLLA0_A06259g"
FT                   /old_locus_tag="KLLA-ORF10502"
FT                   /product="KLLA0A06259p"
FT                   /note="similar to uniprot|P22135 Saccharomyces cerevisiae
FT                   YJL180C ATP12 Molecular chaperone required for the assembly
FT                   of alpha and beta subunits into the F1 sector of
FT                   mitochondrial F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06259g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02867"
FT                   /db_xref="GOA:Q6CXR0"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXR0"
FT                   /protein_id="CAH02867.1"
FT                   /translation="MLRLSRPFRLVSPTVLSRVRCYAQASPLGVDHSIENNLQTETNRL
FT                   SKTLTKFWEQVSLEETPENVTIKLDSKPLRTPLGNPLTLPQSRKLLSVMVLNEWSNLPS
FT                   LSVKPYVLPLTSLVSRCIDLEKANEDGVDPELVAKIGGNREKLTEGLLRYLDTDTLLVF
FT                   SPANEYEGALRKAQDELYLPIISGVEKFLSQINKDKKEVKLQILDADLHGLRGNAQSGE
FT                   TREVAKQYLDSLSVWDLAIFEKTVLTTKSFICGLLLLLNKSATVTNIPELQVSMEDIAR
FT                   AATLETIYQVERWGEVEDTHDVDKRDVRRNIHAAAIVAFGPPTSSK"
FT   gene            <574472..>574813
FT                   /locus_tag="KLLA0_A06281g"
FT                   /old_locus_tag="KLLA-ORF10501"
FT   CDS_pept        574472..574813
FT                   /locus_tag="KLLA0_A06281g"
FT                   /old_locus_tag="KLLA-ORF10501"
FT                   /product="KLLA0A06281p"
FT                   /note="similar to uniprot|P46988 Saccharomyces cerevisiae
FT                   YJL179W PFD1 Subunit of heterohexameric prefoldin which
FT                   binds cytosolic chaperonin and transfers target proteins to
FT                   it involved in the biogenesis of actin and of alpha- and
FT                   gamma-tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06281g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02868"
FT                   /db_xref="GOA:Q6CXQ9"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ9"
FT                   /protein_id="CAH02868.1"
FT                   /translation="MSSQPQDIVKEMANSLRNSRSQLDMTLAQLEQLQRQKKIAKLTEK
FT                   ELGNYGNEQVWRSCGKMFIRQEKQAYTADLNHDERILDEQIKALEQKRHYLQTTVDNTV
FT                   ESLRRVIGN"
FT   gene            complement(<575020..>575877)
FT                   /locus_tag="KLLA0_A06303g"
FT                   /old_locus_tag="KLLA-ORF10500"
FT   CDS_pept        complement(575020..575877)
FT                   /locus_tag="KLLA0_A06303g"
FT                   /old_locus_tag="KLLA-ORF10500"
FT                   /product="KLLA0A06303p"
FT                   /note="similar to uniprot|P46989 Saccharomyces cerevisiae
FT                   YJL178C ATG27 Type II membrane protein that binds
FT                   phosphatidylinositol 3-phosphate required for the
FT                   cytoplasm-to-vacuole targeting (Cvt) pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06303g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02869"
FT                   /db_xref="GOA:Q6CXQ8"
FT                   /db_xref="InterPro:IPR018939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXQ8"
FT                   /protein_id="CAH02869.1"
FT                   /translation="MKVLLATALVSLLPFSSAVECSKNEILNKYRVNEFSIGGVSVQDT
FT                   PPSETKESWWLNICDEHDSKSSIPDQCNVKDIFCGVTSVALPGKESIVTKVMDFTSSVA
FT                   LEVKETAEALSIRLSGAAWGSHILNADIYLQCQEKGSGSLTESSWTDDQNVKLVFSGPF
FT                   GCLKKGNDNKDGNGDDDNNDKDGDDSDKKPHDGDKNGSKPKGGAGLGSWLVWLFMYATI
FT                   FALIYLVVTSYMNTRNGSFNDFREEFVDRSTTFATNLPQFAKEVAGKIVNSGSSSQRGG
FT                   YSAV"
FT   gene            <576887..>577850
FT                   /locus_tag="KLLA0_A06336g"
FT                   /old_locus_tag="Klla0A.mRNA.448.p"
FT   CDS_pept        join(576887..577195,577605..577850)
FT                   /locus_tag="KLLA0_A06336g"
FT                   /old_locus_tag="Klla0A.mRNA.448.p"
FT                   /product="KLLA0A06336p"
FT                   /note="similar to uniprot|P46990 Saccharomyces cerevisiae
FT                   RPL17B Protein or YKL180W uniprot|P05740 Saccharomyces
FT                   cerevisiae YKL180W RPL17A Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02871"
FT                   /db_xref="GOA:Q6CXQ6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ6"
FT                   /protein_id="CAH02871.1"
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKAQ
FT                   KYLDQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNAEA
FT                   KGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTEKEEAVEKASEK
FT                   KVARLSSRQRGRLATQKRITA"
FT   gene            complement(<578090..>580057)
FT                   /locus_tag="KLLA0_A06402g"
FT                   /old_locus_tag="KLLA-ORF10490"
FT   CDS_pept        complement(578090..580057)
FT                   /locus_tag="KLLA0_A06402g"
FT                   /old_locus_tag="KLLA-ORF10490"
FT                   /product="KLLA0A06402p"
FT                   /note="similar to uniprot|P34237 Saccharomyces cerevisiae
FT                   YKL179C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02873"
FT                   /db_xref="GOA:Q6CXQ4"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ4"
FT                   /protein_id="CAH02873.1"
FT                   /translation="MNLSTYEHALSLWKEAGFSSIQSLLDDSIAKIKDLETSSLESRKT
FT                   LASETKKYKKLPDDEKPSQSLKLVKEYQKEIDSLTTRSTFSEKVVIELYEKLIEQPDPT
FT                   GILESIVEELKKDGTNVDDIKAENQKLAAIVSKCADYDTLKKRLSDLEQNSAKTLSNRL
FT                   IAKEKEITSKWEEKQRNWNNREDELLKQLETLKNTNSILEKKIGAQVDLEQQEDGDDDT
FT                   VLVSGKNSAQSELLVQELEAAQIRIMSLESRNEELNSEVTKLKSDEQQDSIFQEKETKL
FT                   NQLESENAKLVTCLEEERKSLKETSQTLSSQLKSSALETQTYKSELETLRRKLTNYSDY
FT                   EKIKQELNAMKKIEFGTSDDSDNENDDGDDSITSSLKHANQKLQNNLVKANTEKNKYMN
FT                   ETQTLKKSIEALYSKIQNLETLNAKLEADIEKVEDVTNQFSDTQSMMSGATRQISNRHA
FT                   TNEKLSPTSSIIGIPEEKELDTFSGNFNGSPSILPIVTKQRDRFRSRNLELERQIKHCN
FT                   QEQTKLKVQVKELKADNSKLYEKAKLLSSYSNNSAVRNTVDLESPFSEEYEESLHPLSS
FT                   FKERELERYERRKMPPLERLFLSFAKVILANKQTRMLFMLYCLGLHGLVMVMTIYVTSF
FT                   TNYITPDVSSSSGSMINTNQ"
FT   gene            complement(<580397..>583288)
FT                   /locus_tag="KLLA0_A06424g"
FT                   /old_locus_tag="KLLA-ORF10487"
FT   CDS_pept        complement(580397..583288)
FT                   /locus_tag="KLLA0_A06424g"
FT                   /old_locus_tag="KLLA-ORF10487"
FT                   /product="KLLA0A06424p"
FT                   /note="weakly similar to uniprot|P32591 Saccharomyces
FT                   cerevisiae YJL176C SWI3 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02874"
FT                   /db_xref="GOA:Q6CXQ3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR032451"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ3"
FT                   /protein_id="CAH02874.1"
FT                   /translation="MADDEQRDSVLESAQTQSSVENTQNTSEQPGLIDHTEDVDMGGID
FT                   DNLDMDVEPNLPDDFGNEFSESLPQDFPEEFGDAPLAENLPEGINDKLLSNLDNENGDA
FT                   DDADLFEEEPEEQNPANEASESDLLKSPSKEDDTTAAGNEEQEQEQEQEQDEQMDKEND
FT                   EIALPETKKESDSNGEGNNDPVGNIETEQSEVEPAQNELETANDKQEPAPEPESFTENP
FT                   KLPDVKDLGQPDSGIDAPVHTTTETTVDEEIDKEHNTEAEAEPEVDSILEQESRSASPE
FT                   SNITVKQESNTADPKLFVPQSHEIVIPSYSKWFNLTKVHEIEVKSLPEFFTNRIPSKTP
FT                   QMYVKYRNFMVNSYRLNPNEYFTVTAARRNLCGDAGALFRLHKFLTKWGLINYQVNATK
FT                   KPKMVEPPFTGEYETRYDAPRGLFPFQSYKPALQLPDMTRLKKIMTQLDTKPSEPSSLK
FT                   RTSDEISSEHTQDLSNGGSSHVNGITNKTASGSVGPENYGLKDEKESPVNADLERNDRK
FT                   PKRPKISQLIDKDWTQEEIYKLIELIKEHGTDWFNIAKTLGTKTPEQCILRFLQLPIED
FT                   AFLMDEKDLGLLKFGSHIPFNKSDNPVMSTLAFLIGLVDPNIVQHLTKRAISLHDINVN
FT                   TGANTEAKDAEERQEEQKEEQTEESKEEQKEEIKTDAREIEHTETGAEKSEPANSNAAD
FT                   HSTATEGTAPAAEQVANSDVTVDTSNEKNANTPENEEKEATEVRAEKTGEEGLQKAEEK
FT                   NKEEGSQEEAIPVEEPHQEESLENEALSNKETPSEKQELPEEQAVTVTNAESDARITVK
FT                   DGTEVALATLGLRSHVFATNQEKLMNRTTNDLINTQLTKVDLKLKALDTMEKSLELERK
FT                   AVHRKQEDVFIQRLSFTKYANSLMGKFESLLKQIPESPEIKQQLHELRTIIADPPKTSI
FT                   TSQSGNLQDSDDLDSANKPISIESPQLYRYWSG"
FT   gene            <583793..>584659
FT                   /locus_tag="KLLA0_A06446g"
FT                   /old_locus_tag="KLLA-ORF10483"
FT   CDS_pept        583793..584659
FT                   /locus_tag="KLLA0_A06446g"
FT                   /old_locus_tag="KLLA-ORF10483"
FT                   /product="KLLA0A06446p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ2"
FT                   /protein_id="CAH02875.1"
FT                   /translation="MSDTDNMSEGISSCQGNTEQRASGTQYGSATGSNNKKLFNNYSIK
FT                   EVTDEYSSSITRYLKDNIFSPFPCEKAKYDVHIREVKTKDFLEKWLFDIYKYFTYCGYE
FT                   DKFDFSNTTLFDGINSDQVAWWQDVYERVVSLPENPEWLEAHREKFREDYADIPTIAMD
FT                   YIHKKYNPYLLEHRVKFFEVNPRYKVKGLIKTLTDLVEAFKKCNLPHLDTILADKVYRH
FT                   IMIYHGFDSIHPISKPPTNQTTEIILELKKELRFSKMTKQKRTLENTDRRIDDRNKSFK
FT                   QRNKFWD"
FT   mobile_element  584843..585278
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLLA0_A06457t"
FT                   /old_locus_tag="Klla0A.retrotransposon.2"
FT   gene            <586957..>587778
FT                   /locus_tag="KLLA0_A06468g"
FT                   /old_locus_tag="KLLA-ORF10480"
FT   CDS_pept        586957..587778
FT                   /locus_tag="KLLA0_A06468g"
FT                   /old_locus_tag="KLLA-ORF10480"
FT                   /product="KLLA0A06468p"
FT                   /note="similar to uniprot|P39005 Saccharomyces cerevisiae
FT                   YJL174W KRE9 Glycoprotein involved in cell wall beta-
FT                   glucan assembly null mutation leads to severe growth
FT                   defects aberrant multibudded morphology and mating defects"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02876"
FT                   /db_xref="GOA:Q6CXQ1"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ1"
FT                   /protein_id="CAH02876.1"
FT                   /translation="MLMLIQAFLFVQLFTRLLFVHADVSIVKPTSGASYSPESGSDSID
FT                   IEIVWEESVDLPSISSYDYFTFSLLYGPGTDMDLIDKVEEVAASNITLSESQYSYTPSF
FT                   SIADAGNGQFFIQVYAYSKELGYTIHYSPRFKITSISGGATTYTYTTDSDAVPTPEWSL
FT                   ANSGIDTKSFTVPYTQQTGIRRYAPMQTQPGTAITVTTWSRRYATSAVTYYTSLRNSLE
FT                   QMTTYTPGWSYSRTSDYNYATPAPFPSDNGGWYDPTDRQTLTTRKLNNKRR"
FT   gene            complement(<588024..>588374)
FT                   /locus_tag="KLLA0_A06490g"
FT   CDS_pept        complement(588024..588374)
FT                   /locus_tag="KLLA0_A06490g"
FT                   /product="KLLA0A06490p"
FT                   /note="similar to uniprot|P26755 Saccharomyces cerevisiae
FT                   YJL173C RFA3 Subunit of heterotrimeric Replication Factor A
FT                   (RF-A) which is a highly conserved single-stranded DNA
FT                   binding protein involved in DNA replication repair and
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02877"
FT                   /db_xref="GOA:Q6CXQ0"
FT                   /db_xref="InterPro:IPR013970"
FT                   /db_xref="InterPro:IPR016588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXQ0"
FT                   /protein_id="CAH02877.2"
FT                   /translation="MSNQTPRIDPSQISNTQHSVFRIIAKVLDQPQPKELILQSPTTNG
FT                   EMITLSQVKLSQGSNIEVGSWYEFVCRNVDTGDIGLMVLDSVKCELKEGEEISVSGIVA
FT                   LQQLSGKFPDLY"
FT   gene            <589213..>591012
FT                   /locus_tag="KLLA0_A06512g"
FT                   /old_locus_tag="KLLA-ORF10476"
FT   CDS_pept        589213..591012
FT                   /locus_tag="KLLA0_A06512g"
FT                   /old_locus_tag="KLLA-ORF10476"
FT                   /product="KLLA0A06512p"
FT                   /note="similar to uniprot|P27614 Saccharomyces cerevisiae
FT                   YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
FT                   induced under low-nitrogen conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02878"
FT                   /db_xref="GOA:Q6CXP9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP9"
FT                   /protein_id="CAH02878.1"
FT                   /translation="MADEKRDKQPVKGSSSKTLVLLLASLFLAGFGYLLHNQNYDIEQV
FT                   KSLVDQHFSNTFGTSIGKLVVEEENDDDEIDFDSVCLKTEPISPSGESSIEKILNDAEY
FT                   KKLAIEKLSGALQIPTEIQDVNPRPKDNIEYYSEFFKFHKYLEEQYPLVHKHLKKELVN
FT                   EVGLVYTWAGSNADLKPVMFTAHQDVVPVNRDTWGAWKFPPFSGHYDEKTDTIWGRGAI
FT                   DCKNLLLGELAAIEHLLSEGFVPERGVVLSYGFDEESSGVLGAKYLSEFLHDRYGDNGI
FT                   YALVDEGNTVLPLSGNVFVAAPVTAEKGYVDLKITVHGHGGHSSMPADHTTIGIASDLI
FT                   TLLEANPFPYHLTEDNPVYGFLTCAAKHDTRIPPKIKKAIVEAPKSEKQKNLVFRWLNV
FT                   VKPLRDLFRTSQAVDIINGGIKANALPEVTSFLVNHRIDVTSSVKQTIDKDLAHADQVA
FT                   KKYNLGLVRDGEVLIEKTKDGYIEIVSEKSLEPAPSSPTKNSSVWDLFTGTIQDVFGTH
FT                   ILSKKNADLFVTTSMTTGNTDTKYYWALTKNIYRFFPMIVDPKVISIIHSVNEHVEVSN
FT                   HLSIIAFFYEYILNINEYASNDV"
FT   gene            complement(<591225..>592532)
FT                   /locus_tag="KLLA0_A06534g"
FT                   /old_locus_tag="KLLA-ORF10474"
FT   CDS_pept        complement(591225..592532)
FT                   /locus_tag="KLLA0_A06534g"
FT                   /old_locus_tag="KLLA-ORF10474"
FT                   /product="KLLA0A06534p"
FT                   /note="similar to uniprot|P06783 Saccharomyces cerevisiae
FT                   YKL178C STE3 Cell surface a factor receptor transcribed in
FT                   alpha cells and required for mating by alpha cells couples
FT                   to MAP kinase cascade to mediate pheromone response ligand
FT                   bound receptors undergo endocytosis and recycling to the
FT                   plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02879"
FT                   /db_xref="GOA:Q6CXP8"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP8"
FT                   /protein_id="CAH02879.1"
FT                   /translation="MGYSQSIIALSVIAFVVLLPPLAWHSYTRNTPAIILIVWLLLMNL
FT                   KAIVDAGIWGGADYQQKWFGYGWCDVMTKLQIGANVGVSCAVANIAFNLHRILKANKEI
FT                   PDNRSWKKIRVDLAISLVSPIVIMSLIYLVQVFRFGIFRYNGCQSMLSPTWVTTVLYTV
FT                   WMLVWSLIGFIYASLLLFVFYKKRKDVRDILHCTNSGLNISRFSRLLIFCMVIILIMFP
FT                   FSMYSFVSDLKNVSPTYRHYSFKETHNSALWNVILHFDPGQPLYSVWLYIVMSYLVFLI
FT                   FGLGSDALNMYANFLRTIGLGVVIDSITDWRIKHKDTRVGKITEKILPNNPQQQDNYAQ
FT                   FYCGSSSDGVVTMSDYSEKMDSPSSPSQFEIDYTLPHERNMKNYDPHNQYEIDPKLSIF
FT                   SHSISHDSDASSELDTPNAMGNESNQLQYHYRLDRR"
FT   gene            complement(<593187..>594386)
FT                   /locus_tag="KLLA0_A06556g"
FT                   /old_locus_tag="KLLA-ORF10473"
FT   CDS_pept        complement(593187..594386)
FT                   /locus_tag="KLLA0_A06556g"
FT                   /old_locus_tag="KLLA-ORF10473"
FT                   /product="KLLA0A06556p"
FT                   /note="similar to uniprot|P46992 Saccharomyces cerevisiae
FT                   YJL171C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02880"
FT                   /db_xref="GOA:Q6CXP7"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP7"
FT                   /protein_id="CAH02880.1"
FT                   /translation="MVQALDILASLFAVATVAAQSSNQVQSYNLIEFGNVGFTGSYTNV
FT                   KKISDAEEDSCSCTVGDRVWFSGDNAPLNEALSVHLRGPLSLSKFAFYTSPSFDINDSS
FT                   STSWSREAYYDSTSQTAENVTFLTGAGDSSPCLGKALTFASENGTGKADDSTILESNNL
FT                   LASDEEVIIFSNVSCPKSGYDKGCGVYRSGIPAYYGFEGDTKMFLFEFTMPTATEKNSS
FT                   SIDYYDMPAIWLLNDHIPRTAQYPSSSSSNCSCWASGCGEFDIFEVMNGTEKNHLYSTF
FT                   HTFQGIEDLGTGIQAGGYIARDTSATMKGGVLFDSSGNTVVFMSNDTVFDSSIDYDTIN
FT                   TLISNIDDDETYSTELATISATAPTSTSKSGAAIMIKPSAGTIRYLLLSALMSVFNLMV
FT                   "
FT   gene            complement(<594872..>595564)
FT                   /locus_tag="KLLA0_A06578g"
FT                   /old_locus_tag="KLLA-ORF10472"
FT   CDS_pept        complement(594872..595564)
FT                   /locus_tag="KLLA0_A06578g"
FT                   /old_locus_tag="KLLA-ORF10472"
FT                   /product="KLLA0A06578p"
FT                   /note="similar to uniprot|P46993 Saccharomyces cerevisiae
FT                   YJL170C ASG7 Protein that regulates signaling from a G
FT                   protein beta subunit Ste4p and its relocalization within
FT                   the cell specific to a-cells and induced by alpha-factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02881"
FT                   /db_xref="GOA:Q6CXP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP6"
FT                   /protein_id="CAH02881.1"
FT                   /translation="MSTFGSTFYDSVAKNYICECGSCKIGKNVEFYMVRFFIMGFVLPV
FT                   LWILNLMLYLYANWIIDHNVRVPELDSETLYTEYECQQWKQRSVTSLNKSITKDFYAIN
FT                   NPLTFSMLTLKLPDPVPLTTYQHLSLPDPTKGSDEKNQFSESATTLDEGATDSSSFETE
FT                   DGGTKSIVTAQCLKEIASELMKNHDVNARTIRNWFLRSLCAMTGYTISIIMIVVIVKTN
FT                   SQPASYRE"
FT   gene            complement(<596010..>598118)
FT                   /locus_tag="KLLA0_A06600g"
FT                   /old_locus_tag="KLLA-ORF10469"
FT   CDS_pept        complement(596010..598118)
FT                   /locus_tag="KLLA0_A06600g"
FT                   /old_locus_tag="KLLA-ORF10469"
FT                   /product="KLLA0A06600p"
FT                   /note="similar to uniprot|P46995 Saccharomyces cerevisiae
FT                   YJL168C SET2 Histone methyltransferase with a role in
FT                   transcriptional elongation methylates a lysine residue of
FT                   histone H3 associates with the C-terminal domain of Rpo21p
FT                   histone methylation activity is regulated by
FT                   phosphorylation status of Rpo21p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02882"
FT                   /db_xref="GOA:Q6CXP5"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR013257"
FT                   /db_xref="InterPro:IPR025788"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR038190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXP5"
FT                   /protein_id="CAH02882.1"
FT                   /translation="MTESGNGIVNTRQPKLFLDVPDMTSEAKKTYAELDVCTYTPKNLG
FT                   DSKHEFMECDCFEEFRDGLNHACGEDSDCINRATLIECVNGLCKHSCGTDCQNQRFQKK
FT                   AYADISVFKTERKGFGVRANSDIEPHNFIYEYIGEVIQEEEFRNRMVKYDQMGFKHFYF
FT                   MMLQTGQFIDATLKGCIARFCNHSCNPNAYVNKWVVNGKLKMGIFANRHISKGEEVTFD
FT                   YNVDRYGANAQPCYCEEPNCIGFLGGKTQTDAASLLPQSFADALGIRPSMEKKWINMMK
FT                   AKGEKIAKSDTTTVNVDFVNSLSLEPCTKTEDVNRVMSVLLQIDDAFIAEKLLERITLT
FT                   EDEAMHYQFIKLHGYLIFSRLITMFEDKPDIIWKILNFLLVLPKTTKNGIIHSGIDKKV
FT                   EQLKNTPKFEVICEDLLEKWSKYETYTRISKKDISENSKVIDLRRIRLPIGWEIIHENG
FT                   RPVYYNAQRQIKQANPPTDSAYRSNSSHNLSGVSDPKSRSATPSSNTSRYSGSVKYIPT
FT                   PTYGQMQQKRTLSPEEYEKRKKSRIEWEQKELELRKLMEQETLKAKLDQETQKKSELER
FT                   IIEEANKQKELERLQKLKQQQEDEERKKVKKQASHVNAIENKWVKFFAQHVPNLIKNYQ
FT                   KDVGKDVLKESARNIVKSLAQKELKKDSSRSPPEELSKEKRAKVKTFSMQYMDRLVAKM
FT                   KEKKEKKR"
FT   gene            complement(<598561..>600705)
FT                   /locus_tag="KLLA0_A06622g"
FT                   /old_locus_tag="KLLA-ORF10465"
FT   CDS_pept        complement(598561..600705)
FT                   /locus_tag="KLLA0_A06622g"
FT                   /old_locus_tag="KLLA-ORF10465"
FT                   /product="KLLA0A06622p"
FT                   /note="similar to uniprot|Q757Y7 Ashbya gossypii AEL127C
FT                   AEL127Cp and weakly similar to YKL176C uniprot|P34239
FT                   Saccharomyces cerevisiae YKL176C LST4 Protein possibly
FT                   involved in a post-Golgi secretory pathway required for the
FT                   transport of nitrogen-regulated amino acid permease Gap1p
FT                   from the Golgi to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02883"
FT                   /db_xref="GOA:Q6CXP4"
FT                   /db_xref="InterPro:IPR037545"
FT                   /db_xref="InterPro:IPR041153"
FT                   /db_xref="PDB:4ZY8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXP4"
FT                   /protein_id="CAH02883.1"
FT                   /translation="MLGRLLRTSSLSEFVPFGSSNVTVGEEVFQNEPFYMTDDLKTLLY
FT                   GTRDKALFERIANDRLHNGGFRLIISQELGHVTSRNNYQVVLDHSSVNFHTGAHIPLNE
FT                   LKDYIFGSSIRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDDVLP
FT                   VLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHDWKARNCIEVAAVLQTFQRKIIPLL
FT                   SGYSDTPRLFLYPMDSIPYIKTWVKYVTNWIELKDGPRVRFLPILLAKLRYDFASLLKE
FT                   NSNTRIVILTGNMNVANRLIFILTAFLGPHFRGTLHKSINSQGCPSPAGRKMSNMSGAS
FT                   DFPFELKPSNSSITETNKGWEIPRIKRDPTFSVTSVSSDETGVQTFIQPSSLKSGASSV
FT                   QYLSSSLNSAYGSYGSWFKKVAQSPSSRSNESSHEVPPILHRNSSSTSFHQQAVLGNIN
FT                   GSQRVTPQPSPTIAEYEEYPWFSPSPIARDQPRPEKRIPTPISSYTTEKERRTHLQSEI
FT                   YDVDMKRTVNRLIDEDSLNDAFADLVIDPPSYDTTVSNEKHGEIVEVNMASPRKQRNNQ
FT                   NQELLRRFTSYTPHYNQWFQLQACQITTESENKVIHSMKRDLTYADQDPCKKDKSTSTL
FT                   LISLRSREIKQVTIVRDTNNRFIQRTKKILQNGKVGPVSRAMLSGIETTDQHLKKLMEC
FT                   NNDNEALVSLFNDIVTCAST"
FT   gene            <601527..>602948
FT                   /locus_tag="KLLA0_A06644g"
FT                   /old_locus_tag="KLLA-ORF10463"
FT   CDS_pept        601527..602948
FT                   /locus_tag="KLLA0_A06644g"
FT                   /old_locus_tag="KLLA-ORF10463"
FT                   /product="KLLA0A06644p"
FT                   /note="similar to uniprot|P34240 Saccharomyces cerevisiae
FT                   YKL175W ZRT3 Vacuolar membrane zinc transporter transports
FT                   zinc from storage in the vacuole to the cytoplasm when
FT                   needed transcription is induced under conditions of zinc
FT                   deficiency"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02884"
FT                   /db_xref="GOA:Q6CXP3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP3"
FT                   /protein_id="CAH02884.1"
FT                   /translation="MLGTEHLPKWLLYSATSSFLCILGSFMVPIVYASFSSHREVNTKL
FT                   LNYGLSLSAGSMLCTSLLKMLGSTEQANSAIVFVGFSAGCLISFILNYIVHSYTSQSLI
FT                   HCAHSDEGGELISDNFDDSHLYDMQTHAHRLSHSHSHGHSNNYGFGASEVENDIPDPQH
FT                   THSHHHEMLPEHEEETTPLINHSEHEPVICATVKPKPSTSLSEYHNANDCIPVVRSATI
FT                   SSLPLAKCGSETKPPALCIEPNIGYDLENLAIYREQFMSKGDSTMDSLSDHGTVLHEND
FT                   HRHVMETPFSKLLSIGIQTCMVICLHKFPEGFIIFYTNPPDKVSDGKPDIGFSIFLSLA
FT                   VHNFIEGFAMTLPLFTALETKWHALLITVILGGGSQPLGALLGLEWYKHSSPDHSPEYA
FT                   TEKMDFLLSITSGFLFVISLQMFQTAVAFSDTHHHHEGEDNSTIREHHSAGTTCLKFCC
FT                   VGVLLILASSALQTL"
FT   gene            complement(<603169..>604851)
FT                   /locus_tag="KLLA0_A06666g"
FT                   /old_locus_tag="KLLA-ORF10461"
FT   CDS_pept        complement(603169..604851)
FT                   /locus_tag="KLLA0_A06666g"
FT                   /old_locus_tag="KLLA-ORF10461"
FT                   /product="KLLA0A06666p"
FT                   /note="similar to uniprot|P36029 Saccharomyces cerevisiae
FT                   YKL174C TPO5 Protein involved in excretion of putrescine
FT                   and spermidine putative polyamine transporter in the Golgi
FT                   or post-Golgi vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02885"
FT                   /db_xref="GOA:Q6CXP2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP2"
FT                   /protein_id="CAH02885.1"
FT                   /translation="MSPRKDRHFAKTDAERVLGNKKGELTKGSHRAELHFEMPEYIWLS
FT                   NLNGNIHIPERLLSLLNEEDQDIPDEVKEFTYVQQLDKNLLSRTSVIGLGFGLMSPVLG
FT                   MSTTMSIGLLNGGSPSIIFGYLICGIMTWISSLSLSEIVSKYPIELHGAAAMLAPGRLR
FT                   LRMSWYCGWLMLFGSWTMSTSITFAGAQLIISLLTMTNESLIDSRWLTLWTVLMFYLIV
FT                   TVVGVINLKFSSFIETINKVCVYWILYAILFTSTLLLLFQPNHRSFKDVFTKFDNSLSG
FT                   YSSMALSFLIGGFQQSNFTFQGFAMLSALSDETEKPEKDIPYSMTRSVIISLVSGLFFL
FT                   IPMMLILPDVSEVMNHEGVMPIVLIFTKSTKSLFVSIFLVLLILGNLLFSGIGSVTTSS
FT                   RALYSLSRDRGIPYHHLWTYVDPASESKVPKYSVMLSMGVSYVLALLALISTAAFNAFV
FT                   GCAVLCLCSASMLPILLSLYHRRKLVKGSAFRIKYRLGYITNCLTVIWLLFTMVIISLP
FT                   QKVPVTFRSMNYSSVVYFLFMIMVTVLYDRWGIYNFRAPLVGE"
FT   gene            <605011..>607812
FT                   /locus_tag="KLLA0_A06688g"
FT                   /old_locus_tag="KLLA-ORF10459"
FT   CDS_pept        605011..607812
FT                   /locus_tag="KLLA0_A06688g"
FT                   /old_locus_tag="KLLA-ORF10459"
FT                   /product="KLLA0A06688p"
FT                   /note="similar to uniprot|P36048 Saccharomyces cerevisiae
FT                   YKL173W SNU114 involved in splicing U5 snRNP-specific
FT                   protein related to EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02886"
FT                   /db_xref="GOA:Q6CXP1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP1"
FT                   /protein_id="CAH02886.1"
FT                   /translation="MDEDLYDEFGNFIGDPMQLIDSDDDSLEEVGEQEAQHELRQKIVE
FT                   ADSTDVVLRDVNRDFDDDVEVLLEVEDREPEKPLIGDDSKSYSEAVNRKVPKALFDRGY
FT                   LKSLFSIPERQLNVGIFGALHCGKTSFTDMFALDTHRNLPSLTKKVKEGWVPFRYLDQA
FT                   RIEKERGISLRLNGMSFAYESSRGRTYAVTMLDTPGHVNFWDDVGIALTACQYGVIIVD
FT                   VIEGITSVVSKLIRELISNGIPFIIVLNKIDRLILDLRLPPTDAYSKLQYIVNEINTYT
FT                   KERFSPELGNVLFASTKFGFLFSVESFVNSFYAKSLKDKTEQFAAQLWGQINYREGAFY
FT                   QTEFITDNIAFIQFILQPLYKVFTHTLSASEEELRTVIETNFQIRLSDEILSKDPQPLL
FT                   FSVFHAILPHYHCFIDAIVSTQDHKINNLSSDESTVVHVLRHMSLEGSKWSLCRIIEGS
FT                   VKKGNKLYIFNESVDSVVDFGDDEYSKVTIERVALMGGRYVYELEEAIKGQIVLLKGFE
FT                   DQYTKYATLSSSLMNPLAPINYLNESVFKFAIQPQKPSELPRLLNGLQQANELYPALVV
FT                   RVEESGENIIIGTGELYLDCVMDELRKKFCEIEIKVSQPLVQFTESCQNESFASIPVKS
FT                   NNGVVSLSVMAEKLDGKIVHDLTHGEIDSSELNNMRKFSKRLRTEYGWDSLAARNCWDL
FT                   SKCNVFIDDTLPDETDKQLLKKYKENILQGFEWAVKEGPLADETIHACQFKLLQFKVQE
FT                   DSIEDIIPSQLVPMTRKACYIALMSATPIIMEPIYEVDIIVSGVLESVIQNLLKRRRGG
FT                   RIYKTEKIVASPFIEIKAQLPVIESIGFETDLRVATAGSGMCQMHFWNKIWRKVPGDVL
FT                   DEEAFIPKLKPAPAASLSRDFVMKTRRRKGLSESGHMTQDGPSLKKYIDQDLFKKLQQK
FT                   RFV"
FT   gene            <608103..>609374
FT                   /locus_tag="KLLA0_A06710g"
FT                   /old_locus_tag="KLLA-ORF10456"
FT   CDS_pept        608103..609374
FT                   /locus_tag="KLLA0_A06710g"
FT                   /old_locus_tag="KLLA-ORF10456"
FT                   /product="KLLA0A06710p"
FT                   /note="similar to uniprot|P36049 Saccharomyces cerevisiae
FT                   YKL172W EBP2 Essential protein required for the maturation
FT                   of 25S rRNA and 60S ribosomal subunit assembly localizes to
FT                   the nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02887"
FT                   /db_xref="GOA:Q6CXP0"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXP0"
FT                   /protein_id="CAH02887.1"
FT                   /translation="MVKGFKLKELLHRRKAIDQSEQKVTSKKTKQPSPSNAQDEEPVIV
FT                   TKDDLRADEDVEPEVESEDEEEGVTGEYESHALSRKEKRKLKKLSKKQQAEEPSKKGEE
FT                   EEEEEQEEEQEEEEEEESDNESDEEDRLDLEKLANSDSDSDSDEEEEEEEEEEEEEEEE
FT                   KEEEEEEDVPLSDVEIDEDADVVPYQKTTINNVKAMKDALERIQKPWEKHSFQEHQSVT
FT                   SQLNTDEKIKDIYDDTERELAFYKQSLDAVTIAREKLKKLKVPFKRPLDYFAEMVKSDE
FT                   HMDRLKGKLIKEASEKKARQEARRQRDLKKFGKQVQVATLQQRQKDKRETLDKIKDLKK
FT                   KRKHNEIGGDDFDIGVEDAAQSEKKHKPNFKREAKNSKYGSGGLKRYKRKNDAQSSAEM
FT                   PEFSQRKMKGKAPRPGKSKRSRRH"
FT   gene            <609710..>610759
FT                   /locus_tag="KLLA0_A06732g"
FT                   /old_locus_tag="KLLA-ORF10452"
FT   CDS_pept        609710..610759
FT                   /locus_tag="KLLA0_A06732g"
FT                   /old_locus_tag="KLLA-ORF10452"
FT                   /product="KLLA0A06732p"
FT                   /note="highly similar to uniprot|P08524 Saccharomyces
FT                   cerevisiae YJL167w ERG20 farnesyl-pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02888"
FT                   /db_xref="GOA:P49349"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="InterPro:IPR039702"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49349"
FT                   /protein_id="CAH02888.1"
FT                   /translation="MSDNRAQFLEVFPSLVQELRDILAGYGMPEEAIEWYEKSLNYNTP
FT                   GGKLNRGLSVVDTYALLKGYKSVSELSAEEYKKVAILGWCIELLQAYFLVADDMMDQSI
FT                   TRRGQPCWYKVENVGDIAINDAFMLEGAIYCLLKKHFRTEPYYVDLLELFHDVTFQTEL
FT                   GQLLDLITAPEDKVDLSKFSLEKHSFIVIFKTAYYSFYLAVALAMFAAGITDSKDLKQA
FT                   SDVLIPLGEYFQIQDDFLDCFGKPEDIGKIGTDIQDNKCSWVINVALKNATKEQRDILD
FT                   ENYGRKDSEKEQKCRAVFNELNIQDIYHKYEEETASNLREKIANIDESRGFKAEVLTLF
FT                   LNKIYHRKK"
FT   gene            <611055..>611339
FT                   /locus_tag="KLLA0_A06754g"
FT                   /old_locus_tag="KLLA-ORF10450"
FT   CDS_pept        611055..611339
FT                   /locus_tag="KLLA0_A06754g"
FT                   /old_locus_tag="KLLA-ORF10450"
FT                   /product="KLLA0A06754p"
FT                   /note="highly similar to uniprot|P08525 Saccharomyces
FT                   cerevisiae YJL166W QCR8 Ubiquinol cytochrome-c reductase
FT                   subunit 8"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02889"
FT                   /db_xref="GOA:P49346"
FT                   /db_xref="InterPro:IPR004205"
FT                   /db_xref="InterPro:IPR036642"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49346"
FT                   /protein_id="CAH02889.1"
FT                   /translation="MGGPHAKAYMGWWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNAV
FT                   FNTFRRVKSQILYMALPAALYWAWWVNCRDYNAYLYTKAGREELERVNV"
FT   gene            <612115..>614517
FT                   /locus_tag="KLLA0_A06776g"
FT                   /old_locus_tag="KLLA-ORF10448"
FT   CDS_pept        612115..614517
FT                   /locus_tag="KLLA0_A06776g"
FT                   /old_locus_tag="KLLA-ORF10448"
FT                   /product="KLLA0A06776p"
FT                   /note="similar to uniprot|Q757Y0 Ashbya gossypii AEL120W
FT                   AEL120Wp and some similarites with YKL171W uniprot|P36003
FT                   Saccharomyces cerevisiae YKL171W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02890"
FT                   /db_xref="GOA:Q6CXN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN7"
FT                   /protein_id="CAH02890.1"
FT                   /translation="MSSSYNVGSGMKRSNTPTLYERDFPSEVVSVGSLQSLTQREDNER
FT                   DSFKLRHKNDSYNHAVNFNIGSSRTSESYQESSDYEEQLSFKPRRMRKGDTNSTLTNTN
FT                   LSNNDNDNSTNNSNSRLTRVYSETEKANFHDVTGVRMYDDMKYRPMHFQNNSNDSDDRV
FT                   SIAQDPIPIDIEPKPDVGGYRQARHQHVIRRRFSSGESPLRSPYFNERYNQGLPLFNDM
FT                   QDEYIPDFDFAEAVSQWQSSDDTNMLSRFNTWEPDYLGKPQKESVLKLDDLHSQVAPIP
FT                   LPNVKNEQQPQIPIARPSSSSLFSASSLRTPPAQIEISEHDLDRIMRSIPSDFINMPFS
FT                   QRKKIIQDLSPNHDYKTIMNILKREKLSHSGSTHNVRSRHGSVASKYLNSFTPGSSSFK
FT                   RDDKGSFILGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKFKDNRSVKR
FT                   QVLREISIWSKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSWGECGNSKIS
FT                   LRERCQATSALALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDWKLVLCDFGMS
FT                   HFYGHFKDQMENESIQLKSLFDGSTLHLKRRPSIPRSSSSTNNSSLRLKSRLRQIVNDK
FT                   KLIHDDTTLGIHSVPKSTRSNLTSSLNQKTDITLTPNKDLHEHINDDMSRIGSLPYAAP
FT                   ELLEPNPPPIGPSADIWAIGVLIFTMLTGKLPFKHEYEPRLRAIITSGKYDKTTLRQVC
FT                   NCDMNSNLGVDDQVEFQGLFNAVKGCLTKDLTRRWELDMVKVALGKH"
FT   gene            <614979..>615395
FT                   /locus_tag="KLLA0_A06798g"
FT                   /old_locus_tag="KLLA-ORF10445"
FT   CDS_pept        614979..615395
FT                   /locus_tag="KLLA0_A06798g"
FT                   /old_locus_tag="KLLA-ORF10445"
FT                   /product="KLLA0A06798p"
FT                   /note="highly similar to uniprot|P35996 Saccharomyces
FT                   cerevisiae YKL170W MRPL38 Mitochondrial ribosomal protein
FT                   of the large subunit appears as two protein spots (YmL34
FT                   and YmL38) on two-dimensional SDS gels"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02891"
FT                   /db_xref="GOA:Q6CXN6"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN6"
FT                   /protein_id="CAH02891.1"
FT                   /translation="MIYLKSFLKVIDNSGAQIAECIKVLGKGSPKSPGRIGDKIVCVVK
FT                   KAKPLTQTITGQSNNNRVKKGDIVHAVVVRTKQRNMIRPDGSTIAFGDNACVLINKNNG
FT                   EPLGSRIMGNDGVVGRELREKGYNKICSLASKVL"
FT   gene            complement(<615686..>618004)
FT                   /locus_tag="KLLA0_A06820g"
FT                   /old_locus_tag="KLLA-ORF10443"
FT   CDS_pept        complement(615686..618004)
FT                   /locus_tag="KLLA0_A06820g"
FT                   /old_locus_tag="KLLA-ORF10443"
FT                   /product="KLLA0A06820p"
FT                   /note="weakly similar to uniprot|P38970 Saccharomyces
FT                   cerevisiae YJL165C HAL5 Putative protein kinase
FT                   overexpression increases sodium and lithium tolerance
FT                   whereas gene disruption increases cation and low pH
FT                   sensitivity and impairs potassium uptake suggesting a role
FT                   in regulation of Trk1p and/or Trk2p transporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02892"
FT                   /db_xref="GOA:Q6CXN5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXN5"
FT                   /protein_id="CAH02892.1"
FT                   /translation="MASSNVDSSEPRISRESSLKRSLSISKSLKGLFKSGGGNANTGPT
FT                   TAAAAAAPSSISTPEVPTLATKDKQDRLKNLAANKEKELQTSRRGVASPSLSPTRHVSL
FT                   SNLAKLSLTSRAGTGQVDPNVIHETSPLASDEESTDLAFGKRQSSSNRSSSFSNEEQEP
FT                   NNKYPLLEKLMGDLDEMVCGSIDTQLSKSPDTVEASSLRRSRSTQRKRLNSFSLRPRAL
FT                   SNPGQNPNHPVENRERSNTSSIDLLMSHESESRAIYKSDQFSVYPDGHHAHHLKVVPIV
FT                   HDLEQSLNKPKSSFSFSGFFKTHRTIADDGENLATALSLLPANRFSFHKRLSQIIDEEN
FT                   GNHNADEELEHNGNNGVDSDSDADYDNQSSGNSNPSDDESESDEDGYKGPNKSANVPKI
FT                   VNEKSVIGANELKLINQLTEKIDNGFCLKGSKSDAVSSNEPSSAPRKQHLCEKYGKSIG
FT                   IIGQGAYGVVKLCYKFIDPDEPDLKDNTYFHDNKLFYAVKELKPRPDEPPKKFSTRLTS
FT                   EFVIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGDLYSLITRSSK
FT                   SDSVLHPLEADCFMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLKICDFGTSSVFQ
FT                   TAWEKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCVMVLGHYLWKIAI
FT                   KGKDSVYDAFLEDMEKHGQYYVFDEMKHVSPGMNRYRTAALYHIFQVDPNKRITVDSLL
FT                   KSSWMKRTKCCVTYPPRPV"
FT   gene            complement(<618848..>620818)
FT                   /locus_tag="KLLA0_A06842g"
FT                   /old_locus_tag="KLLA-ORF10440"
FT   CDS_pept        complement(618848..620818)
FT                   /locus_tag="KLLA0_A06842g"
FT                   /old_locus_tag="KLLA-ORF10440"
FT                   /product="KLLA0A06842p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02893"
FT                   /db_xref="GOA:Q6CXN4"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN4"
FT                   /protein_id="CAH02893.1"
FT                   /translation="MTVRSIAVRHTGSFVDFLHIYKYSLLKQYVFVPIGVILIMMILYG
FT                   VNILIKDVIGIKFPASVAVMLVNFCFLCVLSMINENLTQKIVGVIDVPLSWALRWMNLF
FT                   FTPAFVTLPLSPWISFREAMLIAASFVFMYIITGFCLAYVTIFGQKLFALATGHLGRSN
FT                   GRKRTSLLGSKEDILRDAENGYSSADEDATEEESTLDINEDDDDIHSFADIFSDPDVED
FT                   FQLVNVASNSGFPLQRTRTNLTHHLAMGDTANLDADILRGSEIGLPNDKGLGITQNVQD
FT                   IYDEDNTHGSDSTAETNQLLLQPALIHSRNNAAMVPMASKRFCGSTSHDQFSDRNREVE
FT                   CERAITRQFSHRMEHLFTVNMWHDHLHHVLYGLGFFATIFTYYFSWYIMPFQLFTAICM
FT                   FFIVTDAPLLPNPKYKKFLHPVICSVALFWIVELISSLIKHRQIKYFLSDLREYKVGTT
FT                   YLTLFTNTSVSGPNKNWPGAGDIFSSCMDVSIVALSMPMYTYRSDLKKHFVVLLIPTIS
FT                   LCAATLMLNPFICYNIGISSYNSIGFIGRSITLALGMPVIENFEGSVTVMAVITVLSGI
FT                   VGALSGGPMLDFFRVPRDDFVTRGLTLGCNCGAIATSYLLTVDRRAAAISSLSFVLYGA
FT                   IMVILSSIGPIKDFVHQIVSL"
FT   gene            <621223..>621295
FT                   /locus_tag="KLLA0_A06864r"
FT   tRNA            621223..621295
FT                   /locus_tag="KLLA0_A06864r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            complement(<621646..>623409)
FT                   /locus_tag="KLLA0_A06886g"
FT                   /old_locus_tag="KLLA-ORF10438"
FT   CDS_pept        complement(621646..623409)
FT                   /locus_tag="KLLA0_A06886g"
FT                   /old_locus_tag="KLLA-ORF10438"
FT                   /product="KLLA0A06886p"
FT                   /note="similar to uniprot|P19145 Saccharomyces cerevisiae
FT                   YKR039W GAP1 General amino acid permease localization to
FT                   the plasma membrane is regulated by nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02894"
FT                   /db_xref="GOA:Q6CXN3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN3"
FT                   /protein_id="CAH02894.1"
FT                   /translation="MSQEKKLDYSIDQETQLESGEFHEQNSYVSQSDASPVEGTRWERF
FT                   RDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGK
FT                   ALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNT
FT                   IYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFI
FT                   FSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANGFKGVCSVFVTAAFSF
FT                   AGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSV
FT                   DAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIF
FT                   GYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIR
FT                   VRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFE
FT                   AYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEKAFIASK
FT                   PFYYRMYKFWC"
FT   gene            <625123..>625195
FT                   /locus_tag="KLLA0_A06908r"
FT   tRNA            625123..625195
FT                   /locus_tag="KLLA0_A06908r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            complement(<625498..>627261)
FT                   /locus_tag="KLLA0_A06930g"
FT                   /old_locus_tag="KLLA-ORF10433"
FT   CDS_pept        complement(625498..627261)
FT                   /locus_tag="KLLA0_A06930g"
FT                   /old_locus_tag="KLLA-ORF10433"
FT                   /product="KLLA0A06930p"
FT                   /note="similar to uniprot|P19145 Saccharomyces cerevisiae
FT                   YKR039W GAP1 General amino acid permease localization to
FT                   the plasma membrane is regulated by nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02895"
FT                   /db_xref="GOA:Q6CXN2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN2"
FT                   /protein_id="CAH02895.1"
FT                   /translation="MTEEKKLDYSIVQETQLEPGEFDELNSYVSQSDTSRVGGTRWERF
FT                   KDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGK
FT                   SLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNT
FT                   VYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFI
FT                   FSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANGFKGVCSVFVTAAFSF
FT                   AGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSV
FT                   DAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIF
FT                   GYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIR
FT                   VRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFE
FT                   AYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEKAFIASK
FT                   PFYYRMYKFWC"
FT   gene            complement(<628173..>630323)
FT                   /locus_tag="KLLA0_A06952g"
FT                   /old_locus_tag="KLLA-ORF10430"
FT   CDS_pept        complement(628173..630323)
FT                   /locus_tag="KLLA0_A06952g"
FT                   /old_locus_tag="KLLA-ORF10430"
FT                   /product="KLLA0A06952p"
FT                   /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
FT                   YDR338C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02896"
FT                   /db_xref="GOA:Q6CXN1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXN1"
FT                   /protein_id="CAH02896.1"
FT                   /translation="MATLFGKTLSQVHPKLRTNGIGIATNHRRISLGFDLVSRDKKNPL
FT                   LRKYLRKRRHRGLRRGLHPDEQGSYHTLDEDFGSSVREPSVYDDLDEVLEDIDEYDEDG
FT                   EPLSRTVSLPSRVSEPSNVSQQNLDWLLEEHERRFSSSQNSENDEDEDLENGTSEQADV
FT                   IAYDDFMHRVRQQLQQDFHDRAYAGGAGGSGAGGPNRRRGSLISVTSRGSVPQVFQDVG
FT                   SMKEEDLSHAKVTANSELKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGRTELAAVSL
FT                   ASMTTNITYAIFEGIATSLDTLCPLAYGSGNYYSVGVHMQRCIMFSFTVFIPFGFIWWW
FT                   SETLLTLVMPHEPELIHMTAKFLRVSILGAPAYIIFESLKRFLQAQGIFDAGIYVLMIC
FT                   APWNMFVSYTLVWNERIGMGFIGAPIAVVLNFWTMVTLLSLYAIYVDGYKCWGGFNSKS
FT                   LKHWKALSELAVPGIVMLEAEDLSYEILTLFSSYFGTPYLAAQSAVSTTAALLYMIPFS
FT                   VGISSSTRIGNFIGCRRPNCAKLSAELGIGSSLFVGLLNCLIINVDKRSIANIYTKDEE
FT                   VIQLMCQLLPLVGIVEIFDSLNAISGSCLRGLGLQYIGSIVNLVVYHLVAIPLGIFLAW
FT                   YMDMKLNGLWIGIGVGMLIIGLVQSYYVIFADWNDVMERAEKRRDHDRDADSDTDSLES
FT                   VSSVEAYSDSESDSESSPLLLR"
FT   gene            complement(<630572..>631459)
FT                   /locus_tag="KLLA0_A06974g"
FT                   /old_locus_tag="KLLA-ORF10427"
FT   CDS_pept        complement(630572..631459)
FT                   /locus_tag="KLLA0_A06974g"
FT                   /old_locus_tag="KLLA-ORF10427"
FT                   /product="KLLA0A06974p"
FT                   /note="similar to uniprot|Q757W2 Ashbya gossypii AEL100W
FT                   YNG2 Chromatin modification-related protein YNG2 and some
FT                   similarities with YHR090C uniprot|P38806 Saccharomyces
FT                   cerevisiae YHR090C YNG2 Yeast homolog of mammalian Ing1
FT                   NuA4 histone acetyltransferase complex component"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02897"
FT                   /db_xref="GOA:Q6CXN0"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXN0"
FT                   /protein_id="CAH02897.1"
FT                   /translation="MSSINERPQDPSSALEQATQDVANLKSEFHHIMDEMQVADKTLVS
FT                   SREQYLREDYVLHKLVKQHGSLTKDPKEGSITETVEKEMKRCGDLQQQKCILANTALYL
FT                   VTKHLSKIKANIESLEEDGLLAPLDDELSDKKAGSVDLGAGIAGLGNGTAGSGSSSGRK
FT                   RPASSSSANGKGQKRKQQKKERSRSHQRAGTVSRDVSPNAGIGRDPTFDALAYNDDLFK
FT                   MNQGGEEDDKQLYCFCQRVSYGEMVACDGPNCKYEWFHYSCVNLTEPPKGQWYCPECRL
FT                   EIANQKLNKKKKKQ"
FT   gene            <631799..>632410
FT                   /locus_tag="KLLA0_A06996g"
FT                   /old_locus_tag="KLLA-ORF10425"
FT   CDS_pept        631799..632410
FT                   /locus_tag="KLLA0_A06996g"
FT                   /old_locus_tag="KLLA-ORF10425"
FT                   /product="KLLA0A06996p"
FT                   /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
FT                   YLR326W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02898"
FT                   /db_xref="GOA:Q6CXM9"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM9"
FT                   /protein_id="CAH02898.1"
FT                   /translation="MVFYSFILRKISNKIFGDIKIGEGEDPYYEEVTFVKKSFWTGNSQ
FT                   VVHKKLKKAIPDYVPLNDRTVLQRVRKRAYRLDMMFKIFGMRVGWLGIIGLLPVVGDLI
FT                   CLYLSWTVFHEAQKIQGGLPVPLQAELLGNICIDFLLGLIPIVGDIVGIAYKANSRNTL
FT                   ALEQYLRKKYGGETIAASPVELGSVSPGRDPDLVKGLKQT"
FT   gene            complement(<632523..>633092)
FT                   /locus_tag="KLLA0_A07018g"
FT                   /old_locus_tag="KLLA-ORF10423"
FT   CDS_pept        complement(632523..633092)
FT                   /locus_tag="KLLA0_A07018g"
FT                   /old_locus_tag="KLLA-ORF10423"
FT                   /product="KLLA0A07018p"
FT                   /note="highly similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02899"
FT                   /db_xref="GOA:Q6CXM8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM8"
FT                   /protein_id="CAH02899.1"
FT                   /translation="MGKAKKTRKFALVKRTLNAKKDSRLKSNQAKEVKKDDPELTKNIP
FT                   QVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMA
FT                   ELEKLGPKYRIALKLARDPRIKRLSCSHKGTYADDCIVHRVLQHKCYIVATNDAGLKQR
FT                   VRKVPGIPLMSVGGHSYVIEKLPGVF"
FT   gene            complement(<633503..>635452)
FT                   /locus_tag="KLLA0_A07040g"
FT                   /old_locus_tag="KLLA-ORF10421"
FT   CDS_pept        complement(633503..635452)
FT                   /locus_tag="KLLA0_A07040g"
FT                   /old_locus_tag="KLLA-ORF10421"
FT                   /product="KLLA0A07040p"
FT                   /note="highly similar to uniprot|Q05506 Saccharomyces
FT                   cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02900"
FT                   /db_xref="GOA:Q6CXM7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM7"
FT                   /protein_id="CAH02900.1"
FT                   /translation="MLRRLSSPVLSSIIRTTKHIIFSERTYTAALSSYRSPHINNTRMS
FT                   SSIVSQLKKLSIEEPTKVAESHPDVNVVDLMRNYITQELAKISDVPAEQIYPALEWTNT
FT                   LERGDLLIPVPRLVRKKGINPKEIAEEWATKFPCGDYLEKVEANGPFVQFFFKPEFLFK
FT                   IVLPDILTRKEKYGSSPLGGNKKILIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEQLG
FT                   WDVTRINYLGDWGKQFGVLAVGFERYGDEEALRNDPINHLFEVYVRINKDIENEGDTLS
FT                   EEESTDGKARSYFKKMEDGDPEALKIWKRFRELSIEKYIKTYARLNIKYDVYSGESQVS
FT                   KEQMDKAMRMFEDKNLTHEDRGATLIDLTKFNKKLGKTIVQKSDGTTLYLTRDVGAAMD
FT                   RYEKYHFDQMIYVIACQQDLHVAQFFEILKQLGFEWANRLQHVNFGMVQGMSTRKGTVV
FT                   FLDNILEETKEKMHEVMRKNETKYAQIENPDEVADLVGISAVMIQDMQAKRINNYEFKW
FT                   ERMTSFEGDTGPYLQYAHSRLRSVERNASDITPDQWVSADFSLLHEPAAVILVRLLAQY
FT                   PDVLRNAIKTHEPSTVVTYLFKLTHQVSSCYDVLWVAGQTPELAAARLALYGAARQVLN
FT                   NGMRLLGLTPVDRM"
FT   gene            complement(<635924..>636275)
FT                   /locus_tag="KLLA0_A07051g"
FT   CDS_pept        complement(join(635924..636086,636166..636275))
FT                   /locus_tag="KLLA0_A07051g"
FT                   /product="KLLA0A07051p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07051g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65220"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI7"
FT                   /protein_id="CAR65220.1"
FT                   /translation="MGVEDRLNRKQQRLAALKVSYQELEKKFQTLAHELHITETPEKIN
FT                   LKHIADLKLYNELRDTGLRLVQMVADEKQCKMKDVFEEIGYEMKD"
FT   gene            complement(<636546..>638291)
FT                   /locus_tag="KLLA0_A07062g"
FT                   /old_locus_tag="KLLA-ORF10419"
FT   CDS_pept        complement(636546..638291)
FT                   /locus_tag="KLLA0_A07062g"
FT                   /old_locus_tag="KLLA-ORF10419"
FT                   /product="KLLA0A07062p"
FT                   /note="highly similar to uniprot|P15705 Saccharomyces
FT                   cerevisiae YOR027W STI1 Heat shock protein also induced by
FT                   canavanine and entry into stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02901"
FT                   /db_xref="GOA:Q6CXM6"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM6"
FT                   /protein_id="CAH02901.1"
FT                   /translation="MSADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRS
FT                   ACYASNKDFVKALDDANECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSA
FT                   NKAAQDGLSQVQQTQQQRTAQPDLGLGNMFKDPMMIEKLKKNPKTAEFMKDPQFVAKIL
FT                   QFQQNPQAMGQEMLSDPRLMTVLAALMGIDLSMDPNESNSIPKEEPAAKEAASATKSEP
FT                   KAEPKAEPKAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEA
FT                   WETHNDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYH
FT                   KLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEARLQGKEY
FT                   FTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVR
FT                   AYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKASQARFEPANAN
FT                   ETPEEAYARATKDPEVASILQDPVMQSILSQAQQNPAALQEHMRNPDVFKKIQTLIAAG
FT                   IIKTR"
FT   gene            <638900..>640483
FT                   /locus_tag="KLLA0_A07084g"
FT                   /old_locus_tag="KLLA-ORF10417"
FT   CDS_pept        638900..640483
FT                   /locus_tag="KLLA0_A07084g"
FT                   /old_locus_tag="KLLA-ORF10417"
FT                   /product="KLLA0A07084p"
FT                   /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
FT                   YDR257C SET7 Nuclear protein that contains a SET-domain
FT                   which have been shown to mediate methyltransferase activity
FT                   in other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02902"
FT                   /db_xref="GOA:Q6CXM5"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM5"
FT                   /protein_id="CAH02902.1"
FT                   /translation="MTATDFERKTDLFLEWLPTVGIKLSKNVKIVDSRDEHQGRSMICI
FT                   NDVKEGEKLFSVPETASLNIITGSLGKLDESYLGILLSKVEHWHGLILTILYEWKYLGE
FT                   KSKWWPYFQVLPDQFDTLIYWDKEDLDKLKPSLVLDRLGEQQSKDMYVKVLELMKTFNV
FT                   ADKIGEVTYDDFQRVASWIMAYSFDKEITAENSEVVGEEDGDEEEVEEEVEITEDNNED
FT                   EDADEDADDSVIENSVNFDGVIKCMIAVADILNSDTNLVNANIIYDKTGLICCATKDIK
FT                   AGEQVYNIYGNHPNSEILRRYGYVEWTGSKYDFGEVTLKNILDSLSEKYNVSTEFLDRV
FT                   VEILREDEKIKEIWDYEDVVLDSYDCYADGETIPEAASTIQILFVLLQSHEVVKLEELA
FT                   LTRLLQRIVKKCQQLLESGRVTESVNSIWQQAVEKRLKMYPQTNPVLSEDRIKETFAKS
FT                   KSDQRQLMASCILECERRCIAKSREGISKQFKLLDDEKLLKNVLKRPVEEEKKKKSRIV
FT                   KRVKKNRNDD"
FT   gene            complement(<640536..>641468)
FT                   /locus_tag="KLLA0_A07106g"
FT                   /old_locus_tag="KLLA-ORF10414"
FT   CDS_pept        complement(640536..641468)
FT                   /locus_tag="KLLA0_A07106g"
FT                   /old_locus_tag="KLLA-ORF10414"
FT                   /product="KLLA0A07106p"
FT                   /note="similar to uniprot|P26449 Saccharomyces cerevisiae
FT                   YOR026W BUB3 Kinetochore checkpoint WD40 repeat protein
FT                   that localizes to kinetochores during prophase and
FT                   metaphase delays anaphase in the presence of unattached
FT                   kinetochores forms complexes with Mad1p-Bub1p and with
FT                   Cdc20p binds Mad2p and Mad3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02903"
FT                   /db_xref="GOA:Q6CXM4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM4"
FT                   /protein_id="CAH02903.1"
FT                   /translation="MNGYAKLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQQ
FT                   LLMKLQHSWPLTSCHVSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSI
FT                   DHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQFPS
FT                   WDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDV
FT                   QMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLV
FT                   IAVSDDSFKTCAVPQDIELHPSAIYIKHL"
FT   gene            <641974..>643551
FT                   /locus_tag="KLLA0_A07128g"
FT                   /old_locus_tag="KLLA-ORF10413"
FT   CDS_pept        641974..643551
FT                   /locus_tag="KLLA0_A07128g"
FT                   /old_locus_tag="KLLA-ORF10413"
FT                   /product="KLLA0A07128p"
FT                   /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
FT                   YDR479C PEX29 Peroxisomal integral membrane protein
FT                   involved in regulation of peroxisome size and number
FT                   genetic interactions suggest that Pex28p and Pex29p act at
FT                   steps upstream of those mediated by Pex30p Pex31p and
FT                   Pex32p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02904"
FT                   /db_xref="GOA:Q6CXM3"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM3"
FT                   /protein_id="CAH02904.1"
FT                   /translation="MDAIWKSTTGRSDTSPSQSTQSLLNDKLVEKIIYMALPASNDLAT
FT                   DTIENRVQAGAGRPGLSVPIMSRNFVQMNSRLGAPFMIIDEIIRIFNWTNAAYTLCIMS
FT                   FYSFLVLKPLPVLVSGPFVYILFGIMSPTYMDIHKPDPHMNLDHNPIPARGPPLKNPQL
FT                   PGPVPEFSKEFILNLTDLQNHMTLYVMAYDFVSNFLAKFAYFKNENVSSAVFLGLLLFS
FT                   CINSLAIDSISSLIPWKFIFLCAGWTFVISLHPKIRDTMFNLMYSEETRLRILTKMNHI
FT                   ERIINDKFDSYEPRERREASIFELQRFNAEEKSWELVGYSTDEYALFSESRMKELSTSQ
FT                   IPNVQTLAEVKPPAEWDWLLNVDWTLDLHPTEWVSAGFIQYVDVDNETKWVYDVELNGE
FT                   RGQYRRRRWVKACIRQKHFTAAVKNGGNSTTKSNEVNETDDEMESVDRNLYNGYASITQ
FT                   TSFSGADKNATKTNDANNDNGIVKSPSTASISSFISQGSTNSVAQQTNSAEKSKAVRSL
FT                   TDLLSLTG"
FT   gene            complement(<643679..>644251)
FT                   /locus_tag="KLLA0_A07150g"
FT                   /old_locus_tag="KLLA-ORF10410"
FT   CDS_pept        complement(643679..644251)
FT                   /locus_tag="KLLA0_A07150g"
FT                   /old_locus_tag="KLLA-ORF10410"
FT                   /product="KLLA0A07150p"
FT                   /note="weakly similar to uniprot|P40993 Saccharomyces
FT                   cerevisiae YDR478W SNM1 Subunit of RNase MRP which cleaves
FT                   pre-rRNA not shared between Rnase MRP and nuclear Rnase P
FT                   in contrast to all other Rnase MRP protein subunits binds
FT                   to the NME1 RNA subunit of Rnase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02905"
FT                   /db_xref="GOA:Q6CXM2"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM2"
FT                   /protein_id="CAH02905.1"
FT                   /translation="MSGRRDREKFMDRTMAHKYNMIHHVQRLGEPQLSGLYLKNFYNTA
FT                   KRYRLPLPESIRADNVKFCGNCGCVRIAGYNLTMKLLRETDENGVVTRNLRYQCGHCQS
FT                   EYNIEVDKTEPKKDASSKEPSPKVDIQWPRQSSPEVNDDKIKKNTTAKERAKKRKQSTL
FT                   SNLLASKKEKEESKKKNVSLSLMDFMK"
FT   gene            complement(<644634..>646013)
FT                   /locus_tag="KLLA0_A07172g"
FT                   /old_locus_tag="KLLA-ORF10408"
FT   CDS_pept        complement(644634..646013)
FT                   /locus_tag="KLLA0_A07172g"
FT                   /old_locus_tag="KLLA-ORF10408"
FT                   /product="KLLA0A07172p"
FT                   /note="similar to uniprot|P53687 Saccharomyces cerevisiae
FT                   YOR025W HST3 Member of the Sir2 family of NAD( )-dependent
FT                   protein deacetylases involved along with Hst4p in telomeric
FT                   silencing cell cycle progression radiation resistance
FT                   genomic stability and short-chain fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02906"
FT                   /db_xref="GOA:Q6CXM1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM1"
FT                   /protein_id="CAH02906.1"
FT                   /translation="MSAIVLSPSKNLKMEENDAGVSSSQESEGCCSQSSRKVTLGSMIQ
FT                   TERVKHLSLSEYRETNENSELISQINRVIHRSRKCAVLTGAGISCNAGIPDFRSFEGLY
FT                   RMVKEQYPDVNIRSGQDMFDISLFREEEKISVFASFMENLYSHTIQAKPTKTHEFIAHL
FT                   KNRGKLLRCYTQNIDGLEEMLGLQMSKSRDADQSFSIQWKNLDVVQLHGDLTTLSCTQC
FT                   FKVFSWSRHWKRCLKNGELPVCPKCLEKNNRRSIEGKRCLGHSGMLRPNIVLYGENHPN
FT                   ADFITQGLNMDINRGKPDLFLIMGTSLKVDGVKRLVKTISKQVHDRGGLVILINKTSIG
FT                   DCNWHGIIDYQIESDCDEWVTELKKHMSDFFLSQQQLEKVRQMKREASELRKRQREEKQ
FT                   LLSQSSQSPTTPPNSPKKRKTATLPNEKSIPKLKKTKSLCMLPSPEEMFSMSPRTTSSV
FT                   S"
FT   gene            complement(<646573..>647548)
FT                   /locus_tag="KLLA0_A07194g"
FT                   /old_locus_tag="Klla0A.mRNA.511.m"
FT   CDS_pept        complement(join(646573..646987,647529..647548))
FT                   /locus_tag="KLLA0_A07194g"
FT                   /old_locus_tag="Klla0A.mRNA.511.m"
FT                   /product="KLLA0A07194p"
FT                   /note="highly similar to uniprot|P07280 Saccharomyces
FT                   cerevisiae YOL121C RPS19A Protein component of the small
FT                   (40S) ribosomal subunit or YNL302C uniprot|P07281
FT                   Saccharomyces cerevisiae YNL302C RPS19B Protein component
FT                   of the small (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02907"
FT                   /db_xref="GOA:Q6CXM0"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="PDB:3J80"
FT                   /db_xref="PDB:3J81"
FT                   /db_xref="PDB:3JAM"
FT                   /db_xref="PDB:3JAP"
FT                   /db_xref="PDB:3JAQ"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="PDB:5IT9"
FT                   /db_xref="PDB:6FYX"
FT                   /db_xref="PDB:6FYY"
FT                   /db_xref="PDB:6GSN"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXM0"
FT                   /protein_id="CAH02907.1"
FT                   /translation="MPGVSVRDVPAQDFINNYASFLQRQGKLEVPGYVDIVKTSAGNEL
FT                   PPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINRKV
FT                   LQSLEKLGVVEISPKGGRRISDNGLRDLDRIAAATLEDEE"
FT   gene            complement(<648431..>649488)
FT                   /locus_tag="KLLA0_A07227g"
FT                   /old_locus_tag="Klla0A.mRNA.508.m"
FT   CDS_pept        complement(join(648431..648879,649377..649488))
FT                   /locus_tag="KLLA0_A07227g"
FT                   /old_locus_tag="Klla0A.mRNA.508.m"
FT                   /product="KLLA0A07227p"
FT                   /note="highly similar to uniprot|P07279 Saccharomyces
FT                   cerevisiae YOL120C RPL18A Protein component of the large
FT                   (60S) ribosomal subunit, identical to Rpl18Bp and has
FT                   similarity to rat L18 ribosomal protein; intron of RPL18A
FT                   pre-mRNA forms stem-loop structures that are a target for
FT                   Rnt1p cleavage leading to degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07227g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02909"
FT                   /db_xref="GOA:Q6CXL8"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL8"
FT                   /protein_id="CAH02909.1"
FT                   /translation="MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARRTDAPFN
FT                   KVILKSLFLSKINRPPVSVSRISRALKQEGAAQKTIVVVGTVTDDNRIFEFPKTTVAAL
FT                   RFTAGAKAKILKAGGEAITLDQLAVRAPKGQNTLIVRGPRASREAARHFGFGPHKGKAP
FT                   RIQSTGRKFERARGRRRSRAFKV"
FT   gene            complement(<649905..>651431)
FT                   /locus_tag="KLLA0_A07249g"
FT                   /old_locus_tag="KLLA-ORF10401"
FT   CDS_pept        complement(649905..651431)
FT                   /locus_tag="KLLA0_A07249g"
FT                   /old_locus_tag="KLLA-ORF10401"
FT                   /product="KLLA0A07249p"
FT                   /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
FT                   YOL119C MCH4 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07249g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02910"
FT                   /db_xref="GOA:Q6CXL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL7"
FT                   /protein_id="CAH02910.1"
FT                   /translation="MNIGNVFNFHLLKPQKLFHKKSSDEISVIKDNGSEFEMQVQGSSA
FT                   YPGDSRTATGYAANIENTTSGDKQVTGPHESTREFAEAEGDPLLLDDHSKFPDGGLKAW
FT                   LVVFGSFIGLIPVFGLVNSIGAIESYISINQLAGVSSPVISWIFSLYLCTTFTSCILAG
FT                   GYFDRNGSRDPMIFGMIMFTGGLIATANCTTVWQFILAFSVVVGFASGILMIPLVSVVA
FT                   TFFIKKRAIATSIATTGGSIGGIVFPILLRKLYTKVGFQWALRILALICAVCLIFATVM
FT                   VKEREKPETEPFKNKKEMIKWYYDSSLNWRYFLEPKYLFATLGASLAESSLTASSTFIA
FT                   SYALVQGNTQTVSYTLITTTNAVGVLGRYIPGYIADRYLGRFNVMIITVFMAAVFNFTM
FT                   WLPFGSSTPVLWAYSMLYGFSTGSILSLTPVCIGQISKTTDFGKRYSTAYFQQALITLP
FT                   VMPICGALIGDRSIEGFNHFIIFVSVLMLCGSICYVISRYLSVGAKFVKF"
FT   gene            complement(<651863..>652408)
FT                   /locus_tag="KLLA0_A07271g"
FT                   /old_locus_tag="KLLA-ORF10399"
FT   CDS_pept        complement(651863..652408)
FT                   /locus_tag="KLLA0_A07271g"
FT                   /old_locus_tag="KLLA-ORF10399"
FT                   /product="KLLA0A07271p"
FT                   /note="highly similar to uniprot|Q75AS4 Ashbya gossypii
FT                   ADL154C ADL154Cp and some similarities with uniprot|P38013
FT                   Saccharomyces cerevisiae YLR109w AHP1 Alkyl hydroperoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07271g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02911"
FT                   /db_xref="GOA:Q6CXL6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL6"
FT                   /protein_id="CAH02911.1"
FT                   /translation="MLSTKLFKPSLTRGFKTFTPTLFKAGDSIPTGLKGLHESSPGNSV
FT                   DLGKEVAHGKYIIVGLPAAFSPACSASHVPGYIAHLKELKEKGVKQVFVTAVNDSFVTQ
FT                   AWAEDLGVPSDIRIIADTLGEFAKAGDHLFDSKQIFGNDRSIRYAVIVQDGKVVKEFAE
FT                   PDKIGVDVSSAENVLKEL"
FT   gene            <652702..>654453
FT                   /locus_tag="KLLA0_A07293g"
FT                   /old_locus_tag="KLLA-ORF10397"
FT   CDS_pept        652702..654453
FT                   /locus_tag="KLLA0_A07293g"
FT                   /old_locus_tag="KLLA-ORF10397"
FT                   /product="KLLA0A07293p"
FT                   /note="weakly similar to uniprot|Q12348 Saccharomyces
FT                   cerevisiae YOL117W RRI2 subunit of COP9 Signalosome (CSN)
FT                   like protein complex that cleaves the ubiquitin-like
FT                   protein Rub1 from Cdc53 COP9 signalosome (CSN) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07293g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02912"
FT                   /db_xref="GOA:Q6CXL5"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR037750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXL5"
FT                   /protein_id="CAH02912.1"
FT                   /translation="MSDEEDYAEYMMSEEDMSSFEMDVDSDVEPDDAGLEQDQQVTGDD
FT                   YDGSAGNSGDSMAAVEKQCESWYDTGKAFKNDDQFEEARKWFMKCHASPIWWFKSLKQI
FT                   IKSDLSQGLRVNERLREMFELVSTKKEMIGEESYIYGSVKRLINRIVPDLNSHLLFTER
FT                   LRQSSIDVSTLMERQRYLDILEKSVADMDQELRDLVTIRKIVYCVWIHVLRWEQIPKET
FT                   LEDLHENVNLETYFILLQLHVRTFVDEDIVHLIELVKVVDEMGRFMTNSLSVSQIPTVT
FT                   SVYHFARFLTLWKSTDHYNQSQMLSKCEGELTSCFQDLEAIGGTERDGLMLTRFSLMGI
FT                   VFCHLLLNDKTKLVPFELEQIKVLEADELVVLLQELYQCWLDMDIYALEQCLLQLEDFY
FT                   SPWYNVMIEKIIALCQSNKLWKRIAPTYSCIALQDLMAKLETGNTITMNRDQLLTLLMK
FT                   SIAKDTADVYYKLDLVEDYVYFGEEYFVPLRSEELNIVNPLSQQMGSEIIGKDEWLCNV
FT                   SNWHKPKVPKKLSAIEFMDYMKAARVTISQTNLAHHEPTVTSFLLKLSTITHAQLTQNS
FT                   SSLASTN"
FT   gene            <655210..>655533
FT                   /locus_tag="KLLA0_A07315g"
FT                   /old_locus_tag="KLLA-ORF10396"
FT   CDS_pept        655210..655533
FT                   /locus_tag="KLLA0_A07315g"
FT                   /old_locus_tag="KLLA-ORF10396"
FT                   /product="KLLA0A07315p"
FT                   /note="similar to uniprot|P48560 Saccharomyces cerevisiae
FT                   YNL300W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07315g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02913"
FT                   /db_xref="GOA:Q6CXL4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXL4"
FT                   /protein_id="CAH02913.1"
FT                   /translation="MQFSTVISALTLSAVAVFAQETVVSDGVTYVDVTETPEVTVSAVS
FT                   TELSTSTPYSTTTLAVATLETYAGDNSTSTEHTVEPYSGAALKQEVLGSSLVGVVALVA
FT                   ALL"
FT   gene            <656187..>657368
FT                   /locus_tag="KLLA0_A07337g"
FT                   /old_locus_tag="KLLA-ORF10395"
FT   CDS_pept        656187..657368
FT                   /locus_tag="KLLA0_A07337g"
FT                   /old_locus_tag="KLLA-ORF10395"
FT                   /product="KLLA0A07337p"
FT                   /note="similar to uniprot|P22148 Saccharomyces cerevisiae
FT                   YOL116W MSN1 Transcriptional activator involved in
FT                   regulation of invertase and glucoamylase expression
FT                   invasive growth and pseudohyphal differentiation iron
FT                   uptake chromium accumulation and response to osmotic stress
FT                   localizes to the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07337g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02914"
FT                   /db_xref="GOA:Q6CXL3"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL3"
FT                   /protein_id="CAH02914.1"
FT                   /translation="MDDSMLQKRVEGLERQISMYERLFQSFSSKLDHHFKKYDVLVSSQ
FT                   QQQINILTEALSTMLNDQYRYSEILRDKLGTALSSVSATHVNIAGLSNQRMQDNQKQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQPLSNVTAFLEDFIAPDVPLSNAV
FT                   PRRAKLGSFQTKQTTALNPTPDQDTGFRPLEVDVPVPSGVAVEDSQQQVQQQQIQNNSG
FT                   SGKRKHRTTNGDGSSSKKINRSLPMPDSTSADGHRQSQEPQASHIADEKYYTSRGQSKK
FT                   RKVYTGNFKFFNSPQSIMDIWKEYTEGFEGQPSIKEMEQMYHVSWRREPAMNKRYHRRR
FT                   VLCKAIERGLEKGFHLDDVLRMLEDARVIDAERGTKHSISWICQFSHIPEILR"
FT   gene            <657936..>659990
FT                   /locus_tag="KLLA0_A07359g"
FT                   /old_locus_tag="KLLA-ORF10392"
FT   CDS_pept        657936..659990
FT                   /locus_tag="KLLA0_A07359g"
FT                   /old_locus_tag="KLLA-ORF10392"
FT                   /product="KLLA0A07359p"
FT                   /note="similar to uniprot|P53632 Saccharomyces cerevisiae
FT                   YOL115W TRF4 DNA polymerase sigma involved in mitotic
FT                   chromsome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07359g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02915"
FT                   /db_xref="GOA:Q6CXL2"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL2"
FT                   /protein_id="CAH02915.1"
FT                   /translation="MSKRPSSGKGVKPNRNRNKPVKQVKKMRKSSLSRAQKNFSVFQQQ
FT                   SHENKYESLQSIRDDGEDAGDEVVFLHDEGKDLNSDDIDEVSVSENDLDLEDEEDEEEG
FT                   EEEEPVGTADGIIGNNSLDANEDFIAFDLSEPEEDEHENGFEEHSEPETAGKEEIEEGE
FT                   GDKLRHNADFPWILNHDHSKQREIADWLTLEIKDFVSYISPNRQEIEQRNQAIAKLKEA
FT                   VVELWPDSSLNCFGSYATDLYLPGSDIDCVVRSASGDKENRNALYSLASFLKRKQLATQ
FT                   VEVIAKARVPIIKFVEPESKIHIDVSFERTNGLEAARVIRGWLEEQPGLRELVLIVKQF
FT                   LHARRLNNVHTGGLGGYSIICLVYTFLKLHPRVLTGDIDPLENLGVLLIDFFELYGKNF
FT                   GYDDVGISVSEHEARYIPKNEHPDLSAGRPRFSLLIQDPGDPSNNISRGSFNLRDIKKG
FT                   FAGAFDLLANRCFELDSATFKDRIGSSILGNVIKYKGTKRDFNDERDLVINEAIQENEK
FT                   YHNKRGRIVHDDLFTDISDIEAEEEIYQVQEPPTKKTKKDKSKEKKERKEKRREKRKKQ
FT                   QLKENTERVQEVEEDNYDPTEAIIVNDEPSEQEDDYDPSKPSVDDYMGLPEENNDENDK
FT                   DTKEEARTPVINLIEDENGASDDSNSDPKMQLVDKQTKRDYWLSKGQAM"
FT   gene            complement(<660082..>660579)
FT                   /locus_tag="KLLA0_A07381g"
FT                   /old_locus_tag="KLLA-ORF10388"
FT   CDS_pept        complement(660082..660579)
FT                   /locus_tag="KLLA0_A07381g"
FT                   /old_locus_tag="KLLA-ORF10388"
FT                   /product="KLLA0A07381p"
FT                   /note="similar to gnl|GLV|CAGL0E02123g Candida glabrata
FT                   CAGL0E02123g and weakly similar to YOL114C uniprot|Q12322
FT                   Saccharomyces cerevisiae YOL114C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07381g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02916"
FT                   /db_xref="GOA:Q6CXL1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL1"
FT                   /protein_id="CAH02916.1"
FT                   /translation="MLTVLKRHYSDAIAVGRAWIEGFKAENVPLKLFVATYDRSRGKGG
FT                   QNVNKVNSKCTLTLYNFSKCSWFPDEIRKQLLDKGFRYYAPSKDALVIQSDETRSREQN
FT                   RDICVEKLVKEVKKLVFFPGETDMSTKRKWNEIKKRSNEVRLSEKKFKSDKKRSRTVKL
FT                   DF"
FT   gene            <661261..>663900
FT                   /locus_tag="KLLA0_A07403g"
FT                   /old_locus_tag="KLLA-ORF10386"
FT   CDS_pept        661261..663900
FT                   /locus_tag="KLLA0_A07403g"
FT                   /old_locus_tag="KLLA-ORF10386"
FT                   /product="KLLA0A07403p"
FT                   /note="similar to uniprot|P48562 Saccharomyces cerevisiae
FT                   YNL298W CLA4 Involved in localizing cell growth with
FT                   respect to the septin ring protein kinase homologous to
FT                   Ste20p interacts with CDC42"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07403g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02917"
FT                   /db_xref="GOA:Q6CXL0"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXL0"
FT                   /protein_id="CAH02917.1"
FT                   /translation="MSLSAAARDYSDADFQNIGPAPKPPMGFNQTQPISNDFNKLDLNR
FT                   NLKQRSLVSTTQKRKSGWISYKDDGILSFIWQKRYMVLSDAYLSLYKTEQTIRETPVMQ
FT                   IPLTSIVSVSRNQLKQNCFEIIRSSSANGSMPMSASQDGSKKSIYISTKTELELHTWLD
FT                   AIFARCPLLSGVSSPTNFTHRVHVGFDPETGSFVGMPSNWEKLLKHSRITGEDWNNNSA
FT                   AVIQVLQFYQEYNGVNQSSASLPPSASSATPSPSTNTLPTIAKNNFHATLQSNGSGGSS
FT                   SGSSTSSFNHNNFNNSSTNVDAARSDHGKNELIPQRKPPSPPSSSSSNVHPNVEISKAS
FT                   PNNHGPKVAQQYVPSPQHTQRKPLASLHNMANPYSRTKAGPTVRQQVSTQPYSYQQQQP
FT                   KQNYQQSLQQQQQQANRQQTPAKYPTDGPNVSPRDQNHKPPSPQNHNQYQHNLKQPQQQ
FT                   QQKQLIQQHTVAIPPRMHPQRIASDRSQNQPKPGMQPLIQVTTSQNKQPSPSQSAAQMA
FT                   MRQHNQHPAGMPKVANAKLQPAREAPRVGDSNQQKTTEVSKKKPSKPAMSNAEIMTNLK
FT                   NVTFNMDPTPFFRMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMIL
FT                   SKQPRKELIVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPT
FT                   GSSGQSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCA
FT                   KLTDKRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPYLNEEPLK
FT                   ALYLIATNGTPKLKHPEYLSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNMSCESQDL
FT                   ISLLEWKN"
FT   gene            complement(<663956..>668764)
FT                   /locus_tag="KLLA0_A07425g"
FT                   /old_locus_tag="KLLA-ORF10385"
FT   CDS_pept        complement(663956..668764)
FT                   /locus_tag="KLLA0_A07425g"
FT                   /old_locus_tag="KLLA-ORF10385"
FT                   /product="KLLA0A07425p"
FT                   /note="similar to uniprot|P48563 Saccharomyces cerevisiae
FT                   YNL297C MON2 Peripheral membrane protein with a role in
FT                   endocytosis and vacuole integrity interacts with Arl1p and
FT                   localizes to the endosome member of the Sec7p family of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07425g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02918"
FT                   /db_xref="GOA:Q6CXK9"
FT                   /db_xref="InterPro:IPR026829"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR032817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK9"
FT                   /protein_id="CAH02918.1"
FT                   /translation="MAAAGSFVALSEQLVRDLQTLASESKRRSSDIKQACEKSIEILQR
FT                   SHSEEELVRHPDFVDPFITACLSGNAKLTSISMQSMQRISGIRCICTSKMESLLNALLK
FT                   STELAIDIQLKVLQLIPILFKTYADVITDRLLAKLFLCCTQLLHQPNRTSILIGTVSAT
FT                   LQQLVNEVFDRCKDADNDDVKGPRPVPISNDKAGVVNKYRYDAHIVLANLSQLNDPHTY
FT                   DDAILDVKNIPEDCGLEILEFLLSNHASSICQFEDLLFLLRTKVVPLLLRIFSTSKSFP
FT                   IVVRTARCANLLISIQFFDKLELESEIMLWLLIHTLSKDSDSPMWKKILSLEIFDNCTK
FT                   HPKLIEKIFKSYDHLEDRKDICKSLLSAIDSSVHSFEFESLLNESDILMKGDILILSPD
FT                   NSSSKMSLLNLLDKSSPPLIDQTYVIYLLLSISNNISDGVSSLASLSDQKEEVDEENDV
FT                   LIELFKETYPSLFRIHRRFLYSTTLDTHLFHLLIRAFQKLSLAAGIFGCNEQLHELLSL
FT                   FQTLILNNVPERRSAPVPTPSSGSVLGSIGDTLVNVAATMTEKQTDVKPRTTKDFRSRF
FT                   FQQRNLNLFRALVSLSISLGSSFDAKSWETFLVTWQWVSYYMYGPTADFLDGYYGKDVV
FT                   PATAITKQDLLTYETSVKKFIENSMNFTHAGLYVLFKTAVSCSVSVLESSQDLSSALVD
FT                   SSGNVRFCPYNRSFFVAELSELLVSNYEKILVQNGDGGIWPMFSKYLISQIANRKLPDA
FT                   ALRLYLSRVYSDTVVELSAKCNSEGQTQNDLSLQTQEVIMKSLLELIDAIRALPISSES
FT                   VYSNDTNVESDIILQALKTLNDLLNSFGETLNSWDIVLKILNSPFDVIDNGSQKITVDT
FT                   ESNISQVLVQKHKDMIQMSFEVFKLISDNFLQYLPLNIIKDFIDTLSNFVNQDRDLNIS
FT                   FSSISQFWLIADSLRMQKGDASVEESETKSYDALVQKGEINKIIEQDFPISQKLKALWI
FT                   YLLVTLVRCAYDLRPEVKNGAVQTFFGILDSNFNLFPSWDLIASQVLKLLLSFNLPVEN
FT                   ANGYAEFVNITFKGLLQIYSKHLTYFNSQNDMTEHWIILVSKMGDLMQLTAYDVVYSVC
FT                   NNFKQLLEISKAIEDFPVLIIRKYYEIWSSYNIVYTSIPTNDYRKKTNSDCLQAFMDCF
FT                   KPLYELHRMHSLIDTDFMEKCLSTINASARYPLLPDHISDRLKPSPLQKSLLAAIGTFD
FT                   EDLPPNLQVLLLAQLSAIVDLPFETRDRIEKKLSAKLGDLTKTKIPSFEAISYSACELL
FT                   SQRISRLERLDKTIIESRSFSKLLNNLSHPMTKNSMICPSIDSERPVLWKLACDSFCML
FT                   SDKLFYALVANLTATEEDNVNEYTAILIQMLIATIVKEGKQDDENIGIQAVIIYKQLKE
FT                   LFIKCLSLGLLSKEQIQPFGSALWSSSYYYEIDEVEDAVIKQCANLEDIVRQFAKFDFD
FT                   NIVGSTKEPVALPNYNLTAICLGDLIAFCTLQTNKGEIVREVCFSFMIARVAFVLRKFI
FT                   ADQQLLNLQPISKVKSLELQQVSNGILSVLAFYNTVDTTIQSFELLDDLYPLLLRAIPL
FT                   SQKVPGLQDTLLQIALLYAKLNK"
FT   gene            <669272..>670732
FT                   /locus_tag="KLLA0_A07447g"
FT                   /old_locus_tag="KLLA-ORF10382"
FT   CDS_pept        669272..670732
FT                   /locus_tag="KLLA0_A07447g"
FT                   /old_locus_tag="KLLA-ORF10382"
FT                   /product="KLLA0A07447p"
FT                   /note="similar to uniprot|P48564 Saccharomyces cerevisiae
FT                   YNL295W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07447g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02919"
FT                   /db_xref="GOA:Q6CXK8"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK8"
FT                   /protein_id="CAH02919.1"
FT                   /translation="MLSGIRITPLRRASRLLFAQQYSSKSNPTALKWQKDNTEEEQESN
FT                   SKSKTDVKDLRSKVEALKVSEPETVTTNDKGTSSKKRKAEKSFLVPQVPSTDYLPREDL
FT                   ETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNAQINSENNTVEIDVSDMLD
FT                   DLKKDNQEYQRLHEKAPKIPWDASISGLVYNDEPFKGVPRSVVSKLKPFKLVRVEKKNS
FT                   KDKEAKNDKIKLKFHGTRIKDDSTMVDLIQETSKKKERDNAFGTTGNDVAQGTKVKYET
FT                   EKIDYTYKFQFIGADQRIFKNNVSKLTRLFMKEFMKVRNVRLASDFKENYLPLYIYVDH
FT                   STQSRSMFKRYLRRKIIDYIRPLLMTLSHSYETKEQGRKFERRIMLKVDSIVNTLSEYL
FT                   PSVYFKSEEVDCLLLPSPVSAFGRMHWLKPTKRRNVFWGKNVTNDYVFNLSYDMKVTRS
FT                   GIKRMRYPINLHWKSFNNAFTEWEYSYL"
FT   gene            complement(<670942..>672501)
FT                   /locus_tag="KLLA0_A07469g"
FT                   /old_locus_tag="KLLA-ORF10381"
FT   CDS_pept        complement(670942..672501)
FT                   /locus_tag="KLLA0_A07469g"
FT                   /old_locus_tag="KLLA-ORF10381"
FT                   /product="KLLA0A07469p"
FT                   /note="similar to uniprot|Q758G4 Ashbya gossypii AEL202C
FT                   RIM21 pH-response regulator protein palH/RIM21 and weakly
FT                   similar to YNL294C uniprot|P48565 Saccharomyces cerevisiae
FT                   YNL294C RIM21 Protein proposed to be involved in the
FT                   response to alkaline pH; has similarity to A. nidulans
FT                   PalH"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07469g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02920"
FT                   /db_xref="GOA:Q6CXK7"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXK7"
FT                   /protein_id="CAH02920.1"
FT                   /translation="MTGRSRWRYHFPSEDYSSCQGVQLDEGVLIWNKLPDKFAYIKSLV
FT                   FTSNCQDGTPLYSSFVELEDECPYLPIVAFDWNSYINNDGYTGPFKYSIYSVIYSVTAN
FT                   FIITVFLTVIVFINVPTKPSRKASYILKLGALLASLNLSIFVIRVWKNIAENYTYNGYV
FT                   SSTSFLNLLWGDKVFAGIDLVVVFLLQISQVQIVMRFFDRMQEKRMVFYFGLFLILVTQ
FT                   ILWVIPTLSPVPTKDSDSDIDILPPFVYLFRIALSTCYASVICFHVLTKKSLCFRGRMI
FT                   FLTLLTIFTVFLHPTFFIVDVSNLWIDDLSEIFNTTCYLASTVIVLEWTNRIHTMERKI
FT                   HAASVLGRPIYEDEEQNFHFAIYALRMQNAMKMHRDGHVHDHGHTCDSNDNANVSLQNA
FT                   NTNDSSSIITDNSSQRTSTFGTMATDQVTLHTQQGERNITQFKRAETFWNKCHHVLESI
FT                   VYYTDNVMVNALAGSKTFDSFTNDAEKLLKTERLRKTVGLDEPEDVYLYRKTTMSSDSV
FT                   ME"
FT   gene            <673198..>675057
FT                   /locus_tag="KLLA0_A07491g"
FT                   /old_locus_tag="KLLA-ORF10379"
FT   CDS_pept        673198..675057
FT                   /locus_tag="KLLA0_A07491g"
FT                   /old_locus_tag="KLLA-ORF10379"
FT                   /product="KLLA0A07491p"
FT                   /note="similar to uniprot|P48566 Saccharomyces cerevisiae
FT                   YNL293W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07491g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02921"
FT                   /db_xref="GOA:Q6CXK6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK6"
FT                   /protein_id="CAH02921.1"
FT                   /translation="MNQDQNQANRMYKGPIRLHTMFSPSVPDLNRKFSDLNTSEQSIAV
FT                   SDGGVALRKNVVRNNSNSERISGSKRPKSTILRENSAGLSLINLYYDLDDENEEEIGQV
FT                   SMKGHKINQNNSGSSELELNEGALTLATEDKTINLDDSGSSDALNGIGQLPTPESESRA
FT                   SQLLGNSSLIEDAASIKVKDSHLDRYGFMKQNQYISEKQYNEWWSEYSKYCIRRKRKWK
FT                   DLLLKSGLPVDNDSPSRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQELLNKNIGVY
FT                   DKLLTKINDPSFTSKDTEIIERDLHRTFPDNIHFQRSKVSSEDPLIIKSLRRILKAFAI
FT                   YNAKIGYCQSMNFLVGLLLLFMDEERAFWMLVIMTSRYLPGVHSINLEGVNINQGVLLL
FT                   CIKEYLPHFWQRIYSNKDQQHSPGLSNKNEFLYKLPPVTLCTASWFMSCFIGVVPIEAT
FT                   LRIWDCLFYEGSHILFKMSLAIIELSETNLPKLNHVSSRNSDDEDMELFQAIQTYPRRL
FT                   INPNDIIDKAIFKRRLRFNALNQEEIERCKKYVISQRAKYKNFQDVMKNETTNSNNKRD
FT                   SKLAQELINETFSNEGYGFKKGLNGVNWNNNIKERVRRLSRKR"
FT   gene            complement(<675169..>675804)
FT                   /locus_tag="KLLA0_A07513g"
FT                   /old_locus_tag="KLLA-ORF10378"
FT   CDS_pept        complement(675169..675804)
FT                   /locus_tag="KLLA0_A07513g"
FT                   /old_locus_tag="KLLA-ORF10378"
FT                   /product="KLLA0A07513p"
FT                   /note="similar to uniprot|Q12285 Saccharomyces cerevisiae
FT                   YOL111C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07513g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02922"
FT                   /db_xref="GOA:Q6CXK5"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR031765"
FT                   /db_xref="InterPro:IPR040474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK5"
FT                   /protein_id="CAH02922.1"
FT                   /translation="MSELDFVGKFLSLAALNEPKLASNYRKPLHEVTNLGVSLPPLRYK
FT                   YDPSKSHSKSISKVVEVTIKSIKAPKFVHSKSFESTDTVGQIKEFLVETEPEIYTTGQI
FT                   KLLLKGKVLHDTQLVSDLNQDKISLVAMVSKAEKPVETAPLPKPAQEPEPELELMDVDM
FT                   EDPQLDLSSQTDIDLPWDKIRTVLESSLDASTASVALGRLQKGWELSK"
FT   gene            <676032..>676808
FT                   /locus_tag="KLLA0_A07535g"
FT                   /old_locus_tag="KLLA-ORF10376"
FT   CDS_pept        676032..676808
FT                   /locus_tag="KLLA0_A07535g"
FT                   /old_locus_tag="KLLA-ORF10376"
FT                   /product="KLLA0A07535p"
FT                   /note="similar to uniprot|P41912 Saccharomyces cerevisiae
FT                   YOL110W SHR5 Subunit of a palmitoyltransferase composed of
FT                   Shr5p and Erf2p that adds a palmitoyl lipid moiety to Ras2p
FT                   through a thioester linkage palmitoylation is required for
FT                   Ras2p localization to the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07535g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02923"
FT                   /db_xref="GOA:Q6CXK4"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXK4"
FT                   /protein_id="CAH02923.1"
FT                   /translation="MVSLVLADTADSSDLSKAAITVEESTSAQQPKFFNYHEFVITKYR
FT                   ALDEESCEEHGPENPICITHFPNIYVPEESDEFRTTRVVRIPRRFESSTEFPNFSTQLP
FT                   GSEPAALPDTHNKEFVPAGEFEGQWYGETSVSPLSNYLDQAEWTEIVTRINSLLEAAYN
FT                   PITRRNFVNVILDLLTLNLWSIIEPYLFVNPLQSVEDYVSEINRSESFRLKGIKIIPPR
FT                   ESSYLSVCIDSPAWIKPCTAINEPLLTHCDTLIVLL"
FT   gene            <677067..>679394
FT                   /locus_tag="KLLA0_A07557g"
FT                   /old_locus_tag="KLLA-ORF10374"
FT   CDS_pept        677067..679394
FT                   /locus_tag="KLLA0_A07557g"
FT                   /old_locus_tag="KLLA-ORF10374"
FT                   /product="KLLA0A07557p"
FT                   /note="some similarities with uniprot|P36165 YKR089C
FT                   Saccharomyces cerevisiae STC1 Protein of unknown function
FT                   found in lipid particles potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07557g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02924"
FT                   /db_xref="GOA:Q6CXK3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK3"
FT                   /protein_id="CAH02924.1"
FT                   /translation="MPNVMNTPSVTDIKDDPITSYVIKNYYKRANKGAEMTEEQSRNDS
FT                   GQDEPQLNFFSSLCNSFYKFIRGADSTHEQIARLIEQKQNARSLQEWLAAATKLDDITN
FT                   AEQWKSKRESVLYDYCLVESSTEAMKKARLAKDWPNLLYLIRTTWVRNRGGMGNVNLYR
FT                   HSYVGTKHIIEDYVAESSRSLQELVYNSDLDDTYLLGMLTQTRKNIGRTALVLSGGGTF
FT                   GLFHIGILVTLFEQELLPRVISGSSAGAIVASILASRQEHELMGLMDEILVKDFNIFKD
FT                   DLEMSESENLLIKISRFFKNGTWFDNKNLVSTMINFLGNLTFREAYNRSGKILNITVSP
FT                   ASVHEQPRLLNNLTSPNVLIWSAVCASCSLPGIFPSSPLYEKDPKTGETKQWNSSSVKF
FT                   VDGSVDNDLPVSKLSEMFNVDHIIACQVNIHVFPFLKLSVSCVGGEIEDEFSARFKMAL
FT                   GKVYKYMASEVIHALEIATEIGIGTNVLTKLRSVLSQQYSGDITILPEMNTLLRFNELL
FT                   SNPTQEFLLREATNGVRASWPKISIIKNHCGQEFELDKMINYLKGKIISNTDIKGNPFQ
FT                   ISNRDVPLINSPVLANSEKKAIQVFDDVLLNADNLDNFMVVPDGTGSLKSQDLNNPPRY
FT                   SNEFGSRAHNRRKSDSATNGNRKGKRHNSISLPYSSSSSPLSEKKYSMINFRPSFDKKT
FT                   STGDLQVRKPYPYPPKSSSFSRIDYDPRSNSLTPILDHAVGTRRDDSILHSDVKSNPNS
FT                   PLRLRTKSSVSRRASRKNPDTA"
FT   gene            complement(<679469..>681631)
FT                   /locus_tag="KLLA0_A07579g"
FT                   /old_locus_tag="KLLA-ORF10371"
FT   CDS_pept        complement(679469..681631)
FT                   /locus_tag="KLLA0_A07579g"
FT                   /old_locus_tag="KLLA-ORF10371"
FT                   /product="KLLA0A07579p"
FT                   /note="weakly similar to uniprot|Q7LGN4 Saccharomyces
FT                   cerevisiae YOR080W DIA2 Protein of unknown function
FT                   involved in invasive and pseudohyphal growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07579g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02925"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK2"
FT                   /protein_id="CAH02925.1"
FT                   /translation="MGEEIDALDDGLLTRTYELGLKWMQCREYSKALGLFSKAMKVSRS
FT                   YPMEMVENIRIRAGMPKRCAYDESKAYHPLYVKLLDSRISCLMKVGDYARAVKESQYFC
FT                   KIEPSSTRALLRLGKSYELADKGDRARQVYKSGRKLVKELKERGVLVSPVHEKLFSDRY
FT                   EELLKRNAMQLVNSNDAESGARNSEQIPSKKRVLIEQKLVNNEDIEENDLVSDTDQDHD
FT                   GSTMNKKMKRATIDPIQTFPTELVISIMRRLDTKDITSCMLVSKFWYRKLSTTPMIIDY
FT                   LSVPKTNYSKINSLLRFVKTKRCVSSVIQYLNFSVMATNEEAKCSQLLFNGLDQEVKKL
FT                   VLQFTNLNILKVLQLISDKEKLIANLQEFSVFGHYDPNHWADEDVVFLERIDNLKKIEV
FT                   LIGTAMVPGRNSSIHRRRQLQFPNNDNISRSLQSIKLIFKDNGWTGPTPFACIFSSDTL
FT                   RFANVSKLIVTNRDFRFNQTADWIKKFPNLTDLWLERNTGLSLMGFLQSLQEPNVLKRL
FT                   KYFTFRESSTESNRSFNGQMWTDEQIEPILANLGAVQTLDIMNSAIARSVLYRLLNELP
FT                   SIRKLNIGNVFEMSDELYPRTDIESTAFLFLRHMTHLRDLSVPNMSSHQVRAFRQLALV
FT                   ISEIGSLSRLDLSFNPSMQGYQLYDIIRELFDNGITLKTLVIDGCSHISATTVKDIERN
FT                   GYVENIECAFNKQQWEKFGVNSFWYR"
FT   gene            <682057..>683001
FT                   /locus_tag="KLLA0_A07601g"
FT                   /old_locus_tag="KLLA-ORF10367"
FT   CDS_pept        682057..683001
FT                   /locus_tag="KLLA0_A07601g"
FT                   /old_locus_tag="KLLA-ORF10367"
FT                   /product="KLLA0A07601p"
FT                   /note="weakly similar to uniprot|Q12067 Saccharomyces
FT                   cerevisiae YOR079C ATX2 Golgi membrane protein involved in
FT                   manganese homeostasis overproduction suppresses the sod1
FT                   (copper zinc superoxide dismutase) null mutation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07601g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02926"
FT                   /db_xref="GOA:Q6CXK1"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK1"
FT                   /protein_id="CAH02926.1"
FT                   /translation="MSQLLEPLLSAVFLFFATLGTGLIPVMYMSKLAEKGDSGMGYLKY
FT                   VSDFGIGMLLGTSCLLVIPEGVEKFGDKGGRGFGISLLLGFMILYGLDRFLHALQAGHI
FT                   LSGSFDASAAPDPLERNIDLINPRKTVPFILTNNIVFALVIHAFSDGLALGIAESYDSL
FT                   KFVMLIAIIIHKIPATLSLTGIMISKQRLPKLQVISNLIAFSISTPFGLLFVILMRFVS
FT                   KDLIEKMSDGLLVLSGSSLLYASLLALISPSKDQEQQLQNDGPIPVSGSVLEMGEGVTT
FT                   EEKIEQESLPDVRLLLLGIFIPLMISFFAPHDS"
FT   gene            complement(<683112..>683864)
FT                   /locus_tag="KLLA0_A07623g"
FT                   /old_locus_tag="KLLA-ORF10364"
FT   CDS_pept        complement(683112..683864)
FT                   /locus_tag="KLLA0_A07623g"
FT                   /old_locus_tag="KLLA-ORF10364"
FT                   /product="KLLA0A07623p"
FT                   /note="some similarities with uniprot|O00033 Saccharomyces
FT                   cerevisiae YOR078W BUD21 Component of small ribosomal
FT                   subunit (SSU) processosome that contains U3 snoRNA
FT                   originally isolated as bud-site selection mutant that
FT                   displays a random budding pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07623g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02927"
FT                   /db_xref="GOA:Q6CXK0"
FT                   /db_xref="InterPro:IPR013268"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXK0"
FT                   /protein_id="CAH02927.1"
FT                   /translation="MGLKKVLGSGAALVAKRHLKFDDDADDSFHTADEGNSTLDALKPT
FT                   KAEANGESESESESDSDAPEEEGLSSGKDAIEKRIQEREEAARLQEEAAREKRRKNEKV
FT                   FKQQQLEKKKKLLESEEEKQREKMLEFERQLVAQQGSDNDEPEELPQEFFDELESGSAS
FT                   SFAKATPKHITFSAEAQREEEQALKEELRKQKKRSLRELRKTQIQKGPVTVNLLSSMKV
FT                   SKTLAPKKETSVMKSKDKWLKRRSLKRK"
FT   gene            complement(<684223..>685041)
FT                   /locus_tag="KLLA0_A07645g"
FT                   /old_locus_tag="KLLA-ORF10363"
FT   CDS_pept        complement(684223..685041)
FT                   /locus_tag="KLLA0_A07645g"
FT                   /old_locus_tag="KLLA-ORF10363"
FT                   /product="KLLA0A07645p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07645g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02928"
FT                   /db_xref="GOA:Q6CXJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ9"
FT                   /protein_id="CAH02928.1"
FT                   /translation="MKSLLNKRFSPKRRNKPITYAPASAAKPKPKPKPKPKQLDPPMQS
FT                   GESSSQKSSTPIPIKSILRPVDGTHEHENKSVRIVESSPHPESVPISTPTRIIVGPLPD
FT                   GNVSDSLVYNASDLEKGHIGVAEESSPLLESQLPDLTTYQTISPESNPTAQIHCWSTPS
FT                   LPIPIPPPSSDQPCSGDPVQSPSIPPSRESPFTSPLSRFLQMLYARYPVIITYILITIC
FT                   VIGIIYSLVTGTGRSYLLVIIKACICWIMGTDVARMLFGTQFCDIEFKVS"
FT   gene            <685696..>686613
FT                   /locus_tag="KLLA0_A07667g"
FT                   /old_locus_tag="KLLA-ORF10361"
FT   CDS_pept        685696..686613
FT                   /locus_tag="KLLA0_A07667g"
FT                   /old_locus_tag="KLLA-ORF10361"
FT                   /product="KLLA0A07667p"
FT                   /note="similar to uniprot|P36164 Saccharomyces cerevisiae
FT                   YKR088C TVP38 Integral membrane protein localized to
FT                   vesicles along with the v-SNARE Tlg2p green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07667g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02929"
FT                   /db_xref="GOA:Q6CXJ8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXJ8"
FT                   /protein_id="CAH02929.1"
FT                   /translation="MADLYEARVSSGGLSRPSDTDFLDSNDNFDDLDDDFLDIYNLSWR
FT                   QRIVQHGKRHLRNGKDKFNALSRRKKALVVFLGVLEIILIFITVVKREAIMKGLVDASN
FT                   DLRQKWYTPLVLMLLILAVSFPPLIGYSFLSLSTGLIYGLSFKGWFILAMSTVIGSVLS
FT                   FTVFQRLLHSHAERLIRMNPKLEAVSSVLQGNDSYWMIALIRLCPFPYSFINGAIAGIY
FT                   GISIKNFAIANIITTPKAVIYLFVGERLKNMGETDSGSTRLINFISILLANGFLILTTW
FT                   FLYYRFKKRYLELQSEQQNSFDIF"
FT   gene            complement(<686738..>687457)
FT                   /locus_tag="KLLA0_A07689g"
FT                   /old_locus_tag="KLLA-ORF10360"
FT   CDS_pept        complement(686738..687457)
FT                   /locus_tag="KLLA0_A07689g"
FT                   /old_locus_tag="KLLA-ORF10360"
FT                   /product="KLLA0A07689p"
FT                   /note="similar to uniprot|P40962 Saccharomyces cerevisiae
FT                   YOR077W YORO77W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07689g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02930"
FT                   /db_xref="GOA:Q6CXJ7"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR037321"
FT                   /db_xref="InterPro:IPR038254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ7"
FT                   /protein_id="CAH02930.1"
FT                   /translation="MVSGDVGSASFLNKQMKMRGLQKLRFYCQICQKQCRDENGFKSHS
FT                   KSPSHLQKLSKVTHKDIEEYTVQFEKDFLRLLRLMHGEKKVEANKFYNEFIQDKDHVHM
FT                   NATRFTSLTRFIQHLSQGGKVRIHGIDELTSDTDPGRFMISYIDSSSPNMIRKKQIESL
FT                   KQAERSDQEIKLRLLEKQIEKANAEEVKSGQKEEEEEEEEIKANIRDGPINLTVSTSKV
FT                   TKKKPKKKLKNVFKPTK"
FT   gene            <687735..>688772
FT                   /locus_tag="KLLA0_A07711g"
FT                   /old_locus_tag="KLLA-ORF10359"
FT   CDS_pept        687735..688772
FT                   /locus_tag="KLLA0_A07711g"
FT                   /old_locus_tag="KLLA-ORF10359"
FT                   /product="KLLA0A07711p"
FT                   /note="highly similar to uniprot|P36163 Saccharomyces
FT                   cerevisiae YKR087C OMA1 Metalloendopeptidase of the
FT                   mitochondrial inner membrane involved in turnover of
FT                   membrane-embedded proteins member of a family of predicted
FT                   membrane-bound metallopeptidases in prokaryotes and higher
FT                   eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07711g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02931"
FT                   /db_xref="GOA:Q6CXJ6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ6"
FT                   /protein_id="CAH02931.1"
FT                   /translation="MFKNVFSRLLRPQARFYNTPIPRVTYKRFNGRTGNSFTQLLFDKT
FT                   SRKYLAIVFGTGSLFYLTHLEEAPVTARTRFIWLPRSLELKIGQYTYNSVLSETKGKIL
FT                   PESHPLTRKVTKIFHRIVEAAEHDPSVDQSLLKDVQWKIHIVNDPRAPPNAFVLPGGKV
FT                   FVFSNILPICQNEDGLATVLSHEFAHQLARHTAENLSKAPAYSILGALIYAVTGLDGIN
FT                   RLLVDGLVRMPASREMETEADYIGLMVMSRACFHPEESLKVWQRMAAMEEQQKRRGMVN
FT                   VEFLSTHPATTRRIENMAKWLPKSQELYSQANCGNFGGFYNSFQDAFGYGNSVSPEPRI
FT                   TVWGI"
FT   gene            complement(<688856..>692050)
FT                   /locus_tag="KLLA0_A07733g"
FT                   /old_locus_tag="KLLA-ORF10358"
FT   CDS_pept        complement(688856..692050)
FT                   /locus_tag="KLLA0_A07733g"
FT                   /old_locus_tag="KLLA-ORF10358"
FT                   /product="KLLA0A07733p"
FT                   /note="similar to uniprot|P15938 Saccharomyces cerevisiae
FT                   YKR086W PRP16 RNA helicase in the DEAH-box family involved
FT                   in the second catalytic step of splicing exhibits ATP-
FT                   dependent RNA unwinding activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07733g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02932"
FT                   /db_xref="GOA:Q6CXJ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ5"
FT                   /protein_id="CAH02932.1"
FT                   /translation="MNAELQEWIQQNTESRVTEKFVETLRQIARIHKDVNKFIGGAKAL
FT                   GKFKGKDEFLKQLFEKLQAHKQSPKPESAAVPARTIRKKFVVKLPLDDKEDDDEDELST
FT                   VKVQVKPKFNKPLTLKRITKQTAAKLNEFSENTEPVVMVKKEEATKGTLIDAEGSDVED
FT                   IKDAKDFTAQDRNWYDNDDDFDNVIHDDEYIPAQQDPYEGGDRELDLNEPEIQLTSLSL
FT                   NERKTIIPPFLLDFHDQSGELAIVGALDMSSNANKGIADPIRNPESDFSINARRGSKLV
FT                   AMRRIHRDRKSKSQNATELKGSALGKVLGVKQDSSTDAQTKQPNQPIAIKEKEQSFEEI
FT                   QAVRRSLPAYKVRHDLMRHIRDNQITVVIGETGSGKTTQLAQFLYEDGFTANGRMIGCT
FT                   QPRRVAAVSVAERVSKEMDTPIGVKVGYSIRFEDQTSDSTKIKFMTDGILLREAMIDPL
FT                   LEKYSCIIMDEAHERSLNTDVLLGIFKTLLARRHDLKLVVTSATMNADKFSQFFGNAPQ
FT                   YFIPGKTFPVEIIYTNHPVPDYVESAVQKALDIHLSTPISNGDILIFMTGQEDIEATCS
FT                   TIIERLTEIYTKKYGANYEEQLADVQVLPIYSSLPADVQGRIFQRQEQNVRKIVVATNI
FT                   AETSLTVDGIKYVIDCGYSKLKVYNPKIGLDSLRITPISLANANQRSGRAGRTGPGIAY
FT                   RLFTHDSAMEDMYPQAIPEIQRTNLANTLLQLKSLNINNLSKFPFIDPPPSQNLMTSLY
FT                   DLWALEALDNFGHLTKLGRLMGAFPLQPFLSRVLISASQYGCTEEMLTIVSMLSVPSVF
FT                   YRPKEREEESDQARSRFFIPESDHLTLLNVYAQWKANRYSAHWCNSRFLQFRSLQRAKD
FT                   IREQLLYVIRKLNLPMASSGSDWAPIRKCLCTGYIQQTAKLSGLGKYVHLKTGMDLKVH
FT                   PTSALFGLGDLPAYVVYHELLMTTKEYINVVTAVDPLWLMEYSGIFYHIKRRKEQSYQF
FT                   GLNSSLNNDDQDHQDKIDLQIEKLRLNAKDKLERLETDKSSAALNKTNSIEMRRTTNER
FT                   QEQPAVRIGIKRRRPF"
FT   gene            <692606..>693199
FT                   /locus_tag="KLLA0_A07755g"
FT                   /old_locus_tag="KLLA-ORF10356"
FT   CDS_pept        692606..693199
FT                   /locus_tag="KLLA0_A07755g"
FT                   /old_locus_tag="KLLA-ORF10356"
FT                   /product="KLLA0A07755p"
FT                   /note="similar to uniprot|P22354 Saccharomyces cerevisiae
FT                   YKR085C MRPL20 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07755g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02933"
FT                   /db_xref="GOA:Q6CXJ4"
FT                   /db_xref="InterPro:IPR024388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ4"
FT                   /protein_id="CAH02933.1"
FT                   /translation="MVRLFSTSARAAKDLSKIIDKSGKLPKIVGPATIYNPKSSASNYK
FT                   GYLKAKIPAGLYYDPAPSSIHGSTNSETIPKSFLPATDPRHDIIDDLTQGNAEISRVAP
FT                   VLHEKGEKTYHLKPEDIAEIRRLRLEDPVKNSRKALAKKFNCSPLFISIVSEPPKERKT
FT                   EMNQVLETIKSQWHPKRALARAERKKRKELWYRA"
FT   gene            complement(<693423..>693911)
FT                   /locus_tag="KLLA0_A07777g"
FT                   /old_locus_tag="KLLA-ORF10354"
FT   CDS_pept        complement(693423..693911)
FT                   /locus_tag="KLLA0_A07777g"
FT                   /old_locus_tag="KLLA-ORF10354"
FT                   /product="KLLA0A07777p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07777g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ3"
FT                   /protein_id="CAH02934.1"
FT                   /translation="MTVPENVLTTHQRVIQSCVLYNIVPRSIARAWEPQHLLWKGKLIV
FT                   DELLHLDGSNQSTMMQPSLYRFRFVSDKEDGVDKEDINSDERLFCETQVISNLKELHTV
FT                   LQRREKWYQIAMLCEGQHRHQIALELQIKDAYQMQLFEDIILRIRDEYEIFQEMYDGY"
FT   gene            <694308..>697112
FT                   /locus_tag="KLLA0_A07799g"
FT                   /old_locus_tag="Klla0A.mRNA.524.p"
FT   CDS_pept        join(694308..694563,694879..697112)
FT                   /locus_tag="KLLA0_A07799g"
FT                   /old_locus_tag="Klla0A.mRNA.524.p"
FT                   /product="KLLA0A07799p"
FT                   /note="similar to uniprot|P32769 Saccharomyces cerevisiae
FT                   YKR084C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07799g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02935"
FT                   /db_xref="GOA:Q6CXJ2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015033"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ2"
FT                   /protein_id="CAH02935.2"
FT                   /translation="MSKFYDDDDAVDYDDDVPDFQDEDEFDDYLNDEEFELMNQLFPLA
FT                   KEQLADYQGWDNLAVKVAIFDHNFELEPALVDLKRRFKKKVSFICLFAEQKVEKKLSAL
FT                   ELLARKRAEARNKASTMAPATTKVSLLDKLKNGGGNGQNGNPVKTTVSVASRLQSLKRG
FT                   PITTDNNSNGAATASFSQPKTHTLASKLASLRKSKPEGQIIEKPEAEETNVEVVIEENK
FT                   IDHEKKDKDDPWVILNQLKDSAYVSNINEILAINKVPLYSGILEKLEFNSTTTKRKHEE
FT                   LFSVYYPNTNNRVVKKQAIANFSKPSPDDVVINQQKAAFEVDKIKEKVADLSIQDKQSS
FT                   KTVEKEEDINDDDDDDEKLPFEEPVVKTYKKVSVPTKPKNAINISSYLDNKKPHLNFVV
FT                   LGHVDAGKSTLMGRLLYDVGAVDTKLIRKLQKESEMIGKSSFHLAWVMDQTSEERNRGV
FT                   TVDICTSDFATTKSSFTIVDAPGHRDFVPNAIVGISQADVAVLSVDCGTDAFESGFNLD
FT                   GQTKEHALLARSLGIKHIVVAMNKMDSVSWYEGRFNDIRSELAVFFEEIGFKGNDVSWV
FT                   PCSGLSGEGIFKTPYPPSQTWYQGPSLVGELENVALKLACVDESVTKEPFLFNILDVTP
FT                   TSKNTSAIISGKVESGTIQPGETITIYPSEQSCVVDSILCGNDSQKVDIALHGDFVQLK
FT                   LHNAFPEDIQGGDLASIVGFDIPSSQEFTSRLLTFRLDRPLLPGTSLMLFRGATEQPCR
FT                   IKKLCCTVDKSNPSKVLKKKVKHLGSQQAAIVEIELVEKKRRIPMLTFEQNKKLGRVVL
FT                   RKEGRTIGAALIKSLDY"
FT   gene            complement(<697189..>698178)
FT                   /locus_tag="KLLA0_A07821g"
FT                   /old_locus_tag="KLLA-ORF10351"
FT   CDS_pept        complement(697189..698178)
FT                   /locus_tag="KLLA0_A07821g"
FT                   /old_locus_tag="KLLA-ORF10351"
FT                   /product="KLLA0A07821p"
FT                   /note="similar to uniprot|P41834 Saccharomyces cerevisiae
FT                   YOR075W UFE1 t-SNARE that resides on the endoplasmic
FT                   reticulum and mediates retrograde traffic from the Golgi
FT                   complex potential Cdc28p substrate endoplasmic reticulum t-
FT                   SNARE coprecipitates with Sec20p Tip1p. and Sec22p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07821g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02936"
FT                   /db_xref="GOA:Q6CXJ1"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR019529"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ1"
FT                   /protein_id="CAH02936.1"
FT                   /translation="MSNRTELFKKYMQVIAETQGIDDARNELNNTKAREDREKVKEKFS
FT                   VKDTFVKESKQLMKHIMEFQIVIRQLTPRYESATDMTDQEKDDFDTESKLQLQQYFEKY
FT                   KQLESYERQRQEMMKEKLEKWSATVPFFSRSIDDVSSFHKVNNQFRMGILQSLNMWLMK
FT                   ISDRLSTIQQTRLSRQRHIEAIDFNAQLHLPEEISVSQSPMITTTVEEIKQYEETMSKL
FT                   SSEQLQILATEHEELLNLKNEELQKAEALRRTAVDIASLQSELATHLQVQTQNINTLLD
FT                   NQTDVEMEMEKGNRQLKQANRKGDRLANMVMWFAIICGLLLLFFDYIN"
FT   gene            <698626..>699564
FT                   /locus_tag="KLLA0_A07843g"
FT                   /old_locus_tag="KLLA-ORF10349"
FT   CDS_pept        698626..699564
FT                   /locus_tag="KLLA0_A07843g"
FT                   /old_locus_tag="KLLA-ORF10349"
FT                   /product="KLLA0A07843p"
FT                   /note="highly similar to uniprot|P06785 Saccharomyces
FT                   cerevisiae YOR074C CDC21 Thymidylate synthase required for
FT                   de novo biosynthesis of pyrimidine deoxyribonucleotides
FT                   expression is induced at G1/S"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07843g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02937"
FT                   /db_xref="GOA:Q6CXJ0"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXJ0"
FT                   /protein_id="CAH02937.1"
FT                   /translation="MTLSDENVKRVKLEAVNAEEQQYLDLCERIINEGEFRPDRTGTGT
FT                   YSLFAPPQLRFNLSNDTFPLLTTKRVFTKGIILELLWFVAGCTDGKKLSEQGVKIWEGN
FT                   GSREYLDSLGLTDRREGDLGPVYGFQWRHFGAEYKTCDDDYSGQGVDQLKEIIHKLKTN
FT                   PYDRRIILSAWNPPDFPKMALPPCHVFSQFYVSFPKGEGAKPRLSCVLYQRSCDMGLGV
FT                   PFNIASYALLTKMIAMVCDMEPGEFIHTLGDAHVYKDHVDALRTQIAREPRAFPKLKIK
FT                   RNVSDIDDFKYEDFEITDYNPHGKIQMKMSV"
FT   gene            complement(<699725..>701509)
FT                   /locus_tag="KLLA0_A07865g"
FT                   /old_locus_tag="KLLA-ORF10348"
FT   CDS_pept        complement(699725..701509)
FT                   /locus_tag="KLLA0_A07865g"
FT                   /old_locus_tag="KLLA-ORF10348"
FT                   /product="KLLA0A07865p"
FT                   /note="weakly similar to uniprot|O00031 Saccharomyces
FT                   cerevisiae YOR073W SGO1 Component of the spindle checkpoint
FT                   involved in sensing lack of tension on mitotic chromosomes
FT                   protects centromeric Rec8p at meiosis I required for
FT                   accurate chromosomal segregation at meiosis II and for
FT                   mitotic chromosome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07865g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02938"
FT                   /db_xref="GOA:Q6CXI9"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXI9"
FT                   /protein_id="CAH02938.1"
FT                   /translation="MSASSQYDEFQAMLEQQKGIYLQQNSQLAKYNSSLMMKITDMETK
FT                   VSELVQENVSLRSRLSMGELRYREKLNTVFQTLEDGIVEKFLQMNQLLTTVRESQGLES
FT                   GIHDNPLKPILRGSNGISPRSAKKVEFTGANTTTKPVGFEDPIAEDNHENSGNSLELND
FT                   DEVRPLRKRRRKSSRRESLFIPADFEFNDEDPELELNQLPITEDEPPPSTAATSVPEEE
FT                   SQENKHTKEEREDEGKENVSTIPLVPVLPSVTNTGTECSNTNKNNTTEMETALAEDDSY
FT                   NFTTSVIEYSIPEETSTHEHSHILLETSKSKIDVYNDREETNNNEADDSMNIVQCTIPS
FT                   QSKIKHSMKHPRTKLKGGQDDIMPHTDYDKDDEKRERRTRGKAVNYKLPSLRAKMRRPT
FT                   EKLVDATTVTDIHDLQVKRRNNQQQGIPSDDDDQEELLVPAGVPDTNVVIATVEEENRK
FT                   EPPALPLHEIHLAQNVKPKIALKELSANAINRKVKTSTAVKAISHTKSRVLKDVKFNTL
FT                   PTKQQAIENNSSDPNVSDENENSNVKPTRTKQATSDLAAFEIIDGISLKHVSRTHRVRA
FT                   KEDMNKKRKRIHNDEISI"
FT   gene            <702046..>702444
FT                   /locus_tag="KLLA0_A07887g"
FT                   /old_locus_tag="KLLA-ORF10345"
FT   CDS_pept        702046..702444
FT                   /locus_tag="KLLA0_A07887g"
FT                   /old_locus_tag="KLLA-ORF10345"
FT                   /product="KLLA0A07887p"
FT                   /note="similar to uniprot|Q759Q6 Ashbya gossypii ADR217C
FT                   DAD2 DASH complex subunit DAD2 and weakly similar to
FT                   YKR083C uniprot|P36162 Saccharomyces cerevisiae YKR083C
FT                   DAD2 Essential protein component of the DASH complex
FT                   involved in spindle integrity and kinetochore function
FT                   interacts with Duo1p and Dam1p localizes to intranuclear
FT                   spindles and kinetochore"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07887g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02939"
FT                   /db_xref="GOA:Q6CXI8"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXI8"
FT                   /protein_id="CAH02939.1"
FT                   /translation="MAFETEIETKRRELNYLKHVSALTQKLKAQLDELSVQVAQMNSNA
FT                   VTVKDVMANWDSVLRSISQASISLLQYTENDYETGKWASKEEHRNQQGAEDESAASESS
FT                   EDNQQRQQDQLPPLPETLVRVKVADDVE"
FT   gene            complement(<702533..>705853)
FT                   /locus_tag="KLLA0_A07909g"
FT                   /old_locus_tag="KLLA-ORF10344"
FT   CDS_pept        complement(702533..705853)
FT                   /locus_tag="KLLA0_A07909g"
FT                   /old_locus_tag="KLLA-ORF10344"
FT                   /product="KLLA0A07909p"
FT                   /note="similar to uniprot|P36161 Saccharomyces cerevisiae
FT                   YKR082W NUP133 Subunit of the Nup84p subcomplex of the
FT                   nuclear pore complex (NPC) localizes to both sides of the
FT                   NPC required to establish a normal nucleocytoplasmic
FT                   concentration gradient of the GTPase Gsp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07909g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02940"
FT                   /db_xref="GOA:Q6CXI7"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI7"
FT                   /protein_id="CAH02940.1"
FT                   /translation="MKQLFQLRKELSVPAAAPEDSVISAEETTTGSAVTNVQFSNEQVI
FT                   TENGKYKVSKLAPSLSFLPSNVELCCSVDAKSGYALCCDTDNVYVWPFLSSETHPSFVR
FT                   IPLHDEEYESWSRPPLCCFTWPSVLERDLKSSPGLFLVNSRSGDIQFYEDVDTVSQVAS
FT                   FLTQTKRHKSVLKLRDGEYVENLINAEPAGILLSTNYGRVEFCTIRDANGKPFVSLKQT
FT                   IIKCQVGIFSSMSKSKRVVSLKLGEISGKGERIVSILTQGGRYQVWNLSSVGNCYKKID
FT                   LNVQSEISQAVLEHFPLATSTLKLLDCHPLSGDSDAYLFLSFLAESNETHYLLSTIIVD
FT                   EDTNSFAIFSTYRLNTYTRPLSDEFAPRLIVPTAYTKEHLPITSVYTLFSDAAVLTQTS
FT                   SKLDSNYPFKRKWEDIIRFNKDMKVLGYDCNSSSLYITDGRTCALKLETFEKYENSDFQ
FT                   EIRFIKSHVDQYVYFGGQSTDSLLDFNLPDNLDLQPQEIETDIQMSSDEIKYALSNHIP
FT                   PVANNPMKHLKIRSELFERLLTFVAHNFLDQTSSQFKLDLISDFEMIKCLESLYSLLPQ
FT                   QPTSISQAWKTVLSESSYQSDSDFISDGIVKIPELLGAFLKHLKDLMKSTNETMLKSQI
FT                   AKLINQLVYHSILEECENSYRYGLFQMSPDDVSKNIPWFTTNSIIENLNDIFFLLRHAS
FT                   EDLAVVSEFVEELLLLVKSLFYMVRQITMWIDANAITDSSYKQFFEENHLLWNRVLRDV
FT                   NRSQDSILITDFYQDFEGLVETLQSLPKITAFSLYDEFFQKYGYDFAKSLFSYYIKEGL
FT                   WDDLYESFGETHSEYLDQFLGECPEYGKVKWIGNIYCHKYDEATTTLLSISTGTQSLGQ
FT                   DLKQRQAQLSIAKLTALAAEVQDLEKLNEIQTELDLIDGQILLSQELQESTLNPLFKDF
FT                   TTYRTLFKYLSDAVKRRESLSVPHMIELFTLLNQDTSYGFALSILAIDHTLPTEVKKYC
FT                   EYQIWRRCLLSDENAVRQTLRVFFKQQFYHQSIELPIIDNLANEKLITDSYLDGMYHGL
FT                   TDLNKLASDVKREVALFANSNLDVTMLQSIIGEINEETGNQCVINYATNTIETSPTSF"
FT   gene            <706289..>707323
FT                   /locus_tag="KLLA0_A07931g"
FT                   /old_locus_tag="KLLA-ORF10343"
FT   CDS_pept        706289..707323
FT                   /locus_tag="KLLA0_A07931g"
FT                   /old_locus_tag="KLLA-ORF10343"
FT                   /product="KLLA0A07931p"
FT                   /note="highly similar to uniprot|P36160 Saccharomyces
FT                   cerevisiae YKR081C RPF2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07931g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02941"
FT                   /db_xref="GOA:Q6CXI6"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI6"
FT                   /protein_id="CAH02941.1"
FT                   /translation="MIRTVKPKNARAKRALDKKEAKLVENVKQALFIPGQTSTKLLHDS
FT                   MVDLSALKKPDIKRFSKKNNIRPFEDYEPLEFLSEKNDTSLMVLSTHSKKRRNNLTFIR
FT                   TFGYKIYDIIELQIAENYKLLSDFRKQTFNVGLKPMFSFQGAAFEQHPVYQHIKSLFLD
FT                   FFRGQNTTLQDVAGLQHIISITVQGDFQDGEPLPNVLFRVYHLKTYKSEQGGKKLPRVE
FT                   LEEIGPRFDFKIGRIHTPSPEMVKEAHKKPRQLEVRVAKNVEIDTMGDKIGRVHVGKQD
FT                   LGQLQTRKMKGLKAKYDQVDSDMEEYLEEVEGDLDQENVDDTYGEEFVTATDIDAPPAK
FT                   KQKK"
FT   gene            complement(<707461..>708441)
FT                   /locus_tag="KLLA0_A07953g"
FT                   /old_locus_tag="KLLA-ORF10342"
FT   CDS_pept        complement(707461..708441)
FT                   /locus_tag="KLLA0_A07953g"
FT                   /old_locus_tag="KLLA-ORF10342"
FT                   /product="KLLA0A07953p"
FT                   /note="highly similar to uniprot|Q02046 Saccharomyces
FT                   cerevisiae YKR080W MTD1 NAD-dependent 5 10-
FT                   methylenetetrahydrafolate dehydrogenase plays a catalytic
FT                   role in oxidation of cytoplasmic one-carbon units
FT                   expression is regulated by Bas1p and Bas2p repressed by
FT                   adenine and may be induced by inositol and choline"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07953g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02942"
FT                   /db_xref="GOA:Q6CXI5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR035812"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI5"
FT                   /protein_id="CAH02942.1"
FT                   /translation="MSTEKPGRTILASSISKTYVQEITGKVESLRNIRPDGPLLVGFLA
FT                   NNDPAAEMYASWTQKTCESMGFRYELRRIEDRDFLEEAIIDANQDDSVDGIMIYFPVFG
FT                   NAQDQYLQQVVSREKDVEGLNHVYYQNMYHNIRYLDDQKQLKSILPCTPLAVVKILEYL
FT                   KVYNNLLPEGNRLYGKKCVVVNRSEIVGRPLAALLANDGADVFSVDINNIQKFTRGQGL
FT                   KFTKHHVEDLGAYSEELLKECCKDADVIITGVPGEKYKFPTDYIKEGAICINFSSEKNF
FT                   DESVKSKASLYVPSTGKVTISMLLRNMLRLVENKQKLQNRSASTN"
FT   gene            <709271..>710911
FT                   /locus_tag="KLLA0_A07975g"
FT                   /old_locus_tag="KLLA-ORF10340"
FT   CDS_pept        709271..710911
FT                   /locus_tag="KLLA0_A07975g"
FT                   /old_locus_tag="KLLA-ORF10340"
FT                   /product="KLLA0A07975p"
FT                   /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
FT                   YOR070C GYP1 Cis-golgi GTPase-activating protein (GAP) for
FT                   the Rab family members Ypt1p (in vivo) and for Ypt1p Sec4p
FT                   Ypt7p and Ypt51p (in vitro) involved in vesicle docking and
FT                   fusion"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07975g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02943"
FT                   /db_xref="GOA:Q6CXI4"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI4"
FT                   /protein_id="CAH02943.1"
FT                   /translation="MAIRSSSSSRIDQSPREMFQRSNSNTSSSPNIVGSLLKSWKKSTD
FT                   SFTDSKKHSSRNSPSARHMSPLRAPSHNGSQTHLHHHNHHLHHTTRDKYFKDLDEDWSA
FT                   VIDDYNMPIPMINNGGIETTLRPPAVIQDDRAIESQKSSMDSYQGTIPNLNRTISNDLK
FT                   LQYQIEVEKDVQELNSLMVRIEKFKKLIKPKDSTTQVNLPEIRKLAWNGIPMVHRPVVW
FT                   KLLIGYLPSNLKRQEQVLNRKRLEYKQGVDHIFSDNHEKDVTTWHQIEIDIPRTNPHIP
FT                   LYQFESVHNSLKRILYFWAIRHPASGYVQGINDLVTPFFQVFLSEYLSPSAKDDVYSLD
FT                   PLTYLTAEQLSDVEADCFWCLSKLLEQITDYFIHGQPGILKQVKHLSQLVKRIDCDLFS
FT                   HFESEHVEFLQFSVRWMNCLLMREFQMSMVIRMWDTYLSETSLETSIVSEDLMSDASTS
FT                   LDRKSRTSSSGPSSSDSRQTTLSEFHVFVCAAFLVKWSDELMKMDFQEIITFLQNPPTK
FT                   SWKESDIEMLLSEAYIWQSLYKDATSHWR"
FT   gene            <711231..>712958
FT                   /locus_tag="KLLA0_A07997g"
FT                   /old_locus_tag="KLLA-ORF10338"
FT   CDS_pept        711231..712958
FT                   /locus_tag="KLLA0_A07997g"
FT                   /old_locus_tag="KLLA-ORF10338"
FT                   /product="KLLA0A07997p"
FT                   /note="similar to uniprot|P06779 Saccharomyces cerevisiae
FT                   YJR052W RAD7 Protein that recognizes and binds damaged DNA
FT                   in an ATP-dependent manner (with Rad16p) during nucleotide
FT                   excision repair subunit of Nucleotide Excision Repair
FT                   Factor 4 (NEF4)"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A07997g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02944"
FT                   /db_xref="GOA:Q6CXI3"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI3"
FT                   /protein_id="CAH02944.1"
FT                   /translation="MYRARSRRNNDGSGVRGPNSALTQFLKEQGISAENIRDRWLEAQK
FT                   KEAEHPQETQKDDSETESDEDLKAGVAAKKRSRKPRAVKKQESSSSGESDDDEDDDDED
FT                   DDDYKAEARLRRLRGADLEDSDEEEEVLPVSDRKKRMLTLTNGKKTSPQLAKARHQQKK
FT                   TRRKKAANLLDKKDSLISSLQDICIKVIGKSIVEYNAQSMVEHIRDTLGGVSLENLNKL
FT                   AQALTKNRALNDDTLQLFLNTSLTTLTFYDCSKLSYEGYKRLAIFSPHLESLSLQMCGQ
FT                   LNNEALLYLAEKLPNLKELYLDGPFLINEDTWVQFFELLKGRLTAFHVSNTHRFNDNAL
FT                   SAMLRNCGSSLESLGLATLDTVTNYALLPQYLNSPNFHTLILEEPSRETDINDEVIISL
FT                   LGSIGQNLRKLSLNRCTGLTDSCIINGFLPFLSNSGQSILTDLELEELDQITTDGIVLL
FT                   FSSLQFPLLKRCSLKRCFALEDAAVVELLLNSSSTLEELNLNGLKSLTSKTFTFMACPN
FT                   LKQLNIGFVHCVDNEIVEKISKDNEKLTIIEVYGDNQVTGKCSPRNGVSIIGRQSDSI"
FT   gene            complement(<713019..>714866)
FT                   /locus_tag="KLLA0_A08019g"
FT                   /old_locus_tag="KLLA-ORF10336"
FT   CDS_pept        complement(713019..714866)
FT                   /locus_tag="KLLA0_A08019g"
FT                   /old_locus_tag="KLLA-ORF10336"
FT                   /product="KLLA0A08019p"
FT                   /note="similar to uniprot|P39682 Saccharomyces cerevisiae
FT                   YML046W PRP39 U1 snRNP protein involved in splicing
FT                   contains multiple tetriatricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08019g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02945"
FT                   /db_xref="GOA:Q6CXI2"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI2"
FT                   /protein_id="CAH02945.1"
FT                   /translation="MFEGLDQTFLKNNDEWVQSYNSVDWNDITTIDKLVVGTEALVQKY
FT                   NNPNEHVKSNIYKVFDELLGRYPLFFGYWKRYVAVKYQLDGLEGSISTLKASLHSFPTS
FT                   IDLWIDMLNVYLTHNQNDSELIRNQFRKCESLVGSHFLSHDIWDKHIAYETRLQNWENV
FT                   FEVYKQVMQQPLHQYARYYTSFKEFLEYHPEFANRESSIHLDTTFISNQEKVNKIWTYE
FT                   SQIKQPFFNIPELPENEIQNWDAYLSFLINNTEFSTELIKSTFERCLIPCLRYEYFWGA
FT                   YIDWTERTFGPECTFPLFERALRALPADNKSFKQKYIKYLESNMDPYNKLSSKHYMDAL
FT                   YTFQLKWPHDPSSTIKYLRFHKRRYFAASLNDEDKKILEQQSKYATFLDKTIKAYLSGN
FT                   ADTENHDISQQLLAMLNDTTLPILVVELIKVHWLVLKNVIQCRKHFTYFAKLDPIKTSV
FT                   LFWLTYYKFEKTQKNIARLTKFVDQLGTEIVLPTKVINDIVRDFQGFYLINADYSEYET
FT                   NLSQSRFGFDPIVHNRFKINNPTWRPNAKLTKDWYKSEKYRSNGHPGLFIDKPQIKNTI
FT                   IETLASKQLNPAPLPTFRNLEKIHQKPKFDDYMSIDYLK"
FT   gene            <715347..>717176
FT                   /locus_tag="KLLA0_A08041g"
FT                   /old_locus_tag="KLLA-ORF10335"
FT   CDS_pept        715347..717176
FT                   /locus_tag="KLLA0_A08041g"
FT                   /old_locus_tag="KLLA-ORF10335"
FT                   /product="KLLA0A08041p"
FT                   /note="some similarities with uniprot|P47113 Saccharomyces
FT                   cerevisiae YJR053W BFA1 Component of the GTPase-activating
FT                   Bfa1p-Bub2p complex involved in multiple cell cycle
FT                   checkpoint pathways that control exit from mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08041g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02946"
FT                   /db_xref="GOA:Q6CXI1"
FT                   /db_xref="InterPro:IPR034586"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI1"
FT                   /protein_id="CAH02946.1"
FT                   /translation="MSIRPVVLDDVGETSFEDVESTFTYKDDIEVPRLAPNSATSTTTE
FT                   NTTFSKDKRYSSHTELASDLDDDMNYNSDFEEYQNGTDLPLAVDRRFRESSDQDELADL
FT                   QEQLEKKLSLNLRNSKTGGGSGTRNVDQYINHAGLVRPSLKDSVRQRRSMVDLATRSKG
FT                   NITSLNSQQSRRVPNSRSYMNLRPSSGRTLSYKSSMPSLMRFNRQDVLLEDEDDEDDDE
FT                   DEDDEPYPYVPRVRRSYRDLGPRFGERTDDGNVVQDIAVEATEMANNGDDDDDNFGNDF
FT                   EGIDDNFQFATNNNNNFSAFDPTLRLSPSEYDIEHDDTLLTPQLHKKHYAFDAPLDSYR
FT                   EARQQRGTAKQAAAAAAVNRRNSTRARARLKTIRQEIDLNTPLKRGKMKYNPREKRWDG
FT                   NEDILSSFDNIENVDRKAFIIKNKRSKSPLKTSSSTQIAASGTNAASSNSQHGKVVGKM
FT                   RFDEKNLRWLRVDGTEEDPFHGITDLMPRSQSSPTKNVKFQSQGHSGNILRSQSQLPFG
FT                   RDEHGNRFISSESTRFHSLTTNSTTDPTYQITSKQLEKFYHEENKWSRKVGGWFILGDK
FT                   SRDTGSADQSHTSLNDKSYMYEIRNMVISSARN"
FT   gene            <717703..>719253
FT                   /locus_tag="KLLA0_A08063g"
FT                   /old_locus_tag="KLLA-ORF10333"
FT   CDS_pept        717703..719253
FT                   /locus_tag="KLLA0_A08063g"
FT                   /old_locus_tag="KLLA-ORF10333"
FT                   /product="KLLA0A08063p"
FT                   /note="some similarities with uniprot|P47114 Saccharomyces
FT                   cerevisiae YJR054W Vacuolar protein of unknown function
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08063g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02947"
FT                   /db_xref="GOA:Q6CXI0"
FT                   /db_xref="InterPro:IPR031606"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXI0"
FT                   /protein_id="CAH02947.1"
FT                   /translation="MFDNDRKLDLNSKTFDVLDLELFKNYRFKTVVSYVFIFWGLTILK
FT                   VVLFASDIYTCIKLLAFNSWSNNIIKPYLSFKISKWLFSGCILASIALMLWEVINGIRI
FT                   YRTRSIALTYVNNFSRMVNSITNYNIFCVYNKITPKGRFQKISFYTFFEFKDCVRLLFT
FT                   DTPRQVINGLTLWSVLVTNNNGANLGQLENFDGLITKIKIIADTNHQEAVLLSFMLLSF
FT                   AIWTVFMAKLIVAVIFAPFVYHTIYSNYSVRGLKELVCTTVNKRVDELVEKYKWKKDQK
FT                   TALQKGLIDGITVPSFDDIEKSTTNDTQFHFDYTSRGTSNTLAMSNYKLGNSSTSDQLS
FT                   RKFVPVPFTSVINQDADRSTEFLPPPRTVFPSQLGSRPKPNSEPTLAPAVNPFRSKPLN
FT                   ETTDSLDSTLNGSNVESAFNSKRTFVKQLTLEKTDSDPDFGQKINDIVDDYGDDTESLL
FT                   VPHNPFSSSKSHVTTPDRVYFNDDTPLPARSTSIMDRRLRMETEDYAVYAERFNMSRR"
FT   gene            <719495..>719566
FT                   /locus_tag="KLLA0_A08085r"
FT   tRNA            719495..719566
FT                   /locus_tag="KLLA0_A08085r"
FT                   /product="transfer RNA Arg (CCT) cove"
FT   gene            complement(<719825..>720982)
FT                   /locus_tag="KLLA0_A08107g"
FT                   /old_locus_tag="KLLA-ORF10331"
FT   CDS_pept        complement(719825..720982)
FT                   /locus_tag="KLLA0_A08107g"
FT                   /old_locus_tag="KLLA-ORF10331"
FT                   /product="KLLA0A08107p"
FT                   /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
FT                   YML048W GSF2 ER localized integral membrane protein that
FT                   may promote secretion of certain hexose transporters
FT                   including Gal2p involved in glucose-dependent repression"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08107g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02948"
FT                   /db_xref="GOA:Q6CXH9"
FT                   /db_xref="InterPro:IPR022757"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH9"
FT                   /protein_id="CAH02948.1"
FT                   /translation="MEVYVRMNDDLEYDYAFQVQKDDTLEQKIALIFNKEKGLSRFMVL
FT                   KPSIFYKNEPSGFRKSMHPGFLTENGCLLFDYSADDSEYLEDLEVSKKTVWEQLWPGQL
FT                   VLPKWEKDWKTIWTFVTIMLVWLYTDLPDCISPTPGICLTNQLSKRFASLADNAGLTFV
FT                   AEKLREELEINSVSVTAQWLFFVFHIVKIVILSSFFYTGLVNPVSFNPLRSLLNKKSAI
FT                   SNGNSELKSTLQTIGWVGARRAIYDDYRDKYYQYVIDKSGGPLHAYRKGIMKQAANPGV
FT                   TLSAGEGFQTELSNRFNHNTFETMKSSGKFKLSEDYFLQLETDLKENIKACDGDVAKIN
FT                   AEIRNFRKYGLFECGPELTELVQLRKKVDAAPETEPLPEQEKKEQ"
FT   gene            <722217..>726026
FT                   /locus_tag="KLLA0_A08129g"
FT                   /old_locus_tag="KLLA-ORF10329"
FT   CDS_pept        722217..726026
FT                   /locus_tag="KLLA0_A08129g"
FT                   /old_locus_tag="KLLA-ORF10329"
FT                   /product="KLLA0A08129p"
FT                   /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
FT                   YML049C RSE1 RNA splicing and ER to Golgi transport
FT                   involved in secretion and RNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08129g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02949"
FT                   /db_xref="GOA:Q6CXH8"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXH8"
FT                   /protein_id="CAH02949.1"
FT                   /translation="MTQDSEVLLWHTVLQRHRNYVHSCIGDFTLDRSSLATAEADTTSV
FT                   KGPRSSKKRKELQLCLATQDCVELYDVSNGTLDALGKWPIAATILSMTKLNMDRCSHTI
FT                   LVLITDSGNLTFWQFERDSVSGKVYVRTLANEPISRSGIRRFVPQYQMVSDPQSRCVFF
FT                   SGIERSKMCVLADWQRGKLVVGSPIEIQRSDRITLASAACDVSFDNPVNAAIEVESGTN
FT                   DYYLSFYTMDLGLNTLLLRKEHLLEDKSINFVMQCPNLQQYKIKTRPNDETDQDSVNPF
FT                   VICGYDGYLTLIDLEGFYEVSVQLPVRKTVSSTNIINGTIHKLKKDFFILMQSNHGDMY
FT                   KVGIIPDEETKAPVLEIAYFDTLPTSEDIHIFKSGALFNVSEFGTSYLTQFESLGEDLE
FT                   KITSYTPGRRSFIETESTLKNLSILDSLTSLNPLTSFHASNSTPLTILAAANQTENLVK
FT                   LTSAVDFEELISTTLPRIPSKLWTVRIPKNETHSLIFLSMETSTTILKIHEGTVEDFGG
FT                   DSNPFILNKPSLFVGAMVQRSIIQVTRDCLLQIIEMHDGPYTKKLEWYPPAGVGIVTAF
FT                   CNETQLVVALTNHEICYFEIIEDSLNELQDRVEMDSTVNSIALLAGQKSGYCVLGCEDS
FT                   SLQILNLQSKHPDFFTICAIQSLISKPHSLLFMRDTSDLKIHVGMKSGVYLSSKLNIND
FT                   GTVFDVRTRFVGTKPVQVNLLDNIDINHKDDDDDEPGENDSKIDDFKKKISDFTPLVVL
FT                   NSSISWVTYEIDDKITLRPLKTDEGITLKHINAFITDDIKRNGCCSITSKGQLLIGKLD
FT                   NFLSWSNWFNEKKYTLVNDELKNAGNEEEDEDEDEDEDEDASEKYEIVGYQSQRILSDT
FT                   TDNSLSYVISKTANKETSLSAIRDDKLLATNNGNTVVIIAKEVFNAVCSCNFGTNVKYI
FT                   VISTESGKFIVIQIRVKNNVLETQYIHETMVHSKVNAMVSFGDKLACCILGNVVLFGLG
FT                   KKQLLRKSITEMPPYITQVTALDQWDGTMLAVGDIRESVTIFKYDIDNNSFIGVADDIV
FT                   KRHVTTVKFIDVSSVIGGDRFGNCWVLRVNYESDTRVASNIKACQYTLETLCHMYMNDT
FT                   PMKFEIVNHMNMSDRPAILWIGLQGTIGCFVPLITRKEQQLYQSFQSTYAELDVLHFQD
FT                   NNKPEEVDLEETEGALDEAYHTTKNTDHQDYVEGVISRVGRDFLSYRSSYAPSKNIIDG
FT                   ETLEQLTTYLPSDQRWIASKMKHADSGKLDIFNKYINEMRTNYV"
FT   gene            complement(<726017..>726985)
FT                   /locus_tag="KLLA0_A08140g"
FT                   /old_locus_tag="KLLA-ORF10325"
FT   CDS_pept        complement(726017..726985)
FT                   /locus_tag="KLLA0_A08140g"
FT                   /old_locus_tag="KLLA-ORF10325"
FT                   /product="KLLA0A08140p"
FT                   /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
FT                   YML050W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02950"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXH7"
FT                   /protein_id="CAH02950.1"
FT                   /translation="MNLYSYSRIIKFPGHNALVLKRLFHRPYQFKSVPDDIKNNLVTEC
FT                   ECFVKRLNEKLPDKSQLDISLTLPNKVPEYHKHVLMLSKDPKGWKNWPSKLEMAHEYPH
FT                   SMVGTLKSSLKDTRDGSGVLVNELALDGYTSSETHLKFLVIPDMKVYEVHRDRVSDFAL
FT                   FLGDGKQDSRKKLSFNDFLKGSDAVGQTAIHSSGSVANSIPNFQSEPFHSDIAMVCGHY
FT                   LRDARCGELAPLLIAKLNSIKPNLKTGIVSHFGGHKFAGNLIYYQFNGLKIHNDNETGK
FT                   IDGLWLSKLLPQNLEFVFRHLDKDIILQDFYRGHMSTAAYT"
FT   gene            complement(<727416..>728789)
FT                   /locus_tag="KLLA0_A08162g"
FT                   /old_locus_tag="KLLA-ORF10324"
FT   CDS_pept        complement(727416..728789)
FT                   /locus_tag="KLLA0_A08162g"
FT                   /old_locus_tag="KLLA-ORF10324"
FT                   /product="KLLA0A08162p"
FT                   /note="uniprot|Q06433 Kluyveromyces lactis KLLA0A08162g
FT                   GAL80 Galactose/lactose metabolism regulatory protein
FT                   GAL80"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02951"
FT                   /db_xref="GOA:Q06433"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2NVW"
FT                   /db_xref="PDB:3E1K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06433"
FT                   /protein_id="CAH02951.1"
FT                   /translation="MNNNKRSKLSTVPSSRPIRVGFVGLTSGKSWVAKTHFLAIQQLSS
FT                   QFQIVALYNPTLKSSLQTIEQLQLKHATGFDSLESFAQYKDIDMIVVSVKVPEHYEVVK
FT                   NILEHSSQNLNLRYLYVEWALAASVQQAEELYSISQQRANLQTIICLQGRKSPYIVRAK
FT                   ELISEGCIGDINSIEISGNGGWYGYERPMRSPEYLYDIESGVNLISNSFGHTIDVLQYI
FT                   TGSYFQKINAMISNNIPTQFLLDENGKRTKETISKTCPDHLLFQGILENGKVPVSCSFK
FT                   GGTPVKKLTKNLVIDIHGTKGDLKIEGDAGFVEISNLVLYFYGIKNGNGSSNGTDNNGA
FT                   AAIKDKEKVTKSPSPSTGTSEEEQTMEVFHLRNYNSVVGNILRIYESIADYHFLGKPES
FT                   KSSRGPDDLFASTKFDKQGFRFEGFPTFKDAIILHRLIDAVFRSDKEEKTLDVSKIMI"
FT   gene            complement(<729440..>730312)
FT                   /locus_tag="KLLA0_A08184g"
FT                   /old_locus_tag="KLLA-ORF10321"
FT   CDS_pept        complement(729440..730312)
FT                   /locus_tag="KLLA0_A08184g"
FT                   /old_locus_tag="KLLA-ORF10321"
FT                   /product="KLLA0A08184p"
FT                   /note="similar to uniprot|P54003 Saccharomyces cerevisiae
FT                   YML052W SUR7 Multicopy suppressor of rvs167 mutation
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02952"
FT                   /db_xref="GOA:Q6CXH5"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH5"
FT                   /protein_id="CAH02952.1"
FT                   /translation="MSAVGSILTKFVSLLFLMGSTMLLIFIVLSGSIEHSPVNEFYWLQ
FT                   ADTSNITGAPALSRWTFWGLCGVSGNKNVNCSSLEPAYPLSPVDDFGTTEGFPSDFVNN
FT                   RDTYYYLTRFSFCFFLIALVFIGVGLIFYVLSWCSYSFTKTVFVTIVIGTLLNMAASAC
FT                   QTAATVLAKNAFKDADVSVDIGVKLMAFSWTTVALNIMLFFITGASFIRKAYKAHKEFV
FT                   ELQNYKEQALSYEQQQQQLQFQQQQQQQDLEATGAGTAIDEPQPQESHQTGIKFFKIRR
FT                   TQKSDEESI"
FT   gene            <730940..>731632
FT                   /locus_tag="KLLA0_A08206g"
FT                   /old_locus_tag="KLLA-ORF10317"
FT   CDS_pept        730940..731632
FT                   /locus_tag="KLLA0_A08206g"
FT                   /old_locus_tag="KLLA-ORF10317"
FT                   /product="KLLA0A08206p"
FT                   /note="some similarities with uniprot|P53907 Saccharomyces
FT                   cerevisiae YNL144C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH4"
FT                   /protein_id="CAH02953.1"
FT                   /translation="MYIYIYRYRYIARTYPCPLPCCTCPTADQQHQTPTMEPLPPYTPS
FT                   LQISFLLQTQFEHSHRWTPHCVEINSTQLLIRPLIHSHDEKLINKWYSKLDELEYKQYK
FT                   ATSNHQLCHDQLVQSTQVPNQRDHIVLCTAKGLYLEKDKSLNLIQWNRDPIKKYSLQDC
FT                   RIGLNTDMSRCLRIRCEREQFLLRVPDDASVTSLFAKIACAAELAVPMDSKSHDPLPLK
FT                   LMPWEDVM"
FT   gene            complement(<731744..>731842)
FT                   /locus_tag="KLLA0_A08228r"
FT   tRNA            complement(join(731744..731780,731803..731842))
FT                   /locus_tag="KLLA0_A08228r"
FT                   /product="transfer RNA Tyr (GTA) cove"
FT   gene            <732629..>732700
FT                   /locus_tag="KLLA0_A08294r"
FT   tRNA            732629..732700
FT                   /locus_tag="KLLA0_A08294r"
FT                   /product="transfer RNA Gln (TTG) cove"
FT   gene            <733200..>735302
FT                   /locus_tag="KLLA0_A08316g"
FT                   /old_locus_tag="KLLA-ORF10313"
FT   CDS_pept        733200..735302
FT                   /locus_tag="KLLA0_A08316g"
FT                   /old_locus_tag="KLLA-ORF10313"
FT                   /product="KLLA0A08316p"
FT                   /note="similar to uniprot|P32340 Saccharomyces cerevisiae
FT                   YML120C NDI1 NADH:ubiquinone oxidoreductase transfers
FT                   electrons from NADH to ubiquinone in the respiratory chain
FT                   but does not pump protons in contrast to the higher
FT                   eukaryotic multisubunit respiratory complex I which is
FT                   absent in S. cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02955"
FT                   /db_xref="GOA:Q6CXH2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH2"
FT                   /protein_id="CAH02955.1"
FT                   /translation="MFATGISKGLIGVALPIRSIHGSMRGPIQTVNKLPLRAVCLASFK
FT                   PSVRNFHVSSCLRSEIEQEKSTPPVGLVKTSGFTSKLGKLVKWSIFTAGIVASGVGAII
FT                   IGFFIYDSTTYKSCGTAVEIKVPKLALNPELGGPENLPILRETLDAYDSEMKELTSYKP
FT                   KLVVLGSGWASVGLLKNLNPGDYDVTVVSPQNYFLFTPLLPSAATGTLEVKSLMASIRK
FT                   IVNDVNGHYLEAYAEKVEFDEKLIKVSQINTKTGAKDSFYLPYDKLVIAVGSTSNTHGV
FT                   EGLQYCSRLKTAEDAITLRKKIKTLLERACLPTTSDEERRRLLSFVVCGGGPTGVEFAA
FT                   EVFDLLNEDLPSMYPRILRQQLSVHVIQSRSNILNTYDEKISEYATQRFRKETIDVLTN
FT                   SRVERILPDRVIFKQKDDKTGEVELKEIPFGICLWSTGVSQNPLTKQVVHSLAHSQRNK
FT                   RAIETDSYLRVIGAPTEDVYAIGDCSTVRTDLADHTADYIRRFIVNRHLSLTRSNEIIT
FT                   DEDIKHLSLSYNEIIDIAKQVARRHPQTREHLIHLEDDLPKYDVNKSGQLNFDQISTLL
FT                   REVETKVTSLPATAQRAHQQGKYLGKKLTKVARSANKDSIQGIHEKGIDEKVYRPFRYV
FT                   HLGSLAYIGNSAVFDLPGYSFVGGLIAMYLWRSIYFAQTVSWRTRVLLFMDWLKRGMFG
FT                   RDILSE"
FT   gene            <736461..>738761
FT                   /locus_tag="KLLA0_A08338g"
FT                   /old_locus_tag="KLLA-ORF10311"
FT   CDS_pept        736461..738761
FT                   /locus_tag="KLLA0_A08338g"
FT                   /old_locus_tag="KLLA-ORF10311"
FT                   /product="KLLA0A08338p"
FT                   /note="similar to uniprot|P39684 Saccharomyces cerevisiae
FT                   or to YHR015W uniprot|P38760 Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02956"
FT                   /db_xref="GOA:Q6CXH1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH1"
FT                   /protein_id="CAH02956.1"
FT                   /translation="MSFEAESSLTLSDIPLNIQRNNNIHHHGNSKYSLVKGLMGKTVKN
FT                   ERCNSKKEEENTAEQSDDDEDDENNNGNSSNNHHQHHGRGEKSYQHQNQLHSATDSRGS
FT                   SSTDTTSTGSDVVNLSNSKHSTQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKS
FT                   FNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRK
FT                   NIGTNVFFSNLPLDNTKLTTRVFYDEFKKFGKILSCKLDRRKNIGFIYFENDAAAKEAI
FT                   KQYNGKEFFDSTIMCGVHFDRNVRKSPEFEQKINRINNLTVVKEKLEMEDDNNVTTDPS
FT                   ENGKKDVVAGNDTDDDDDDKAVGNATKSLVEETNKESKNTKLPHPNAIFVKNLPINPSH
FT                   DNLLNFFSKIGPVKSVYTSDVSKFDSSWAFITYKRIQDTKTAIEKLNGCKYMKRTIEVK
FT                   KTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQERIKTERVVVRYYE
FT                   EKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASWQQPKDVKLIEVEPSYRNHDN
FT                   NGNTSNDRRSRGSKHGYVYRAPAPNYRPPKNVRNFNKPSGSRVSQNPQMIYHHPNPYHQ
FT                   LQQQHYIGNIHQPMVPRAAAVMGDSSINKGVGIGISIEEPSRKAYSYEAKKQLITMLKK
FT                   ETKRCIDFLQHPVATRDENVSTIASYIMDVYYKPNYDTLAQLLLLKTGNNYYERVFQSQ
FT                   VELAIEKLGLQER"
FT   gene            complement(<739092..>740764)
FT                   /locus_tag="KLLA0_A08360g"
FT                   /old_locus_tag="Klla0A.mRNA.451.m"
FT   CDS_pept        complement(join(739092..740316,740718..740764))
FT                   /locus_tag="KLLA0_A08360g"
FT                   /old_locus_tag="Klla0A.mRNA.451.m"
FT                   /product="KLLA0A08360p"
FT                   /note="similar to Saccharomyces cerevisiae YFR024C-A LSB3
FT                   or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
FT                   YHR016C YSC84"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02957"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="InterPro:IPR033643"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXH0"
FT                   /protein_id="CAH02957.1"
FT                   /translation="MGINNPIPRSLKSETKKAAKVLASFVKPNQVLSANDVIPPEVLKS
FT                   AKGLAIITVLKAGFLFSGRAGSGVIVARLPDGGWSAPSAIAMAGAGAGGMVGLELTDFV
FT                   FILNTADAVKSFSQFGSITLGGNVSVAAGPLGRNAEAAASASTSGVAAIFAYSKTKGLF
FT                   AGVSLEGSVIIERREANRKFYGNNCTAKMILSGRVRPPPSVDPLFRVLESRAFNYRSPR
FT                   GDNYDDDDDYDEDEDGEYYNDIPSSFDSDDLDSQRPNTRSTRRRANSYRSTTSDDSDDY
FT                   LDEDEERYSSSRYSRRQGPSSNSRWEDEVYDLNDRFERTNLNTRNARGGPSRPKSEKPD
FT                   FGSSSFSRGSPRGNSSANSPARNSGAPKAVALYTFKGEESGDLPFRKGDVISIIKKSES
FT                   QDDWWTGRVNGKEGIFPANYVELV"
FT   gene            <741712..>742857
FT                   /locus_tag="KLLA0_A08382g"
FT                   /old_locus_tag="KLLA-ORF10307"
FT   CDS_pept        741712..742857
FT                   /locus_tag="KLLA0_A08382g"
FT                   /old_locus_tag="KLLA-ORF10307"
FT                   /product="KLLA0A08382p"
FT                   /note="similar to uniprot|Q757L8 Ashbya gossypii AEL018C
FT                   AEL018Cp and similar to uniprot|P32792 Saccharomyces
FT                   cerevisiae YHR017W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02958"
FT                   /db_xref="GOA:Q6CXG9"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG9"
FT                   /protein_id="CAH02958.1"
FT                   /translation="MSDQVLDYCFGAYKHTVDAVCNSGKNTVDLAKGLVKKTKSLYDKS
FT                   LKGLSDEELANLYEDPAIHSESTSNMFSKMGNRVWAHRGLLLVGVGLTSAGLLLYSSTH
FT                   YLMNALPTHLTDDNQVLLVLGDIRDPVVRNQVNELYRRRFIVFVCKRKLKYGTGEPEDD
FT                   FTIDDLTSDDGGIFYIDADSSGLASFIQYMNDHSEKQLRSILFMPNLSYYPSGNTLSSK
FT                   LVTNEVQENILNYYGVLEKLIPHFAGNAFKKLQLIFFNPSLSKNLQLKHHSVEHLVSGL
FT                   ISTFYETMKIEYSHQCDVYMCHIGILGIGGNASTFKYLSVKGSNISKSLCEPIYQLILS
FT                   RDYMWLRLKRWLSGSILYCGKGSALTSWLGYLCPLWLLDLF"
FT   gene            complement(<743192..>744577)
FT                   /locus_tag="KLLA0_A08404g"
FT                   /old_locus_tag="KLLA-ORF10306"
FT   CDS_pept        complement(743192..744577)
FT                   /locus_tag="KLLA0_A08404g"
FT                   /old_locus_tag="KLLA-ORF10306"
FT                   /product="KLLA0A08404p"
FT                   /note="highly similar to uniprot|P04076 Saccharomyces
FT                   cerevisiae YHR018C ARG4 Argininosuccinate lyase catalyzes
FT                   the final step in the arginine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02959"
FT                   /db_xref="GOA:Q6CXG8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG8"
FT                   /protein_id="CAH02959.1"
FT                   /translation="MAEKQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYT
FT                   SGLQKIGLLTEDELSKIHAGLKQIEQEWSDGSFVREADDEDIHTANERRLGEIIGRGIA
FT                   GKVHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQ
FT                   RAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDREFLAAGLN
FT                   FNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDLIIYSTAEFGFIQLSDAYSTG
FT                   SSLMPQKKNPDSLELLRGKSGRVFGQLAGFLMSIKSIPSTYNKDMQEDKEPLFDCLTTV
FT                   EHSILIATGVISTLAIHKEKMEGALTMDMLATDLADYLVRKGVPFRETHHISGQAVALA
FT                   ESLNVSGIDKINLQQYKSIDERFEQDVFEVFNFEKSVERRDATGGTAKVAVLKQLKNLA
FT                   SQL"
FT   gene            complement(<745048..>746712)
FT                   /locus_tag="KLLA0_A08426g"
FT                   /old_locus_tag="KLLA-ORF10304"
FT   CDS_pept        complement(745048..746712)
FT                   /locus_tag="KLLA0_A08426g"
FT                   /old_locus_tag="KLLA-ORF10304"
FT                   /product="KLLA0A08426p"
FT                   /note="highly similar to uniprot|P38707 Saccharomyces
FT                   cerevisiae YHR019C DED81 Cytosolic asparaginyl-tRNA
FT                   synthetase required for protein synthesis catalyzes the
FT                   specific attachment of asparagine to its cognate tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02960"
FT                   /db_xref="GOA:Q6CXG7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG7"
FT                   /protein_id="CAH02960.1"
FT                   /translation="MSVYVNEFSGVDESTVAGTEQQPFKTAAFALYSKAESEPKEIYVF
FT                   KKEDDGAEGAYVEISASALKKAKKGVEGLKKKAAKQKELEQKQQEQEAKNAAKKLEAMN
FT                   ITIEEDLSLPKAERRKIRSAYDAVDKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVL
FT                   TGDLARSYQIVNLTLETTITLYGTIKVVPESKSAPGGVELFVDYFEIVGPAPSGENAFT
FT                   NRVQENADPSILLDQRHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQT
FT                   QVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLAALGDVYCIQESFRAEKSHTRRHLSEY
FT                   THIEAELCFLDFDDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEY
FT                   KDAIEWLKEHGIKNEEDKEFQFGDDIAEAAERKMTDTIGVPILLTRFPLEIKSFYMKRC
FT                   DDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGFKREGIDPAPYYWFIDQRKYGTC
FT                   PHGGYGLGTERILAWLCDRFTVRDCSLYPRFSGRCKP"
FT   gene            <747134..>749152
FT                   /locus_tag="KLLA0_A08448g"
FT                   /old_locus_tag="KLLA-ORF10302"
FT   CDS_pept        747134..749152
FT                   /locus_tag="KLLA0_A08448g"
FT                   /old_locus_tag="KLLA-ORF10302"
FT                   /product="KLLA0A08448p"
FT                   /note="highly similar to uniprot|P38708 Saccharomyces
FT                   cerevisiae YHR020W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02961"
FT                   /db_xref="GOA:Q6CXG6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG6"
FT                   /protein_id="CAH02961.1"
FT                   /translation="MSLEETFSKLQINASDDAVVVKSLVFKPKTPKSQTPVPIVVVALH
FT                   STTTPSGLIASVTSTKDPRLARDELFQSQFKIQSGKEFHLGHLAQAEGAFKLLLDQQLV
FT                   ALADDTVLQLNDEKFVKKSDLIGKYLNSFEPLEVDFSQVVEVAKKEASAPAPAKSAASL
FT                   EDAKLIGVTVDKALDFSGWYQQILTKGEMLDYYDVSGCYILRPASYAIWEQIQRWFDDR
FT                   IKGLGVQNAYFPMFVSSRVLEKEKDHIEGFAPEVAWVTRAGTSELDEPIAIRPTSETVM
FT                   YPYYAKWIQSYRDLPIKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEAAEEE
FT                   VMQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHL
FT                   GQNFSKMFNISVENPLGSEHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQF
FT                   QSVVLPVGITTKTSDEQRAKIHENARAIESRLKKAGIRAFGDYNDNYTPGWKFSQYELK
FT                   GIPLRIELGPKDLEKEQVTCVRRNDGKKIVVSLNDLEKRIPEILEELQQDLFNKAKELF
FT                   DTHRVIVDEWKDFVPALNKKNVILSPWCGVEECEEDIKDASAKKDDGEEIEVDDKSPSM
FT                   GAKSLCIPFNQPTLKPGQKCVKCTRLAKTYCMFGRSY"
FT   gene            complement(<749442..>750446)
FT                   /locus_tag="KLLA0_A08470g"
FT                   /old_locus_tag="KLLA-ORF10300"
FT   CDS_pept        complement(749442..750446)
FT                   /locus_tag="KLLA0_A08470g"
FT                   /old_locus_tag="KLLA-ORF10300"
FT                   /product="KLLA0A08470p"
FT                   /note="similar to uniprot|P38635 Saccharomyces cerevisiae
FT                   YFR025C HIS2 Histidinolphosphatase catalyzes the eighth
FT                   step in histidine biosynthesis mutations cause histidine
FT                   auxotrophy and sensitivity to Cu Co and Ni salts
FT                   transcription is regulated by general amino acid control"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02962"
FT                   /db_xref="GOA:Q6CXG5"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG5"
FT                   /protein_id="CAH02962.1"
FT                   /translation="MYSHHSHSGDYVAHGVDPLEDIITEVKRRKFHTWCMTEHMPRLEL
FT                   ELLYPEEKTNESSTEEDLKILVKKFEAYMIHAKRIKDRETASENGLHILIGFEIEGCDL
FT                   EHMRYANELLRRNNNVLQFMVGSVHHVHNIPIDFNQEKWNEALKVSGNNLRQLLYDYFT
FT                   IQRKMLETTQPLVVGHFDLIRLFLPDDMRVDLESGQVLSEGGTLVKDLESVMTQWSDVK
FT                   QLIVESLKYVVSYGGVVEINSAGLRKGKVDPYPHRDIVNLSKEVTPSIRYVTSDDAHGV
FT                   SQIAVCYDEMLNYIENVVQLKQISYLEEQDDGNIQIKDIFVEEVKRSEFWSIK"
FT   gene            <751047..>752168
FT                   /locus_tag="KLLA0_A08492g"
FT                   /old_locus_tag="KLLA-ORF10298"
FT   CDS_pept        751047..752168
FT                   /locus_tag="KLLA0_A08492g"
FT                   /old_locus_tag="KLLA-ORF10298"
FT                   /product="KLLA0A08492p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02963"
FT                   /db_xref="GOA:Q6CXG4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG4"
FT                   /protein_id="CAH02963.1"
FT                   /translation="MAKVVVVGAGISGLSVAHSLLELYGRDKIEELVIIARDIPGTFTS
FT                   YDYTSPWAGANWDSFAAPDDHAQIKRDTVTYEWFTELARSKPETGVKEYTLKLVTRKET
FT                   IPWFVRDNFVRDLKQMSEEELKYRNLDPQDYHGFEFTTFTVTPSTYKFWMVNEIKKMGG
FT                   KLRQLAKIDAIENIPEIVGFVPDLVINATGVHAGQFLRHYEPSEVEKVYPVKGQIVQIY
FT                   EDLPFQIVVEPLPKDDNPASDQFLNMFPRGDGGCIIGGIMRKNDWSNTVDDELTKKIVE
FT                   VCKRHTPELKNPTIYNSYVALRPGRKDGVRVEYSEFDLPKNQGKLKVIHNYGIGGAGYQ
FT                   ASRGLALEASALAAANVLGLPKFISRKACPYKL"
FT   gene            complement(<752342..>752414)
FT                   /locus_tag="KLLA0_A08514r"
FT   tRNA            complement(752342..752414)
FT                   /locus_tag="KLLA0_A08514r"
FT                   /product="transfer RNA Ala (AGC) cove"
FT   gene            <753262..>754161
FT                   /locus_tag="KLLA0_A08536g"
FT                   /old_locus_tag="KLLA-ORF10297"
FT   CDS_pept        753262..754161
FT                   /locus_tag="KLLA0_A08536g"
FT                   /old_locus_tag="KLLA-ORF10297"
FT                   /product="KLLA0A08536p"
FT                   /note="some similarities with uniprot|P25587 Saccharomyces
FT                   cerevisiae YCL005W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02964"
FT                   /db_xref="GOA:Q6CXG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG3"
FT                   /protein_id="CAH02964.1"
FT                   /translation="MGLLALAETSLGFITRILATLYLYTLQLMMSTVYMSVRTVHKVVI
FT                   HPVKRIIHYVVVIPSEIIFRNLAALVLLPINIPLYILFGSSVKSLYHSFDANATTFGVI
FT                   MLSQYVLSMLILGFTLGIMTGVFLSSFHKFVPIPNIYWEPSIGGFIESIKGLLFSRPTE
FT                   SPREHPYRVPIPRLSTKRQSNMPDSSLYTDANVDAAASAAVSSILETASDLDLDLMPHH
FT                   QPDIGNMTPLSLPDTNEDSDQELGSDEDLSEMSRFWGNEQGYGVDTIRTEMTDDINHLI
FT                   YRNRIKKDAENVVDIRNL"
FT   gene            complement(<754348..>754419)
FT                   /locus_tag="KLLA0_A08558r"
FT   tRNA            complement(754348..754419)
FT                   /locus_tag="KLLA0_A08558r"
FT                   /product="transfer RNA Arg (TCT) cove"
FT   gene            <754857..>756479
FT                   /locus_tag="KLLA0_A08580g"
FT                   /old_locus_tag="KLLA-ORF10295"
FT   CDS_pept        754857..756479
FT                   /locus_tag="KLLA0_A08580g"
FT                   /old_locus_tag="KLLA-ORF10295"
FT                   /product="KLLA0A08580p"
FT                   /note="uniprot|Q874C6 Kluyveromyces lactis PGS1 CDP-
FT                   diacylglycerol-glycerol-3-phosphate 3-
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02965"
FT                   /db_xref="GOA:Q6CXG2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG2"
FT                   /protein_id="CAH02965.1"
FT                   /translation="MFHRLRSGIERLTCLPVWSNTYKRPVNTRPIVESVKSVSMATVTE
FT                   ESDQQVRKLKLTGQDGNGFLDMVKEKLSFLNTKVYLRQGEVEILDHPVQFYSTLKNKIS
FT                   AAQNRVFMASLYLGKTENDLINCISDSLKKNKDLKVYFMVDGLRGTRETPNKCSASLLA
FT                   ELEKEFGERVEIRLYRTPEFVGWKTLIPKRFNEGLGLQHMKIYGVDEEVILSGANLSND
FT                   YFTNRQDRYYVFKNKFLSDYYFKVHQLVSKISYRVRHANNEQKYHLEWPESNVAVEPLK
FT                   DKHKFIEKCSSIFTDFLRGPSSMGNAHLIKDFSQYPTIVYPVSQFTPLFQPHHDVSTEK
FT                   PGVLSILSCLSNPMSRWTFTAGYFNMLPEIKQRLLDSPSIQGQVITASPYANGFFQSPG
FT                   VSGHLPDAYLYLSQGFLKDVHRHGKENHIKLREWKHGIVNQANGWSYHAKGLWLSEPGN
FT                   DKRPCLTIVGSSNYTRRAYSLDIETNAIVLTKDEQLKTAMQNEIDNLLKNTKEVTLGSF
FT                   EEDPDRHISTGVKLATKILGNRL"
FT   gene            complement(<756584..>757493)
FT                   /locus_tag="KLLA0_A08602g"
FT                   /old_locus_tag="Klla0A.mRNA.422.m"
FT   CDS_pept        complement(join(756584..757326,757472..757493))
FT                   /locus_tag="KLLA0_A08602g"
FT                   /old_locus_tag="Klla0A.mRNA.422.m"
FT                   /product="KLLA0A08602p"
FT                   /note="similar to uniprot|P25565 Saccharomyces cerevisiae
FT                   YCL002C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02966"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG1"
FT                   /protein_id="CAH02966.2"
FT                   /translation="MFQRGCKFGVLYQKRYDRLHKSIYGLSYDMYALDIISRLMMIYIS
FT                   LQYMFSPLIRKQLANRFPLFYPLDGQKVVVNFFLLMAETGMIYFNLKVMKQLINYRKTK
FT                   HIHQGFSVYLFWTLALCMVFHVFTLACSTVYLPESDMGKFGIFYVEHVNYIWVNVQFFQ
FT                   CVKFVPQISLNWMGNCTKGLSSKFVIMSLVSSVAGVLSLYVNSTDATNFFLVPWNSYPL
FT                   FVFICQTMSVLLILYQAQYLYIKNSPYLPKRT"
FT   gene            <758042..>758590
FT                   /locus_tag="KLLA0_A08624g"
FT                   /old_locus_tag="KLLA-ORF10291"
FT   CDS_pept        758042..758590
FT                   /locus_tag="KLLA0_A08624g"
FT                   /old_locus_tag="KLLA-ORF10291"
FT                   /product="KLLA0A08624p"
FT                   /note="highly similar to uniprot|Q75ET0 Ashbya gossypii
FT                   AAL002W AAL002Wp and similar to YCL001W uniprot|P25560
FT                   Saccharomyces cerevisiae YCL001W RER1 Protein involved in
FT                   retention of membrane proteins including Sec12p in the ER
FT                   localized to Golgi functions as a retrieval receptor in
FT                   returning membrane proteins to the ER"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02967"
FT                   /db_xref="GOA:Q6CXG0"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXG0"
FT                   /protein_id="CAH02967.1"
FT                   /translation="MDLNTEEASADKLTSEIRRIGTLYQYYLDQLTPHVKYRWAALGGL
FT                   VFLFIVRIVISQGWYVVCYALGIYLLNQFLAFLTPKFDVSLQQNEQNEEMEAGEMTDEF
FT                   RPFIRRLPEFKFWHNSIRAAVLCFFMTFFSVFDIPVFWPILLMYFIVLFALTMRRQINH
FT                   MIKYKYVPLDIGKKKYASK"
FT   gene            <758933..>760099
FT                   /locus_tag="KLLA0_A08646g"
FT                   /old_locus_tag="KLLA-ORF10290"
FT   CDS_pept        758933..760099
FT                   /locus_tag="KLLA0_A08646g"
FT                   /old_locus_tag="KLLA-ORF10290"
FT                   /product="KLLA0A08646p"
FT                   /note="highly similar to uniprot|Q75ES9 Ashbya gossypii
FT                   AAL001W AAL001Wp and similar to YNL001W uniprot|P33309
FT                   Saccharomyces cerevisiae YNL001W DOM34 Probable RNA-
FT                   binding protein functions in protein translation to promote
FT                   G1 progression and differentiation required for meiotic
FT                   cell division"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02968"
FT                   /db_xref="GOA:Q6CXF9"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF9"
FT                   /protein_id="CAH02968.1"
FT                   /translation="MRLINKVTGSHSGERAILTLQPQDKEDLFTLYNIINTDDEIIFKK
FT                   KVTSKTEEGGKKKATQLEKLRIKVVSSEFEPQHEFLRYKGVTTEDDYSNANQDLPVGKF
FT                   FSFTIDFSYPFTLIKDDYNSYVDNLVKQACNIEGRSDMAAVVLQEGISHICLINSFSTV
FT                   LKHKIEYSIPKKKRGTDIMKFDDKVEKFYRATYASMVRHFDFDTLKCIIICSPGFYAKT
FT                   LYDKVMQYAQEDQNKKILANTGKFLVAHCSTGYLQGIDEVLKDPAYKHKLEDAKNSKEA
FT                   LVMDDFLDHLNKDDFKAWYGEHEITKAAELAAIDTLLISDSWMRSDDVNVRKKSLNLIN
FT                   EVEQTGGKAYIFSSLHNIGEELDRLTGLACILKYPVPDLDEDIDEEEE"
FT   misc_feature    760404..760598
FT                   /locus_tag="KLLA0_A08668s"
FT                   /old_locus_tag="centromere.klla0A"
FT                   /note="Centromere Klla0A"
FT   gene            complement(<761149..>762084)
FT                   /locus_tag="KLLA0_A08690g"
FT                   /old_locus_tag="KLLA-ORF10289"
FT   CDS_pept        complement(761149..762084)
FT                   /locus_tag="KLLA0_A08690g"
FT                   /old_locus_tag="KLLA-ORF10289"
FT                   /product="KLLA0A08690p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF8"
FT                   /protein_id="CAH02969.1"
FT                   /translation="MTKLVACAERKRDRLKRALHESNEKLASKLHQLKLRLSREDKNNF
FT                   AKVLTTRYSTHTINDDQFNTKPGDFEQSSVLFRDKKPKKRMLHWFLDFKTRTNNGVLSN
FT                   DKATVNGNLKAQVYDAVMYDGTLVIENQSNPIPQFVEPIPWDISMKRETITNCDPASIV
FT                   ESSSIYSQRDVYLTEKSLLSVGRLSACIGKPHTFSGFLTTADRSISDVLQTNDEHILPT
FT                   NITITEEEWLANIRCSNSDPLITSSFISELKENTHMLKTVNCNSHRPVLKDIIHDSETY
FT                   SKYSTNSNDYQISMTNIQLEKDNNNRLLDY"
FT   gene            complement(<762700..>763440)
FT                   /locus_tag="KLLA0_A08712g"
FT   CDS_pept        complement(762700..763440)
FT                   /locus_tag="KLLA0_A08712g"
FT                   /product="KLLA0A08712p"
FT                   /note="highly similar to uniprot|P53200 Saccharomyces
FT                   cerevisiae YGR001C Protein with similarity to
FT                   methyltransferase family members; required for replication
FT                   of Brome mosaic virus in S. cerevisiae, which is a model
FT                   system for studying replication of positive-strand RNA
FT                   viruses in their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02970"
FT                   /db_xref="GOA:Q6CXF7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="InterPro:IPR041370"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF7"
FT                   /protein_id="CAH02970.1"
FT                   /translation="MSDSESDGELQLSSHTLAALQAFRNEEQQREEEFQKMMNQADEEY
FT                   ERKKRQQGMDLFKEDWQLSQFWYSDNTADTLAEALLEGADEDTVIAVVSAPSVYAAILK
FT                   KPDSEIPTKHIYLFEFDKRFSLLAGEDKFFFYDFANPLDFDDKLKGKVDRLLIDPPFLN
FT                   EHCQTNSSITAKALLAPKTDEKTSKGVPKHRLMSCTGERMSEVIAKVYPDTKITTFYPE
FT                   HANGLSNEFRCYANFEWDQWKFSE"
FT   gene            <763946..>767434
FT                   /locus_tag="KLLA0_A08734g"
FT                   /old_locus_tag="KLLA-ORF10286"
FT   CDS_pept        763946..767434
FT                   /locus_tag="KLLA0_A08734g"
FT                   /old_locus_tag="KLLA-ORF10286"
FT                   /product="KLLA0A08734p"
FT                   /note="similar to uniprot|P34111 Saccharomyces cerevisiae
FT                   YAL001C TFC3 Largest of six subunits of the RNA polymerase
FT                   III transcription initiation factor complex (TFIIIC); part
FT                   of the TauB domain of TFIIIC that binds DNA at the BoxB
FT                   promoter sites of tRNA and similar genes; cooperates with
FT                   Tfc6p in DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02971"
FT                   /db_xref="GOA:Q6CXF6"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="InterPro:IPR035625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF6"
FT                   /protein_id="CAH02971.1"
FT                   /translation="MTETTVLSPDELVQKVIDEISFRKGRISLNELWDYASEYVDLNDD
FT                   NMKGYTLSNVLAHPDTILLLSGKIVNKSSMQYEDVVKNADSVQIGITDDRLWLTLTGHT
FT                   KKEASVVGLAFDLLLEVAASKDKGINTMELAKNTGQDPRSVTGRIKKFSHLVTMNQLVY
FT                   KGHLVKSLTLNRFVTEKQKKPYVNIKQHLSEIVQVVKNSKNGVRQVIDLKREMGFDKEK
FT                   RLSKAFTSAISWLDQQGYLKKVIVISPANPSIKIRCVQFVKSYFPEEVTGNNEFEDESA
FT                   DEDENEGDGDEGGTGNDDVEKTSLDEEELMEGFDKVNATNILQDSNLVIQEAPSEKKEV
FT                   TINRFYPLQTQIYSMADKAGLTGISTLDLISKFVGPDYKRCFSKNTEYFIEGTSQKSSK
FT                   SFSDNDIGLVKIYDFEGKKKFHRIFTKKNFARLTDQEAGSRHKSLPEIEEQPHTLEELS
FT                   KMNFVPLNASLRYMNDGDKDVFFWHGELDIPASTKTSVRGRKRITLPDAAAKPKRIKVA
FT                   NPTVDMKIEHDEPQIARNGTSITVNGFTGSSLKSIQRQKALLTVLKNSGGVRFIGDKFY
FT                   DSISKSMGTDMILDKKTLKKESEILAESGKLKIVEDPNTRRRLLCLPEISDEKIEEYLI
FT                   DSKDTRGKFNTEVVCKEDIYFFDQTEKDRFHRSAKAAKRIKEFERKNKKGQSSTAVDVS
FT                   IEPALAPKKLRKRTTAAKKGASTKEAKPSSKSKSKKTEIPSNIRTTFHSGTKEGITALV
FT                   YAVAITKSIKGQIAWDEITKLFPHNAIENLKKQWRVKRVRMGESGWRALMEKWRKIMVE
FT                   AIKDERATLADAEQLNLVKLVDLWLSVEKDSTHTVKLYKEYSVNRAKYTFVPLTNKSKT
FT                   ETKGKGIAMSSMIQRECFLLNKKYSYQESVQPKSKSVEDEIKTVVRSMLFDKTLVEAGE
FT                   VDILQQFNHEQVDKVILDMAKERLVTFVDSSKLQLTDKIYDVLKYLGDPSFLENSSAFR
FT                   KTLIELFNNKNTLVLSEEPQRHIPCVLLDVIDNFNIKSAVVPLEVQHKKMYYTTRQYEV
FT                   RALTPPLVFYSVDTIKEKKVKKVNIPVNKPFSRLWINGNSEIRPSVWKSVISILLKEIL
FT                   FNPGITESVISNRYATLLSSEEVSEVVKWLSNTQRISAIDYGGYTVCDGWYFALG"
FT   gene            <767756..>769534
FT                   /locus_tag="KLLA0_A08756g"
FT                   /old_locus_tag="Klla0A.mRNA.592.p"
FT   CDS_pept        join(767756..767845,768005..769534)
FT                   /locus_tag="KLLA0_A08756g"
FT                   /old_locus_tag="Klla0A.mRNA.592.p"
FT                   /product="KLLA0A08756p"
FT                   /note="similar to uniprot|P39705 Saccharomyces cerevisiae
FT                   YAR002W NUP60 Subunit of the nuclear pore complex (NPC)
FT                   functions to anchor Nup2p to the NPC in a dynamic process
FT                   that is controlled by the nucleoplasmic concentration of
FT                   Gsp1p-GTP potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02972"
FT                   /db_xref="GOA:Q6CXF5"
FT                   /db_xref="InterPro:IPR034432"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF5"
FT                   /protein_id="CAH02972.2"
FT                   /translation="MTNNRKSYIVRNSIAPYKKPTHSVVTGNSRKPSFFNKIKSFFQNQ
FT                   EVRQKEAKNEPKHIANGQRRSTSSFSVPGGFYDSQAAAESSAILSRALGAQTAESTFAD
FT                   DNEAEEEDPNVSNAKLASFFQEKGDRPLTEMEMEGVISVMKRCRSVSSTPFGSRIISES
FT                   KTIPNSKVLRTTSESVATPLKATSYTPRYEDSSVGNNSIRSTRSSVTRRIFDYSKVPSP
FT                   YRTTVYKYSAATLPSKSANATLPLQPTETKNKITRNRSPPKKLSNTASALMSILDGDND
FT                   RNDHTKLSIASNLANPYSSHVSRVRKSKPIAETTTHSPSTPAKVTDKPHVDHQESSNTG
FT                   LQTNTSLKEISKSVNGVSHPEEPHKVEEPNTLNNNNTTQYKPSVSSSLRQTVVAETSPA
FT                   KDQTTKQLSAEQIFGNSNSNKPASSFSFSFQKPEPFVLPSMGSTSENNKTDSIESKTGL
FT                   KAPPKSKLSPLPTVESPSIIEPEAEIGDKIDPNTTSKIPAPAVISTKMQDQFTFGEVPK
FT                   SNVDPASIDKAKVEQYKSMFIF"
FT   gene            complement(<769697..>770350)
FT                   /locus_tag="KLLA0_A08778g"
FT                   /old_locus_tag="KLLA-ORF10278"
FT   CDS_pept        complement(769697..770350)
FT                   /locus_tag="KLLA0_A08778g"
FT                   /old_locus_tag="KLLA-ORF10278"
FT                   /product="KLLA0A08778p"
FT                   /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
FT                   YAR002C-A ERP1 Protein that forms a heterotrimeric complex
FT                   with Erp2p Emp24p and Erv25p member along with Emp24p and
FT                   Erv25p of the p24 family involved in ER to Golgi transport
FT                   and localized to COPII-coated vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02973"
FT                   /db_xref="GOA:Q6CXF4"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF4"
FT                   /protein_id="CAH02973.1"
FT                   /translation="MFMFQVLLQLLVLFQLPLNAYAFYYYGNTGERRCFHKELTKDTLL
FT                   KGKYQLSIYDNSEEAYVLNNGQETSVQIMVEEVFDNNHRVVNQKGSASGDFTFTAMQSG
FT                   EHLICFQPTSRGGRVKTMMDIEFQVGSLAEVDSKKKSTIQTLQNKVQILIDKVNGIRRE
FT                   QDLVREREAMFRDASESANSRAMWWSIVSLIVLGGTCAWQLSHLRTFFVKQKVL"
FT   gene            <770989..>772308
FT                   /locus_tag="KLLA0_A08800g"
FT                   /old_locus_tag="KLLA-ORF10276"
FT   CDS_pept        770989..772308
FT                   /locus_tag="KLLA0_A08800g"
FT                   /old_locus_tag="KLLA-ORF10276"
FT                   /product="KLLA0A08800p"
FT                   /note="similar to uniprot|P39706 Saccharomyces cerevisiae
FT                   YAR003W SWD1 Subunit of the COMPASS complex which
FT                   methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02974"
FT                   /db_xref="GOA:Q6CXF3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037850"
FT                   /db_xref="PDB:6CHG"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF3"
FT                   /protein_id="CAH02974.1"
FT                   /translation="MANLLLQDPFGVLKEYPEKLTHTLEVPVAAVCVKFSPRGDYLAVG
FT                   CSNGAIIIYDMDSLKPIAMLGTHSGAHTRSVQSVCWSNDGRYLWSSGRDWYAKLWDMTQ
FT                   PTKCFQQYKFDGPLWSCHVVRWNVCIVTVVEEPTAYVLTLTDRQNAFHCFPLLEQDQDI
FT                   SGHGYTLVACPHPTIESIIITGTSKGWINAFQLDLESGFEDKIRCCYEEKIANANIKQI
FT                   IISPSGTRIAINGSDRTIRQYQLIVEDNESEGGSSHSVSIELEHKYQDIINRLQWNTIF
FT                   FSNHSGEYLVASAHGSSAHDLYLWETSSGSLVRVLEGADEELLDIDWNFYSMRIASNGF
FT                   ESGWVYMWSIVIPPKWSALAPDFEEVEENIDYQEKENEFDIMDDDNNLQAMTEAEEIAI
FT                   DLCTPEKYDVRGNDISMPSFVIPIDYEGVIIQQHWAHQEQ"
FT   gene            <772565..>774313
FT                   /locus_tag="KLLA0_A08822g"
FT   CDS_pept        772565..774313
FT                   /locus_tag="KLLA0_A08822g"
FT                   /product="KLLA0A08822p"
FT                   /note="similar to uniprot|P53197 Saccharomyces cerevisiae
FT                   YGL003C CDH1 CDC20 homolog 1 protein required for Clb2 and
FT                   Ase1 degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02975"
FT                   /db_xref="GOA:Q6CXF2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF2"
FT                   /protein_id="CAH02975.1"
FT                   /translation="MQNPFVNNPPSSSPVKRSQVPGGRINKRPTSSATTNMSNSSSSSS
FT                   LLASPVRRPRSTSSAGSGFADRFIPNRTEMDLNTVSSIRSNPSIPAFKPSNGSDNRLEW
FT                   ERERQAHQTFDIVLKNELFGELLNTDSNSGDTISRIQYSESLERPTTPPSGHRDGGDTD
FT                   EDEEQTYQNLNSEPPTTPRRNHSSFLHHDSHRPTSNSTKGVSLFSYGSRSQSNRLHSSN
FT                   LDLGPNATASMMNNQYFQSLSPMRPESQKLLLSPGKKFREIAKVPYRVLDAPSLADDFY
FT                   YDLIDWSSTDVLAVALGKSIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLAVGLSSG
FT                   IVEIYDVLKNKCIRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEPFFEQIDT
FT                   HSQEVCGLKWNVNENKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAWSPHTRGV
FT                   LATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSKYNLTLWN
FT                   YPTLEPMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDKPKSRGYQDSLITN
FT                   AFDNLR"
FT   gene            complement(<774642..>776507)
FT                   /locus_tag="KLLA0_A08844g"
FT                   /old_locus_tag="KLLA-ORF10271"
FT   CDS_pept        complement(774642..776507)
FT                   /locus_tag="KLLA0_A08844g"
FT                   /old_locus_tag="KLLA-ORF10271"
FT                   /product="KLLA0A08844p"
FT                   /note="similar to uniprot|P22336 Saccharomyces cerevisiae
FT                   YAR007C RFA1 Subunit of heterotrimeric Replication Factor A
FT                   (RF-A) which is a highly conserved single-stranded DNA
FT                   binding protein involved in DNA replication repair and
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02976"
FT                   /db_xref="GOA:Q6CXF1"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF1"
FT                   /protein_id="CAH02976.1"
FT                   /translation="MGVQLLEGDLLDIFRIPERYNNPTGGIYQVVQTKKTETNAKKNLI
FT                   LINDGKYHVKALLRNKAAEAAQQAELERGDVFKVLNAECAVIKEKKKFVLLVDEIEIVS
FT                   RGLDLFNNATEFVDAYLGEHMNELVTLTDNGAVASEAASAAASATSSMTSKMAPTSTSN
FT                   IPAPQPRSVPKAKSNNGSSQNSRPIFAIEQISPYQNNWTIKARVSFKGDLKKWQNNRGE
FT                   GHILNVNLLDSSGEIRATAFNDNAIKFNEILQEGKAYFVSKARVQPAKPQFSNLKHPYE
FT                   LSLERDCVVEECMNEDANDVPEMHFNFIKLNDVNNVEKNTAIDVVGILKSVGPHFELAA
FT                   KSGKKFDRRDVEIVDDSGACISLGLWGEQAIKFNLPEGSVVALKGVRVTDFNGKSLSMG
FT                   NTSSLFANPDIQEAYTLKGWYDANASNTTFKALKTESGGGADTSKFIADRTTIARAIES
FT                   NLGRSEKGDYFSVKAAVSFLKVDNFAYPACLNEGCQKKVIMQSDGTWRCEKCDMNHPHP
FT                   KYRYMLTISIMDQTGQIWLTLFNDQAEQLVGVSANELTELKENNNQAFVALTQKVQMNE
FT                   YDFRIRAREDNYNNETRIRYTVANLHDLRWKAEADFLAAELLKAL"
FT   gene            <776960..>778231
FT                   /locus_tag="KLLA0_A08866g"
FT                   /old_locus_tag="KLLA-ORF10267"
FT   CDS_pept        776960..778231
FT                   /locus_tag="KLLA0_A08866g"
FT                   /old_locus_tag="KLLA-ORF10267"
FT                   /product="KLLA0A08866p"
FT                   /note="similar to uniprot|P53196 Saccharomyces cerevisiae
FT                   YGL004C RPN14 Putative non-ATPase subunit of the 19S
FT                   regulatory particle of the 26S proteasome localized to the
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02977"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXF0"
FT                   /protein_id="CAH02977.1"
FT                   /translation="MRVEEWNICSEFDDILDDVRGEKVASDKIWVSRSSGEPLYDLEFD
FT                   VRLDSRGNVGFHNANTSDKISFQRVRPHLYELTGPDATAGHLASFQSPKKRFQLPSDIG
FT                   AVDLTSIDITNVFDPEIRLVCGDTNGGIYVLRKNTGTNYSGPLQEVIKLPEAHASHITK
FT                   TQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDG
FT                   SLKLWECSTSACVFTLNSNDGINCISLANYQGNPATTSYNALDHSNEYNTEGKAVFAGH
FT                   DSGIITFHDIYNRKKILDILPASKSACVTLTSQHIAGDDHYLFAGYSDGTIVSWDTRNV
FT                   SKPVETLQVNDNDSISRLFLAHNTLNVSSGVQFAFNVPVLDGKFNFNKLTHLIRPYDEV
FT                   TDFCVDESHQNVWCVGKNGMLLKY"
FT   gene            <778534..>779286
FT                   /locus_tag="KLLA0_A08888g"
FT                   /old_locus_tag="KLLA-ORF10266"
FT   CDS_pept        778534..779286
FT                   /locus_tag="KLLA0_A08888g"
FT                   /old_locus_tag="KLLA-ORF10266"
FT                   /product="KLLA0A08888p"
FT                   /note="similar to uniprot|P53195 Saccharomyces cerevisiae
FT                   YGL005C COG7 Component of the conserved oligomeric Golgi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02978"
FT                   /db_xref="GOA:Q6CXE9"
FT                   /db_xref="PDB:4U6U"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXE9"
FT                   /protein_id="CAH02978.1"
FT                   /translation="MSRRISGANDPLLDMFFDDDFVPQAFVDILLSSFQTSQLEELKTN
FT                   CSSLLSKMDYYSGHITKELESTIQVLQKPAELIIYAANEEQQGTTKLEYYLDTLANSVN
FT                   LLETDVKAIDKQLEELNSKYEDSNEVTETLSKLTAAKEHLVTVKRSFDLLKTIMDISIQ
FT                   DDQEKLQHISLDDFKLALLTLQETIIITLKKPQNDATDLLKKIDAFIELKTVLKGLQKF
FT                   YIPYTEFAQAIQKEKDNYLNSKDTLDEL"
FT   gene            complement(<779526..>783368)
FT                   /locus_tag="KLLA0_A08910g"
FT                   /old_locus_tag="KLLA-ORF10265"
FT   CDS_pept        complement(779526..783368)
FT                   /locus_tag="KLLA0_A08910g"
FT                   /old_locus_tag="KLLA-ORF10265"
FT                   /product="KLLA0A08910p"
FT                   /note="similar to uniprot|P38929 Saccharomyces cerevisiae
FT                   YGL006W PMC1 May be involved in depleting cytosol of Ca2
FT                   ions putative vacuolar Ca2 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02979"
FT                   /db_xref="GOA:Q6CXE8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXE8"
FT                   /protein_id="CAH02979.1"
FT                   /translation="MSSLNEGVDEAHSPSLTGRESFVGLQSKKDENKTVETEEQTRPLN
FT                   KGVTSTSIGAVKPLKHHDTQITMMSVNRMTKASSFKLAPSQLSELHDPKSLTAFNNVFD
FT                   NDESNLYTYLQTDRTNGLTIQDEDIESLERTQVYGLNRIPERKGKSFLRLVWEAFNDKT
FT                   MILLTVAAVISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLVGAIND
FT                   YQKELQFAKLNKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGS
FT                   CECDESALTGESDTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKL
FT                   LSGIGNAVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFII
FT                   LFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATT
FT                   RMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKE
FT                   IKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSR
FT                   NNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDLGIDKVVQV
FT                   IPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESF
FT                   KKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMT
FT                   LDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPE
FT                   CAMEGPTFRKLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAP
FT                   ALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTV
FT                   NITAVILTFVSAVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGR
FT                   DAPLIAVSTWKMILGQAALQLTVTFVLHFRGKEIFFPNKRTITAHEQEQLNAMTFNTFV
FT                   WLQFFKLIVTRKLDEADGISKFKDRLTANNLNFFQHLFRNYYFICIALLIGGFQILIMF
FT                   VGGAAFSIARQTPAMWATAIICGLISLPVGLFIRACPDEWALAIFPRRLVRAILYVFGL
FT                   EFIFKRNKNKKQHDEDEEASLLVEYANDSSLVESTAFQRAKSDMISHKVHPPTSEPSKY
FT                   NPITAINRWRSSSGDENESEEEHSFIASVTMVPTLVGGAVGGFSHITGPNENKKQ"
FT   gene            <784599..>785492
FT                   /locus_tag="KLLA0_A08932g"
FT                   /old_locus_tag="KLLA-ORF10262"
FT   CDS_pept        784599..785492
FT                   /locus_tag="KLLA0_A08932g"
FT                   /old_locus_tag="KLLA-ORF10262"
FT                   /product="KLLA0A08932p"
FT                   /note="similar to uniprot|P39707 Saccharomyces cerevisiae
FT                   YAR008W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02980"
FT                   /db_xref="GOA:Q6CXE7"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXE7"
FT                   /protein_id="CAH02980.1"
FT                   /translation="MEYRESFTKAMSEKAKIYLVGSNLEDGDGDDASSVVPVLYDVDDI
FT                   AKIREHGVAGVLIGTLGGAPQQNVFLGVPLRLMMEEALWLVEVGHAVFRHVMGQDLIKS
FT                   LKGLDGEKLQKFKDDRANDVAQQLEWKRANFLRKMKTLRGASDVAVPSDVINERDEQLM
FT                   KQSIFIETKDTSAVIEPSLNDQTIDQRKICEQILRQNEKLRLNYKVYKKLREMGYFMSP
FT                   GARFGGRYVAYPGDPLRYHSHLTVQDARSKDEEIDLLNMINGARLGTSVKKTWVLPGIN
FT                   ENGDAEFYSVEWAGFG"
FT   gene            <785743..>785824
FT                   /locus_tag="KLLA0_A08965r"
FT   tRNA            785743..785824
FT                   /locus_tag="KLLA0_A08965r"
FT                   /product="transfer RNA Ser (AGA) cove"
FT   gene            <785915..>785987
FT                   /locus_tag="KLLA0_A08987r"
FT   tRNA            785915..785987
FT                   /locus_tag="KLLA0_A08987r"
FT                   /product="transfer RNA Ala (TGC) cove"
FT   gene            <787768..>790467
FT                   /locus_tag="KLLA0_A09031g"
FT                   /old_locus_tag="KLLA-ORF10255"
FT   CDS_pept        787768..790467
FT                   /locus_tag="KLLA0_A09031g"
FT                   /old_locus_tag="KLLA-ORF10255"
FT                   /product="KLLA0A09031p"
FT                   /note="highly similar to uniprot|P05030 Saccharomyces
FT                   cerevisiae YGL008C PMA1 Plasma membrane H -ATPase pumps
FT                   protons out of the cell major regulator of cytoplasmic pH
FT                   part of the P2 subgroup of cation-transporting ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09031g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02983"
FT                   /db_xref="GOA:P49380"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49380"
FT                   /protein_id="CAH02983.1"
FT                   /translation="MSAATEPTKEKPVNNQDSDDEDEDIDQLIEDLQSHHGLDDESEDD
FT                   EHVAAGSARPVPEELLQTDPSYGLTSDEVTKRRKKYGLNQMSEETENLFVKFLMFFIGP
FT                   IQFVMEAAAILAAGLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVV
FT                   IRDGNLVEVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKRF
FT                   GDSTFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGTILLIL
FT                   VIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAI
FT                   VQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKG
FT                   LDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAP
FT                   LFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPP
FT                   RDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGS
FT                   ELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGA
FT                   TDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAIL
FT                   NRSLNIDLVVFIAIFADVATLAIAYDNAPYSPKPVKWNLRRLWGMSVILGIILAIGTWI
FT                   TLTTMFVPKGGIIQNFGSIDGVLFLQISLTENWLIFITRAAGPFWSSIPSWQLSGAVLI
FT                   VDIIATMFCLFGWWSQNWNDIVTVVRVWIFSFGVFCVMGGAYYMMSESEAFDRFMNGKS
FT                   RRDKPSGRSVEDFLMAMQRVSTQHEKEN"
FT   gene            complement(<792171..>793367)
FT                   /locus_tag="KLLA0_A09075g"
FT                   /old_locus_tag="KLLA-ORF10247"
FT   CDS_pept        complement(792171..793367)
FT                   /locus_tag="KLLA0_A09075g"
FT                   /old_locus_tag="KLLA-ORF10247"
FT                   /product="KLLA0A09075p"
FT                   /note="uniprot|P40952 Kluyveromyces lactis KLLA0A09075g
FT                   KYE1 NADPH dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09075g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02985"
FT                   /db_xref="GOA:P40952"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40952"
FT                   /protein_id="CAH02985.1"
FT                   /translation="MSFMNFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHPG
FT                   NVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAI
FT                   HDNKSFVWVQLWVLGRQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITK
FT                   DEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRAR
FT                   FVLEVVDAVVDAVGAERTSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKR
FT                   LAYVDLVEPRVTSPFQPEFEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNP
FT                   NTLIGYGRAFIANPDLVERLEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGYKK"
FT   gene            <794827..>797244
FT                   /locus_tag="KLLA0_A09097g"
FT                   /old_locus_tag="KLLA-ORF10243"
FT   CDS_pept        794827..797244
FT                   /locus_tag="KLLA0_A09097g"
FT                   /old_locus_tag="KLLA-ORF10243"
FT                   /product="KLLA0A09097p"
FT                   /note="similar to uniprot|Q750N6 Ashbya gossypii AGL086C
FT                   AGL086Cp and some similarites with YGL014W uniprot|P25339
FT                   Saccharomyces cerevisiae YGL014W PUF4 member of the PUF
FT                   protein family YGL014W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09097g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02986"
FT                   /db_xref="GOA:Q6CXE1"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXE1"
FT                   /protein_id="CAH02986.1"
FT                   /translation="MNIDPVSVPETINAALGQLHLDDVVEKPNSNSNTQEPDQETGNDA
FT                   APIAAATETISNNRGNGNNATSATNGGTIPQQLQQQEFFMGDSLVPGPSGPGPAPMFAP
FT                   HMMNPFMPYHPMMHMPHSGFFPGAQDQMFPPPDSSAAVDFNLSLSPSGGSAVPGAGNMT
FT                   GGVNDSAIPGSDLMMHYPQQYMNHNGQRPMFWMNPDLNSSAIDDTTAGEDPQNQDSFVR
FT                   GASFTLESSEQGNDAKVPGANTSRRQTFHAVSATDLLNNSTSSPTETTDATGTNASATS
FT                   PEASASKKEMQDRVYPQAAAYPYTGALLQPNPVLSGHPLGHHPHPIGSPFPGYGFNTAF
FT                   SPVPGPTNTLNAGSPAISADGKEANSSGDPSGQSNRHVHSGTNSPGLSQPGSLPMSGPN
FT                   PWMFAAPHGSPNFLVPHPHHPGHAGPPAGHQRPQSNNPQHRKRHFNNNGSSRSNFGNMK
FT                   PHGKPQRFEDGSRYQDAVLEQFVGSIYSLCKDQHGCRFLQRQLDENGEEVASTIYSEIK
FT                   DHICELMNDPFGNYLMQKLFERINQRDRVEIVKNCSPQFMDIALDAHGTRALQKLVECT
FT                   DTEEETQILVASLQPSILSLSRDFKSNHVVQKMLENFSNKDTQFIYDAACDDIIKISNH
FT                   RNGCCVVQRCLDFGNTEQLDALCGKIVEKSFELTMNPYGNYVIQYILTKEKDQATPDFK
FT                   YTKKIVDVLKFNAIDLSLNKFGSNVVESILRTPAVSDVMITKILNSNDESGLLKLLHDS
FT                   YGNYVLQTALDIVKDSNASLFSLLSDSLKPLLVGQIRNTPHGRRIAALLQAE"
FT   gene            complement(<797533..>800781)
FT                   /locus_tag="KLLA0_A09119g"
FT                   /old_locus_tag="KLLA-ORF10242"
FT   CDS_pept        complement(797533..800781)
FT                   /locus_tag="KLLA0_A09119g"
FT                   /old_locus_tag="KLLA-ORF10242"
FT                   /product="KLLA0A09119p"
FT                   /note="weakly similar to uniprot|P12383 Saccharomyces
FT                   cerevisiae YGL013C PDR1 Zinc cluster protein that is a
FT                   master regulator involved in recruiting other zinc cluster
FT                   proteins to pleiotropic drug response elements (PDREs) to
FT                   fine tune the regulation of multidrug resistance genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09119g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02987"
FT                   /db_xref="GOA:Q6CXE0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXE0"
FT                   /protein_id="CAH02987.1"
FT                   /translation="MVDIFQPAVSPPGLSEEAARSDSASSGVNGDRTAIPRDSNGNGTG
FT                   KPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVAKGKKKTAKSDSSA
FT                   FTKEKLSVQSIPNSTVAILNPEIDGNSYAPSRTGFSEATITGVQSHLHSSRSSFGRDSS
FT                   SGPSATGSMSVTQTSHPVGFSCPRRFDPVKDDASTNINDPSSDDINRYPILYISNAEIE
FT                   SRIAKLKECVSSLRRNDGPQSESIMYAIKNIEFEIQTLNNKLARPCINHELTSNPELNR
FT                   DKSVCFEAKLMKNHESNYVSLNRYVKINTNKLEEYLQKPPMVDVKHGLYFPGQWLSLRG
FT                   VGYFVKDFMKHAKCNIKELKENIYLILRQFDIMSAVEIKNAECWGAPVELYCQNFSVKV
FT                   RKDERVQHLLRKIPASLLNKVIATKSEFKLENWNHIINNTSETSVSSATDAFHWIIAIM
FT                   EVNKNEYQKLSKHHKLSAQQRGDDIITETLFFIEAEELLFTLGLHFFKQISIARVHSEP
FT                   LTFLDDLLDFVMNIFWIDGHQIFTCLLSSAIQTMRLCGMDHWETYLVMDERMADSRRNL
FT                   WWKAFIWDQYSVFITGSRPVFSTVDIQGPLFPGFMRKMKFIDHQDLMANFDEQFNLENV
FT                   DFSSSDLTRRETIAFVIFLSCFFAHQFQCKIVFSDRFSNFRIFALSKSEKIKMAEEVLS
FT                   ELRIYKHRLDILNEGFKRYLESGLKKVDPKENSDLEDPGIFWYEITREVSLTFCVVSSV
FT                   HIIARLNPSPEVVSISQEMKKFRKNIGVSWKITMQYLEQNNSLYDLFFMSKLVALVAVS
FT                   YVGENIAYFKHASFDDVCSFVKICRFFDYSGINCGSVENTRIQRTLLQIQFLLKILVRC
FT                   VVSVHVQSHKKTIENLLQQLASSKYPEYQETIVKLFDPTFNYFSPTLNALKESELHLQI
FT                   KSWLTETLYGSVLSLPNNLFFDDIFPTYTPSAGSSVADQRDIPPNYFTEAVDTVNGTVI
FT                   ANKNPHFSSTERYNGNNELKNGLDSSDKTEGFQNPVSSASPSKLSEPSNHIDQGTTFNL
FT                   GTIYDFADHGDFDRLFSFIWDDFVGAPVSSTEKE"
FT   gene            <801373..>803655
FT                   /locus_tag="KLLA0_A09141g"
FT                   /old_locus_tag="KLLA-ORF10240"
FT   CDS_pept        801373..803655
FT                   /locus_tag="KLLA0_A09141g"
FT                   /old_locus_tag="KLLA-ORF10240"
FT                   /product="KLLA0A09141p"
FT                   /note="weakly similar to uniprot|P38863 YHR172W
FT                   Saccharomyces cerevisiae SPC97 Component of the
FT                   microtubule-nucleating Tub4p (gamma-tubulin) complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09141g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02988"
FT                   /db_xref="GOA:Q6CXD9"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD9"
FT                   /protein_id="CAH02988.1"
FT                   /translation="MEDRGVVESVFLLNDKVGPFGRRVNPAPLCSEEIKVRTYPIEKTS
FT                   NDRVQESLVVRDLLLVLQGYEGVYIRYNSSYRRDSMTGPEYKVVKMMNVTFKSFSKKLI
FT                   KIGSIFVKLDKFQQWCCDERYGRVMHRLGHEVRIFLYENYLSCIKELEIRFQQDVKFSI
FT                   RDLEMVLEDGFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDTNDELDL
FT                   RVLYDTRVSLFVKGGSLIIIVQQIMEQEQGDIRHVEFLSLICDSLNRVYGQMFVEWMQE
FT                   GKLNDYHEEFLISDTVADVDEEKLANTIDNERLWDTRFVIRKDGLLPQFRDKELQQKIL
FT                   MTGKIWNLIAICCGNTALKPRSWGTSVTNIDITNMTFLKGYVNECYQQANEKCLKMYYE
FT                   GYHMDKFLNLIHDQSYVHGVIDQLWNTKFLSKTLFELTRSPTESTLHKIQRHFDDILKE
FT                   ISVEDTYRHMILSKLTSVKIDTCPFYETLRQFIDEQETGLLNADNFQQLKGMLVAEEQN
FT                   HTSQGSNELDEGRKSKKKKNATPTAMYVQFETSIPYPLNIIWTKPVMVQYQMIQRLLLI
FT                   LSYHERLLEDTWFEISKNKHWRRNSSQQSEYETHGMIFEDNNDDDDDGVRYFYVRGQCI
FT                   RLARILHFQMRSMVKSKRNQVTSAAAAATAVAATGTHPMQEDLLQIQQHVQDHVTNIVS
FT                   LSGLTSLPQIELQEATLHVIHSFIRFVASWRRTSDDELSGSSGWITRMDTLRQYVSVWS
FT                   DLTRTNS"
FT   gene            <804448..>805761
FT                   /locus_tag="KLLA0_A09185g"
FT                   /old_locus_tag="KLLA-ORF10236"
FT   CDS_pept        804448..805761
FT                   /locus_tag="KLLA0_A09185g"
FT                   /old_locus_tag="KLLA-ORF10236"
FT                   /product="KLLA0A09185p"
FT                   /note="highly similar to uniprot|P00924 Saccharomyces
FT                   cerevisiae YGR254W ENO1 Enolase I and to uniprot|P00925
FT                   Saccharomyces cerevisiae YHR174W ENO2 Enolase II"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09185g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02990"
FT                   /db_xref="GOA:Q70CP7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q70CP7"
FT                   /protein_id="CAH02990.1"
FT                   /translation="MPISKVYARSVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHE
FT                   ALELRDGDKSKWLGKGVLTAVSNVNNIIAPALVKANVDVTNQQQVDDLLLSLDGTANKS
FT                   KLGANAILGVSLAASKAGAAAKNVPLYQHLADLAGAKTQPFVLPVPFLNVLNGGSHAGG
FT                   ALALQEFMIAPTGAETFAEALRMGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPNIQTA
FT                   EEALDLIVDAIKAAGYEGKIDIGLDCASSEFYKDGKYDLDFKNPESDPSKWLSGPQLAD
FT                   LYHELVKKYPIVSIEDPFAEDDWEAWSHFYKTAGVQIVADDLTVTNPVRIATAIEKKAA
FT                   DALLLKVNQIGSLSESIKAANDSFAANWGVMVSHRSGETEDTFIADLVVGLRTGQIKTG
FT                   APARSERLAKLNQLLRIEEELGSNAIFAGKKFHNGNQL"
FT   gene            <806124..>806531
FT                   /locus_tag="KLLA0_A09207g"
FT                   /old_locus_tag="KLLA-ORF10233"
FT   CDS_pept        806124..806531
FT                   /locus_tag="KLLA0_A09207g"
FT                   /old_locus_tag="KLLA-ORF10233"
FT                   /product="KLLA0A09207p"
FT                   /note="some similarities with uniprot|P38865 Saccharomyces
FT                   cerevisiae YHR175W CTR2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09207g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02991"
FT                   /db_xref="GOA:Q6CXD6"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD6"
FT                   /protein_id="CAH02991.1"
FT                   /translation="MSSHHHPAEPETGMCSMDMTFNWNTENVCVVFKSWSINSHSQLLF
FT                   SCLAIFLLSYGYEYLKHHIRLVNQNLSGTLSRRNRVQSSLWYGLQYSISILLMLIYMTY
FT                   NGYLIAAVLLGAMFGNFHWAQSPAVQLLPCH"
FT   gene            <806734..>808005
FT                   /locus_tag="KLLA0_A09229g"
FT                   /old_locus_tag="KLLA-ORF10231"
FT   CDS_pept        806734..808005
FT                   /locus_tag="KLLA0_A09229g"
FT                   /old_locus_tag="KLLA-ORF10231"
FT                   /product="KLLA0A09229p"
FT                   /note="similar to uniprot|P38866 Saccharomyces cerevisiae
FT                   YHR176W FMO1 Flavin-containing monooxygenase localized to
FT                   the cytoplasmic face of the ER membrane catalyzes oxidation
FT                   of biological thiols to maintain the ER redox buffer ratio
FT                   for correct folding of disulfide-bonded proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09229g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02992"
FT                   /db_xref="GOA:Q6CXD5"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD5"
FT                   /protein_id="CAH02992.1"
FT                   /translation="MVSIGIIGAGPAGIAAARVLIANDRSYDIDLFETSSKIGGVWNYD
FT                   PQSNNTAMYDVLETNLSSHLMAFKDYPFTNIDPNIKTFPGREQVQQYLESYYDSTVANY
FT                   SKLGLFTEKRVISLEKVDSHWELKADSDDSTYIYDYIVVANGHFNKPFIPTVPGSYQWK
FT                   NQSHSKNFVNSEHYRGLNVVVVGNASSATDIATQISTTASKVYHSVKPDSETNWPANSI
FT                   IEVVSQIQSLDEPNSNTVHFIDGTSIQNVDHIIWATGFQYGVPFLKSYHSDLFRNQSNR
FT                   LYNLWEQIVYKPDPTIFFSLLPKNIIPFQLAELQASIIDLVILGSITKSDMVDADNESI
FT                   TSSDYHSLPTPKDIEYYQHLGSIVARHGPDSKFKPLTWTDSLVQERISSSKVKAERQKL
FT                   LVQWAIHQNLQNKPYSIPPDDFTG"
FT   gene            <808253..>810319
FT                   /locus_tag="KLLA0_A09251g"
FT                   /old_locus_tag="KLLA-ORF10229"
FT   CDS_pept        808253..810319
FT                   /locus_tag="KLLA0_A09251g"
FT                   /old_locus_tag="KLLA-ORF10229"
FT                   /product="KLLA0A09251p"
FT                   /note="similar to uniprot|P38699 Saccharomyces cerevisiae
FT                   YHR178W STB5 binds Sin3p in two-hybrid assay Zinc finger
FT                   (6-Cys)"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09251g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02993"
FT                   /db_xref="GOA:Q6CXD4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD4"
FT                   /protein_id="CAH02993.1"
FT                   /translation="MGTETDGGGEISGPNKKASHSCSRCRRLKKKCSKDLSTCTNCAKA
FT                   NEPCDYPGRAPRRKRKEIEEAMLLGELSNDRTKRVKSGQQPNKSNTKPEIVATDVSQRG
FT                   GNDIIEPGLRTPQQSLVSASSVASFLNLLNTLNHTNGSTVNESNMREENSNMPRPVQRV
FT                   RSQHGVMPDKVSDSSKDESRAGEGTTAGTGNGIKQERSDAVASHAGLTEHERHRSESTP
FT                   ITASAIQIEAVLSVFKGGRTTPMKMPLNIERPLYDRFIAAFFKHNHKSYPLMNKIEFLN
FT                   KVSTIRDFNKLPEEESNAFVFQLHMIMAIGCTTLQRAGMLTSEEEGLSEHFAYLAMKNF
FT                   CPVMHLQNLETIKCLLLLGIYSFFEPKGVSSWTISGLIMRLCIGFGLNRALTPKKLKTM
FT                   SVIDVEMRYRAFWAFYSFERLVATSLGRISCLSDDDISVPPPRALFEEEKDDIEVTNMM
FT                   ISLRRIGGRIYRKVHSVGAARRKLNAEEKKNVIDKLRQELDELYKLETFKIHSAKQETN
FT                   NITFHHSDTWLSMRYYQLQIMIYRPSALIPKPAMDSLTILGDACLKSLKYTYNLYQKKL
FT                   LPLNWITLFRVLTICNTMLYCLCQWSIDIIESKIEIHQCIEVLRHFGAKWVFAAKCAEI
FT                   FSSIINTILDISLSNGRVPNMDKLTRELFGASNEYQEILDENNVDISWVDSIV"
FT   gene            <810512..>810583
FT                   /locus_tag="KLLA0_A09273r"
FT   tRNA            810512..810583
FT                   /locus_tag="KLLA0_A09273r"
FT                   /product="transfer RNA Thr (TGT) cove"
FT   gene            <810967..>811647
FT                   /locus_tag="KLLA0_A09295g"
FT                   /old_locus_tag="KLLA-ORF10226"
FT   CDS_pept        810967..811647
FT                   /locus_tag="KLLA0_A09295g"
FT                   /old_locus_tag="KLLA-ORF10226"
FT                   /product="KLLA0A09295p"
FT                   /note="similar to uniprot|P38869 Saccharomyces cerevisiae
FT                   YHR181W SVP26 Component of Sed5p vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09295g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02994"
FT                   /db_xref="GOA:Q6CXD3"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD3"
FT                   /protein_id="CAH02994.1"
FT                   /translation="MIIQLLSYAGTVLGFIFLTLSTASGLYYLSELVEEYTEPTRRLLY
FT                   RAIYTIIGIYVLLLLFDGFPWLLTAFSIFTYVVYLQNMKHFPYISLTNPTLMLSCVLVL
FT                   INHYLWFKYFNDVDIPPQFRFDPNYVPRRRASFAEVASFFGICVWFIPFALFVSLSAGE
FT                   NVLPTHIERKKNEDGDGAESSRGVRRRAKGLAKIVIDYIREYFYSIGKLFGLKDSKKDE
FT                   GLLL"
FT   gene            <811860..>813809
FT                   /locus_tag="KLLA0_A09317g"
FT                   /old_locus_tag="KLLA-ORF10225"
FT   CDS_pept        811860..813809
FT                   /locus_tag="KLLA0_A09317g"
FT                   /old_locus_tag="KLLA-ORF10225"
FT                   /product="KLLA0A09317p"
FT                   /note="weakly similar to uniprot|P38870 Saccharomyces
FT                   cerevisiae YHR182W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09317g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02995"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD2"
FT                   /protein_id="CAH02995.1"
FT                   /translation="MDLRYTFWSPVSTVSVNSLYDAITQDIQSIMRLSQFLNHLNNVWN
FT                   ASLLSMKKAPDPKVTIVGEQVVEKITESLKSYKVDTTSLDHLLKRYESLLGQCKENKGR
FT                   DASLIKELKQWKTLKLEIQDQSVVYDKDKDDHHCPVAGGILQFPSRTVMFKFLRWLKDD
FT                   IKYSKRFIPISKLPNEYFSGKQLIESIRKQYPDSVVSLYQQEKLGQWFMSEGYMAHYND
FT                   LLGVRKAFSCNGYYCWKELDQQKSVKYNLATVNGLIWEQWSKYTMQKLQFETNHFNQMD
FT                   QLAQLREELVQTMKHFNGTLEDTWHITSKESVKPSSVTVQSMYEQNMGSIGFYVTSNEP
FT                   IIKYNSETTKFEMTSPIPDDITGNSLLHRLIDEIEIETEDHVENIKRCWITEFDLINWH
FT                   RIKEDLLRRWMRVQTGDKDDYASLNLTLEKKVLLLKGWLIELDDSIIPSEICEESVRNN
FT                   QSILKSFQGSGDNLRKDQNRIRCIVRILRHLAWLKEKSGEALDDVLSVPLKIPVTHYFM
FT                   RCQHQVPNKIGAFKALLLQSVEEGFQQWYQLMESTPTVPSVLVDDTNLSLPPGVLTASV
FT                   ADTATATAPPPSHHVTTDFIPKPFKASSSGSNASSTTSSTAGSHTATTTADPREKRRSG
FT                   TPLLQIMPDVSSST"
FT   gene            <814960..>816438
FT                   /locus_tag="KLLA0_A09339g"
FT                   /old_locus_tag="KLLA-ORF10223"
FT   CDS_pept        814960..816438
FT                   /locus_tag="KLLA0_A09339g"
FT                   /old_locus_tag="KLLA-ORF10223"
FT                   /product="KLLA0A09339p"
FT                   /note="highly similar to uniprot|P53319 Saccharomyces
FT                   cerevisiae YGR256W GND2 and to uniprot|P38720 Saccharomyces
FT                   cerevisiae YHR183W GND1 6-phosphogluconate
FT                   dehydrogenase(decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09339g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02996"
FT                   /db_xref="GOA:F2Z6B1"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6B1"
FT                   /protein_id="CAH02996.1"
FT                   /translation="MSEPAGDIGLIGLAVMGQNLILNAADHGFTVVAYNRTVSKVDHFL
FT                   ANEAKGKSIIGAHSVEELCRNLKRPRRIILLVKAGDAVDAFIQQLLPFLEKGDIIIDGG
FT                   NSHFPDSNRRYDELKEKGIYFVGSGVSGGEEGARYGPSLMPGGAEEAWPHIKDIFQSIS
FT                   AKSDGEPCCDWVGPAGSGHYVKMVHNGIEYGDMQLITEAYDIMKRIGGFTDKEIGEVFS
FT                   QWNKGVLDSFLVEITRDILLYDDVDGTPLVEKILDSAGQKGTGKWTAINALDLGMPVTL
FT                   IGEAVFARCLSSLKDERVRASKLLPGPQIPKDAVKERQQFVDDLEQALYASKIISYAQG
FT                   FMLIREAGKTYGWKLNNPAIALMWRGGCIIRSVFLGEITKAYRENPELENLLFNKFFAD
FT                   AVEKAQSGWRKTIGLAVSYGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFR
FT                   VLPEAASENLPADQNIHINWTGKGGNVSASSYQA"
FT   gene            <816911..>818611
FT                   /locus_tag="KLLA0_A09361g"
FT                   /old_locus_tag="KLLA-ORF10219"
FT   CDS_pept        816911..818611
FT                   /locus_tag="KLLA0_A09361g"
FT                   /old_locus_tag="KLLA-ORF10219"
FT                   /product="KLLA0A09361p"
FT                   /note="weakly similar to uniprot|P38871 Saccharomyces
FT                   cerevisiae YHR184W SSP1 Protein involved in the control of
FT                   meiotic nuclear division and spore formation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09361g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02997"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXD0"
FT                   /protein_id="CAH02997.1"
FT                   /translation="MEEPDEVDEYSYSELDRPQYPTPKVIDSKKIYERLKSKVQFWKHQ
FT                   DVDGSSFNTMDKRQQELWKLIRDSPLKFNQNNGAPESKEAHASPLQPIGESANTFLTDN
FT                   DKDVNVGDQFIKVSPMKITALDQSPLFEVHSTTKELTGPSPPVLVERLTDKLHFKKVGL
FT                   KRIQDRLGKIADSKENVARNYNKLASEITAWCSLCLERDSELDLLTDLQQVLAADKKSE
FT                   QTMTRLFMMINAKLEYVAKREENMLQERKDMNALTKKYDALRVRKGDQSMETQYLKENL
FT                   QRKRTSLQQLTEQYYESLSKILREEFTRACFTIYEMGSELKDVTRDFSLQSIELLKNGN
FT                   DSDYIDGFLEDVRKLRADKQWNKLSMQEKNNPNKLAELVGNLYNGQDSLLRIASNKVPI
FT                   KFSPLPLHENASTSTLDPQHFKASEGLDLSMSQYGTDKYNDITTNKFMLKKPLFTDVRP
FT                   VSQQPLQTLQNLRAPVSSHGATGSAGGGATRQRNLASNIANNYPYQRGPSLVRSKAEPN
FT                   GLRNEIISENVSAESIADADDKEVVIKFGHDLTNSFIEADQLLATNAWD"
FT   gene            complement(<818752..>819852)
FT                   /locus_tag="KLLA0_A09383g"
FT                   /old_locus_tag="KLLA-ORF10218"
FT   CDS_pept        complement(818752..819852)
FT                   /locus_tag="KLLA0_A09383g"
FT                   /old_locus_tag="KLLA-ORF10218"
FT                   /product="KLLA0A09383p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257C MTM1 Mitochondrial protein of the mitochondrial
FT                   carrier family involved in activating mitochondrial Sod2p
FT                   probably by facilitating insertion of an essential
FT                   manganese cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09383g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02998"
FT                   /db_xref="GOA:Q6CXC9"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC9"
FT                   /protein_id="CAH02998.1"
FT                   /translation="MSGDRSSTAIMKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVML
FT                   PDCSCGAASELKGSVGTEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAF
FT                   TKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLNPLFCGATA
FT                   RMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEI
FT                   TLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAAL
FT                   LTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLI
FT                   PRVMKIAPSCAIMISTYELSKRLFAV"
FT   gene            complement(<820161..>820970)
FT                   /locus_tag="KLLA0_A09405g"
FT                   /old_locus_tag="KLLA-ORF10217"
FT   CDS_pept        complement(820161..820970)
FT                   /locus_tag="KLLA0_A09405g"
FT                   /old_locus_tag="KLLA-ORF10217"
FT                   /product="KLLA0A09405p"
FT                   /note="some similarities with uniprot|P38872 Saccharomyces
FT                   cerevisiae YHR185C PFS1 Sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09405g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH02999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC8"
FT                   /protein_id="CAH02999.1"
FT                   /translation="MMEAMGTQKPLGVNSTILNKHIPTKSPTKRTRTRMTLERADVRNK
FT                   GRIRYKTNVQDLNFLDSMDTSCDTGPQMIQLPSQSPYNQHFYQSNNSGNRNPDVSFHSL
FT                   PPEYEELQLQSQKQYQMQLQQHNYYSSSPVRHQPPEQQNAPQLPPRADNINTSMLVFNS
FT                   SGFNNCSPHSSVPIVTGFPSYFNPRQAKNMPHGEKVERWMENLPIYFEESEQMTHTNCF
FT                   SISDDSEFWEEDEFDNDLDDGIALTNSVEIIFLQQKRITALINKLYH"
FT   gene            complement(<821244..>824279)
FT                   /locus_tag="KLLA0_A09427g"
FT                   /old_locus_tag="KLLA-ORF10214"
FT   CDS_pept        complement(821244..824279)
FT                   /locus_tag="KLLA0_A09427g"
FT                   /old_locus_tag="KLLA-ORF10214"
FT                   /product="KLLA0A09427p"
FT                   /note="similar to uniprot|P07276 Saccharomyces cerevisiae
FT                   YGR258C RAD2 Single-stranded DNA endonuclease cleaves
FT                   single-stranded DNA during nucleotide excision repair to
FT                   excise damaged DNA subunit of Nucleotide Excision Repair
FT                   Factor 3 (NEF3) homolog of human XPG protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09427g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03000"
FT                   /db_xref="GOA:Q6CXC7"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC7"
FT                   /protein_id="CAH03000.1"
FT                   /translation="MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRNK
FT                   EGDALRNAHIIGFFRRICKLLYYGIKPVFVFDGGVPVLKLNTIRERKERRQGKRDTANA
FT                   TARRLLARQIHQSQTDKESSPKKKKQSPDENGQTGSETGSFFYPHDEYHLPEIKGFSYE
FT                   KDDLRITDTDDYKTVMEQIDDLDGIDLDSINPASKEFDELPKSTQYLILSALRLKSRLR
FT                   LGYTKEQLEHVFSDSMEFSKFQIEMVKRRNFFTQKLMNVTGMHDGGASKLDDEVVNRVS
FT                   GQRDRKYALIRTDNGWALSLTGNDGSESTKAIKLDEDEEEDASQLDWEEVDTKPKPKKK
FT                   QLDYSMNASLLPRLSTTKTQGGSQSFFDKRPDLAPSTSHLLDEDEDDGTNDHPAVNNVE
FT                   KEDDNDSNEDDYAMLLKETKAMSEYQRRQKELPVQKNIIPQVEVNIESTESESDGEFED
FT                   VNFKPTVISNSEGGPSNSAAHRPSNDNTVSSIVEKPSAIPIIDHKVSQQNLDSIVSKIP
FT                   EFSFSLSMRGKAFEDNEKSEPGETAPTSTDTQEKQAQEVPAWFSSTANRNPYSSSSFVA
FT                   DREKSDVRPEDQYGILTGEAAQELVKNRIGYHHPELIDLDQLERDDNEDEVEDDAVIEV
FT                   SKRDLNEQKSPSGKGFSTTKDSTSSRISEGNDSDSDNLVESESAATREQLPILDYDFYE
FT                   DEEERLAEQLTREQEDYNHFKSTLNPNLVNTAFLEDELFEQQKKDKRDADEVTIEMIHE
FT                   IQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLFGGTHVYKNMFQEKN
FT                   YVEYYSLDLFDQKLGLDRDKLIQLAQLLGSDYTPGLRGIGPVMGVEILAEFGSLKEFAK
FT                   WYNEGQFDKQKLEGETAFQKQLRKRLVSNEIILDDNFPSEAVYDAYIHPTVDADKTKFV
FT                   WGSPDLDKLRSFLQQTIGWDKAKSDEVLIPLIRDLNKRKATGVQKRINEFFPVQYLQQD
FT                   KQYKLGKRIETATSKLKKRRTE"
FT   gene            <825574..>827106
FT                   /locus_tag="KLLA0_A09449g"
FT                   /old_locus_tag="KLLA-ORF10210"
FT   CDS_pept        825574..827106
FT                   /locus_tag="KLLA0_A09449g"
FT                   /old_locus_tag="KLLA-ORF10210"
FT                   /product="KLLA0A09449p"
FT                   /note="similar to uniprot|P53322 Saccharomyces cerevisiae
FT                   YGR260W TNA1 High affinity nicotinic acid plasma membrane
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09449g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03001"
FT                   /db_xref="GOA:Q6CXC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC6"
FT                   /protein_id="CAH03001.1"
FT                   /translation="MAVISVRGLDAVVSKDESLGEEVVEGNIDACKESVRSHEHDDNAS
FT                   YDEPPSLTHPMESRVVRKMDLYLVPLMCMLYFLSNLDKSNIGNAEVAGLSESLNLTGNQ
FT                   YGNCVTVFYATYIFFDPIGANLLKIIGPKYMMTGCLICFGAISLGTAWVKDYGHLLLVR
FT                   VLLGAFEATIYPSINMYLSICYRREQYAIRFAWVFFAACISSSFGGLISYGCSKINGSL
FT                   NAWQYIYIVEGCISLGFAPFYALGLANNLEESWFWTAEERQYIVDRYETMSTFNPADKF
FT                   EWSQVWLAVKDLKTWVSAVALFCIDMTAFGLTVFMPIIITSMGFSSVNAQLMTVPVYFL
FT                   TAITFFACAYVSDRIRIRSPFIVGACISCATGLAIVLGSDVHGVRLFGIFVLALGIYVN
FT                   ASMNCLWLSGNNGNYFKRATALGINLFVGSSSGLVSGQIFRAEDKPRYALGLAICLGLQ
FT                   VFAAMLTVVQYYMYRRLNKQKQALIKRCEELDEPIPHDEHLSDMNPQFKYMY"
FT   gene            complement(<827264..>831784)
FT                   /locus_tag="KLLA0_A09471g"
FT                   /old_locus_tag="KLLA-ORF10209"
FT   CDS_pept        complement(827264..831784)
FT                   /locus_tag="KLLA0_A09471g"
FT                   /old_locus_tag="KLLA-ORF10209"
FT                   /product="KLLA0A09471p"
FT                   /note="some similarities with uniprot|P38873 Saccharomyces
FT                   cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
FT                   sensitive complex involved in growth control that contains
FT                   Tor1p or Tor2p Lst8p and Tco89p contains four HEAT repeats
FT                   and seven WD-40 repeats may act as a scaffold protein to
FT                   couple TOR and its effectors"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09471g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03002"
FT                   /db_xref="GOA:Q6CXC5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC5"
FT                   /protein_id="CAH03002.1"
FT                   /translation="MVVYGPQPLTRLNTETRHGFEEQYSSEKLLEAHASNFIFYYDDKR
FT                   HRTNGNPVPEEVKQEDKDGYYQPIPDWKIVKDRQKTVAAALLLCLNLGVDPPDVTKTQP
FT                   CARLESWVDPLAFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSLR
FT                   RASKDERILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYVWDCN
FT                   SAGNIVSNFKKFVQKRLRDDREGNHDMASPSPTEAYTECVQLASCANNELLPMNPELPA
FT                   DFFTCCLTNPIEISVKVFLMQSPLKDTKYSVFFQDNDPRRKETGVNEMPNITIPGKLSE
FT                   RRTPLGELNWIFTAITDTIAWTSLPRALFKKLFRHDLMVAALFRNFLLAKRIMPWYNCH
FT                   PVSDPELPDSIADHPMWRSWDLAIDEVLTKLLESAHANAKNSNFPESQFISQPNEGNET
FT                   NDGLQSKNTIGNLSSMSLVNFSSTAHTSSGNSASHPTTSQQQQQQFTKFFEQNLTAFDL
FT                   WVKYGANSRHPPEQLPIVLQVLLSQVHRVRTLVLLSRFLDLGPWAVYLSLSIGIFPYVS
FT                   KLLQSPAHELKPILVFIWARIFSIDYKNTQTELIKERGYQYFVKMLVPEFGVPRGHSVS
FT                   SAGSPLTMNVPASSSTQRYQMYQQQQQQQAYNNATLLSNNNTTDEQKAMAAFVLSCFVR
FT                   DFPLGQKHCFSTELVNKLCFFIENSEVPLLRQWCIILLGQLYIHNPLHKTLCLENENMN
FT                   TIIESLKDPIPEIRCAALLAIKYFLSEEDDVNIILKLQQEFQQQLQQFQAQLQLLQSQQ
FT                   NQQQQQQQGNQQNSTHHIQQQYYQIQQQSQQVQTSMSQLQSINLRNLKQFEIKTIITTL
FT                   SLVNDGSPMVRKELIIFLSQVVERYIEFFTVIAFTEISTEIVALETNGHEDDSRNPTSV
FT                   GHGSIFNTVWKALLISSEDPFVENRELAGDVVDYILIKLNEHSKLAEMVKEMEQYILKR
FT                   SVVNVKGFTSPNKLPAIRRPASLSNGKHDHYRNDTVSDRRVFSMNSILKALGFANDQDS
FT                   YSDHESTSSGNGKMAQGLSLMGIEYGTSPRAFPAMYRKRDTPLTLPLESCFLNYCSEYF
FT                   QEPQMKKQEADEPGSIEFTAREWKRNRNEAIIQETQSQKELALYGDWSHKIVTFDNKTQ
FT                   PKILLFTQFDNYIAASDDRDNITIYDWSTQEKLSRFSNGNPFGTKITDMKFLNDDDTPL
FT                   LLAGSSDGIVNIYKDFHDTEDLFMISSWRGLTDLLLTPRSTGLLTEWQQSRGSLLVTGD
FT                   VKIIRIWDALTESVEVDIPAKSSSLITSLTSDQFSGNIFVAGYSDGSIRVYDRRMDPRD
FT                   SMIRLWKTPKSDNSPVGSWVNNIHLQRGGYRELVSGTNNGVVALWDIRADKPVCTFTDE
FT                   GEPGKKLGSTMTSMQVHEHASIIATGTKEIKLWTTSGDLLRTFKNHGSSHSGPISGMTT
FT                   GARSSPFISTMAFHPHRMMLTANNSHDTTFNIYECLDNRRDYMYY"
FT   gene            <832430..>833317
FT                   /locus_tag="KLLA0_A09493g"
FT                   /old_locus_tag="KLLA-ORF10207"
FT   CDS_pept        832430..833317
FT                   /locus_tag="KLLA0_A09493g"
FT                   /old_locus_tag="KLLA-ORF10207"
FT                   /product="KLLA0A09493p"
FT                   /note="similar to uniprot|P38874 Saccharomyces cerevisiae
FT                   YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p-subcomplex of
FT                   RNA polymerase II elongator complex which is a histone
FT                   acetyltransferase iki1 mutations confer resistance to the
FT                   K. lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09493g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03003"
FT                   /db_xref="GOA:Q6CXC4"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC4"
FT                   /protein_id="CAH03003.1"
FT                   /translation="MASTNNNPKVLLKRTFSLKEQSSLILCTDTMAQSSRFVVEEFLDN
FT                   IPDEMPIVFVSFETPNRPKYARQFIDASGKTTQQLVAALQPYLPQPQEQAPKMHLVIFD
FT                   TFNYIGSESLTQFISTIASPFVTILATYHQSIPAWRPAELQNYPTAIQLLQFIANTVIE
FT                   VTPKTSIDEDDLDADLSRFVIPKNLNNPTYYITLTNKRKSGRAIKNKFLINSKTHDYEY
FT                   VIEKQEPVTDESPEMFEGLTTFNLNTSEKQKLAKDQVELPYLEAQSFNSGGAIVYEFEK
FT                   DDDYDEEDPYEDPF"
FT   gene            complement(<833455..>835386)
FT                   /locus_tag="KLLA0_A09515g"
FT                   /old_locus_tag="KLLA-ORF10204"
FT   CDS_pept        complement(833455..835386)
FT                   /locus_tag="KLLA0_A09515g"
FT                   /old_locus_tag="KLLA-ORF10204"
FT                   /product="KLLA0A09515p"
FT                   /note="similar to uniprot|P38875 Saccharomyces cerevisiae
FT                   YHR188C GPI16 Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   GPIs to newly synthesized proteins human PIG-Tp homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09515g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03004"
FT                   /db_xref="GOA:Q6CXC3"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC3"
FT                   /protein_id="CAH03004.1"
FT                   /translation="MRLQNWIPVLLLAAIVTAEVDFEVNPVDNETESVQQDVIDESWNA
FT                   EPGESSRITQSSKFLSLEHPIEYNFREHLDLTPLPNNFLLASFQFYMQSEPFGIDRDQH
FT                   ESSEYSHHTVFPKPVGPIMSQTNTRQLHLRFTHGLWDSQEWGQLPHNGLKSGGTGVELW
FT                   AIVEAPSKEEALKSWITLANSLSGLFCASINFIDTSKTTFPVSSFLPKEDEAIPLLNQS
FT                   NHLYLMRATLANEPVCTENLTPFVKLLPTRGKSGISSLLDGHKIFDSNWHSLSIDVNTV
FT                   CDESTANCHFVMEEFIETVVNVPNALARADRPIPKPLPGDELRCDTNRPHDAFQCFPLP
FT                   QSKEVSFSISKLFGKKIRGGSLLGEQSSKICVHVPSHWDVMIQVDESYFATDDNCFDLN
FT                   NNKPHDVRLETTDSKSVLPSKKTPIYVSRALTGYGQDRGGLRSVFRNPSNEAVELVYFE
FT                   SLPWFMGVYLSSLAIESDDPELTLDSVVKSTFYSPARDRERPTHLERAMIIPPNTAFAI
FT                   SFQFDKSLLKYAEYPPDANHGFEIEAAVAAVLTPERYEARTSSLLLSLSTPDFSMPYNV
FT                   IILTSTVMGLAFGTLFNLISKQLITLEEADKILASTGPRAKLLRVKAKIVNMLQGNKNK
FT                   IIKSAKYE"
FT   gene            <835653..>838517
FT                   /locus_tag="KLLA0_A09537g"
FT                   /old_locus_tag="KLLA-ORF10199"
FT   CDS_pept        835653..838517
FT                   /locus_tag="KLLA0_A09537g"
FT                   /old_locus_tag="KLLA-ORF10199"
FT                   /product="KLLA0A09537p"
FT                   /note="similar to uniprot|P49955 Saccharomyces cerevisiae
FT                   YMR288W HSH155 U2-snRNP associated splicing factor that
FT                   forms extensive associations with the branch site-3' splice
FT                   site-3' exon region upon prespliceosome formation;
FT                   similarity to the mammalian U2 snRNP-associated splicing
FT                   factor SAP155"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09537g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03005"
FT                   /db_xref="GOA:Q6CXC2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC2"
FT                   /protein_id="CAH03005.1"
FT                   /translation="MEAIKFEKSGQRHSLTGQYTAPRAILESTVGKDEGDDELTANQKQ
FT                   RSLYNKQSDYHKRRFLRNLDEEVDEEQVKDVKRRKTDKDGDKEEESGGGYTMPKTSQHI
FT                   ITELSEEMVTEVPGVRNLQFFKPSDRQHFAILFDERSPEDMTEEERKQKQVLKLVLKVK
FT                   NGLPSSRKIALRALTQKAPSFGAPLLFDSILPILLDKTLEDEEHQLMLKLMDRILFQLQ
FT                   DLVKPYTHKLLIVLCPMLIDPVPLTRSTGRDIITTLAKAVGLPTMIYTMRPDLDHEDEY
FT                   VRNTTARAMAVVSKAFGVSQTIPFLRLVCRSKKSWKARHTGIKIIQQIAILVGIGSLPY
FT                   LDDLIACIEKGFQDEHPPVRIIAAQTVSSLAQSCQPYGIERFNPVLEPLWRGVKQNRGR
FT                   ELAAFLKALGFLIPLMDPEYASYYAEEVMKIVKREFNSPNEDMKKTVLFVIQKLSVTEG
FT                   VTPQYLRKELAAEFFKQFWVRRSALDRQLNNIVTFTTVLLANKTGAAFTLEKLIYPLKD
FT                   ESEPFRTMGAHAVNRVVKALGMTDVDERLEARLLDALLIAFQDQTNGERIVYRSIGTVA
FT                   KSLNTRMKPYISPVSSIILEHLKHKKPLVRTHAASLCALLIPVFKHCEETALINKFNII
FT                   LFESLGEVYPEVLAAIISAMDKAAAQIRLTDLQPPPNQILLSLTPILRNNHPLVQESTV
FT                   KLVGRIARRGPEYVSPKEWMRICSELLEMLKSPVKSIRVAANRTFGYIAKAIGPQDVLV
FT                   TLLNNLKVQERQLRVNTSIAIGIVAKTCGPFVVIPALMNEYRTPDTNVQNGILKALAFI
FT                   LEYIGPMSKDYIYPLIPLLQDALTDRDLVHRQTAATCIKHLAFNCAGRGLEDAFIHCMN
FT                   LLLPNVFETSPHVISRILEGLEGLRMALGPGVSMNYAWGGLFHPAKNVRNAYWKLYNGA
FT                   YVAQPDALVPYYPVNEVEELNLLL"
FT   gene            complement(<838592..>840970)
FT                   /locus_tag="KLLA0_A09559g"
FT                   /old_locus_tag="KLLA-ORF10198"
FT   CDS_pept        complement(838592..840970)
FT                   /locus_tag="KLLA0_A09559g"
FT                   /old_locus_tag="KLLA-ORF10198"
FT                   /product="KLLA0A09559p"
FT                   /note="similar to uniprot|P46682 Saccharomyces cerevisiae
FT                   YGR261C APL6 beta3-like subunit of the yeast AP-3 complex
FT                   which functions in transport of alkaline phosphatase to the
FT                   vacuole via the alternate pathway suppressor of loss of
FT                   casein kinase 1 function putative beta adaptin component of
FT                   the membrane-associate clathrin assembly complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09559g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03006"
FT                   /db_xref="GOA:Q6CXC1"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="InterPro:IPR026740"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC1"
FT                   /protein_id="CAH03006.1"
FT                   /translation="MVDSIQRITSVLQSARDLTFGAAAVASSRIGESSYTQYSKSIDPE
FT                   ALTRLLSSRNSREVKDAMKRVMSLMATNDPTVDLKSMFADILKNISSEDVKVKRMVCIY
FT                   LLRFAESDPNVALLSVNTIQKNLQDRDPEAKALALKALSDINVASLYPITLQSVKKCVS
FT                   DASPLVRATSAMTLFKLFQDSKSHDEEDDVRRHDLVPLLQELLADPDPLVISCTLVVLQ
FT                   NCLPDRLDLLHGHFRRYCAVLPSLSHWAQSLLVEMFIRYSKHFIKRPVFVNREDRSETP
FT                   LPETPELVDSWFLEANDLIIDPDLDLFLTSLKPLLFSSNASVIISVSRALFMLAPLSKF
FT                   REFGMPHCLVKALQLSSTENRCIIVQMIAYYASIDPEAFASLYRSFLPTADDDPIVGSY
FT                   KLTIISLLITDKNVKDIIHELKYYITTYRDPAIVKKALSTLVVCAHNSNAFSAHIMKWL
FT                   LSFMENDNLTDSEVTSEYVNVIRHLIQINPSKNLSVMLKLSQIITETDNLSAYAKAGII
FT                   WLFGEYIHVEPRIVPDVLRKLIPKFADESTEARLQILILAAKLLSFDIDRCESDYDFEQ
FT                   SRIAHLYDAVMYLAKFDDDFDIRDKVRSLSSLFSHERFEILTLLLQAAKPWPALSLFTY
FT                   GDKASDLAHLELSPEVLNSLKVPQWSTEVPEVDRTPVETNNFMKNKSSISSNTFFASRT
FT                   RANYQQPKASSPISSKSSSPEPKTFTSSKGKTYKLQSLDEFFADIPEKPKKTKIVIEEE
FT                   SETESDVAQLEESSSDESDDTDDIEEGEEDDRSSTSSDP"
FT   gene            complement(<841221..>841293)
FT                   /locus_tag="KLLA0_A09581r"
FT   tRNA            complement(841221..841293)
FT                   /locus_tag="KLLA0_A09581r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            <841883..>843100
FT                   /locus_tag="KLLA0_A09603g"
FT                   /old_locus_tag="KLLA-ORF10194"
FT   CDS_pept        841883..843100
FT                   /locus_tag="KLLA0_A09603g"
FT                   /old_locus_tag="KLLA-ORF10194"
FT                   /product="KLLA0A09603p"
FT                   /note="similar to uniprot|Q03266 Saccharomyces cerevisiae
FT                   YMR289W ABZ2 4-amino-4-deoxychorismate lyase catalyzes the
FT                   third step in para-aminobenzoic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09603g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03007"
FT                   /db_xref="GOA:Q6CXC0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXC0"
FT                   /protein_id="CAH03007.1"
FT                   /translation="MPSGELNDAALAAIKEKIGQDTIEQNFNISSQDFQILATIRYDPH
FT                   FTHVFEPDGNDSVEYDHCLSQLDPQLTSLMDSSSFLQSDDSGSLGNGLLDYLDSSSVNS
FT                   SPISEGFEFNASSAIQRDPVFQSLYGTNYSHTQQGEATVDDVDIWSIYYDRFFLLGEHY
FT                   KRLKLALAFFQWKLALTPRMLLTQLIHSLPIQESLSIEDKMKALLSASTPYKMRVLVNK
FT                   DGTMKIEAHELPQFLTTCPSTHEYLVQNLLSGYLDHAPTWDVYINPEPIVVSPFTTFKT
FT                   TKRDHYNKARENMEVLKLSVQDPRPKSEVLVYNDLYQLMEGSITNVAVKSKPTENSNAF
FT                   RYTTPYLSSGCLCGVTRYFLLRKGLLQEDSIDVRDLSVGDEILLFNGIIGCVKGVIRNS
FT                   VDFSNT"
FT   gene            complement(<843147..>843938)
FT                   /locus_tag="KLLA0_A09625g"
FT                   /old_locus_tag="KLLA-ORF10193"
FT   CDS_pept        complement(843147..843938)
FT                   /locus_tag="KLLA0_A09625g"
FT                   /old_locus_tag="KLLA-ORF10193"
FT                   /product="KLLA0A09625p"
FT                   /note="highly similar to uniprot|P53323 Saccharomyces
FT                   cerevisiae YGR262C BUD32 Protein involved in bud-site
FT                   selection diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09625g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03008"
FT                   /db_xref="GOA:Q6CXB9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXB9"
FT                   /protein_id="CAH03008.1"
FT                   /translation="MSAEIIASIADVLTDNIPLTPISQGAEAVVFTSPVHPYLPKNRTD
FT                   GDDKLYILKYRPEKKYRHPVIDKTLTKHRTLGESRLLAKLRLIDGLNVPKLIGCDPYHG
FT                   CIWLEFLGEDLPNGHGFSNLKNFLWMNASDPYSDLVRDTMINVGKQIGLMHWNDYCHGD
FT                   LTTSNIVLVRAGEDWQPYLIDFGLGSISTLVEDKGVDLYVLERAIISTHSSFANRYNLW
FT                   VLEGFKSVFESHGKAGLGKYKDLIRRFEEVRLRGRKRSMIG"
FT   gene            complement(<844245..>846578)
FT                   /locus_tag="KLLA0_A09647g"
FT                   /old_locus_tag="KLLA-ORF10192"
FT   CDS_pept        complement(844245..846578)
FT                   /locus_tag="KLLA0_A09647g"
FT                   /old_locus_tag="KLLA-ORF10192"
FT                   /product="KLLA0A09647p"
FT                   /note="highly similar to uniprot|P00958 Saccharomyces
FT                   cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
FT                   complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
FT                   which increases the catalytic efficiency of both tRNA
FT                   synthetases also has a role in nuclear export of tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09647g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03009"
FT                   /db_xref="GOA:Q6CXB8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB8"
FT                   /protein_id="CAH03009.1"
FT                   /translation="MTNIRRNGDRFTTKRATDTLRPISLAMASSHISFDQSKGHTSALQ
FT                   LANNIKLAYALLSSGNLKLEENKDVLIPQLVIDSTGFRLFDANAILRYVLNDFEEEESN
FT                   EYNFAVSSLEAFASHKDPIKEHLAEAVQKSLDNYLTSVEEPLSATRIVIFANTYALDPA
FT                   AVEARITSLPERLQEALKLAKTKIVRSSTDYKHTGAVNVSQEHLMKSQDAEILPKEGER
FT                   NILITSALPYVNNVPHLGNIVGSVLSADIYSRFAKGRNYNALYICGTDEYGTATETKAL
FT                   EDGVTPRELCDKYHKVHSDVYKWFQIGFDYFGRTTTEKQTAIAQDIFMKLYDRGFLEEQ
FT                   TMKQLYCPAHKGYLADRYVEGTCPKCGYEDARGDQCDKCGALLNPFELIDPRCKLDDGV
FT                   PEPRDSDHIFMSLDKLEPEIKKWVDEASSKGNWSKNSKTITQSWLKEGLHPRCITRDLV
FT                   WGTPVPLENYKEKVLYVWFDACIGYVSITANYTNKWEQWWKNPNNIDLYQFMGKDNVPF
FT                   HTVIFPGSQLGTGDDWTMLHHLNTTEYLQYEGGKFSKSRSIGVFGNNAQEIGLSPSVWR
FT                   YYLISVRPETSDSQFSWSDFAARNNSELLANLGNFVNRVVKFVNAKYNGVVPDFNVDNL
FT                   PGYAQLKKDIDEILTNYVDNMEKVHLRRGLEIAMTLSARGNQFLQDNKLDNSLFAQEPA
FT                   KSDAVVGVALNIIYTVASIMSPFIPETSEIIYRMLNAPALRIDDHFNLPIRPGHNINKA
FT                   EYLFSRIDEKDVEKWRSKHSGKQV"
FT   gene            complement(<847036..>848529)
FT                   /locus_tag="KLLA0_A09669g"
FT                   /old_locus_tag="KLLA-ORF10190"
FT   CDS_pept        complement(847036..848529)
FT                   /locus_tag="KLLA0_A09669g"
FT                   /old_locus_tag="KLLA-ORF10190"
FT                   /product="KLLA0A09669p"
FT                   /note="highly similar to uniprot|Q03532 Saccharomyces
FT                   cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
FT                   localizes to both the nuclear periphery and nucleolus
FT                   highly enriched in nuclear pore complex fractions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09669g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03010"
FT                   /db_xref="GOA:Q6CXB7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXB7"
FT                   /protein_id="CAH03010.1"
FT                   /translation="MAGNKRVRDAESEQDHAETETVVKDTATTGEVEGSFSDLKLSDGT
FT                   MKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEMLHSLKFKPR
FT                   NGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMKGVNILIAT
FT                   PGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSAT
FT                   QTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFLLLFSFLKRNQK
FT                   KKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV
FT                   AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPTELGFLRYLKA
FT                   AKVPLNEYEFPTNKIANVQAQLEKLIKSNYYLHQIAKDGYRSYLQAYASHSLKTVYQID
FT                   KLDLAKVAKSYGFPVPPKVNITIGASGKTPATKKRRTKD"
FT   gene            <849221..>851305
FT                   /locus_tag="KLLA0_A09691g"
FT                   /old_locus_tag="KLLA-ORF10188"
FT   CDS_pept        849221..851305
FT                   /locus_tag="KLLA0_A09691g"
FT                   /old_locus_tag="KLLA-ORF10188"
FT                   /product="KLLA0A09691p"
FT                   /note="similar to uniprot|P53326 YGR266W Saccharomyces
FT                   cerevisiae probably contains a single transmembrane span"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09691g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03011"
FT                   /db_xref="GOA:Q6CXB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB6"
FT                   /protein_id="CAH03011.1"
FT                   /translation="MSDASTWFNEVDPRELYADKVIGCDGCGDSPLNGKKDGIVCGPIL
FT                   RLINVDYEKNLYRGSMLIVTKGEVAEPKVEFQVGQSEEKNLGSESKHPNLETGQFVATK
FT                   FYSESDYSFYRYAIEIELDSVERMCKYSIDGKLEPQYRFFIPSQTTNFNTISVSCNGFS
FT                   LSVDTTKFKGSMWYDILRKHANVHYHVILGGGDQIYSDSIKLYCESFQNWLKTSDPIKK
FT                   YSTKCSPEMRSDMDQFYLKEYLEWFGYGHWKGSTENSRTTQRCFPIAMSTIPSINMFDD
FT                   HDIIDGYGSYSHKFMFTDVFKSVGKSAYKYYMLFQHHTSIEEPEAYNKEKCWVIGAQPG
FT                   AYIGEKSHSVYTRLGPTMAVLGIDCRTERKLTEICSKKTYDILFDKLAQDAKLGKLDHL
FT                   LLMLGVPIAYPRLVWLEYIFSSKFLFIFKWLSKKGILAKGLVNEFNGDVELLDDLNDHW
FT                   CAHYHKKERNYLLARLQDFSAKQGIRVTILSGDVHLASVGRFKSKVHTHHITSAKVDQD
FT                   KKVLNEPEKDVRLMLNVISSAVVNTPPPDQMAKLLQKRVKNHHFDASTDEDSVPIFTTD
FT                   VDGENRSSNAFMNRRNWSDIIPVTTVLKNKYLNDQYKFEIGDKIVPGRVGIKTQIDEKT
FT                   NIGHIPYPVTEKGIIATIHIEKDTSSAESETVGYTIPIPELQATEENLSHAGIKHLDLA
FT                   "
FT   gene            <851952..>853625
FT                   /locus_tag="KLLA0_A09713g"
FT                   /old_locus_tag="KLLA-ORF10185"
FT   CDS_pept        851952..853625
FT                   /locus_tag="KLLA0_A09713g"
FT                   /old_locus_tag="KLLA-ORF10185"
FT                   /product="KLLA0A09713p"
FT                   /note="similar to uniprot|Q03533 Saccharomyces cerevisiae
FT                   YMR291W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09713g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03012"
FT                   /db_xref="GOA:Q6CXB5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB5"
FT                   /protein_id="CAH03012.1"
FT                   /translation="MSIATSDYSRIDDKVWPTANRTGPKEDPSKYHCTYVTKKVALGDG
FT                   HFSVVKECMNTMTGDRYAMKLVHKSLVMDKLQLIQREVSVLKRVSSLIRELETLNQKVA
FT                   GSGSNHGDVFEGHHHVLQLFDFFETSKSIVLVTQLCESEDLYDKILNAGHLDLETQVKP
FT                   FTACLLSALQFLHGNGIIHRDLKAENVLFRLKTKTNMIELPRDDAMYDKSAHDLILADF
FT                   GLAISTETGSKEFVGTISYLAPELVACKNSGKQSSIQNGRLKPYGTGVDVWALGVLCYF
FT                   MACGYMPFDCETDAETMEYIANSDYYMDEDMSKDDKYKQFWSFLEKCFEVDMDKRASAD
FT                   ELSAHSFVCPQYFPNKSPTPIIDSPRAPALRVSKSSTSLHSLEPPSRSASTVSLNLNEP
FT                   MKRSDSREVNLNRIRETLRKTLSMTSIKREPNVLLNVPSGSNSANFNRASSTLKLEPEP
FT                   PNVALMNGCLCATPESCSNFTTSPSMSRNGSKNNLQTAIGSWNESSLSGLNSGATLAFD
FT                   RNSFDFTKLNNTSLSPSVPTSSSSNDARKDKIVFQLGEDD"
FT   gene            complement(<854163..>854900)
FT                   /locus_tag="KLLA0_A09735g"
FT                   /old_locus_tag="KLLA-ORF10181"
FT   CDS_pept        complement(854163..854900)
FT                   /locus_tag="KLLA0_A09735g"
FT                   /old_locus_tag="KLLA-ORF10181"
FT                   /product="KLLA0A09735p"
FT                   /note="highly similar to uniprot|P51601 YGR267C
FT                   Saccharomyces cerevisiae FOL2 GTP-cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09735g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03013"
FT                   /db_xref="GOA:Q6CXB4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB4"
FT                   /protein_id="CAH03013.1"
FT                   /translation="MENKHISHVSQIERRATPLNIRPASPYTLNPTVEKDGLSWPSIGA
FT                   RERAEETDEEEQKRVGRIADAVKTILSELGEDTEREGLLDTPTRYAKAMLYFTKGYQDN
FT                   IMNDVIKNAVFEEDHDEMVIVRDIEIFSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLAR
FT                   LAEMYARRFQVQERLTKQIAMALSDILKPRGVAVVIEATHMCMVSRGVQKTGSSTVTSC
FT                   MLGYLRESHKTREEFLNLLGRRY"
FT   gene            complement(<855406..>855999)
FT                   /locus_tag="KLLA0_A09757g"
FT                   /old_locus_tag="KLLA-ORF10180"
FT   CDS_pept        complement(855406..855999)
FT                   /locus_tag="KLLA0_A09757g"
FT                   /old_locus_tag="KLLA-ORF10180"
FT                   /product="KLLA0A09757p"
FT                   /note="some similarities with uniprot|P40325 YGR268C
FT                   Saccharomyces cerevisiae HUA1 uncharacterized ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09757g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03014"
FT                   /db_xref="GOA:Q6CXB3"
FT                   /db_xref="InterPro:IPR038910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB3"
FT                   /protein_id="CAH03014.1"
FT                   /translation="MKSESDIQPDEHLPSYDEVLRQDTAAASQQQQQLPPNPPPRPTQP
FT                   PARPPRPSNAIPAYHHSTSTFSSSTSTSTGNKKLPWTYPPGYYCKKCGNTGTKIKTQQK
FT                   CKKCWSKFYKPPPAQPPRPSAGPRPAFVYSNVTMPPQNFVINSAPIVVRPGDSRIGGMM
FT                   CNNCNGTGRVRFFLDKEPCPVCYGLGRILTGPTY"
FT   gene            complement(<856553..>857008)
FT                   /locus_tag="KLLA0_A09779g"
FT                   /old_locus_tag="KLLA-ORF10177"
FT   CDS_pept        complement(856553..857008)
FT                   /locus_tag="KLLA0_A09779g"
FT                   /old_locus_tag="KLLA-ORF10177"
FT                   /product="KLLA0A09779p"
FT                   /note="some similarities with uniprot|P40325 Saccharomyces
FT                   cerevisiae YGR268C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09779g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03015"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB2"
FT                   /protein_id="CAH03015.1"
FT                   /translation="MAASVKQSGILPSYDEAVGQGSSTGASRHQEASNDEPNDEPNDES
FT                   NDASNDIPNNATNSTTTSSCNTGTDIDQLPWTYPPWYYCRRCGNTGVETRTQRRCRTCW
FT                   SRFNRRQFPARRGLILTVVLLGVAVVKHLGKHVSNASHASHAAHATD"
FT   gene            <857479..>858089
FT                   /locus_tag="KLLA0_A09801g"
FT                   /old_locus_tag="Klla0A.mRNA.625.p"
FT   CDS_pept        join(857479..857506,857695..858089)
FT                   /locus_tag="KLLA0_A09801g"
FT                   /old_locus_tag="Klla0A.mRNA.625.p"
FT                   /product="KLLA0A09801p"
FT                   /note="similar to uniprot|Q03554 Saccharomyces cerevisiae
FT                   YMR292w GOT1 evolutionarily conserved non-essential protein
FT                   present in early Golgi cisternae that may be involved in
FT                   ER-Golgi transport at a step after vesicle tethering to
FT                   Golgi membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09801g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03016"
FT                   /db_xref="GOA:Q6CXB1"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB1"
FT                   /protein_id="CAH03016.1"
FT                   /translation="MSSWLSESQQFGAVFTFGGCLFFLFGIFTFFDRALLAVGNILFLL
FT                   GVLLMIGPHKTLKFFTRPTKRRGTLFLVFGIFMILCKWTFLGFIIESLGIVGLFGDFFG
FT                   VILQLLRSIPIIGPVLSHPTIAPVLDRIAGVSVLPV"
FT   gene            <858458..>862417
FT                   /locus_tag="KLLA0_A09823g"
FT                   /old_locus_tag="KLLA-ORF10173"
FT   CDS_pept        858458..862417
FT                   /locus_tag="KLLA0_A09823g"
FT                   /old_locus_tag="KLLA-ORF10173"
FT                   /product="KLLA0A09823p"
FT                   /note="similar to uniprot|P40340 Saccharomyces cerevisiae
FT                   YGR270W YTA7 Protein of unknown function member of
FT                   CDC48/PAS1/SEC18 family of ATPases potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09823g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03017"
FT                   /db_xref="GOA:Q6CXB0"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXB0"
FT                   /protein_id="CAH03017.1"
FT                   /translation="MTLHSKSGDDESGTHTEFYDDNGIAHTTPRLLKKVNYAEIENGYD
FT                   YIEESDTNSGGTAAVGANYSDTGTGRRRGRRPGQRNKRVRDDDDDDDVSFHEEDVDDDD
FT                   DDDDDVDDGDEYIDPADDRKRIARRRDKNFIVKDDEDGSDGNEDYSIKEEDLDEDEDDG
FT                   DEDEEDDDGTVRRGRRPKRSAARSTRREQPPRKLRPHRTRSSRVVDDDEDDDDTVGSGR
FT                   HRSASARTREALTLEDEIRELQEDSPIREKRSLRERTKPVNYTIPPPLSENQIGAMEAT
FT                   SVPGIPPGTLPYQSSVYQSPRGKRGLHSGQSFGPIRRLFPTGGPFGGNDVTAIFGKNVQ
FT                   FYNSNPNALNEQSNKFLDSDSSDDEILALGMKPKPKDPSKQKKKKKPEIADLDPLGVDM
FT                   NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARAL
FT                   AASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPV
FT                   RSSKQEQIHASIVSTMLALMDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL
FT                   PDLKARDKILHIHTKKWNPPISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFPQ
FT                   IYKSEEKLKIDPKSVRVKARDFMLALEKIVPSSARATGSTAQPLPKYVEPLLAQQFINV
FT                   KDQLNLLLPKQSTKLKSGSSIIQYYLENEDLEDSDDEEGTGFDKHEFLKLIKKSRVCKP
FT                   KLLITGPPGNGLQYIASATLHFLEDYNIQMLDIPTLVSESSRTMEAALVQTFAEAKKRQ
FT                   PSVICIPNLELWLQACPQSCLITLTTLFRSLQSNENVVLLAIADGLSRAEIEDGPLAMF
FT                   SFGPNIVNINEPSPHQRFMYFKTVADLIKMKPTQYIESRKRKKPLPKLPVVETSQEIDE
FT                   NGRLLTEEEKLRLELKKFQHQDMKLKNTLKIKLSGLMDLFKNRYKRFRKPPIDDTFLIH
FT                   LFEPETFAANQGWQPAYVKDGDMILEVATGRKFYNMDLDIIEERLWNGYYSEPKQFLKD
FT                   IELIYLDATTSADRERVIKASEMFANAQVGIEDISQPEFVAECKATRQRELLRQELFIK
FT                   EKSERVDKEQQILLQNNPTQTDSIATVELTTASGNQVQSQAQLDAGTLDLGETSQVEPF
FT                   TTQPVNFGTNDADLAKTDTVQDYSESRLTNAENGFAQTSHNNSHLTVDTEDATNKEQEK
FT                   QPPSVTEAEVEPEAQSEPEPESEPESELEPEPEFVYDESRALSLISALEKNTQNFTVEK
FT                   LEEVYASIANVIWNNRLSWDKTDALDQLEGLIKTL"
FT   gene            complement(<862467..>863876)
FT                   /locus_tag="KLLA0_A09845g"
FT                   /old_locus_tag="KLLA-ORF10171"
FT   CDS_pept        complement(862467..863876)
FT                   /locus_tag="KLLA0_A09845g"
FT                   /old_locus_tag="KLLA-ORF10171"
FT                   /product="KLLA0A09845p"
FT                   /note="similar to uniprot|Q03557 Saccharomyces cerevisiae
FT                   YMR293C Uncharacterized ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09845g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03018"
FT                   /db_xref="GOA:Q6CXA9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA9"
FT                   /protein_id="CAH03018.1"
FT                   /translation="MSIKTALSRLQQIPEIQSRYNVFTYVNERASSQLESIDKNTTADK
FT                   PLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDEFG
FT                   MGSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRLPAS
FT                   YTSTFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPTSLSE
FT                   ELRHKFTSLTTKRKTLRIGIPEEFSQESVPAEFRAAMTAIIKRLMKKGHEVYPVSIPSV
FT                   KNALSIYYTLSPAEAVSNLSRYDGVRYGYRAESDVEDGTLFTPTRSAFGPEVQNRIILG
FT                   NYNLCSESFKNNYIKAQKLRVQLINDFDRAFRFPNVLSGNSVNKDGVDIMLSLTSTSFP
FT                   TTYDEVVSEENKNPLNTYINDIFTMPMSLCGLPTMTVPAGHAFGIQVFSQHGNDYELLD
FT                   ACSEIDALVNS"
FT   gene            <864111..>865193
FT                   /locus_tag="KLLA0_A09867g"
FT                   /old_locus_tag="KLLA-ORF10170"
FT   CDS_pept        864111..865193
FT                   /locus_tag="KLLA0_A09867g"
FT                   /old_locus_tag="KLLA-ORF10170"
FT                   /product="KLLA0A09867p"
FT                   /note="similar to uniprot|Q75D83 Ashbya gossypii ABR141W
FT                   ABR141Wp and some similarites with YMR294W uniprot|P36224
FT                   Saccharomyces cerevisiae YMR294W JNM1 Component of the
FT                   yeast dynactin complex consisting of Nip100p Jnm1p and
FT                   Arp1p required for proper nuclear migration and spindle
FT                   partitioning during mitotic anaphase B"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09867g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03019"
FT                   /db_xref="GOA:Q6CXA8"
FT                   /db_xref="InterPro:IPR028133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA8"
FT                   /protein_id="CAH03019.1"
FT                   /translation="MAVEIIDLSTEVEQLGLQGDTGKEVYETSDVEETPDQVVITEANE
FT                   DIIEEEIPKVQENNERFEHSVLSSEDTDFSGKLYALPTYNIRHINETRRQRLARIRREL
FT                   LEIEQDSEEDGSSNELQNLKQLYETLAQSTESTMENIQSQLVIASDEDTENEVTLPNIR
FT                   IEINQLKQLEDIEHKISILESQIGPSNTNKSITSIINELHREINILKLDEPTLTGFQNK
FT                   MKEISDQYDQSIIGRRAQKDPNLSTDIERKLKSTESKVNDIYDKYNILNKYSEVIPQIT
FT                   ERVQSLNVLHTSVNDMNDTVSEINDHMSSVHSQIEKWSSLLESTSRQLTDREQSFKRTR
FT                   HQLELQLNDLEVRIGKLSGQ"
FT   gene            <865422..>871304
FT                   /locus_tag="KLLA0_A09889g"
FT                   /old_locus_tag="KLLA-ORF10169"
FT   CDS_pept        865422..871304
FT                   /locus_tag="KLLA0_A09889g"
FT                   /old_locus_tag="KLLA-ORF10169"
FT                   /product="KLLA0A09889p"
FT                   /note="highly similar to uniprot|P53327 Saccharomyces
FT                   cerevisiae YGR271W SLH1 SKI2-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09889g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03020"
FT                   /db_xref="GOA:Q6CXA7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA7"
FT                   /protein_id="CAH03020.1"
FT                   /translation="MSTTYSVHSVGSYMKAMEVMVSAAQAFPHLDTSTIPKVDEELKKG
FT                   TKRSDNRNKLLVTSQDRNEWDDIFEEFANLSSDNLQSLITSNHSASNAQAQVYKELFRL
FT                   LDNVDSDFPRDQLLQQLIELLRNNENTGTADQDLFDYLGAENIELISFLIENQEILKHT
FT                   PIEHMSNSDTYEGNRFMTEEDMRRQVLKNREKGKNAKLATAQRKVKYPHVFRQSEDAGS
FT                   SMLSFAGQKFALPAGSMRYTFQTHEEITIPCAVPKRKFDIPLVKVSDLDEYCRKVFEYD
FT                   YLNKVQSLVYPVAYNTNGNMLICAPTGAGKTDIALLTILNTIKQFSVINEEGGFDIEYD
FT                   DFKIIYVAPLKALAAEITDKFARKLSVFDVKVRELTGDMQLTKREILETQVIVTTPEKW
FT                   DVVTRKASGDNDLTSKVKLLILDEVHLLHEDRGSVIESLVARTLRQVESSQTMIRILGL
FT                   SATLPNFVDVADFLGVNRNVGMFYFDQSFRPKALEQHLIGCRGKAGSKQCRENTDKVAY
FT                   EKAVEMMKLGNQVMIFVHSRKDTVKTARTLISMARDNYEMDLFTSNDASVTIFQKELSK
FT                   HKDKDLKELFQSGFGVHHAGMSRSDRNITEKMFKSGAVNVLVCTATLAWGVNLPADCVI
FT                   IKGTQVYDSKKGGYTDLGISDVIQIFGRAGRPGFGSDYGTAYLCTSNDRLDHYVDLITQ
FT                   QHPIESRLGAKVVDNLNAEISLGTVTNVEEGVKWLGYTYMFVRMKQNPFTYGIDWEEIR
FT                   NDPQLYEKRRQIIITAARRLHSLQMIVFDEVSMHFIPKDLGRIASEFYLLNESVEIFNQ
FT                   VANPRATEADVLAMISMSSEFDSIKFREEESNELNKLLDCAVECQISGDVDSSPGKTNI
FT                   LLQAYVSQSRINDSALNSDANYIAQNSARICRALLLIGINRRWGTFSKVMLDICKSIEK
FT                   RMWAFDHPLCQFDLPDTILRNIKAKNPSMEMLLDMDAAELADLVHNQKMGGKLYRIISR
FT                   FPRVDIDAEIFPITTNVMRVHISLLPNFEWDYHVHGDAQFFWVFVEESNQSSILHFEKF
FT                   ILNKRQLSNPHEMDFMIPLSDPLPPQVIVKVVSDTWIGCESAHTISFQHLIRPHNETLQ
FT                   TRLQKLNPLPTSALKNPLVESIYPFKYFNPMQTMVFHTLYHSNVSTFVGSPTGSGKTVV
FT                   AELAIWHAFRDYPGSKVVYIAPMKALVRERVNDWRKRITPVTGDRIVELTGDSVPDPQD
FT                   IKDATIVITTPEKFDGISRNWQTRKFVQNVSLIIMDEIHLLASDRGPILEMIVSRMNYV
FT                   SSQTKKPIRLLGMSTAVSNAFDMASWLGVKGNGLYNFPSSVRPVPLKMYIDGFPDNLNF
FT                   CPLMKTMNKPAFMAIKQHSPEKPVLLFVASRRQTRLTALDLIHLCGMEDNPRRFLHIDD
FT                   EEELQYYISKVSDDTLKLSLQFGIGLHHAGLIESDRAISHELFLRSKIQILVATSTLAW
FT                   GVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTSGTAIVYTKESKK
FT                   MFYKHFLNVGFPVESSLHKVLDDHMGAEIASGTISTKQEALDFLNWTFLFRRAHHNPTY
FT                   YGINDDTSTSGINKYLSDLVNNTLDNLKESRCVEIYGTNIYSTPYLSISSYYYISHKTI
FT                   RSLLKQINSNASFQDVLKWLSLAVEYNELPVRNGEIIMNVEMSAQSRYSIESTFIDEFE
FT                   LPMWDPHVKAFLLLQAYLSRAELPIVDYHQDTISVLDQSLRILQAYVDVAAELGYFNTV
FT                   MTLIKAMQCVKQGYWYEDDPISALPGAHLKRDDRIEFGDDGWPLPDNGYKMSLDSLARL
FT                   QDDNGAKNKVKNIMSRQYHVTPDHQKRMLREISRLPILDNIVFTSQTSNESLVLKATHH
FT                   NRVPKEFSVYCAKYPKTQRELWFAIAYQNDELIMLKRCQPRLGPNGKGLLSFDFVVPED
FT                   IRGKELDFVLVSDALDIKYHLKHKLME"
FT   gene            complement(<871390..>872076)
FT                   /locus_tag="KLLA0_A09911g"
FT                   /old_locus_tag="KLLA-ORF10166"
FT   CDS_pept        complement(871390..872076)
FT                   /locus_tag="KLLA0_A09911g"
FT                   /old_locus_tag="KLLA-ORF10166"
FT                   /product="KLLA0A09911p"
FT                   /note="similar to uniprot|P53328 Saccharomyces cerevisiae
FT                   YGR272C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09911g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03021"
FT                   /db_xref="GOA:Q6CXA6"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXA6"
FT                   /protein_id="CAH03021.1"
FT                   /translation="MSGKSKRPRQRHDSSLQLASVIGAGANKIKKQIRNVERLLQKRRD
FT                   VLPDTVIVEKERMLEGLKFELKEAELRQVGRKNAKKYHMVRFFERKKALRRYKQASKKV
FT                   IADPENKRFQNELRDCTIDLCYVVNFPRLSKYIALYPTGSSDAKELSEEVKKGLDSTDA
FT                   KRTEFRNLVAKQLDEGTLPVSLSQILEGKRLNKDSTGVMLEEEQVEEEATEKQFNDEEE
FT                   EDDFFE"
FT   gene            complement(<872665..>873258)
FT                   /locus_tag="KLLA0_A09933g"
FT                   /old_locus_tag="KLLA-ORF10162"
FT   CDS_pept        complement(872665..873258)
FT                   /locus_tag="KLLA0_A09933g"
FT                   /old_locus_tag="KLLA-ORF10162"
FT                   /product="KLLA0A09933p"
FT                   /note="similar to uniprot|Q03559 Saccharomyces cerevisiae
FT                   YMR295C Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09933g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03022"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA5"
FT                   /protein_id="CAH03022.1"
FT                   /translation="MGVFNRRSSGDSSSHGSTGSNEVKITKEDRQHLKVRTASVHDPIL
FT                   EAVQEMQPFEQAADTFQGNMNRQSHVPTGELKDVFGQPIQQPDVSNPTRSRDERPLDTI
FT                   RGFEYSISGDPTWSQQLETPQYGFRVRPGFQAYTGGVAGNGNDHHGYPSNLNMNTNTTN
FT                   SYQQQGVYQAPVSDANKEQKTKKKRGFFGRKKKD"
FT   gene            complement(<873688..>875355)
FT                   /locus_tag="KLLA0_A09955g"
FT                   /old_locus_tag="KLLA-ORF10158"
FT   CDS_pept        complement(873688..875355)
FT                   /locus_tag="KLLA0_A09955g"
FT                   /old_locus_tag="KLLA-ORF10158"
FT                   /product="KLLA0A09955p"
FT                   /note="similar to uniprot|P25045 Saccharomyces cerevisiae
FT                   YMR296C LCB1 Component of serine palmitoyltransferase
FT                   responsible along with Lcb2p for the first committed step
FT                   in sphingolipid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09955g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03023"
FT                   /db_xref="GOA:Q6CXA4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA4"
FT                   /protein_id="CAH03023.1"
FT                   /translation="MIDSVNVPEVLPSSIPVPSAVISSASYLWFYFITFFKLIPGAHYV
FT                   IDYVEKSHQDDPYRTFVEVLLILYSIVYFLSKPKKKGAVDQPKLSEKEIDNLIEEWEPE
FT                   PIVVPDERNEWRLAKIPVIEGSGADNVINITRDNGKEAYASAFNLCSFNFLQLSKHPRV
FT                   VEIAKEIIKNYGVGSCGPAGFYGNEDVHYNLEYDLASFFGTENSVLYGQDFCVSSSVIP
FT                   AFTKRGDVIVADDKISVSSQNALQLSRSTVYYYKHNDMASLENLLHELDEAEKKEKLPA
FT                   IPRKFIVTEGIFHRTGEIAPLPELVQLKRKYKYRLFIDETFSIGVLGATGRGLTEYYNI
FT                   NRATSIDITVGSLATAIGSSGGFVLGDNVMVRHQRIGSNAYCFSASLPPYAVRTASTVL
FT                   QMMDEDNSSVTKLRYLSNKLHEWFQTDTELLRYIEVTSHRDSSVLHFQLTDAQRQQKFG
FT                   SSIESVFQESQYQQQHCISDHFVESWEKEEIFLQAIVDTVLIDGNILISRDTIVLKQET
FT                   LPVTPNISICCNSSMEESQLLDAYNVIRIAIIKHCSEA"
FT   gene            <876594..>878201
FT                   /locus_tag="KLLA0_A09977g"
FT                   /old_locus_tag="KLLA-ORF10157"
FT   CDS_pept        876594..878201
FT                   /locus_tag="KLLA0_A09977g"
FT                   /old_locus_tag="KLLA-ORF10157"
FT                   /product="KLLA0A09977p"
FT                   /note="similar to uniprot|P00729 Saccharomyces cerevisiae
FT                   YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
FT                   involved in protein degradation in the vacuole and required
FT                   for full protein degradation during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09977g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03024"
FT                   /db_xref="GOA:Q6CXA3"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA3"
FT                   /protein_id="CAH03024.1"
FT                   /translation="MRTASVLCALAGCASALSVQNKLPGRTALDKAIDALGLSSSDVLS
FT                   SLPNHLKTAWNEMGMLFPQEAGQLEFLSKPRGKITKHDKWDYVVKPESFVSTANVNNDN
FT                   VGNYQLRVKKIKDPKVLGVDPDVKQYSGYLDVEDEDKHFFYWFFESRNDPKNDPIILWL
FT                   NGGPGCSSLTGLFFELGPSSVGEEIKPIYNPHSWNSNASVIFLDQPVNVGYSYSSSEGV
FT                   SNTVAAGKDVYAFLQLFFQQFPEYASGQDFHIAGESYAGHYIPVFATEILSHPTEERSF
FT                   NLTSVLIGNGLTDPLSQYPYYEPMACGEGGEPSVLEPEQCDNMLETLPRCLNLIQSCYE
FT                   YESVWSCVPASIYCNNAQMGPYQSTGKNVYDIRKECQGELCYDEMKYMDEYLNLDFVKE
FT                   AVGAEVDNYESCNFDINRNFLFAGDWMKPYHKHVTELLEQDLPVLIYAGDKDFICNWLG
FT                   NQAWTNLLPYKDAEEFAKQPVKNWVTSVGKKAGKVKNFDKFTFLRVYGAGHMVPFDQPE
FT                   NALDMVNDWVNGKFDFEH"
FT   gene            <878563..>879006
FT                   /locus_tag="KLLA0_A09999g"
FT                   /old_locus_tag="KLLA-ORF10155"
FT   CDS_pept        878563..879006
FT                   /locus_tag="KLLA0_A09999g"
FT                   /old_locus_tag="KLLA-ORF10155"
FT                   /product="KLLA0A09999p"
FT                   /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
FT                   YMR298W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A09999g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03025"
FT                   /db_xref="GOA:Q6CXA2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CXA2"
FT                   /protein_id="CAH03025.1"
FT                   /translation="MATQQNKNRVYILLQYVLAALVLIAAVEYFKYKTRISYEWFHCTV
FT                   QSEELFDHPEGSPLKLWAIGGPSCDKRGELKTIMKRITMDFDPNVEPVKFCIVEDTKVK
FT                   SIHYPIEDGNKGDPGYISFVGYERDSDVVEQACASYAATVFNL"
FT   gene            complement(<879152..>882253)
FT                   /locus_tag="KLLA0_A10021g"
FT                   /old_locus_tag="KLLA-ORF10154"
FT   CDS_pept        complement(879152..882253)
FT                   /locus_tag="KLLA0_A10021g"
FT                   /old_locus_tag="KLLA-ORF10154"
FT                   /product="KLLA0A10021p"
FT                   /note="similar to uniprot|P46677 YGR274C Saccharomyces
FT                   cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
FT                   polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10021g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03026"
FT                   /db_xref="GOA:Q6CXA1"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="InterPro:IPR041670"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA1"
FT                   /protein_id="CAH03026.1"
FT                   /translation="MPRVAGSSGSKKQGKAKKDFSNEDDAYNALFGGEFGALDISNYTS
FT                   GGGNGKQDETEHLPNAIDFEDEDELADEELPEEEEPSHSPNRHNEGSFQRSLTEDDEYM
FT                   TLMDHGDVMHEVDAAGFEVQGNNALFMESTYQSFGPEQHQFNEYDEQHRRLMEEQRRKQ
FT                   EEQNAKEEQLLFQSYFPELKPGRVLRMTKIAPKPLAKYQWQRELYLRNRILKPLIPIKV
FT                   KFQVQKDTKKLFKMRSKSVKPWQSAISEFSEVQRRNVIKVAYDEIYKEDTVDDKKDEHD
FT                   EVIPEDLLIVADEWDYEKIVDDRENEEPMTSNKRNPPAVENTLEEDGKDWEWNEDDIIN
FT                   GKVSAKEPPIDMNDERLLILPNENKIESAQKVVKPLIPYNEKSLLAKFNISNDDTYKIL
FT                   KKNYQKKIRSTISNLNIEHSQPATRLQSPFYKVVLPKDQLRHFHRNHFGKRIRPGTNIV
FT                   FSKIKTRKRKKDKGKDVHEIFQHSADLTVGDSAQVFLMEYSEQQPVALSKFGMANKLIN
FT                   YYRKTGETDSSRPKLPVGETHVLGVQDKSPFWNFGFVSPGNIVPTLYNNMVRAPVFKHE
FT                   VSKTDFLLVKSLGNGSGNRFYLRQINHLFAVGQTFPVVEVPGPNSRKVTAMGKNRLRMV
FT                   VYRILNKSPENRLLVKQVARHFPEQNDMQNRQRLKEFMKYQREGDDQGFWKLKEGEVLL
FT                   DNENVKKMVTPEDVSLVESMYYGQQFQEDIDFYNFDERAKELEENLIFWNATKNFLNAT
FT                   QMRAMIQIHGPGDPTGCGEGFSFLKTSMKGGFVKSGSKDQPQIAGGHSYNVAQQQKAYE
FT                   EEISRTWYNQAKSLSIQNPFEEMDDPDIVNESNKHVPSTRPDEKVLRITRKKRDSNGII
FT                   QRQTVIVRDPRVIQGYLRAYEKRREEAERNLGLDELINDNITIVGGENEEERQLKQKKL
FT                   LEEQLAKLEKSKERRQARKAAREKTKDGKVSKSKNTTRRCATCGAIGHIRTNKSCPMYN
FT                   GGVAANAAAAQGSNGTSTSKVGTESSTPIAPSTPSASVPDLGDN"
FT   gene            <882810..>883271
FT                   /locus_tag="KLLA0_A10043g"
FT                   /old_locus_tag="KLLA-ORF10152"
FT   CDS_pept        882810..883271
FT                   /locus_tag="KLLA0_A10043g"
FT                   /old_locus_tag="KLLA-ORF10152"
FT                   /product="KLLA0A10043p"
FT                   /note="weakly similar to uniprot|P53330 Saccharomyces
FT                   cerevisiae YGR275W RTT102 Regulator of Ty1 Transposition;
FT                   regulator of Ty1 transposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10043g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03027"
FT                   /db_xref="GOA:Q6CXA0"
FT                   /db_xref="InterPro:IPR018304"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CXA0"
FT                   /protein_id="CAH03027.1"
FT                   /translation="MSLISRANRLGGFTTDAKHWEYEWSTTAKQNENGTDEKVKYKFKQ
FT                   WVKKDHPLRDVVEDDTDVLNLDEFDRTKIAKKNARVQEKSGPDSLSINDIRGAVGGSDI
FT                   PGFSGSDAKKEAESEAAVETPVVETPAEETPAEDTPAEVKDQEGDVKME"
FT   gene            complement(<883467..>885515)
FT                   /locus_tag="KLLA0_A10065g"
FT                   /old_locus_tag="KLLA-ORF10150"
FT   CDS_pept        complement(883467..885515)
FT                   /locus_tag="KLLA0_A10065g"
FT                   /old_locus_tag="KLLA-ORF10150"
FT                   /product="KLLA0A10065p"
FT                   /note="similar to uniprot|P53331 Saccharomyces cerevisiae
FT                   YGR276C RNH70 3'exoribonuclease required for 5S and tRNA-
FT                   Arg3 maturation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10065g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03028"
FT                   /db_xref="GOA:Q6CX99"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR034922"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX99"
FT                   /protein_id="CAH03028.1"
FT                   /translation="MSNSASGSPKSTVCVSPAKNADQLPALGTSQGFADSNSVFPPPAG
FT                   TSDNASLSVRSRVERLSICEGNTSKDEILSKLGRTGSNGGKDNRDDDVVTDISHSQSGS
FT                   KRRRRRSSAVQGSSLENLKHDNISASSLAVPKKKKKSTKAVNLSVEKISKPLSIKDLRD
FT                   LVLFSFRDTNNSPNWLQIDNRAALQRVVVLFAPGLLPSDFSIGAGSDSKMTSFAENLEK
FT                   LTNTHTLPSVLFSDPATYWYNLPICAPGSKNSLFSAYNSFVNVGLNKKEKERKRLQLSK
FT                   KKVVMSDLLMSIDDLIENDYPIHLDSPGLIEEFKETLEKLYSSPYYSEWTDTKTIDRDG
FT                   PRTFAIDCEMCMSENGHVLTRCSIVNFDGDLIYDKLVKPDVPIIDYLTKYSGITEEKLR
FT                   DVTTTLKDVQEDLLNIISSKDVLIGHSLQSDLNVLKLRHPNIVDTAVIYEHKAGPPFRP
FT                   ALRYLASEYLNVDIQKDTGLGHDSYEDAKTCMELTKLKIVNGLTFGIGFNTENLFHRLS
FT                   RNGISSMILNDSASKQSNVLKIENHEVHVRCKDDQMVADEICEHINEHNLFVGRLRELE
FT                   YAREFAACNNRDTEVLTEELALENMGKRITKIYENLPSSAMLLICSGTGDTREWIKIMS
FT                   ELNKLDKEDRAVEKSKREAEIQASIKTARDAISFMTIKTNNVNNESQ"
FT   gene            complement(<885994..>887106)
FT                   /locus_tag="KLLA0_A10087g"
FT                   /old_locus_tag="KLLA-ORF10148"
FT   CDS_pept        complement(885994..887106)
FT                   /locus_tag="KLLA0_A10087g"
FT                   /old_locus_tag="KLLA-ORF10148"
FT                   /product="KLLA0A10087p"
FT                   /note="weakly similar to uniprot|Q04949 Saccharomyces
FT                   cerevisiae YMR299C DYN3 Dynein light intermediate chain
FT                   (LIC) localizes with dynein null mutant is defective in
FT                   nuclear migration"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10087g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03029"
FT                   /db_xref="GOA:Q6CX98"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX98"
FT                   /protein_id="CAH03029.1"
FT                   /translation="MATKLEAFINDLRLQCETNDTTKYVSIVLFCEKETTLKLFFQYID
FT                   GIDTNSEPKLAVLSPTLSPVGYYTKEITTEDGWQVILNITCIPPPWKSSSIDLLPSILK
FT                   SDPEKSSKRFVLLLDWINEDQSYWLEDIEGLFVQLKQVSPETKAAGSVMMLHSDYCKHL
FT                   ENTHTKWSSTAIDFMHQSLRTLALHLKISLYSDLKNSVLAAKSAVGVPLSTEEQKSLID
FT                   MVNLENVNVTYGSDSLNKIAMIDENFPLSVYKDNLSTLKHDFSDVIPEIKPRNMGSCAI
FT                   TEPIKPLPDLQSLIPDVQGQLSHLYELQRKNSSLKRVTNQPAVVQDIGQDNTMALNDIA
FT                   SDNNHLQHVPDDDSALDSLVHGIVQRHQIS"
FT   gene            complement(<887498..>889027)
FT                   /locus_tag="KLLA0_A10109g"
FT                   /old_locus_tag="KLLA-ORF10147"
FT   CDS_pept        complement(887498..889027)
FT                   /locus_tag="KLLA0_A10109g"
FT                   /old_locus_tag="KLLA-ORF10147"
FT                   /product="KLLA0A10109p"
FT                   /note="highly similar to uniprot|P04046 YMR300C
FT                   Saccharomyces cerevisiae ADE4 Phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10109g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03030"
FT                   /db_xref="GOA:Q6CX97"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX97"
FT                   /protein_id="CAH03030.1"
FT                   /translation="MCGVLGICLADQTAAVAPELFDGCLFLQHRGQDAAGISTCGQRGR
FT                   LYQCKGNGMARDVFTQQRMAGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGICMGH
FT                   NGNLVNTQAIQRYMDEDVHRHINTDSDSELLLNIFAAELEKYNKYRVNNDDIFHALEGV
FT                   YRLCRGGYACVGMVAGFAMIGFRDPNGIRPLLFGTRTNADGTKDYMLASESVVLKAHNF
FT                   NDFRDLKPGEAVIVPKDCSKSEPEFRQVVPVNSYRPDLFEYVYFARPDSVLDGISVYHT
FT                   RLAMGVKLAESVLKSIKPEDVDVVVSVPDTARTCALECANTLNKPYREGFVKNRYVGRT
FT                   FIMPNQKERVSSVRRKLNPMESEFKGKRVLIVDDSIVRGTTSKEIINMARESGALKVYF
FT                   ASAAPAIRFNHIYGIDLADTKQLVAYDKTEEEIQHELGCDEVIYQSLDDLIDCCKTPQI
FT                   QKFEVGVFTGQYVTGVEDGYLLELEKARAMNVLKASAKAESDIGIYNSGDY"
FT   gene            complement(<889688..>891850)
FT                   /locus_tag="KLLA0_A10131g"
FT                   /old_locus_tag="KLLA-ORF10146"
FT   CDS_pept        complement(889688..891850)
FT                   /locus_tag="KLLA0_A10131g"
FT                   /old_locus_tag="KLLA-ORF10146"
FT                   /product="KLLA0A10131p"
FT                   /note="similar to uniprot|P40416 Saccharomyces cerevisiae
FT                   YMR301C ATM1 Mitochondrial inner membrane transporter
FT                   exports mitochondrially synthesized precursors of iron-
FT                   sulfur (Fe/S) clusters to the cytosol member of the ATP-
FT                   binding cassette (ABC) transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10131g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03031"
FT                   /db_xref="GOA:Q6CX96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX96"
FT                   /protein_id="CAH03031.1"
FT                   /translation="MIMFRSLSVTPVWKAGLSLSHRSIPINSRLSSVRNYISIGCANKT
FT                   GSRLLRSAGVSSQYKDFRRFNSSSNGNGTDKNASVAPKTEVKKIVPPKPSTNGKSKTPT
FT                   ISELRIMKDLFKYIWPSGDNKVKIRVLIALALLIGAKLLNVQVPFFFKQTIDSMNIEWG
FT                   PDVATVLPVAITMTILSYGAARFGAVMFGELRNAVFAKVAQNAIRKVSLQTFQHLMKLD
FT                   LGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHMIPITFEISVVCGILTYQFGSSFAAM
FT                   TFVTMLLYSFFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNEEYLANK
FT                   YHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYMGASGVMEGALTVGDLVLIN
FT                   QLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKF
FT                   ENVTFGYQPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDG
FT                   KDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIH
FT                   KLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTI
FT                   KENFSDVAKTSVYIAHRLRTIADADKIIVLENGAVREEGTHNALLANPNSLYSELWNIQ
FT                   ENLDMLEDELEDELKLEKEPRTSKKD"
FT   gene            complement(<892398..>893099)
FT                   /locus_tag="KLLA0_A10153g"
FT                   /old_locus_tag="KLLA-ORF10143"
FT   CDS_pept        complement(892398..893099)
FT                   /locus_tag="KLLA0_A10153g"
FT                   /old_locus_tag="KLLA-ORF10143"
FT                   /product="KLLA0A10153p"
FT                   /note="highly similar to uniprot|P40302 Saccharomyces
FT                   cerevisiae YMR314W PRE5 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10153g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03032"
FT                   /db_xref="GOA:Q6CX95"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX95"
FT                   /protein_id="CAH03032.1"
FT                   /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAV
FT                   VVALKRNADELSSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLA
FT                   LERAGYLLSDKAQKNTQSYGGRPYGVGLLLIGYDNTGAHLLEFQPSGNTLELYGTAIGA
FT                   RSQGAKTYLERVLDDFREIEDADELIKHGVEALRHSLKDETLSTKNLSIAIVGHDKPFT
FT                   IYDGEDVQPYL"
FT   gene            <893626..>895401
FT                   /locus_tag="KLLA0_A10175g"
FT                   /old_locus_tag="KLLA-ORF10141"
FT   CDS_pept        893626..895401
FT                   /locus_tag="KLLA0_A10175g"
FT                   /old_locus_tag="KLLA-ORF10141"
FT                   /product="KLLA0A10175p"
FT                   /note="similar to uniprot|P40308 Saccharomyces cerevisiae
FT                   YMR313C TGL3 Triacylglycerol lipase of the lipid particle"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10175g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03033"
FT                   /db_xref="GOA:Q6CX94"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX94"
FT                   /protein_id="CAH03033.1"
FT                   /translation="MFYQRIMMWFKRVFFYFFYLLLNNVPKTVWDILHVVTDIYMFWWR
FT                   KFMDKVRPRSRTMYREAVAGLYGCDDYEEWYEKASLVDELTGVDLWRRNFFSKRFDFEA
FT                   VLEQYAALMESLEEDDFETVKSRFTNTGPTMLRNFAGIVDKRLFTKSLVGTKLLIEQYL
FT                   DKVVDTLYLLTAHPEVVQRTFFQRCKLSLGATALALQGGSLFGLFHLGVLKGLLDRNLL
FT                   PNIINGTSMGACVASMACCLSDGELEDLLTGNRLVSTIKRDTALMKECGYGNIDEHFNI
FT                   GTLVENVVHNGYSKDVYLFIKFIQKSVIGDLTFEEAFQRTGKVLNIVVHPTNKNICPNL
FT                   LNYVTTPNVLISSAIDCSFGTNTISKNTWLLGKNIENKIVDYLDRKEPHYQELKFSAPQ
FT                   YVQDSSQLEAPYTRLTELFNVNNFIVSLARPYLAPLALNDLKHDIRTSEYYYYKRFPYI
FT                   DPGSYSPMQLSKVTKLEPLAFKFKYHLERKMKHILTMELKHRVEIMDSLGLLSNWIKRI
FT                   AIDEKTPRSATEVAIVPHMNSLSVSRIIEGRLDNINYWMKCGQESTWPVISLVKTRCAV
FT                   EFTLDDIIKGFKKSI"
FT   gene            complement(<895418..>896227)
FT                   /locus_tag="KLLA0_A10197g"
FT                   /old_locus_tag="KLLA-ORF10139"
FT   CDS_pept        complement(895418..896227)
FT                   /locus_tag="KLLA0_A10197g"
FT                   /old_locus_tag="KLLA-ORF10139"
FT                   /product="KLLA0A10197p"
FT                   /note="similar to uniprot|Q04868 Saccharomyces cerevisiae
FT                   YMR312W ELP6 Elongator protein part of the HAP subcomplex
FT                   of Elongator which is a six-subunit component of the RNA
FT                   polymerase II holoenzyme required for Elongator structural
FT                   integrity and histone acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10197g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03034"
FT                   /db_xref="GOA:Q6CX93"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX93"
FT                   /protein_id="CAH03034.1"
FT                   /translation="MSVQKQELQIFSDHSVLSRHLFTDSSSNLVLVTDTVATNASWFVN
FT                   ALVETVTLGGPVSLNGNNSGSNSGLSSSDPVKVVVGSFLNHQSYFTTAFDRLKVPRNRY
FT                   NVLQIAEDLVVKNVGKPVDVVIEWVLKQFEESLSNSPSVVILEKPEILMALFKLNSDEL
FT                   HLKLINPLLKLCSLLIVVNSVESFDNDFPEHLGKDTVEFVRFTTSCFHKSFLVLSVRPL
FT                   DTGKAKDVTGTLAITRGGALLDIPALHVVENQYLFHDLKENTTLFYR"
FT   gene            <896931..>898358
FT                   /locus_tag="KLLA0_A10219g"
FT                   /old_locus_tag="KLLA-ORF10136"
FT   CDS_pept        896931..898358
FT                   /locus_tag="KLLA0_A10219g"
FT                   /old_locus_tag="KLLA-ORF10136"
FT                   /product="KLLA0A10219p"
FT                   /note="similar to uniprot|Q75BF2 Ashbya gossypii ADL388W
FT                   ADL388Wp and some similarites with YHR206W uniprot|P38889
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10219g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03035"
FT                   /db_xref="GOA:Q6CX92"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX92"
FT                   /protein_id="CAH03035.1"
FT                   /translation="MDDLGEQLSEGHKDDYDNGIGSVPGGSGSNGKGKSQRTSFNDFVR
FT                   KLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYDFH
FT                   KVKRKKNEVSEGIQNAWEFNHQYFRRHDEAGLDNIRRKPSSQKKILVDENSVIVRKLGG
FT                   APGDDGAFIAGDEEGMTAKMLLKNTVNKTKFNQLKRKVEDMENQVQYLTNENHNMKLDL
FT                   QKIQSKYNMALESLLSTESFNSQLISNFQILVDALSQQGLKVPVGLSFEKGNSRADNKS
FT                   HQQRQISDSTGSTPNANIPGLSVNTTLQKQEPIELLPMDQHPVLRPGFHVLLVEDDSVC
FT                   IQLCSKFLRKYGCSVEVVTDGLSAISTLEKQRFDLVLMDIVMPNLDGATATSIVRSFDN
FT                   ETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYLKDRIPLSEQRQNSN
FT                   NDPKAYVEEPMLKKPHI"
FT   gene            complement(<898752..>900230)
FT                   /locus_tag="KLLA0_A10241g"
FT                   /old_locus_tag="KLLA-ORF10134"
FT   CDS_pept        complement(898752..900230)
FT                   /locus_tag="KLLA0_A10241g"
FT                   /old_locus_tag="KLLA-ORF10134"
FT                   /product="KLLA0A10241p"
FT                   /note="similar to uniprot|P38890 Saccharomyces cerevisiae
FT                   YHR207C SET5"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10241g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03036"
FT                   /db_xref="GOA:Q6CX91"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX91"
FT                   /protein_id="CAH03036.1"
FT                   /translation="MVHLKLETLRLNDEDQSTGSSLITPSRTQLCDEVVRWWKEEPAAE
FT                   DMLIDTLYEHLIRRRSNWSVTKDELYQALKSHKLYTPELNELDSYTGDIRPSTVTDADI
FT                   AQLNKKLLDKVTIADTEFGKGLVATDDIRKGGLVFHEQLPLTVIPQLDKQPLVSRGKCC
FT                   GLCSAFTTLSSQLIIKNNLDCNMCNTIWCSKQCKKLDTTHSVLKHATSRNSLCNSSNWI
FT                   KFENFCLQESLVAAYAVGVIYARHVMQPTSNLWKLFTSLCSVSQRVRWQASDSINVGGT
FT                   FDASCNGKLYADVSAPNMETQWSDAFEMFAKSFPKCDMDYEDFLNLTGTFNLNQIMGQV
FT                   YPLVAHINHSCEPNVRYELEPKHGIKLYARKDIKKGEQLRLTYVNPLHGVTLRRRELRV
FT                   NYGFLCHCPRCCQEWEKRQKIVSDPSNHAISSEAAHSSTTARRKSSMKSCRPSLKELLE
FT                   NGDEFDLEIPSDVNSKRRMSVRFNSHVTLAVEEE"
FT   gene            <900517..>901284
FT                   /locus_tag="KLLA0_A10263g"
FT                   /old_locus_tag="KLLA-ORF10131"
FT   CDS_pept        900517..901284
FT                   /locus_tag="KLLA0_A10263g"
FT                   /old_locus_tag="KLLA-ORF10131"
FT                   /product="KLLA0A10263p"
FT                   /note="similar to uniprot|P40098 Saccharomyces cerevisiae
FT                   YER182W FMP10 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10263g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03037"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX90"
FT                   /protein_id="CAH03037.1"
FT                   /translation="MFRIIRDPLLRNTIRRASTDATSESIAAAARQAKFVVKKPSSNRK
FT                   WTNVLIFGTCFGIGWFTTQHLTLTDIMAWWFYGKLPDTDSKLIDYRDELNQRCDNLSIV
FT                   KQLLSKGYVAVYKQPDADATNTLIDKTLRAPGAICIPPRIYYNPTTKDTVSVYHLGMKL
FT                   TGYPFLVHGGILATVLEDTMRDSVKLVTGKSAEVTQRLKLNYSFPTLANQFVVVRRTKW
FT                   EQKGKNDVEIEAELLDQSGRRPLVRGKANFKLN"
FT   gene            complement(<901341..>902216)
FT                   /locus_tag="KLLA0_A10285g"
FT                   /old_locus_tag="KLLA-ORF10129"
FT   CDS_pept        complement(901341..902216)
FT                   /locus_tag="KLLA0_A10285g"
FT                   /old_locus_tag="KLLA-ORF10129"
FT                   /product="KLLA0A10285p"
FT                   /note="similar to uniprot|P40099 Saccharomyces cerevisiae
FT                   YER183C FAU1 5 10-methenyltetrahydrofolate synthetase
FT                   involved in folic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10285g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03038"
FT                   /db_xref="GOA:Q6CX89"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX89"
FT                   /protein_id="CAH03038.1"
FT                   /translation="MRIIEKWSRETGTRHPTCCRGQIAGCISYKPVFCCLVFPVIDSQV
FT                   SIPLVLGSDFASVIFAQVRCTCMTHQDSAMISQKQVLRTQVKAMLRGLSQAELARQSEI
FT                   VSRHALSLVNAKGFTHIACFLNMDHSEMKTEPLVESLFKQGKTVYLPRCSSTSVSKQVD
FT                   LRQDGALKRPHLVFYRFDSLAQVQALQPQGKYKLREPVRTDPEPLPTPALEVILMPGVA
FT                   FCKKNGARMGHGAGYYDDYISRHIHYTGKKPLLVGLALEEQLVDDVPLEQHDYTVDCLV
FT                   CGDGTVKWYT"
FT   gene            <902374..>903597
FT                   /locus_tag="KLLA0_A10307g"
FT                   /old_locus_tag="KLLA-ORF10127"
FT   CDS_pept        902374..903597
FT                   /locus_tag="KLLA0_A10307g"
FT                   /old_locus_tag="KLLA-ORF10127"
FT                   /product="KLLA0A10307p"
FT                   /note="highly similar to uniprot|P38891 Saccharomyces
FT                   cerevisiae YHR208W BAT1 Mitochondrial branched-chain amino
FT                   acid aminotransferase homolog of murine ECA39 highly
FT                   expressed during logarithmic phase and repressed during
FT                   stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10307g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03039"
FT                   /db_xref="GOA:Q6CX88"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX88"
FT                   /protein_id="CAH03039.1"
FT                   /translation="MNYIGLRNCARAVSSRVSIPSRGIKSHILTSYRAMSLDASKVKIT
FT                   KVETPSKPRPNDELVFGQTFTDHMLTIEWTAENGWGVPEIKPYGNLSLDPSSCVFHYAF
FT                   ELFEGLKAYRTPDNKISMFRADKNMERMNKSAARICLPSFNSDELIKLIGKLIEQDKHL
FT                   VPQGQGYSLYIRPTMIGTTNGLGVGTPDRALLYVITSPVGPYYKTGFKAVRLEATDYAT
FT                   RAWPGGVGDKKLGANYAPCILPQLQAAERGYQQNLWLFGPEKNITEVGTMNVFFVFKDS
FT                   KTGKKELVTAPLDGTILEGVTRDSILQLARENLNSDEWIVSERYYTITEVEERAAKGEL
FT                   VEAFGSGTAAVVSPIKEIGWNGHDIQVPLLPGEQCGPLTKQVAEWIADIQYGRKEHKGW
FT                   SRIVADLN"
FT   gene            <903873..>905792
FT                   /locus_tag="KLLA0_A10329g"
FT                   /old_locus_tag="KLLA-ORF10123"
FT   CDS_pept        903873..905792
FT                   /locus_tag="KLLA0_A10329g"
FT                   /old_locus_tag="KLLA-ORF10123"
FT                   /product="KLLA0A10329p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10329g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03040"
FT                   /db_xref="GOA:Q6CX87"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX87"
FT                   /protein_id="CAH03040.1"
FT                   /translation="MVGTIEMKKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCD
FT                   YSRTLKWGGRPFKDNRVSKKMKFEHTYVVEGICAVDLNAATGKQATKVKKNKKMITKKT
FT                   VVVKEEEPVQEKQLQELVQELEKPPLSEPVIEIERVEEEGNSPQRVNMALVSSTPLSPL
FT                   SLSLFDGSKDELDDSIAGSQRIGGFHNDDDDLVQSLDLEFFMPSISLPSLMIPDLLLQS
FT                   PEMAESFDFFVNQTSKLLVPAPSSIYTRNPFFNFLPRMAMSNTALMNLLLVFGANHKHK
FT                   ILQYQELSNGDSSLVANDLLINTFTNLMGQLTNFDSRNSDSTLATILLLAAFDIFFGDK
FT                   KQKWRTHVYGARKIMKERISNDTGSVMLSNNSADVEQEYFLLRWFAYTDIISSLSSTNS
FT                   INNIHKLTTLRYEMETTIKDSLMQKMMLLKDIEYFTGMEVICLWLLAEISRLVNEKETA
FT                   TNNIFPQDLILRALELDHKMVSYLKASELKRNEIFQSYYLSKTDAITTESYGAYRILRA
FT                   TNQIFSLTGVLQLKRRVLGLPPSSPIVIELVKNITELIETWIEFGSSAETCIIFCIFSC
FT                   GCELMAPELHHYRPLYLQHLLSLIQKGVSSAEQARNIVEECWSSNKQWWDIFKEKSLDV
FT                   TFAL"
FT   gene            complement(<906401..>907087)
FT                   /locus_tag="KLLA0_A10351g"
FT                   /old_locus_tag="KLLA-ORF10122"
FT   CDS_pept        complement(906401..907087)
FT                   /locus_tag="KLLA0_A10351g"
FT                   /old_locus_tag="KLLA-ORF10122"
FT                   /product="KLLA0A10351p"
FT                   /note="weakly similar to uniprot|Q9A7D3 Caulobacter
FT                   crescentus CC1790 Hypothetical protein CC1790"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10351g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03041"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR015069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX86"
FT                   /protein_id="CAH03041.1"
FT                   /translation="MSFKFDDNGVVKTFHGNTIICHIPQQTDFFNRLLDFYRFAKRLSF
FT                   YDKITLLPPSSYHVTIMNCCHEHDRSVGHWPTGLGADASISECHNHLAQLFKDANFRDQ
FT                   GTNPSGVELKVHIPPKDELPSSKPRSINVIVKPSNTSQETAIKQLRDSISALTGLEDPS
FT                   HDSIKFHITLAYINEELKDSEVEELNSHLGNLHCILDRDCPVVQLGEPEFVTFEDMFYF
FT                   HLVTKL"
FT   gene            complement(<907244..>907864)
FT                   /locus_tag="KLLA0_A10373g"
FT                   /old_locus_tag="KLLA-ORF10121"
FT   CDS_pept        complement(907244..907864)
FT                   /locus_tag="KLLA0_A10373g"
FT                   /old_locus_tag="KLLA-ORF10121"
FT                   /product="KLLA0A10373p"
FT                   /note="some similarities with uniprot|P32805 Saccharomyces
FT                   cerevisiae YGL254W FZF1 Transcription factor involved in
FT                   sulfite metabolism sole identified regulatory target is
FT                   SSU1 overexpression suppresses sulfite-sensitivity of many
FT                   unrelated mutants due to hyperactivation of SSU1 contains
FT                   five zinc fingers"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10373g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03042"
FT                   /db_xref="GOA:Q6CX85"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX85"
FT                   /protein_id="CAH03042.1"
FT                   /translation="MEKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGC
FT                   DKAFLRPSHLRVHMLSHSKVKPYNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGY
FT                   YGCPFNAPSKEALNEHVLELHLIHEILDQNPPLQTPPHWDNLQCQDSSCSGYPSFQSSL
FT                   ELLEHYDEYHIYIPESLLKYSFEENINTSSSEYSADGLYTDLE"
FT   gene            complement(<908097..>908981)
FT                   /locus_tag="KLLA0_A10395g"
FT                   /old_locus_tag="KLLA-ORF10120"
FT   CDS_pept        complement(908097..908981)
FT                   /locus_tag="KLLA0_A10395g"
FT                   /old_locus_tag="KLLA-ORF10120"
FT                   /product="KLLA0A10395p"
FT                   /note="similar to uniprot|P53750 Saccharomyces cerevisiae
FT                   YNR064C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10395g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03043"
FT                   /db_xref="GOA:Q6CX84"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX84"
FT                   /protein_id="CAH03043.1"
FT                   /translation="MTDSRIQTFHTATLSNNTKVWYREAGDKSNPSIVLLHGYPTSSTM
FT                   FRHLIPLISDKFHVIAPDLPGFGFTEVPEDYHYSFDNLAATVREFLKEINVTRFAIYVF
FT                   DYGSPVGFRLALKDPSSITGIVTQNGNAYEEALGDEFWGFIKKYWQTTQTDPVFVKPLS
FT                   QFIADRKNVDDQYFIGVKDKTAIEPAAYTLDFALLQRPGQTDIQLKLFHDYQNNLTIYP
FT                   AIHEFLKAHRIPVLAAWGKNDYIFTPEGAEAFGKHAQKFKLTLLDSGHFALETHVQDIA
FT                   HDINTFLHDNIAL"
FT   gene            complement(<910347..>912176)
FT                   /locus_tag="KLLA0_A10417g"
FT                   /old_locus_tag="KLLA-ORF10118"
FT   CDS_pept        complement(910347..912176)
FT                   /locus_tag="KLLA0_A10417g"
FT                   /old_locus_tag="KLLA-ORF10118"
FT                   /product="KLLA0A10417p"
FT                   /note="uniprot|Q9Y746 Kluyveromyces lactis KLLA0A10417g
FT                   INV1 Invertase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10417g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03044"
FT                   /db_xref="GOA:Q9Y746"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y746"
FT                   /protein_id="CAH03044.1"
FT                   /translation="MLKLLSLMVPLASAAVIHRRDANISAIASEWNSTSNSSSSLSLNR
FT                   PAVHYSPEEGWMNDPNGLWYDAKEEDWHIYYQYYPDAPHWGLPLTWGHAVSKDLTVWDE
FT                   QGVAFGPEFETAGAFSGSMVIDYNNTSGFFNSSTDPRQRVVAIWTLDYSGSETQQLSYS
FT                   HDGGYTFTEYSDNPVLDIDSDAFRDPKVFWYQGEDSESEGNWVMTVAEADRFSVLIYSS
FT                   PDLKNWTLESNFSREGYLGYNYECPGLVKVPYVKNTTYASAPGSNITSSGPLHPNSTVS
FT                   FSNSSSIAWNASSVPLNITLSNSTLVDETSQLEEVGYAWVMIVSFNPGSILGGSGTEYF
FT                   IGDFNGTHFEPLDKQTRFLDLGKDYYALQTFFNTPNEVDVLGIAWASNWQYANQVPTDP
FT                   WRSSMSLVRNFTITEYNINSNTTALVLNSQPVLDFTSLRKNGTSYTLENLTLNSSSHEV
FT                   LEFEDPTGVFEFSLEYSVNFTGIHNWVFTDLSLYFQGDKDSDEYLRLGYEANSKQFFLD
FT                   RGHSNIPFVQENPFFTQRLSVSNPPSSNSSTFDVYGIVDRNIIELYFNNGTVTSTNTFF
FT                   FSTGNNIGSIIVKSGVDDVYEIESLKVNQFYVD"
FT   gene            complement(<913342..>915246)
FT                   /locus_tag="KLLA0_A10439g"
FT                   /old_locus_tag="KLLA-ORF10116"
FT   CDS_pept        complement(913342..915246)
FT                   /locus_tag="KLLA0_A10439g"
FT                   /old_locus_tag="KLLA-ORF10116"
FT                   /product="KLLA0A10439p"
FT                   /note="similar to uniprot|P38731 Saccharomyces cerevisiae
FT                   YHL040C ARN1 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to ferrirubin
FT                   ferrirhodin and related siderophores"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10439g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03045"
FT                   /db_xref="GOA:Q6CX82"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX82"
FT                   /protein_id="CAH03045.1"
FT                   /translation="MSTEKNSVVGEDKVLKSTYSDDETNVIKSVNGAGVGVDEKQAGPT
FT                   DLNEYGIPDYLKSSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFY
FT                   TTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIE
FT                   SQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWPFIINTWISG
FT                   NIVDVAKPEQNWSWDIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELSSQKTYYQT
FT                   HGLVQSLVQLFWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFILGFVLI
FT                   PFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILMVAVNESV
FT                   TSATRISSVSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSD
FT                   KGIIGALVVWGLGTTMFTYPVTVSLQSVTSHENMATVTALSYTMYRIGSAVGSAVSGAI
FT                   WTQLLYKQLLQHLDGDATLAASFYGSPLTYIAQYPWGTPVRDGVVQAYRYVQKYEVLVA
FT                   LVFTAPLFVFSLCLRDPPLTNEVAHENIKQGEYVDVEDDDPVANWIHDKWSRIRRKSD"
FT   gene            <916547..>917332
FT                   /locus_tag="KLLA0_A10461g"
FT                   /old_locus_tag="KLLA-ORF10114"
FT   CDS_pept        916547..917332
FT                   /locus_tag="KLLA0_A10461g"
FT                   /old_locus_tag="KLLA-ORF10114"
FT                   /product="KLLA0A10461p"
FT                   /note="similar to uniprot|P36087 Saccharomyces cerevisiae
FT                   YKL070W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10461g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03046"
FT                   /db_xref="GOA:Q6CX81"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX81"
FT                   /protein_id="CAH03046.1"
FT                   /translation="MYIPSHLEVTDLDKQVSVIKQYPLGVLFNYNSAKTGLLDYFKSGK
FT                   PPSGTDRVDSVMCATHVPFHYVEDPEGKTKGKLIAHLAGQNQHIAMLEENANCLVVFQS
FT                   VDSYVSPEWYPLKKKTHKFVPTWDFACVHVYGRAKIIHDDEEWLLGMLNSITDQEEKKR
FT                   PDTTTVSEKDEDHSGEKGEVPIHRWKVEEAEKRYLSQAMKNIVGLEIEIDHVQSKFKFH
FT                   QDQPPVNVNGVLDGYAKELDPKKAQELEKFTRQQYPREL"
FT   gene            complement(<917868..>918620)
FT                   /locus_tag="KLLA0_A10483g"
FT                   /old_locus_tag="Klla0A.mRNA.153.m"
FT   CDS_pept        complement(join(917868..918293,918576..918620))
FT                   /locus_tag="KLLA0_A10483g"
FT                   /old_locus_tag="Klla0A.mRNA.153.m"
FT                   /product="KLLA0A10483p"
FT                   /note="highly similar to uniprot|P26781 Saccharomyces
FT                   cerevisiae YDR025w RPS18A or uniprot|P26781 Saccharomyces
FT                   cerevisiae YBR048w RPS18B ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10483g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03047"
FT                   /db_xref="GOA:Q6CX80"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="InterPro:IPR032440"
FT                   /db_xref="PDB:3J80"
FT                   /db_xref="PDB:3J81"
FT                   /db_xref="PDB:3JAM"
FT                   /db_xref="PDB:3JAP"
FT                   /db_xref="PDB:3JAQ"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="PDB:5IT9"
FT                   /db_xref="PDB:6FYX"
FT                   /db_xref="PDB:6FYY"
FT                   /db_xref="PDB:6GSN"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX80"
FT                   /protein_id="CAH03047.1"
FT                   /translation="MSTELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTP
FT                   KTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRH
FT                   KNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF"
FT   gene            <918705..>919115
FT                   /locus_tag="KLLA0_A10505g"
FT                   /old_locus_tag="KLLA-ORF10110"
FT   CDS_pept        918705..919115
FT                   /locus_tag="KLLA0_A10505g"
FT                   /old_locus_tag="KLLA-ORF10110"
FT                   /product="KLLA0A10505p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10505g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03048"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX79"
FT                   /protein_id="CAH03048.1"
FT                   /translation="MYLVSYCTYEPNVFFMLKSGKLGIWMGAGWPWRPWRPIGRNPWAG
FT                   FPGESPGNGFGKDSLWAGSLVGQGIGGPTAPELGSILPFLGTPSRAKLGSFRPVSSHLL
FT                   CPPTLSPLSPTLPTCSTPANQLFQNTAEAPYT"
FT   gene            complement(<919456..>920004)
FT                   /locus_tag="KLLA0_A10527g"
FT                   /old_locus_tag="KLLA-ORF10108"
FT   CDS_pept        complement(919456..920004)
FT                   /locus_tag="KLLA0_A10527g"
FT                   /old_locus_tag="KLLA-ORF10108"
FT                   /product="KLLA0A10527p"
FT                   /note="similar to uniprot|P38231 Saccharomyces cerevisiae
FT                   YBR047W FMP23 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10527g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03049"
FT                   /db_xref="InterPro:IPR035283"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX78"
FT                   /protein_id="CAH03049.1"
FT                   /translation="MLKFSRTFTTFSRLSSRAVSNRVIIPPKALTDLGQPTLKSLRSEY
FT                   KQLPENSNFIDKFYTELQKFHDEFLVPRLNKHYTDFDENPDDLVFELEKYIELHIIPSH
FT                   SVRTQKSDLMAQGINLPMVYCETLGDKMVIERFIEFCRSVRYTLRLNGGHSFIFDIMLQ
FT                   SNSVFQDFEKSKYQQTKEQ"
FT   gene            <921022..>922083
FT                   /locus_tag="KLLA0_A10549g"
FT                   /old_locus_tag="KLLA-ORF10105"
FT   CDS_pept        921022..922083
FT                   /locus_tag="KLLA0_A10549g"
FT                   /old_locus_tag="KLLA-ORF10105"
FT                   /product="KLLA0A10549p"
FT                   /note="highly similar to uniprot|P38230 Saccharomyces
FT                   cerevisiae YBR046C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10549g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03050"
FT                   /db_xref="GOA:Q6CX77"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX77"
FT                   /protein_id="CAH03050.1"
FT                   /translation="MFSAVRSVVSSGIKTSIRTMSTIPGVQKVVLIRENGGPEVLKYEE
FT                   DYPVPKIGATDLLIKNKYAGINFIEVYFRKGIYPSEKPYVLGREAVGEVVAKGDQVDKY
FT                   NVGDKVAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAY
FT                   NVQKGDFILVYAAAGGVGLIFDQLLKARGARTIAVASTDEKLQLAKEYGAEFLINSTKD
FT                   DIVEKVKEFTNGEGVAAAFDSIGKDTFETTLQVVKRKGTIVSFGNASGAVPPFSINRLS
FT                   PKNLKLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKITISKVYPLKDYKEATEDLES
FT                   RKTVGKLILEIPE"
FT   gene            <922516..>924201
FT                   /locus_tag="KLLA0_A10571g"
FT                   /old_locus_tag="KLLA-ORF10104"
FT   CDS_pept        922516..924201
FT                   /locus_tag="KLLA0_A10571g"
FT                   /old_locus_tag="KLLA-ORF10104"
FT                   /product="KLLA0A10571p"
FT                   /note="weakly similar to uniprot|P38229 Saccharomyces
FT                   cerevisiae YBR045C GIP1 Meiosis-specific protein proposed
FT                   to be a regulatory subunit of the protein phosphatase
FT                   Glc7p, required for spore wall formation and proper septin
FT                   organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10571g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03051"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX76"
FT                   /protein_id="CAH03051.1"
FT                   /translation="MATASLLTSIVHHDSGGLPSGTKRAKLKRLFSSLSGVTPTSENRS
FT                   LGYETPPTLSPDEFAGISPTKQAFKKMRFFFSRHWHGMDQGEPDHCYSTNNDDQSVGNY
FT                   SCYNKYKTDGQQLERLFNEAVVDKRPPVTRDDAVRKMAPFEAMDPRFANNWMKNIQDFN
FT                   ITFSPVDTEPSIVIPSSSDVLKTKIATATEKGQREGQLSPDNHSKSSGVYRALANQAIS
FT                   YCNSGSATQKSSSYEYGNPSALPDLLYGLESLPTVSGKDCSTPPQCPSVQLIQDRDDFG
FT                   LLTSGGRSLKNGSKIFSATTQQSPKNELVEPNSGSQKVVIPTFREETGLEVHSIASNLQ
FT                   VGTLTESDLIKLASAKRRSFMDAKFYDEESEISDDEQEEHQGSKHVPCHEPSLQNLKSA
FT                   ANCDNATGKSEKNDTVKFNKYSYLVIYDASTKCLYSESTDKLTLRIPNEITDATDNSIY
FT                   IAAESTPYQESTMLKSILKRRTNEQEDIEAERAKKCDEIDATDFLQFVENHESKKRRGE
FT                   QLLVLARERQLQNYYDDQAVPTIKIRKERPSYSDFEDEYNQNLE"
FT   gene            complement(<924496..>925875)
FT                   /locus_tag="KLLA0_A10593g"
FT                   /old_locus_tag="KLLA-ORF10103"
FT   CDS_pept        complement(924496..925875)
FT                   /locus_tag="KLLA0_A10593g"
FT                   /old_locus_tag="KLLA-ORF10103"
FT                   /product="KLLA0A10593p"
FT                   /note="highly similar to uniprot|P07284 Saccharomyces
FT                   cerevisiae YDR023W SES1 seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10593g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03052"
FT                   /db_xref="GOA:Q6CX75"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX75"
FT                   /protein_id="CAH03052.1"
FT                   /translation="MLDITQFIEEKGGNPELIRKSQIARGASVEIVDEIIAGYKEWVKT
FT                   RFQVDELNKQLNKVQKEIGLKFKNKEDASELLAEKDRIVAEKKVLSEREQEEDKQLRSK
FT                   VNQVGNIVHPSVVVSNDEENNELVRSWMPENIKEVAQVATATGAEAKLSHHEILLRLDG
FT                   YDPERGVKITGHRGYFFRNYGVFLNQALINYGLSFLASKGYTPLQAPVMMNKDVMAKTA
FT                   QLSEFDEELYKVLDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYVGYSSCFRRE
FT                   AGSHGKDAWGVFRVHAFEKIEQFVLTEPEKSWEEFDKMINYSEEFYQSLGLPYRVVGIV
FT                   SGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVH
FT                   CLNSTLCATQRALCCVLENYQTDEGLKVPEVLRKYIPGEPEFLPYVKELPKNSTSNKKK
FT                   N"
FT   gene            <926295..>926368
FT                   /locus_tag="KLLA0_A10615r"
FT   tRNA            926295..926368
FT                   /locus_tag="KLLA0_A10615r"
FT                   /product="transfer RNA Val (TAC) cove"
FT   gene            <926574..>927005
FT                   /locus_tag="KLLA0_A10637g"
FT                   /old_locus_tag="KLLA-ORF10099"
FT   CDS_pept        926574..927005
FT                   /locus_tag="KLLA0_A10637g"
FT                   /old_locus_tag="KLLA-ORF10099"
FT                   /product="KLLA0A10637p"
FT                   /note="weakly similar to uniprot|Q03939 Saccharomyces
FT                   cerevisiae YDR022C CIS1 Protein involved in microtubule
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10637g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03053"
FT                   /db_xref="GOA:Q6CX74"
FT                   /db_xref="InterPro:IPR018621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX74"
FT                   /protein_id="CAH03053.1"
FT                   /translation="MESPVLLVKNANAATNASNLGLLGQKQNSYTVDENTWFLNNISFI
FT                   FEDDDPSQHDEDQLDYENVIIIDSEPSGTVNNVEMLSERWQLLAFDQNPRDNCISLTVM
FT                   NELSADLGQNTDISGLDNLSKLYHERNAQIRKLLDSIAP"
FT   gene            complement(<927059..>928255)
FT                   /locus_tag="KLLA0_A10659g"
FT                   /old_locus_tag="KLLA-ORF10098"
FT   CDS_pept        complement(927059..928255)
FT                   /locus_tag="KLLA0_A10659g"
FT                   /old_locus_tag="KLLA-ORF10098"
FT                   /product="KLLA0A10659p"
FT                   /note="highly similar to uniprot|Q12099 Saccharomyces
FT                   cerevisiae YDR021W FAL1 Nucleolar protein required for
FT                   maturation of 18S rRNA member of the eIF4A subfamily of
FT                   DEAD-box ATP-dependent RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10659g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03054"
FT                   /db_xref="GOA:Q6CX73"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX73"
FT                   /protein_id="CAH03054.1"
FT                   /translation="MSFNRDDDSKLKFKTSKKLKVSATFESMNLKPDLLRGIYFYGFEY
FT                   PSSIQSRAISQIISGKDVIAQAQSGTGKTATFTIGLLQAIDSKSKELQALVLSPTRELA
FT                   SQSESVISNLGDYLNVTAHACTGGKALQQDIKKVSKNCQVVSGTPGRVLDMIKRQVLNV
FT                   RNCKILVLDEADELLGETLGFKQQIYDIFTKLPPTIQVVVVSATMSKDILEITKKFMSD
FT                   PVKILVKRDEISLDVIKQYYVDVEKEEWKFDTLCDLYDSLTITQCVIFCNTRKKVDWLS
FT                   RKLTQTNFSVSSMHGDMKQEERDQVMNDFRSGKARVLISTDVWARGIDVQQISLVINYD
FT                   IPDNLENYIHRIGRSGRFGRKGVAINFITKEERPKLKEIESHYRIKIKPTPANLEELS"
FT   gene            <928563..>929657
FT                   /locus_tag="KLLA0_A10681g"
FT                   /old_locus_tag="KLLA-ORF10097"
FT   CDS_pept        928563..929657
FT                   /locus_tag="KLLA0_A10681g"
FT                   /old_locus_tag="KLLA-ORF10097"
FT                   /product="KLLA0A10681p"
FT                   /note="similar to uniprot|Q08144 Saccharomyces cerevisiae
FT                   YOL018C TLG2 member of the syntaxin family of t-SNAREs"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10681g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03055"
FT                   /db_xref="GOA:Q6CX72"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR028673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX72"
FT                   /protein_id="CAH03055.1"
FT                   /translation="MFRDRTNLFLSYRRTFPHQRLSSTKHLRSNKDLENQPFIGSDDGN
FT                   NDEDMVAMDDFSRQLPPKFFDLTFQVDESLSAVDQLLLQLTKLYQKNSLPGFQDNKQDE
FT                   EEIEQISFQVIKRFQECFGVIKTLTRIKDSQYSNGKQLSKDELRILDNLEKNYALKVQD
FT                   KSQKFRILQNNHLKFLNKDDFKPLPTTKSSNDTLMLLEEEVEGDEVNNIDSYSKQTLQK
FT                   QNQKLQDNNQQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTV
FT                   IELKQAQKELDKATHYQKRSQKCKIILFLSLVVLALFLLVMLKPHHHTIRESAPSKSHK
FT                   PPGSQVEVNSPNGDPLLDPESNVE"
FT   gene            complement(<929877..>931715)
FT                   /locus_tag="KLLA0_A10703g"
FT                   /old_locus_tag="KLLA-ORF10096"
FT   CDS_pept        complement(929877..931715)
FT                   /locus_tag="KLLA0_A10703g"
FT                   /old_locus_tag="KLLA-ORF10096"
FT                   /product="KLLA0A10703p"
FT                   /note="some similarities with uniprot|Q08157 Saccharomyces
FT                   cerevisiae YOL019W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10703g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03056"
FT                   /db_xref="GOA:Q6CX71"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX71"
FT                   /protein_id="CAH03056.1"
FT                   /translation="MAKRFTFGFATLLFFLQCVALAFLILACVSAPVFDNVRLASFDGI
FT                   HYGVFGYCEDDGGSCSSAQANYHPENLDDDDSNWKMNNDSRKALGSILIVTPIAAGLTF
FT                   LALVTSFLCQFRFFDSSTFWFVMNFLFSILAFLSSALICIVVILLFYPHVTWYSYILIA
FT                   SAVLNLVCLPLCFFARSQTASNSKNGLVDEEDEDRSSTSIRDKFYKEEFNQTEVTNLDA
FT                   PSIPDYYKGSKIVTSNTLNSNTITDSDVPSSYMNNGSVAATTANTAVVPPQGLATMAAA
FT                   NSYQRHSNNNDATLLHNAVPKQPYSAINQSGTNSSMNSSSRALSSGRITAPNNNYSQQN
FT                   FSQMGEIGSLAPSSVYAEHIAGGSSGVIASDLQQGNNRGQSQDELTQPPKTQQDVLQDI
FT                   INGVLSEDEEEFLKQNTVDPSERPAMDTFDDDGINDDDSQFTSVSQRGINPNYYQGRGG
FT                   VQYIPPTHGPLQNQLQGQVQNPAMAQGMVPNGMHPTQPPVVGGQYYPPLPNQAGPQQGY
FT                   YHPPPLPVQQQQPQQPQPPYSAGPSASDFLLQSNPEFSIGTGPASYGNSQRSAGLNSAP
FT                   ASSMHYKPAYRKRLPRKNNLPLHPCQETVPMEHFKF"
FT   gene            complement(<932445..>932543)
FT                   /locus_tag="KLLA0_A10725r"
FT   tRNA            complement(join(932445..932481,932504..932543))
FT                   /locus_tag="KLLA0_A10725r"
FT                   /product="transfer RNA Tyr (GTA) cove"
FT   gene            <933157..>933618
FT                   /locus_tag="KLLA0_A10769g"
FT                   /old_locus_tag="KLLA-ORF10091"
FT   CDS_pept        933157..933618
FT                   /locus_tag="KLLA0_A10769g"
FT                   /old_locus_tag="KLLA-ORF10091"
FT                   /product="KLLA0A10769p"
FT                   /note="similar to uniprot|P43594 Saccharomyces cerevisiae
FT                   YFR011C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10769g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03057"
FT                   /db_xref="GOA:Q6CX70"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX70"
FT                   /protein_id="CAH03057.1"
FT                   /translation="MGAQPSKPAETKVYVPETPVNFESKLIAQIDNSTESDFIRSQKAE
FT                   RYLQEKVSAKLSDLESEALKEFETKLQSSILPDDSKSAGDALSTKLVNEKVDQLKVRLS
FT                   KLQEAHKAKSTDKVTATKKTLTECLLKNKEKPLNCYDEVDQFKKAVLEI"
FT   gene            complement(<934135..>935733)
FT                   /locus_tag="KLLA0_A10791g"
FT                   /old_locus_tag="Klla0A.mRNA.140.m"
FT   CDS_pept        complement(join(934135..935573,935718..935733))
FT                   /locus_tag="KLLA0_A10791g"
FT                   /old_locus_tag="Klla0A.mRNA.140.m"
FT                   /product="KLLA0A10791p"
FT                   /note="similar to uniprot|P43593 Saccharomyces cerevisiae
FT                   YFR010W UBP6 Ubiquitin-specific protease situated in the
FT                   base subcomplex of the 26S proteasome releases free
FT                   ubiquitin from branched polyubiquitin chains deletion
FT                   causes hypersensitivity to cycloheximide and other toxic
FT                   compounds"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10791g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03058"
FT                   /db_xref="GOA:Q6CX69"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX69"
FT                   /protein_id="CAH03058.1"
FT                   /translation="MSDLEFNIKHAGKVYPITINADAKAADLRAKVEALTLVPQERQKY
FT                   MVKGGLTDNETLVSSVIKAKATVMVLGTPDANLVFKPTDDTKFLEDLTDKERLMQEDTI
FT                   PMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHGQLVIQLRNCFNAFAQRK
FT                   EKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTIDTVFGESLSSKFE
FT                   IEFQTTVKDTLNETDVQTKIESDKKLQCHISGTTNFLKNGLTESLVEKVEKRSEATGSN
FT                   SIFENSKKITKLPEYLTVQFVRFYWKRSTGKKSKILRKVQFPFQLDVADLLTPEYATAK
FT                   IKVRDELREVDKQREDDLKEFNQNILEHVPLSLTPAERYETQMALEESKREHWLAEFAK
FT                   KFPKDLRQGENPSSVYNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVT
FT                   REKVEQLAGGGESDSALILIYKGFGL"
FT   gene            complement(<936126..>937880)
FT                   /locus_tag="KLLA0_A10813g"
FT                   /old_locus_tag="KLLA-ORF10085"
FT   CDS_pept        complement(936126..937880)
FT                   /locus_tag="KLLA0_A10813g"
FT                   /old_locus_tag="KLLA-ORF10085"
FT                   /product="KLLA0A10813p"
FT                   /note="similar to uniprot|P38967 Saccharomyces cerevisiae
FT                   YOL020W TAT2 Tryptophan permease high affinity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10813g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03059"
FT                   /db_xref="GOA:Q6CX68"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX68"
FT                   /protein_id="CAH03059.1"
FT                   /translation="MKEDEYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDK
FT                   NKNIVRRMIDSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGG
FT                   PLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQW
FT                   YFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVI
FT                   TIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANGFKGVASVFVTASYSLGGSEMVC
FT                   LCSAETDPKELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNSPFVIAI
FT                   KLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLV
FT                   GIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRS
FT                   LDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALV
FT                   LVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWY
FT                   IRFYNFWC"
FT   gene            <938712..>941738
FT                   /locus_tag="KLLA0_A10835g"
FT                   /old_locus_tag="KLLA-ORF10082"
FT   CDS_pept        938712..941738
FT                   /locus_tag="KLLA0_A10835g"
FT                   /old_locus_tag="KLLA-ORF10082"
FT                   /product="KLLA0A10835p"
FT                   /note="highly similar to uniprot|Q08162 Saccharomyces
FT                   cerevisiae YOL021C DIS3 Nucleolar exosome component
FT                   involved in rRNA processing and RNA degradation binds
FT                   Gsp1p/Ran and enhances the GEF activity of Srm1p implicated
FT                   in mitotic control homologous to the E. coli RNase R of the
FT                   RNase II family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10835g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03060"
FT                   /db_xref="GOA:Q6CX67"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033770"
FT                   /db_xref="InterPro:IPR033771"
FT                   /db_xref="InterPro:IPR041505"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX67"
FT                   /protein_id="CAH03060.1"
FT                   /translation="MATVQQLRRKRISDGLTVTQKVFVRSRNGSAQKVVREHYLRKDIP
FT                   CLSRICDICPNIIVPNAAGELPKFVLSETPQELQGLGKHYVVVDANIIIQSIDLLENPN
FT                   CFFDVIVPQIVLDEVRNKSYPIYTRIRALCRDSEDDVKRFVVFHNEFSEYTFIDRTGNE
FT                   SINDRNDRAIRKTVEWYTNHLKGKGINIVFVTNDRLNRQAALKDSLVAKSLAEYVDMLP
FT                   NSEEIKDLIPNLAPISGMSSKMLEDDPEGHGAAKAEFSFPEYYSTSRIMGGLKNGSLYQ
FT                   GSIQISEYNFLEGTVSLPTFKKPVLVLGQKNLNRAFNGDLVVVELLPQSEWKAPSTVTM
FT                   DSEHFNVNDNPDNDGEDDEGEPSGVLDDSGAIMSDKDRRLLAQSAILAQKSNKVQPTAR
FT                   VVGITRRSWRQYVGQITPTSVDPQSSGTQNVFVILMDKCLPKIRIRTRLAKQLLNKRIV
FT                   ISVDCWPENYRYPLGHFVRDLGDIESAQAETEALLLEHDVEYRPFSKKVLDCLPKEGHD
FT                   WKAPEDLTDPEAIRNDPLLPSRKDFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGV
FT                   HIADVTHFVKPGTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVV
FT                   WELDNDANIVGVDFTKSVIRSREAFSYEKAQNRIDDETAKDELTLGMRALLQLSKKLKQ
FT                   KRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLDTNSLVEEFMLLANISVARKIYEA
FT                   FPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPNDSYLNTL
FT                   IRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIG
FT                   YEALDLSHRDKQKMEMICRNINKKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVF
FT                   NNGIAVLVPKFGVEGLIRLENLTENPQSAEFIEDQFSLRFVDKNGVSKEVSVFDKVEVQ
FT                   LKSVLDPATSKRKAQLLLK"
FT   gene            complement(<941784..>944042)
FT                   /locus_tag="KLLA0_A10857g"
FT                   /old_locus_tag="KLLA-ORF10081"
FT   CDS_pept        complement(941784..944042)
FT                   /locus_tag="KLLA0_A10857g"
FT                   /old_locus_tag="KLLA-ORF10081"
FT                   /product="KLLA0A10857p"
FT                   /note="highly similar to uniprot|P43535 Saccharomyces
FT                   cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
FT                   kinase activity forms a complex with Gcn1p proposed to
FT                   stimulate Gcn2p activation by an uncharged tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10857g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03061"
FT                   /db_xref="GOA:Q6CX66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX66"
FT                   /protein_id="CAH03061.1"
FT                   /translation="MSNIGLQLRQSAPQVDSIVTDYVLGYFNHLSNATYDAVQSKQLDL
FT                   DSEVSFLRDLLLNAGANSEKISKVINEMEGKLSGQLKENQAKLELTGDTSKRLLDINVL
FT                   QSHNSKDNLNNSLAALGVSGDIEHAGRKMETRVDLKKLRKAEDKIAKKVAKRNNKFVKY
FT                   EASKLINEGEDDDYDSFYLKINPLEFGSGAGKSKDIKIDTFDLYVGDGQRILSNAQLTL
FT                   SYGRRYGLVGQNGIGKSTLLKALSRRELNVPKHISVLHVEQEIRGDETKALQSVLDADV
FT                   WRKQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEKLIDMES
FT                   DKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD
FT                   VPSIAYLAEYLKTYPATVLVVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKE
FT                   ERRKTAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPILEPPEEEKVV
FT                   NFHFPDCEKLSPPIIQLQDVSFSYKESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLK
FT                   VMMEQLRPTKGFVSRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRRHLG
FT                   AFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTAGLDALVDALK
FT                   SFNGGVLMVSHDISVINSVCNEIWVSEGGKVQRFDGTIFDYRDYIIANAGKAGFVKRQ"
FT   gene            complement(<944431..>944501)
FT                   /locus_tag="KLLA0_A10879r"
FT   tRNA            complement(944431..944501)
FT                   /locus_tag="KLLA0_A10879r"
FT                   /product="transfer RNA Gly (GCC) cove"
FT   gene            <945121..>946407
FT                   /locus_tag="KLLA0_A10901g"
FT                   /old_locus_tag="KLLA-ORF10078"
FT   CDS_pept        945121..946407
FT                   /locus_tag="KLLA0_A10901g"
FT                   /old_locus_tag="KLLA-ORF10078"
FT                   /product="KLLA0A10901p"
FT                   /note="similar to uniprot|P25040 Saccharomyces cerevisiae
FT                   YOL022C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10901g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03062"
FT                   /db_xref="GOA:Q6CX65"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX65"
FT                   /protein_id="CAH03062.1"
FT                   /translation="MSNIEEIHSAGEEDEYDYKTKKKSDVYLGLVDAAIKEDDEVLVED
FT                   TFIGGEPCWLAPDSPPSEEILRCDSCKSADFMKLLVQAFAPVDLGIIEPICEKKKINLT
FT                   TKSYINPDYTRVLYVFYCTKCKRKNGSVKCIRGVKKTTSVDTLGQKMEQLQTTEFQLNP
FT                   FSANEVDSNSNKNPFDKNPFAVTGSKSGEAANPFAAAASNPFAQTENIKPEPKTGASNA
FT                   PVSQKTLRKLHDQKKDKEFDSSKAFPGYFLFVEEETFKSTPDHLKLPKNLKIDKTALEL
FT                   PDDAFDSLEENQMKLDPRTEKISKFLDDDVFQKFQEVVSYNPGQVLRYDLGGLPLYYAK
FT                   TPKEFEDLVAKPAYNPSSRRVFEMQLMPKMILDLEEEVSLTDGMDWGTIMVYTDIENYI
FT                   PKFDENQVGYVQEVVKVQWEPIDYDEVKG"
FT   gene            complement(<946489..>948501)
FT                   /locus_tag="KLLA0_A10923g"
FT                   /old_locus_tag="KLLA-ORF10077"
FT   CDS_pept        complement(946489..948501)
FT                   /locus_tag="KLLA0_A10923g"
FT                   /old_locus_tag="KLLA-ORF10077"
FT                   /product="KLLA0A10923p"
FT                   /note="similar to uniprot|P25038 Saccharomyces cerevisiae
FT                   YOL023W IFM1 Mitochondrial translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10923g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03063"
FT                   /db_xref="GOA:Q6CX64"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX64"
FT                   /protein_id="CAH03063.1"
FT                   /translation="MKPMLSTVPLRPCCRLTSRLPLLTRSIHISGINLAGKHKKRSFPS
FT                   KELKKLTFDIPNHTSVNNLSNLLNVRLEKLIQDLKKLGFTHASSNYILTKGYIELILQE
FT                   YNYDFEVNEVVNSSNVYDELKSPMNPRFLETRPPIVTIMGHVDHGKTTILDYLRKSSIV
FT                   SQEHGGITQHIGAFQCVAPISRKLITFLDTPGHAAFLKMRERGANITDIIVLVVSVEDS
FT                   IMPQTLEAIKHAKNSGNELIVAITKIDRISNLKERAEAIEKVENSLIVNDIELEKIGGD
FT                   VQVVHISAKTGENMDQLEESIISLSDIMDLKAEKNVKTVCEGWVLESEVKKAVGNVATV
FT                   LLKKGVMNKGDILISGNSICKVRAMLNEHGAQVTKALPSQAVEIVGWKSLPNAGDEVIQ
FT                   AKSESIAKKYVARRQHLLQEEKEAETVEKLNDERVAQSETKALKNDIDEVDEDEEQAEV
FT                   ESGPKDVNFIIKADVSGSVEAIVQSIEHLGNDEVKCNIVGSSVGVPAENDLKMAKITGS
FT                   TILCFNLDNVPNDIINNKDKIPVKQFNVIYKLIEDVTETLTDNLKPIFEEKQIAAVEIR
FT                   EIFEFKVKRNFIKIAGCKVINGKVSRNSLVKVIRGPEEEVIYKGRISTIKQGKETVQDV
FT                   NKGNECGITLENDFEGYQAGDKLIVYESVKIPRFL"
FT   gene            complement(<948881..>950086)
FT                   /locus_tag="KLLA0_A10945g"
FT                   /old_locus_tag="KLLA-ORF10075"
FT   CDS_pept        complement(948881..950086)
FT                   /locus_tag="KLLA0_A10945g"
FT                   /old_locus_tag="KLLA-ORF10075"
FT                   /product="KLLA0A10945p"
FT                   /note="weakly similar to uniprot|P23180 Saccharomyces
FT                   cerevisiae YHL021C FMP12"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10945g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03064"
FT                   /db_xref="GOA:Q6CX63"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR012776"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX63"
FT                   /protein_id="CAH03064.1"
FT                   /translation="MTIQIVDSVENRSFDNYVTIKLNDSLYLFHLVYLRDNCTGKESFH
FT                   GETHQRLIDIFNDIDLEKDLNGTVVVEGDELVVKWFDGHISRFTERWLLNHAYYPEKNV
FT                   INNKAVKLPNRITWCKQEFNELKQASDHFKNDYNHINDDSTKKIIFNEIYQYGFTLIDN
FT                   VPVSLDATKEVSELISIIRPTHYDTGVWDFTSDLSKKDTAYTSLAIDMHTDGNYWYETP
FT                   GLQLFHLLLHDGQGGETRICDVAHILKLIKDKANEDESWQETLEILTKQPIEFHQSGES
FT                   ENVFIENRYPILQVDKDGELIQCRWNTSDRTSMLKGTKYPVNEIYRAMARFNDLINDTD
FT                   NYVRFPLAPGTILVFDNWRVLHARTAFNGKRRLCGSYLTRDDFLARYRSLLFNREQWLE
FT                   SV"
FT   gene            complement(<950412..>950942)
FT                   /locus_tag="KLLA0_A10967g"
FT                   /old_locus_tag="KLLA-ORF10074"
FT   CDS_pept        complement(950412..950942)
FT                   /locus_tag="KLLA0_A10967g"
FT                   /old_locus_tag="KLLA-ORF10074"
FT                   /product="KLLA0A10967p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10967g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX62"
FT                   /protein_id="CAH03065.1"
FT                   /translation="MSTPGHRLHHKHKHAHDLFPPENKQFMESRDFTGLDNPPEPKRTP
FT                   NPFAEKNDSKEDSYVNALLSSVSQKLKNQQQHPSSTREQRHIFQQKSVPLSAEESPNSG
FT                   DEIKFSNGYNEEERPDRVNREGKKKNGELGLGSLNGTEQAPAPPPPIRRNSSLYEDFKK
FT                   AYYHDTHMFDSHK"
FT   gene            complement(<951316..>952923)
FT                   /locus_tag="KLLA0_A10989g"
FT                   /old_locus_tag="KLLA-ORF10072"
FT   CDS_pept        complement(951316..952923)
FT                   /locus_tag="KLLA0_A10989g"
FT                   /old_locus_tag="KLLA-ORF10072"
FT                   /product="KLLA0A10989p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A10989g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03066"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX61"
FT                   /protein_id="CAH03066.1"
FT                   /translation="MNLLAKDEDLRYMALKGYIDSNWQNVEPIPTEDNSSASSDEERVV
FT                   LMGLHDTSVLIQDLASTSLIQSFCKCKDIAAVYTLFHSLLNDMSLPCTRGLKTLLVSTS
FT                   AEGRPVSVSLENVTKYCLNLVEHQHLMQSIHWDVFIELINHYSELKPLDSLFLQELVPL
FT                   NPPDNVIKAVVPHLSRSLISNYNNFDAQQLLMISESYPHKFTRDKANSILTECVDQSSD
FT                   VSLEKVKMCYNLFWFWYTPQGGVPTEILNLLDRFKNITKDEGDLNDASDSDEFDISLSE
FT                   DEDSVPMYEETQTGNGNQEEVNEVISQFESLISSASSFTQQHQTTTPSSQITQPPRLYS
FT                   EILVSTPADSEELLETWLKEYQDYDLNLTKSIIDQILESEFTLFQWQWLITMASRLPTD
FT                   AVVQFLPRSVTFLKPMKRFVQVIQVGNLKQRQDDALNLRLQLWSLIDSLLNFDDPLNLD
FT                   QVFVLTLIIPYLQYGLKDCVKDSTFQPVLLSILDKLKDHCSPLIITNEPLLQSLEELNQ
FT                   EQHPWIIPTINSIKFKML"
FT   gene            <953797..>955047
FT                   /locus_tag="KLLA0_A11011g"
FT                   /old_locus_tag="KLLA-ORF10071"
FT   CDS_pept        953797..955047
FT                   /locus_tag="KLLA0_A11011g"
FT                   /old_locus_tag="KLLA-ORF10071"
FT                   /product="KLLA0A11011p"
FT                   /note="highly similar to uniprot|P00560 Saccharomyces
FT                   cerevisiae YCR012W PGK1 3-phosphoglycerate kinase catalyzes
FT                   transfer of high-energy phosphoryl groups from the acyl
FT                   phosphate of 1 3-bisphosphoglycerate to ADP to produce ATP
FT                   key enzyme in glycolysis and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11011g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03067"
FT                   /db_xref="GOA:P14828"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14828"
FT                   /protein_id="CAH03067.1"
FT                   /translation="MSLSSKLTVKDLDVTGKRVFIRVDFNVPLDGKKITSNQRIVAALP
FT                   TIQYVLEKKPKAIVLASHLGRPNGEVNDKYSLAPVADELSRLLQKPVTFLHDCVGEEVT
FT                   NAVNNAKDGEVFLLENLRFHIEEEGSRKVDGNKVKADKAAVTKFREQLSSLADVYVNDA
FT                   FGTAHRAHSSIVGFDLPNRAAGFLLSKELQYFAKALENPTRPFLAILGGAKVADKIQLI
FT                   DNLLDKVDSLIIGGGMAFTFKKVLENTEIGDSIYDAAGAELVPKLVEKAKKNNVKIVLP
FT                   TDFVIGDKFSADANTKVVTDKEGIPSGWQGLDNGPESRKAFAATVAEAKTIVWNGPPGV
FT                   FEFAPFAKGTEALLDAVVASSQAGNTVIIGGGDTATVAKKYGVVDKISHVSTGGGASLE
FT                   LLEGKELPGVTFLSNKQ"
FT   gene            complement(<955278..>956798)
FT                   /locus_tag="KLLA0_A11033g"
FT                   /old_locus_tag="KLLA-ORF10068"
FT   CDS_pept        complement(955278..956798)
FT                   /locus_tag="KLLA0_A11033g"
FT                   /old_locus_tag="KLLA-ORF10068"
FT                   /product="KLLA0A11033p"
FT                   /note="weakly similar to uniprot|P25615 Saccharomyces
FT                   cerevisiae YCR014C POL4 Probable homolog of mammalian DNA
FT                   polymerase beta may function in double-stranded DNA break
FT                   repair DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11033g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03068"
FT                   /db_xref="GOA:Q6CX59"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR019843"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX59"
FT                   /protein_id="CAH03068.1"
FT                   /translation="MLNGHKFLVLPNEDTSRRRYMRTLIDKNGGQHGVEIGLIDDSFVH
FT                   GDHIINHKLFYKEMNPNDVPLDQLRLFKLSDLTKWLKHRFLDFSKPLKLHEEVVVETDS
FT                   QESNTGVPDTHQVTSPSETHDTADTNVSHSSDANLIMPMNNPNYKLIKVLKSLEKRYKL
FT                   QNDTFRYLGYMKMIKILQNVRVKIESEEDAIENGLSKGLSKKIPFLLKLGESGSELKMD
FT                   TSEQTLLYFQECHGIGAFKSKQYVNMGYSTFEDLIPYMNWTQLTGLAFYEDWQLSIPRE
FT                   ETMKHEAIIRKAMNEVNENLCMEITGSYRRGQPRSGDIDIVVHMPGQNDLNYISRELEK
FT                   VIIKLTETGYIICPLNLNETLKSLFQPWFHKLFSHFNKPFDVKAYDEPVHKFYCGAAVT
FT                   KYEPDRIKDADALTLKGNDKKYKMDIGKTCRRVDFLLAEYQGLGATNVYFTGNNNFNKK
FT                   CRTIAKQKGYVLSNDGIYKDGQLIPVADEYEILDMIGVDKLKPTERNL"
FT   gene            complement(<956792..>957493)
FT                   /locus_tag="KLLA0_A11044g"
FT                   /old_locus_tag="KLLA-ORF10067"
FT   CDS_pept        complement(956792..957493)
FT                   /locus_tag="KLLA0_A11044g"
FT                   /old_locus_tag="KLLA-ORF10067"
FT                   /product="KLLA0A11044p"
FT                   /note="some similarities with uniprot|P25616 Saccharomyces
FT                   cerevisiae YCR015C"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03069"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX58"
FT                   /protein_id="CAH03069.1"
FT                   /translation="MLKRILVLDFDGTITTSDTTSIIGQSVYNLKSVPVAWTHYTKIYE
FT                   ECYIPKPENLAPDAWKVVCDYERASRRCELSSINELELQDHFKDVVIKDLLQLVKEKVD
FT                   IRPGLQELMQQYNKTYVLSLNWSKDLIHDLTGISKSDIYCNELKSRDGEVYSGQFTKQI
FT                   LTGWDKYEMLKEICDLDKVQGDQSITYIGDSFGDLPCILAKEVDGYIIGDRLKHLDIDV
FT                   PTIQRFDEVKC"
FT   gene            <958239..>959087
FT                   /locus_tag="KLLA0_A11066g"
FT                   /old_locus_tag="KLLA-ORF10065"
FT   CDS_pept        958239..959087
FT                   /locus_tag="KLLA0_A11066g"
FT                   /old_locus_tag="KLLA-ORF10065"
FT                   /product="KLLA0A11066p"
FT                   /note="similar to uniprot|P25617 Saccharomyces cerevisiae
FT                   YCR016W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03070"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX57"
FT                   /protein_id="CAH03070.1"
FT                   /translation="MSEHVPAWKRFQIKKSEEGNQIDDELDSLIVSTHLSNGSLSKKEK
FT                   RRIIRGGNADSKSTGNKVAKKSKDRKREKLAKEDRLKKKETVLKDQLRYLIDFYTLKLE
FT                   VELPEAVKELPSVKENVSIISPSEELADKNVVRDVWKFSKQKQNWLIKHFVITDEIPSA
FT                   FNPLLVRYFQDLQGGSKAQLQESCLDVIEKQNKYLEQQKEEMAKIVLGEATEASKDQEK
FT                   QSADDESKDKDVKTEMSKKSDESEEDTANKINEILPPSQELLERVRSMLDTWGVKYELN
FT                   S"
FT   gene            <959342..>962446
FT                   /locus_tag="KLLA0_A11088g"
FT                   /old_locus_tag="KLLA-ORF10064"
FT   CDS_pept        959342..962446
FT                   /locus_tag="KLLA0_A11088g"
FT                   /old_locus_tag="KLLA-ORF10064"
FT                   /product="KLLA0A11088p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03071"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX56"
FT                   /protein_id="CAH03071.1"
FT                   /translation="MNRNIETVNEEGSFVVDLLRKPFKLPSRYDDLPWESIEESKLTET
FT                   DILDRKHVFPLLKVMPIRLFTTDIERSEMFESLKQYCQTERYNKFGADWPNELADSMGL
FT                   DSLLDWDFDMEQIDDTASIPEYSPNHLLILTERTIHVLGSDAKFLAPNRIVDALVIPNQ
FT                   KCSDKNDTCILCLASGEIYSMDFHYHQTAEKYDIELVCSYKLDNVPPKFTAKLTYSSTN
FT                   DLIGFVTSMHLMCVLSLHKRERAFFKLDFNVLLQLGCDIDTITWQSGKLLYIDYFKKNH
FT                   VRVVEQDVQGYGFFECNFIINDVKDEDKILLLDRDNVLLVEGSMKKANIVSAGTEKIDV
FT                   GSLDLVFASSADIIDYSLFKVIEEPFKSVNFLILNNWVILLSLVTDSNKVLVSELTRLA
FT                   IPIDGLILERVVGYNEIAILVLSRGEVIRYTVDLNDITFQDTGINKLAIKPTVMLLNNI
FT                   LDEQWVFEGYEKIDHIYKYEHSTLLHSKNKLYDIPAKSADIQITFDLITFMSEFKVFHD
FT                   VRVIDLKCAVSGSFQFGSISIRSDDPEVQQYVLIGISSICAPESYYLEIVKGEQIKFQL
FT                   IDDLLPETEDTFIEFFTVRGTFLSITANNLYINDLEDIKQLPLPFSIKGAKSICIPKDI
FT                   FSILIWNEDEISITDWKSGTTTSINIPEGFEKLHDIIEINGEHVLRFDQSIASIDLEKL
FT                   EVLGSDFRNSLNCEGVLNEVWLKNCSSKTASLTSVRSLVEGRLEILSTDGNRTFVDAGT
FT                   QMCLEPFVYPWVIAYSTSEIKIVNVQDGHVCAVFESDSLILNVYCGDRKGRNIFVLYED
FT                   GMSVNELLIDVTRGKLIELIGTDSLNWNEYKWPLQVAGGSRIILNDNAFKFLKIDTNGK
FT                   TFVKQGPRKVPGSIITYGMLDDSNKHMCIFSYDTITHTLWCNIFTIQNSELTHLSEITV
FT                   SKDLNIIGAPQGSSNTSIHGQFYAVTTENNHIYVWRVRSDGNSNWNVTLWQTINPGNKP
FT                   ETEFNDDTFYFTQNYMLQLPQNTDKTPATIHCTIPSSYRQLFRDP"
FT   gene            <964084..>965739
FT                   /locus_tag="KLLA0_A11110g"
FT                   /old_locus_tag="KLLA-ORF10059"
FT   CDS_pept        964084..965739
FT                   /locus_tag="KLLA0_A11110g"
FT                   /old_locus_tag="KLLA-ORF10059"
FT                   /product="KLLA0A11110p"
FT                   /note="uniprot|P49374 Kluyveromyces lactis KLLA0A11110g
FT                   HGT1 High-affinity glucose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03072"
FT                   /db_xref="GOA:P49374"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49374"
FT                   /protein_id="CAH03072.1"
FT                   /translation="MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFD
FT                   IASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHIC
FT                   AALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQ
FT                   FSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDR
FT                   WEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVG
FT                   VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFG
FT                   RRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASS
FT                   YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW
FT                   KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEE
FT                   GNKLGLLGNPQHLEDVHSNEKGLLDRSDSASNSN"
FT   gene            complement(<967049..>969982)
FT                   /locus_tag="KLLA0_A11132g"
FT                   /old_locus_tag="KLLA-ORF10056"
FT   CDS_pept        complement(967049..969982)
FT                   /locus_tag="KLLA0_A11132g"
FT                   /old_locus_tag="KLLA-ORF10056"
FT                   /product="KLLA0A11132p"
FT                   /note="similar to uniprot|P25618 Saccharomyces cerevisiae
FT                   YCR017C CWH43 Putative sensor/transporter protein involved
FT                   in cell wall biogenesis contains 14-16 transmembrane
FT                   segments and several putative glycosylation and
FT                   phosphorylation sites null mutation is synthetically lethal
FT                   with pkc1 deletion"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03073"
FT                   /db_xref="GOA:Q6CX54"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="InterPro:IPR027317"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX54"
FT                   /protein_id="CAH03073.1"
FT                   /translation="MVSIRGSVIAWTHTVCAASAFIAALVVGYTLHFEKIVANAWYRYP
FT                   DEWFPSVSATIGDRYPERSIFQILIALTALPRFLLLFTHYYLNRSLFTLLVGIVRTITC
FT                   GGWVYITSTDDHDAHDVFMISYIVLTIPWDYMIIKHSQYKEWKKILMTAFFGTLIPLIY
FT                   WFIQHQVHRRAGAYSVYAYFEWSLIVLDIAFDALACQDFEQIKISVSDWSATEDENIVV
FT                   PTEYIVETEEQVDITVTETVEEKLNDSSVEELSDDENIQQEHSRLLESNDNEITILLKE
FT                   TEDIMYPNDLPVPPSQDSFMYVIVNTFNSFMFWTTVTSLFCMLWHFPLWYMGISGYEAV
FT                   ILSTLSPVFLYIPLVTVVVDQYGMLLANVFSIGAFFIDTPETRLLTVALATALIVMTFA
FT                   LNLNSLNSSSIGKFSLTWIMGLILSVVVKMGFFTNNPLWAIMNENNGGLNIPGLVVSTL
FT                   FALITPFTNSCHLWNRSKTTTRLPFFRKLLVSTGFGSLVFAIHQSLTDASTLIYWCWEG
FT                   WNSHKGPLAWPWAGLVCVAMIGGALTGKQSSRTISMTLAISTLALAVPQVKEWFRFVFG
FT                   VLPYVVSIIWIIPSYFELVNYIQSPGFLSYSFFIYILFVLAHVWTVAYAFVPYGWILRE
FT                   KLPQVLCFSTTFILAGLIEFDSFKPYEGIAKSFTKKIRVVAVGLLLLTGIFTYQIRPTL
FT                   VPEPYHPEANLITAGIWTIHFGFDNDLWASEDRMTHLIKDMQLDIVGLLETDTQRITTG
FT                   NRDLTAKMAHDLGMYADFGPGPNKHTWGCVLLSKFPIIKSEHHLLPSPVGELAPAIHAT
FT                   IEAYGELVDVFVFHSGQEEDEEDRRLQSEAMAELMGSTDRPSILLSYLVTKPHQDNYNI
FT                   YVSDKSQMYDIDPTDEDRWCEYILYKKLKRAGYARVSRATITDTELQVAKFQVLPDIDE
FT                   VDEDYLYGYRRLPTKNVHRSFKFPKKFMGDGERGHHYHVFDEPRYFN"
FT   gene            <970437..>970509
FT                   /locus_tag="KLLA0_A11154r"
FT   tRNA            970437..970509
FT                   /locus_tag="KLLA0_A11154r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            complement(<970974..>973133)
FT                   /locus_tag="KLLA0_A11176g"
FT                   /old_locus_tag="KLLA-ORF10053"
FT   CDS_pept        complement(970974..973133)
FT                   /locus_tag="KLLA0_A11176g"
FT                   /old_locus_tag="KLLA-ORF10053"
FT                   /product="KLLA0A11176p"
FT                   /note="highly similar to uniprot|P32775 Saccharomyces
FT                   cerevisiae YEL011W GLC3 Glycogen branching enzyme involved
FT                   in glycogen accumulation green fluorescent protein (GFP)-
FT                   fusion protein localizes to the cytoplasm in a punctate
FT                   pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03074"
FT                   /db_xref="GOA:Q6CX53"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX53"
FT                   /protein_id="CAH03074.1"
FT                   /translation="MTGDNNDIPENVRGVVEIDSWLTPFAKVLSERRYLADEWRYKIEH
FT                   STNSEGRDTTLAQFARDAYKSFGLHADPGSLEIRYKEWAPNAVRAFLIGEFNSWNENAN
FT                   EMQRDEYGIFTTVVPPVVDDSGNKQYGIPHDSKVKVCFQLADGSRIYRLPAWITRATQP
FT                   DKETAKQWGPSYEARFWNPPVHYSFKNKRPGFMRDTDSLRIYEAHVGISTPEPKVGSYK
FT                   EFTQNVLPRIKDLGYDAIQLMAIMEHAYYASFGYQVTNFFAASSRFGTPDELKELVDTA
FT                   HGMGILVLLDVVHSHASKNVTDGLNQFDGSDHQYFHSLASSRGEHPLWDSRLFNYGHFE
FT                   VQRFLLANLAFYIDVYQFDGFRFDGVTSMLYLHHGVGEGGAFSGDYNEYLSSERSFVDH
FT                   EALAYLMLANDLVRELLPDNGITIAEDVSGYPTLCMPRHLGGAGFDYRLAMALPDMWIK
FT                   LLKESRDEDWEMGHIVHTLVNRRHREKVVAYTESHDQALVGDKTLAFWLMDAAMYTDMT
FT                   ILKESTPVVDRGIALHKLIRLITHSLGGEAYLNFEGNEFGHPEWLDFPNVNNGDSYHYA
FT                   RRQFNLVDDPLLRYQYLYQFDKAMQTTEKNYKWLNTPQAYVSLKHEVDKVIAFERNGLL
FT                   FIFNFHPTESFTDYRIGVNEPGCYRIVLNSDKHEYGGWDRIDESQSKYFTTDLKWNERN
FT                   NFIQVYIPNRTALVLALDSRVRNGN"
FT   gene            complement(<973755..>974529)
FT                   /locus_tag="KLLA0_A11198g"
FT                   /old_locus_tag="Klla0A.mRNA.105.m"
FT   CDS_pept        complement(join(973755..974358,974525..974529))
FT                   /locus_tag="KLLA0_A11198g"
FT                   /old_locus_tag="Klla0A.mRNA.105.m"
FT                   /product="KLLA0A11198p"
FT                   /note="similar to uniprot|P28263 Saccharomyces cerevisiae
FT                   YEL012W UBC8 Ubiquitin-conjugating enzyme that negatively
FT                   regulates gluconeogenesis by mediating the glucose-induced
FT                   ubiquitination of fructose-1,6-bisphosphatase (FBPase);
FT                   cytoplasmic enzyme that catalyzes the ubiquitination of
FT                   histones in vitro"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03075"
FT                   /db_xref="GOA:Q6CX52"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX52"
FT                   /protein_id="CAH03075.1"
FT                   /translation="MSSNSKRRIETDVMKLLMSDHDVELVEDKMQEFHIKFHGPKDTPY
FT                   EKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIV
FT                   EWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINKYATKEKYIQQFGKWNSS
FT                   DDTDDEDEDADMDESDDEQAHDDNDSMELSDIEVSDDDD"
FT   gene            complement(<974831..>975076)
FT                   /locus_tag="KLLA0_A11209g"
FT                   /old_locus_tag="KLLA-ORF10049"
FT   CDS_pept        complement(974831..975076)
FT                   /locus_tag="KLLA0_A11209g"
FT                   /old_locus_tag="KLLA-ORF10049"
FT                   /product="KLLA0A11209p"
FT                   /note="similar to uniprot|Q9URQ5 Saccharomyces cerevisiae
FT                   YCR020W-B HTL1 Subunit of the RSC chromatin remodeling
FT                   complex, a multisubunit complex that functions in
FT                   transcriptional regulation,chromosome stability and
FT                   establishing sister chromatid cohesion"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11209g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65221"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI8"
FT                   /protein_id="CAR65221.1"
FT                   /translation="MTTTQGTEQPQDLKVNLKTITAEDLLSRRANMVELFNLLDDSSRT
FT                   ELFLGSSEDREKKLASLRKRLQSVQQEVETLKSESD"
FT   gene            <975454..>975729
FT                   /locus_tag="KLLA0_A11220g"
FT                   /old_locus_tag="KLLA-ORF10048"
FT   CDS_pept        975454..975729
FT                   /locus_tag="KLLA0_A11220g"
FT                   /old_locus_tag="KLLA-ORF10048"
FT                   /product="KLLA0A11220p"
FT                   /note="similar to uniprot|P23059 Saccharomyces cerevisiae
FT                   YCR020C-A MAK31 Non-catalytic subunit of N-terminal
FT                   acetyltransferase of the NatC type required for replication
FT                   of dsRNA virus member of the Sm protein family"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03076"
FT                   /db_xref="GOA:Q6CX51"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX51"
FT                   /protein_id="CAH03076.1"
FT                   /translation="MTDLSNVHLHDLLSETLYINLDQKRSLTGKLIAIDCKANLLLDEV
FT                   VENNDGHVRKMGLVSVPFVSVRSVKVRRELVDTINALKLNISSQYV"
FT   gene            complement(<975786..>976844)
FT                   /locus_tag="KLLA0_A11242g"
FT                   /old_locus_tag="KLLA-ORF10047"
FT   CDS_pept        complement(975786..976844)
FT                   /locus_tag="KLLA0_A11242g"
FT                   /old_locus_tag="KLLA-ORF10047"
FT                   /product="KLLA0A11242p"
FT                   /note="similar to uniprot|P23060 Saccharomyces cerevisiae
FT                   YCR019W MAK32 Protein necessary for structural stability of
FT                   L-A double-stranded RNA-containing particles"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03077"
FT                   /db_xref="GOA:Q6CX50"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX50"
FT                   /protein_id="CAH03077.1"
FT                   /translation="MGLLTTNGMLIIDEIETASSHYYDVLGGGGTYAMLGASICCTDLS
FT                   LRKELLWIVDRGMDFPKQLTETIESWDTGCVFRDDNERLTTRGYNVYGPNDFRSFKYLA
FT                   PKKRIDVSDWCESFGVKAVQRVSCYHLLCSADRVADILDKLAEELSFEGTLKTGQTFIW
FT                   EPIPDLCNVEHLEGIKKLLNGPYHFIFSPNAEEGARMLGETEPTELSDCSTILLKLAAL
FT                   IKPGNICVLRCGKKGSLALICNKNPSNDDIIHFPAYHYKTPECVIDPTGGGNTFLGAFA
FT                   FAYAMCKDISIASICGNIAAGCAIEQIGVPSHNGMHWNKTTFADRLLYYLSTYELKQGH
FT                   SEILNSLQPMKY"
FT   gene            <977210..>977281
FT                   /locus_tag="KLLA0_A11264r"
FT   tRNA            977210..977281
FT                   /locus_tag="KLLA0_A11264r"
FT                   /product="transfer RNA iMet (CAT) cove"
FT   gene            complement(<978095..>979834)
FT                   /locus_tag="KLLA0_A11286g"
FT                   /old_locus_tag="KLLA-ORF10044"
FT   CDS_pept        complement(978095..979834)
FT                   /locus_tag="KLLA0_A11286g"
FT                   /old_locus_tag="KLLA-ORF10044"
FT                   /product="KLLA0A11286p"
FT                   /note="highly similar to uniprot|P39968 Saccharomyces
FT                   cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
FT                   protein that interacts with Atg13p required for the
FT                   cytoplasm-to-vacuole targeting (Cvt) pathway interacts with
FT                   Nvj1p to form nucleus-vacuole junctions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03078"
FT                   /db_xref="GOA:Q6CX49"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX49"
FT                   /protein_id="CAH03078.1"
FT                   /translation="MGLCCSCLRGESSLEDSTGLPIAENEREAVTSLLEFLENKDQYDF
FT                   YSGKPLRALTTLVYSDNLNLQRSAALAFAEITEKYVSPVSRDVLEPILMLLTNPDPQIR
FT                   IASCAALGNLAVNNENKLLIVEMGGLEPLIEQMKSDNVEVQCNAVGCITNLATQDDNKI
FT                   EIAQSGALVPLTKLARSSNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSLLSSM
FT                   DADVQYYCTTALSNIAVDESNRRYLSKHAPKLVTKLVSLMNSTSPRVKCQATLALRNLA
FT                   SDTNYQLEIVRAGGLPDLVQLIQSDSLPLVLASVACIRNISIHPLNEGLIVDAGFLPPL
FT                   VKLLDYQESEEIQCHAVSTLRNLAASSEKNRAEFFQSGVIEKFKQLALTCPISVQSEIS
FT                   ACFAILALSDNTKYDLLQQDVLKVLIPMTMSQDQEISGNSAAAVANLISRVSNLEKILE
FT                   YWGQPNDGIKGFLIRFLSSDFPTYEHIALWTILQLFECHNETIYKLIKEDQKLVNGVKK
FT                   IADENYAVAREYMQDGQDTNIDHNGNSNNIEGNGRSNKQSSEKEDASFELYNITQQIIQ
FT                   FLV"
FT   gene            complement(<980616..>982022)
FT                   /locus_tag="KLLA0_A11308g"
FT                   /old_locus_tag="KLLA-ORF10042"
FT   CDS_pept        complement(980616..982022)
FT                   /locus_tag="KLLA0_A11308g"
FT                   /old_locus_tag="KLLA-ORF10042"
FT                   /product="KLLA0A11308p"
FT                   /note="weakly similar to uniprot|P39998 Saccharomyces
FT                   cerevisiae YEL015W EDC3 Non-essential conserved protein of
FT                   unknown function plays a role in mRNA decapping by
FT                   specifically affecting the function of the decapping enzyme
FT                   Dcp1p localizes to cytoplasmic mRNA processing bodies"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03079"
FT                   /db_xref="GOA:Q6CX48"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="PDB:5LOP"
FT                   /db_xref="PDB:6AM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX48"
FT                   /protein_id="CAH03079.1"
FT                   /translation="MLNFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVSP
FT                   VFKIKADKLYDLKVLKLPPNANVKMNNGNGNGNGNGKQEKEKEKGKERDRFTEKADEIW
FT                   DTEMSSDFDFQGNLQRFNKKDAFKDFQNVEIPKDETKIPHNEMVTAGNVKETTSDSDKI
FT                   TESINITHLLRNDSIAASLANQRKTFTCGSKNKIKVPLATPIQLLEMEKIADEKFMLPL
FT                   KTSLEHSGIHISRLLRNMLKSYTPPATSDSDAVPTVVAFVSGGRSGSRCISALRCLLYI
FT                   KDIRCIIVNPFINERESFDDDISTEQINKIKTLNNVHFPDSLAKLKELLQNEPPSIIID
FT                   ALQGFDDTVSDLDFSPDSNDNIAQYIKWINSHETVSACLEVISFDCPAHIDPSSGDVIE
FT                   SDFVHPTTILSTGWPLHCLPKLTQILPDWRNTYVYDTGVPQQTYLLKPNLRKFYKLDIY
FT                   PGFSGTQELK"
FT   gene            <982552..>983124
FT                   /locus_tag="KLLA0_A11330g"
FT                   /old_locus_tag="KLLA-ORF10038"
FT   CDS_pept        982552..983124
FT                   /locus_tag="KLLA0_A11330g"
FT                   /old_locus_tag="KLLA-ORF10038"
FT                   /product="KLLA0A11330p"
FT                   /note="similar to uniprot|P25378 Saccharomyces cerevisiae
FT                   YCR027C RHB1 Putative Rheb-related GTPase involved in
FT                   regulating canavanine resistance and arginine uptake;
FT                   member of the Ras superfamily of G-proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03080"
FT                   /db_xref="GOA:Q6CX47"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX47"
FT                   /protein_id="CAH03080.1"
FT                   /translation="MSVRDRKIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHE
FT                   FVLKKPNGTELKFNLDIVDTSGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIR
FT                   DKMLDMLGLLELPMVLVGNKIDLDRQVSYKEGEELAKRLKCGFVEICVKQGSGIEMPFK
FT                   TLIQKIEGYEDGNTKADQGQSEGCSIM"
FT   gene            complement(<983428..>984372)
FT                   /locus_tag="KLLA0_A11352g"
FT                   /old_locus_tag="KLLA-ORF10037"
FT   CDS_pept        complement(983428..984372)
FT                   /locus_tag="KLLA0_A11352g"
FT                   /old_locus_tag="KLLA-ORF10037"
FT                   /product="KLLA0A11352p"
FT                   /note="some similarities with uniprot|P32573 Saccharomyces
FT                   cerevisiae YNL202W SPS19 late sporulation specific gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03081"
FT                   /db_xref="GOA:Q6CX46"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX46"
FT                   /protein_id="CAH03081.1"
FT                   /translation="MQKTMAQEVRSATPLNPTIPSITDVLPSFRLDGHVTIVTGAAGGL
FT                   AHTLSQALVSQGSELALMDLSLPSLENVKTELELFQKQNNIPPVKISLWACDISNADEV
FT                   EMVVKSIPSSHKGIVPQKLVHTAGFCQNINAHEYDAEKAQKLVNVNLLGSLYICQSMAR
FT                   QLLARRTRRKSISEHIDESGEAMPQFPEASFVLIGSMSGLIVNTPQPQCAYNMSKAGVI
FT                   HLVKSLAAEWAKFGIRVNAISPGYIATALTKKVISQSQEGAALQKEWTNRIPLGRMAEP
FT                   KEFIGSMLYLLSRSASSYTTGENMVVDGGYVCW"
FT   gene            complement(<985471..>987336)
FT                   /locus_tag="KLLA0_A11374g"
FT                   /old_locus_tag="KLLA-ORF10034"
FT   CDS_pept        complement(985471..987336)
FT                   /locus_tag="KLLA0_A11374g"
FT                   /old_locus_tag="KLLA-ORF10034"
FT                   /product="KLLA0A11374p"
FT                   /note="some similarities with uniprot|P25353 Saccharomyces
FT                   cerevisiae YCR026C NPP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03082"
FT                   /db_xref="GOA:Q6CX45"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX45"
FT                   /protein_id="CAH03082.1"
FT                   /translation="MPTADSEFELEFSDLEDPLDFLDSPTWSQRLKSYVNRSKNYLKKW
FT                   YYVTPFNTGIELQTWNGTELQDDDDNDHIFDNIGVVRAKKKTYIWKWITFVLSIIATLL
FT                   LSILVISSLKHKQKKLTHSAAKLEPGSTSFKTLVISLDGFHPGYISELRTPFLNQLFTP
FT                   SNQINDTLVAPYMIPSFPSQTFPNHWTMITGQFPHHHGIIANRFWDSKNDVEFQINDIS
FT                   SRMNTFWNQSYPLWFFTNEIHLNTHTHMWPGSEQIHSDPLRNPTIVDSFNIDEPLNDKL
FT                   NTIRTALQNESTTLTFAYVPVVDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFADVDENV
FT                   NILVISDHGMSTILKENVYVWETLFGDLSTIPAIVKLYDDANTLIYTNQEDMETAYKQL
FT                   DPHIPEQCELVRSTDIFPDVSNEIIHERIPQLLITCEPGYQIVRQSKYDKLPKRFGTHG
FT                   FRKDHPDMRSLFLGKGPFFADLRSNLNDQYIKPFDNIQIFSLLLQLCGTDDIDVNVDAD
FT                   LKFWKHLIPLGKFSEVSKSMWENYPDSEFNKLWNNYIEETISEKPSATTSSIATSTISP
FT                   TSSTIHDSTPTSERHPSLGEIIDEVEDTINDILHKIWPSNDKGND"
FT   gene            complement(<987998..>988912)
FT                   /locus_tag="KLLA0_A11396g"
FT                   /old_locus_tag="KLLA-ORF10031"
FT   CDS_pept        complement(987998..988912)
FT                   /locus_tag="KLLA0_A11396g"
FT                   /old_locus_tag="KLLA-ORF10031"
FT                   /product="KLLA0A11396p"
FT                   /note="weakly similar to uniprot|P39996 Saccharomyces
FT                   cerevisiae YEL017W GTT3 Protein of unknown function with a
FT                   possible role in glutathione metabolism as suggested by
FT                   computational analysis of large-scale protein-protein
FT                   interaction data GFP-fusion protein localizes to the
FT                   nuclear periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03083"
FT                   /db_xref="GOA:Q6CX44"
FT                   /db_xref="InterPro:IPR038872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX44"
FT                   /protein_id="CAH03083.1"
FT                   /translation="MSTVLEKFKKVELIDLADKLGLSVSTSNTKPTLVLKILDHLESLD
FT                   EPVDLNEYPELQLYYEALAEDNDEEDSEEEESSLDDEEEEDEQDIKEMFDRSDLPTKSP
FT                   ACLWFSNLRFVNKVTNSPYYFRFHEFVDDVQWTTQEWNETVQDYLSTLHTVKQLVLAVE
FT                   LFVFVKSLIQFNWYRFPSPDFVTFYPSQRDFILSVSFWFIFSRMIPSIVSYYFNFVRHE
FT                   LFAIEFDPLVYHLTKVLISLQFLYNSPSVKKEIELLLSSDYSICQLLSHGYNVGLFCWK
FT                   FQLGHLPLIANSAAVIIALYVLA"
FT   gene            complement(<990779..>991606)
FT                   /locus_tag="KLLA0_A11440g"
FT                   /old_locus_tag="KLLA-ORF10025"
FT   CDS_pept        complement(990779..991606)
FT                   /locus_tag="KLLA0_A11440g"
FT                   /old_locus_tag="KLLA-ORF10025"
FT                   /product="KLLA0A11440p"
FT                   /note="weakly similar to uniprot|P39995 Saccharomyces
FT                   cerevisiae YEL018W EAF5 Esa1p-associated factor, subunit of
FT                   the NuA4 acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03085"
FT                   /db_xref="GOA:Q6CX42"
FT                   /db_xref="InterPro:IPR026226"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX42"
FT                   /protein_id="CAH03085.1"
FT                   /translation="MFKEFLLLDVLYDELLNSQTNKVSLIRLRTGFNDHKIHKFTRMED
FT                   IKINEILDMIKEMFPNQTSLNDGQITFYHLQINEIQNKIMDVYERCQRDLVGKLAKNEK
FT                   ELKRGKVGKVSHTGSNGNKSNSSSSSSSTSAISNGAGAAGATTHSVLSTPAASTSTTTN
FT                   NSSKVDYMKSRRGKILAMYRDTVIAKLESFEQFKEVFSSFEKVNHNEVIKMENDLKKLK
FT                   TLHLNNLIDLQWNLQNCVTNGIMSMGHEDTNRVLLAQDELDMTINFVRNAMDN"
FT   gene            <991845..>992615
FT                   /locus_tag="KLLA0_A11462g"
FT                   /old_locus_tag="KLLA-ORF10022"
FT   CDS_pept        991845..992615
FT                   /locus_tag="KLLA0_A11462g"
FT                   /old_locus_tag="KLLA-ORF10022"
FT                   /product="KLLA0A11462p"
FT                   /note="similar to uniprot|P38632 Saccharomyces cerevisiae
FT                   YEL019C MMS21 Protein involved in DNA repair mutants are
FT                   sensitive to the alkylating agent methyl methanesulfonate
FT                   and show increased spontaneous mutation and mitotic
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03086"
FT                   /db_xref="GOA:Q6CX41"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR026846"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX41"
FT                   /protein_id="CAH03086.1"
FT                   /translation="MTSRLVLPDVLPITSKRHDILHQITLPDLSREISAAKSSIQDSVI
FT                   GLLSSYPKYPTDRVDEINELESAYKDLLRMESRQKFLNSKLTEMKSKYTQQSSDAPRLN
FT                   RENWDSFLNNEYNLINVRKEWIKLQSEEVEIDKKDQWLRVFCALPYIWSDPTRIIPNDP
FT                   FETDAAQEEEGEDIKVEGGVVELTCPVSVKKFQSPMISVKCHHTIDNESLQSLFQQGKS
FT                   IQCPVSGCNKTLTSRDFVPDRLMHIRVLISELRE"
FT   gene            <992734..>994158
FT                   /locus_tag="KLLA0_A11484g"
FT                   /old_locus_tag="KLLA-ORF10021"
FT   CDS_pept        992734..994158
FT                   /locus_tag="KLLA0_A11484g"
FT                   /old_locus_tag="KLLA-ORF10021"
FT                   /product="KLLA0A11484p"
FT                   /note="similar to uniprot|P25345 Saccharomyces cerevisiae
FT                   YCR024C SLM5 Mitochondrial asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03087"
FT                   /db_xref="GOA:Q6CX40"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX40"
FT                   /protein_id="CAH03087.1"
FT                   /translation="MISKIEGISGETLRCGSVRVRDHKLYTGPPAMRLPVTLKRVFETA
FT                   RTNGGTPVKIDQVSGWVKNVRPLKTITFVEIQDGTTLQDLTVVLKQGAPSFKPSLGQSV
FT                   TVLHPEIVQRKNQQFETLCMPENLKLIGPTVEYPVQNKQTSLPTLRKLPEFKHRTTYLS
FT                   NLLRFRHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMFNLKQDHWDEIVNLTVSS
FT                   QLHLEVLMMGLGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEASFVDKNESLMDLVELMV
FT                   KSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTDAVEALLSSGVKFEHDL
FT                   AWGKDLNSEHERWLCDHFGGPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIGEIV
FT                   GGSVREDDYDTLKQEIERRDMASNQLDWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPN
FT                   IRDSIPFHRTAGQIDL"
FT   gene            <994478..>994870
FT                   /locus_tag="KLLA0_A11506g"
FT                   /old_locus_tag="KLLA-ORF10018"
FT   CDS_pept        994478..994870
FT                   /locus_tag="KLLA0_A11506g"
FT                   /old_locus_tag="KLLA-ORF10018"
FT                   /product="KLLA0A11506p"
FT                   /note="similar to uniprot|P53903 Saccharomyces cerevisiae
FT                   YNL149C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03088"
FT                   /db_xref="GOA:Q6CX39"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX39"
FT                   /protein_id="CAH03088.1"
FT                   /translation="MEVLQNLKTNLYQTFDIDLQHAIRLIVIVGGYFFLRQIAQRELAK
FT                   RQLKNQLAEKDDEAIRSVAAGTSDGSTADQGESSANGSSFGWGNRTRQRVKKQEELLES
FT                   EIQRLQENGAVLDPEDDKDIEDLLID"
FT   gene            <995143..>995889
FT                   /locus_tag="KLLA0_A11528g"
FT                   /old_locus_tag="KLLA-ORF10016"
FT   CDS_pept        995143..995889
FT                   /locus_tag="KLLA0_A11528g"
FT                   /old_locus_tag="KLLA-ORF10016"
FT                   /product="KLLA0A11528p"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151C RPC31 RNA polymerase III subunit C31 contains HMG-
FT                   like C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03089"
FT                   /db_xref="GOA:Q6CX38"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX38"
FT                   /protein_id="CAH03089.1"
FT                   /translation="MSFRGSRGKSSSTFSNLPFGLSYSDVSAKGSTELPLIPLPLNHPS
FT                   NELEREIAIHYINFKNALKDGPFFTGSMELISEEDQEEGDTENAKNKRKNKPSLQVDAD
FT                   GLNDGIERYSDKYLKRRKIGTSIDEHPFNIDFFPKELYHVMGINKKKLIQLSKLDKSKT
FT                   LFGLNGSKEEDEAVGRALLEKMSGMVDDDEENEEGNEEKEADKDDIDEDDEFEEDDDDD
FT                   YNAEKYFDDGDDDLGGDDEYPDEAEF"
FT   gene            complement(<996087..>997151)
FT                   /locus_tag="KLLA0_A11550g"
FT                   /old_locus_tag="KLLA-ORF10015"
FT   CDS_pept        complement(996087..997151)
FT                   /locus_tag="KLLA0_A11550g"
FT                   /old_locus_tag="KLLA-ORF10015"
FT                   /product="KLLA0A11550p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX37"
FT                   /protein_id="CAH03090.1"
FT                   /translation="MIRQDGKLIILPSKITVGKQLEVGTYFMLKLGQNAIRFNSIRGNL
FT                   ELNVRAADWDTNMEFIIFRRRPRLKNDLLGCRRRDVLDQDFININKLRPKALREYYVVW
FT                   KSVELNSLAKDVQFIVDIEFFPSSGPIIPLKSPQSPSEKSSPVIKTKLPKQLPQSPESK
FT                   PATTPRDQESSPKFFPRLRRHSRHQRRNDLNIDSDDIVYDNVIIYDGKEKAVVAGNYTH
FT                   GLKSYEAESSDTSGVYSFIEQNKEKIRNYDYDTLVIKETPKDLLNNEYARLQLGDKLMF
FT                   IHSFPSANVKLTGYLGNGRWSVPETNETRRQLYVLQQPTLPPPRVPPKCPKGMLWEEYY
FT                   LLNKEKYIREVMRN"
FT   gene            complement(<997457..>998623)
FT                   /locus_tag="KLLA0_A11572g"
FT                   /old_locus_tag="KLLA-ORF10013"
FT   CDS_pept        complement(997457..998623)
FT                   /locus_tag="KLLA0_A11572g"
FT                   /old_locus_tag="KLLA-ORF10013"
FT                   /product="KLLA0A11572p"
FT                   /note="similar to uniprot|P53901 Saccharomyces cerevisiae
FT                   YNL152W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03091"
FT                   /db_xref="GOA:Q6CX36"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037791"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX36"
FT                   /protein_id="CAH03091.1"
FT                   /translation="MSNNVITGANGRLDVYVSKAKDLPNLRKLDKQDPFVKLRVAHLTE
FT                   ISPVIYRGGQTPKFDYHCVFQLTPDIKPLLCVELYDDHDHKHGSKLIGKCDVDLLPALL
FT                   SDPEEGHDRWYHLKRGPLEAGKVYIELTFVPNNISEDRRDNVPKISSSVQSRSVPPLPS
FT                   DPPELHAQYELQTSASEQRFVASASPGQYVHGSHIKSPLPDLPINLDTSRSSHASSERI
FT                   DFDSSMGSNATANTYHSQQSQSTDGLMDKLKLIKEKLNYFKNGSSVPSTESITNTAMDL
FT                   EVLQKVVGGGLESSSSSRIPTNIDEPSPMNHLPTKSFVEPPLPPLPTTPSRLSSQSSVR
FT                   HSAGQKYPLKSPVRQPTTPRLPNLPNSFSSPSSRSGSVSPTRRRPPPL"
FT   gene            complement(<998888..>1003480)
FT                   /locus_tag="KLLA0_A11594g"
FT                   /old_locus_tag="KLLA-ORF10012"
FT   CDS_pept        complement(998888..1003480)
FT                   /locus_tag="KLLA0_A11594g"
FT                   /old_locus_tag="KLLA-ORF10012"
FT                   /product="KLLA0A11594p"
FT                   /note="similar to uniprot|P53552 Saccharomyces cerevisiae
FT                   YNL139C RLR1 Required for LacZ RNA expression from certain
FT                   plasmids suppressor of the Transcriptional (T) defect of
FT                   Hpr1 (H) by Overexpression (O) plays a role in
FT                   transcription elongation by RNA polymerase II Involved in
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03092"
FT                   /db_xref="GOA:Q6CX35"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX35"
FT                   /protein_id="CAH03092.1"
FT                   /translation="MALYDCLNNLASNLPNDEQVTYFDKTFFDEPSRGVETIISQYLSL
FT                   DASSQKSDYVYDLFLEAFSLINGKSDESEFLNLDAISKIVSALCNEDRYNFELFVSLAN
FT                   SYPWEANNGFNDLVGCAKDLQLEVCIYLNDQILSKGTERWSKDFWSAFKKSIVPEFFLL
FT                   QKPNLFLECSTGFSQLITLLNIAFEDVDKFQSVQYYSKQLKYIMGKYKLDPIRCMDILL
FT                   QVSSYHVVHHFEFILELLQSTDYWPSSNLANCSRYEQLNQGGNPIATRLIVNYLNNGKP
FT                   DANYIDLVVHLIKGGFVSFAAIFDCLTPYDTDIDEFVERKLTTLEKESLEGSLNPLAMA
FT                   SVLTDEDNTISKNTEGDKTNTAADTGISEKEKEALLRETVEKSPKWKLVERLLVNGHFV
FT                   PGLYALFKYPRFFAVNDSLVKSLLEVFDNMIEPLTVKLSPSAISEHCRPLLKLSHNGIP
FT                   TKQDRLIRQYRSLGKDYKYIQGTEFVFYNKDWRQNLTPIETIENLVHYSHLIFESIGPR
FT                   IILNAKLVEHICAIAEKNILDNLEDETVMDLWINYCRKFMLPVLGLVEDEQFVANAIYS
FT                   VMKHFPFERRYFMYHELSTKIAEDNIHVRLQFNKYQKRIRSLLKSLSIDNIAFKCRDVA
FT                   NFVSCNPLSTLDSILKQIENYDKVSELIVISAEFFSEFAYDVLQYTLLIKLTSERPTLQ
FT                   DDGITPKMWISRLSLFIAGLAKGCSKMSMSNIFVFLVKNLYKDPSLTLAILKELISQVA
FT                   GIQTLYDVNWNTLLMISSGSFLKQIGRNLILDFRDKYYQPSKTIVNYLLELNAVSEMII
FT                   MLTNLNLKIQTDNNVHYKILSAKCDESNALLWSFIEMLKHILTEEQFKANILPFNVLIE
FT                   KYQFPVEWAFDIWRHYFDTKLARSENDADEINEILYETDFKGINFENIDKRLFIDFWRL
FT                   SLYDIRLEEDLYTKQKIIYEDKRKAAKVLKERHSLLSTIQTVKFDLSQHASVFEKTKNM
FT                   IKMNKETWFPEFSRERITSFLQHCVVPRLIFSPFDAIFCATFITETFNIEEVIDILGQF
FT                   TSSNILGTLLFSSTVNESSNIATFLKDIITKIENWRHTTLLDDDKIKPVIYDLYYQLTE
FT                   QLSFTLEDSNYMSIRNTIQFLNAISEIFPVVDEHLELVLDTLDHLIEHEQREDIILPSN
FT                   ALKGHLKARLKNASKTSDFREVSAEEQQQLQDEMNLIKRYQDMKEAAKAEQSRKEEAEL
FT                   KEKEREKAKQQDAENGAATSSLTAPSMSSISNNSPSPSQVMDGFYKIEKYIKDAEYTRA
FT                   IPLIYDSNTQSDFRKLIKAPGNISGFRNKLKILFEDYYHRVTSNPPDHYRSVFENFIQR
FT                   CKSAPLPQTKTPGSMYEDEVVPVKPSSKYSGERWNSNTSSNRPIPSEPRKAASSRYQHG
FT                   IASTTLPRAPANASKPPDTSSRPSGPASSGSSSRFQNTLPSGPRKDSSSNRSISNSNTS
FT                   QLPSRPFNQGKKFVNTPSEPRKRQSDESYQSSSRFSNVKKPKLNDRSTNNQSPLPSGPK
FT                   RQSGGSRYSR"
FT   gene            <1003776..>1004115
FT                   /locus_tag="KLLA0_A11605g"
FT                   /old_locus_tag="Klla0A.mRNA.857.p"
FT   CDS_pept        join(1003776..1003778,1003855..1004115)
FT                   /locus_tag="KLLA0_A11605g"
FT                   /old_locus_tag="Klla0A.mRNA.857.p"
FT                   /product="KLLA0A11605p"
FT                   /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
FT                   YNL138W-A RCP10 Component of the U2 snRNP, associated with
FT                   the SF3b complex; conserved in Ashbya gossypii"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11605g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65222"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSI9"
FT                   /protein_id="CAR65222.1"
FT                   /translation="MSNKVKEELIYEDMRKKHPGVGSARTTKEEWSNTISKDTYASLAI
FT                   HQNLLEYYTLASGFPSKRDAQLTLLRKLANPPKPIKRDIGND"
FT   gene            complement(<1004255..>1004896)
FT                   /locus_tag="KLLA0_A11616g"
FT                   /old_locus_tag="KLLA-ORF10005"
FT   CDS_pept        complement(1004255..1004896)
FT                   /locus_tag="KLLA0_A11616g"
FT                   /old_locus_tag="KLLA-ORF10005"
FT                   /product="KLLA0A11616p"
FT                   /note="some similarities with uniprot|P38833 Saccharomyces
FT                   cerevisiae YHR127W (H)igh copy (S)uppressor of (N)34
FT                   dominant negative allele of SEC4. Suppression is very
FT                   specific to this allele. It has no affect on the analogous
FT                   YPT1 allele. No homology or known function"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03093"
FT                   /db_xref="GOA:Q6CX34"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX34"
FT                   /protein_id="CAH03093.1"
FT                   /translation="MASQHRNGNSKSRNGGGKGVGKGSNSLFGRVGNSSGQNPVLQKKQ
FT                   TLERAEKAKAEKAKAKTGLTFLGGKLVLAADLQGNKMKASSDKNKQQIQSNKRVNLLHN
FT                   LKNRARSKQRNNSDNSNNKKLVISLKESLKCLKIRNLPIGTNPSNLQRVLQQMGNCKVT
FT                   DLKVIDLPTGSAHAEVFASNMDLETLHKRFNQAEIDGRRILTEISSQPEL"
FT   gene            <1005270..>1006913
FT                   /locus_tag="KLLA0_A11638g"
FT                   /old_locus_tag="KLLA-ORF10002"
FT   CDS_pept        1005270..1006913
FT                   /locus_tag="KLLA0_A11638g"
FT                   /old_locus_tag="KLLA-ORF10002"
FT                   /product="KLLA0A11638p"
FT                   /note="similar to uniprot|P17555 Saccharomyces cerevisiae
FT                   YNL138W SRV2 Adenylyl cyclase-associated protein N-
FT                   terminal domain appears to be involved in cellular
FT                   responsiveness to RAS"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03094"
FT                   /db_xref="GOA:Q6CX33"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR028419"
FT                   /db_xref="InterPro:IPR036222"
FT                   /db_xref="InterPro:IPR036223"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX33"
FT                   /protein_id="CAH03094.1"
FT                   /translation="MTETNFSVQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKFGLE
FT                   KDGKVDGFADSVTASSAERIASAGSGASAASKEAATPVATAPNSTGESKEEEPKSIQEF
FT                   KHFIEQNVDPLVKLSAEIDPTVEKAVVFLANAFKAQLVFLKAAVQSKKPDFSSSAFVKG
FT                   LTPINENIFSIGELKEENRNSKYFAHLNAISEGSPLFSWIAGSTPVSTITDFKDAAQFW
FT                   TNRILKEFRSTDPKSVEWVQQFLSVFDSLKLYVKEYHTTGVTWNDTTGEDFETVYERVS
FT                   NEGSGASSSGATSSEPHSSGAGAPPPPPPPPPASVFEVNEQSKEQESGGIGAVFAELNQ
FT                   GENITKSLKKVEKSQQTHKNPELRASGKVSDKAVPPPKPKKPSTLKTKKPPRKELIGNK
FT                   WFIENYEDEAEPLVIETKIDESVFIGKCVNTLVQIKGKVNAVTVNETEKCSLVLDSSIS
FT                   GVDIIKCLRFGIQVENTLPQITIDASDSGSIYLSKNSLQAQIFTSSSTGININTPTGPD
FT                   GDFVEVPLPEQMIHTFVEGKLQTKIYEHAG"
FT   gene            complement(<1007120..>1008568)
FT                   /locus_tag="KLLA0_A11660g"
FT                   /old_locus_tag="KLLA-ORF10000"
FT   CDS_pept        complement(1007120..1008568)
FT                   /locus_tag="KLLA0_A11660g"
FT                   /old_locus_tag="KLLA-ORF10000"
FT                   /product="KLLA0A11660p"
FT                   /note="similar to uniprot|P27929 Saccharomyces cerevisiae
FT                   YNL137C NAM9 Mitochondrial ribosomal component of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03095"
FT                   /db_xref="GOA:Q6CX32"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX32"
FT                   /protein_id="CAH03095.1"
FT                   /translation="MPRKAVLLNSLSRGKVRTSFNKYNLFNLYKKSQVSFRSKTLYQQK
FT                   WTSKQETRAYHGEHLTESRWQSVFEPQLNSVAQLDASLRGGDIEPTPILLQTYAVLEKR
FT                   LDFALFRAMFASSVRQARQFILHGNVHVNGVKITSPGYALKAGDVFNVRPEKVLQALGA
FT                   KKPSLKEALKVDNTQIFLWNKYILEARKNPRKFWDEKIEKLRTMDSNDPKKQEFLSFLE
FT                   NYNKTMHIQMRKELDQTSNEYLLAKIFSTVNRVNDVEKLAVKDFLGEFYNNENLAAKGF
FT                   EIYREVKSAKAVETIAGKPLAEIPNEQGELLKVATGITKPVDNTNDALKKKFRAINHTI
FT                   VDLRHFYETVVREHYNDKMASVDSVDIPYDAKWAEKLPLHQKINVPELLENEPAAQKAI
FT                   NLPWQKGVFGRNDPSKPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVYLRDPVARPGQ
FT                   SEVITPFGLPVHERSYMYYVRRGK"
FT   gene            <1008960..>1010168
FT                   /locus_tag="KLLA0_A11682g"
FT                   /old_locus_tag="KLLA-ORF9999"
FT   CDS_pept        1008960..1010168
FT                   /locus_tag="KLLA0_A11682g"
FT                   /old_locus_tag="KLLA-ORF9999"
FT                   /product="KLLA0A11682p"
FT                   /note="some similarities with uniprot|P53911 Saccharomyces
FT                   cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
FT                   acetyltransferase complex which acetylates the N-terminal
FT                   tails of histones H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03096"
FT                   /db_xref="GOA:Q6CX31"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX31"
FT                   /protein_id="CAH03096.1"
FT                   /translation="MSAVKIESPRGQTWSKVEEIRLFKWMMLFKPAGIHKHFHMVCLLE
FT                   RLNKPDQYPIKLLQSDKGSSDKVFSGEDVWEQLSRYYNLEKADEVENQPYPEFYNDDGP
FT                   TETTNKKTEGDAQLDNDDDSDNDVDNCDELKRNIIPLQNRLQQETEFELSWEDYGELML
FT                   EHARDHEVEDIKQEETASADDKAKLKGAESQDTQVEQESEEPREREKDIDEKDTEQNNV
FT                   QAKQEMATTPPVSVGESVSELANEPVDEPVDAHKKPRTRRSTRLTRSQKRGIDDESENK
FT                   EDQPHGGNTDEKEDVEHDTEGRSGSEKESTADAADTTATKQVTFADESEGAAKESANSP
FT                   TGKAEENETESSQQPRPKKQKVAAAEEVPEDLADVDSPARRTRRKSITKPTTRLSSRLR
FT                   SRK"
FT   gene            complement(<1010467..>1010811)
FT                   /locus_tag="KLLA0_A11704g"
FT                   /old_locus_tag="KLLA-ORF9997"
FT   CDS_pept        complement(1010467..1010811)
FT                   /locus_tag="KLLA0_A11704g"
FT                   /old_locus_tag="KLLA-ORF9997"
FT                   /product="KLLA0A11704p"
FT                   /note="highly similar to uniprot|P20081 Saccharomyces
FT                   cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans isomerase
FT                   (PPIase) binds to the drugs FK506 and rapamycin also binds
FT                   to the nonhistone chromatin binding protein Hmo1p and may
FT                   regulate its assembly or function"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03097"
FT                   /db_xref="GOA:Q6CX30"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX30"
FT                   /protein_id="CAH03097.1"
FT                   /translation="MSETIEGNVQILRLSPGDSTNFPKPGDLVTIHYTGTLENGQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDAAIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATL
FT                   VFDVELLKIN"
FT   gene            <1012732..>1013991
FT                   /locus_tag="KLLA0_A11748g"
FT                   /old_locus_tag="KLLA-ORF9995"
FT   CDS_pept        1012732..1013991
FT                   /locus_tag="KLLA0_A11748g"
FT                   /old_locus_tag="KLLA-ORF9995"
FT                   /product="KLLA0A11748p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03099"
FT                   /db_xref="GOA:Q6CX28"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX28"
FT                   /protein_id="CAH03099.1"
FT                   /translation="MHFQPVLSFLIAAAGFVSTVTSADSDASEKFILEPSDLESIIKAL
FT                   QEVDHTIDIPHLQLSNVTNGTAAISVSNSATFDLVGVKDATTLQVTKDGYLVSVSANGG
FT                   IKYATIAAAAADPAVLFTADQSYASPGFSISGGNLALNGTDSWLLSVNSTDLTFKANGA
FT                   SLLNGETVNIPLSLAAVGTSGGSTVPDYLPSLTINSGADIQKRHNQDSHDHSNYTYGSG
FT                   FKHGNHTHGSNYTHHTDYSNHTHTQPPQFSDLSGDFTTTVTHETTALEPKVTFQKRADA
FT                   VSQIGDGQIQAGTGSTAVAETTPAAAETTSAAAETTPAAAETTSAAAETTPAAAETTPA
FT                   AVETTSAAVETTPAAAETTPATETTPAVVTSAVETTPVAVTTAASSTQALSTYAGAGVK
FT                   QLASSSGLFAAACVLGSLLI"
FT   gene            <1014918..>1016663
FT                   /locus_tag="KLLA0_A11770g"
FT                   /old_locus_tag="KLLA-ORF9991"
FT   CDS_pept        1014918..1016663
FT                   /locus_tag="KLLA0_A11770g"
FT                   /old_locus_tag="KLLA-ORF9991"
FT                   /product="KLLA0A11770p"
FT                   /note="similar to uniprot|P06775 Saccharomyces cerevisiae
FT                   YGR191W HIP1 High-affinity histidine permease also involved
FT                   in the transport of manganese ions"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03100"
FT                   /db_xref="GOA:Q6CX27"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX27"
FT                   /protein_id="CAH03100.1"
FT                   /translation="MTHFSKNMDTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAEEKD
FT                   YADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVI
FT                   AWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPL
FT                   ELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFT
FT                   ILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGV
FT                   SAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPL
FT                   VIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKG
FT                   RPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKH
FT                   QNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLP
FT                   IFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRL
FT                   WNFWC"
FT   gene            <1017064..>1021095
FT                   /locus_tag="KLLA0_A11792g"
FT                   /old_locus_tag="KLLA-ORF9989"
FT   CDS_pept        1017064..1021095
FT                   /locus_tag="KLLA0_A11792g"
FT                   /old_locus_tag="KLLA-ORF9989"
FT                   /product="KLLA0A11792p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03101"
FT                   /db_xref="GOA:Q6CX26"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX26"
FT                   /protein_id="CAH03101.1"
FT                   /translation="MINKVIICKQREHKRVPEAARHMSLSNSSHSSGSDSVRSSVFREF
FT                   SLLLKRHNSDMKVRTLEEHKEWLDHLDSEADAKHRRKAILNITDNIDKYEKSEIPLIWV
FT                   KATSLLKRDVDNTESRMLLELLSKCCLHCGNEHSVRLMFYFTLIDFCCVMGDKITLNRA
FT                   SLDSSLDLIFNGIDGLTHQGTDIVIFEQHATMNISQLLSLSLSNILNFNTRTCISFLSF
FT                   LNNCLRNSTLTVDGLGMIIHCAQKTPSPEVLLCCFHTINILISTEHEDISDQSTYDLAY
FT                   LITGAINLDNKFNQQLLKTLDALIESKYWDQFAYQLKILMESPDTNYLNLRGAVTILTD
FT                   FALQDKEDWFVWLTKIFERGNTMYGQILECIKTLITDDHFCEQGNGYVWYNEENMCLLK
FT                   MLREILSVDVIRDNNPITIASIYNALFQALLSKKWELYGLKNSSDLLALVIEHEELLSK
FT                   EQISIIAQYLESYRDPFPQSSLTKILHMLDATDERTAAIVKYFANSYALFDSACKKLIE
FT                   KSVLELLSCDESQSVFVSCTEFLVVLSEYIPTDALKSYVEAYLVPKQPRRKSIVSIGID
FT                   PHKIKWKLTEQSIALVRLFQRKIFMFPYLILTWRCCIKAKDTVALLVLARILMKMRIDA
FT                   DSLFYFCEETDIDGLTATLNRNTVIKPEGIDGSYLWKYPEDETTSYIDKGTLGKKFDAD
FT                   CLAYIDISEWTELLIETLRKPLDWELYTYLLSHLCPQLANYHLFKNDRHNIEILHDLIL
FT                   HQLKDGCPIKMGVGINKSDVQLAFVRTLSSLFPYYGFLGKSKADEMIKISLGVLESSFE
FT                   KTIVPLLHNFSVSCYEIPSSIKKHLNPLLETISIRLTKKQAIPCLLEFLIALSDSPQII
FT                   SPLTIDQLKRVFTIAFKLIEVSHDLKEEAEEADFVRHSFTDEQEASFNPSTSSFTVTKQ
FT                   MAHFYLTLSYQIISHWFIRISLSKRPLIAPFLMVKLSTLKRCDDTEAYKDLVTRFTTTD
FT                   LELRVETVTSDTPNSGDPHYLHEYWYRDGKILSIEVNTTTGASLVVTRGASGNSIFNVD
FT                   PIVKKEPDSFDLFQFGKNTKPASANMFTPGYVLAQFSAEDTYEDMVRIEEPHLIKSIQL
FT                   VDTIPVVEFHKIGLLYMGPNDTTEKDILSHSMEDGSHQYKWFVNELGSIIKLDQNETFY
FT                   IGGLNPGTDGEYALIWHDQKCQIVFHTVSLMPNDDKADPDRTMKKRHVGNNFINIYYDE
FT                   RKQDSFPFDIIKSQFNFINLVIKPMWNGKDEKDSVSEFYKVKIYRAKEVPGIFSTSHFK
FT                   IMHRQRLAAYVRHLCTVANTFAQIWHESVSSEHCSTWSRRFAHIKTIKTRLKNQSSGAS
FT                   "
FT   gene            <1021526..>1022434
FT                   /locus_tag="KLLA0_A11814g"
FT                   /old_locus_tag="KLLA-ORF9986"
FT   CDS_pept        1021526..1022434
FT                   /locus_tag="KLLA0_A11814g"
FT                   /old_locus_tag="KLLA-ORF9986"
FT                   /product="KLLA0A11814p"
FT                   /note="highly similar to uniprot|P20459 Saccharomyces
FT                   cerevisiae YJR007W SUI2 Alpha subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon phosphorylation of Ser51 is required for
FT                   regulation of translation by inhibiting the exchange of GDP
FT                   for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03102"
FT                   /db_xref="GOA:Q6CX25"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX25"
FT                   /protein_id="CAH03102.1"
FT                   /translation="MSTSNCRFYENKFPEVDDVVMVNVQQIAEMGAYVRLLEYDNIEGM
FT                   VLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSAEDVIKCEERYQK
FT                   SKAVHSILRQCAEKYQVSLEDLYKAYAWPLSRKYGHAYDAYKMSIVDPNVWDGIESISD
FT                   EIFQELKGQITRRLTPQAVKIRADVEVSCFSYEGIDAIKEALKSAEELSTEQMQIKVKL
FT                   VAAPLYVITTQSLDKDQGVQLLETAIAKIEEVILKYNGVCNVTMAPKAVTATEDAELQA
FT                   LLESKELEGRSDSEDEDSDYE"
FT   gene            <1023063..>1024028
FT                   /locus_tag="KLLA0_A11836g"
FT                   /old_locus_tag="KLLA-ORF9985"
FT   CDS_pept        1023063..1024028
FT                   /locus_tag="KLLA0_A11836g"
FT                   /old_locus_tag="KLLA-ORF9985"
FT                   /product="KLLA0A11836p"
FT                   /note="similar to uniprot|P47085 Saccharomyces cerevisiae
FT                   YJR008W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03103"
FT                   /db_xref="GOA:Q6CX24"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX24"
FT                   /protein_id="CAH03103.1"
FT                   /translation="MSSVRPATHAGSWYSSSPALITTLQQLLSRDEAVPGTKHLISPHA
FT                   GYKYCGDTMALGYSKLDFTNVKRCIIMGPSHHIYFKNKIQVTSFDEVNTPFGDFKVDGG
FT                   LRNELLVGGKVVLMSKEVDMDEHSLEMQFPMLWAAAKLRGVDPTNIKILPLLVSHNSTK
FT                   VDFELGKLLQKYVDDEETLFILSSDFCHWGRRFGYTGYVMESSDIDESLENDSEVEYLT
FT                   QRSFNHKSSHNVPIYKSIEILDQYAMDILGKNTENKYYDWKKYINVTGNTICGERPIGV
FT                   FLCAMSLLNKPYQFNWAHYSQSSQCVDLEDSSVSYASGYF"
FT   gene            complement(<1024297..>1025292)
FT                   /locus_tag="KLLA0_A11858g"
FT                   /old_locus_tag="KLLA-ORF9982"
FT   CDS_pept        complement(1024297..1025292)
FT                   /locus_tag="KLLA0_A11858g"
FT                   /old_locus_tag="KLLA-ORF9982"
FT                   /product="KLLA0A11858p"
FT                   /note="highly similar to uniprot|P00358 TDH2, to YGR192C
FT                   uniprot|P00359 TDH3 and to YJL052W uniprot|P00360 TDH1
FT                   Saccharomyces cerevisiae glyceraldehyde 3-phosphate
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03104"
FT                   /db_xref="GOA:Q6CX23"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6CX23"
FT                   /protein_id="CAH03104.1"
FT                   /translation="MVRVAINGFGRIGRLVLRIALSRPNVEVVAINDPFISVDYAAYMF
FT                   KYDSTHGRFAGEVSHDENSLIIDGKKVLVFQERDPATLPWGEHNVDIAIDSTGVFKELD
FT                   SAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYNGETIVSNASCTTNCLAPLAKVVNN
FT                   AFGIEEGLMSTIHSITATQKTVDGPSQKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQ
FT                   GKLTGMAFRVPTVDVSVVDLTVKLAKEATYDEIKAVIKKASENELKGILGYTEDAVVSS
FT                   DFLGDTNSSIFDAAAGIQLSPKFVKLVTWYDNEYGYSTRVVDLVELVAKN"
FT   gene            <1026841..>1028672
FT                   /pseudo
FT                   /locus_tag="KLLA0_A11885g"
FT                   /old_locus_tag="pseudo-Klla0A-1026841-1028672"
FT   gene            <1029032..>1029448
FT                   /locus_tag="KLLA0_A11913g"
FT                   /old_locus_tag="KLLA-ORF9976"
FT   CDS_pept        1029032..1029448
FT                   /locus_tag="KLLA0_A11913g"
FT                   /old_locus_tag="KLLA-ORF9976"
FT                   /product="KLLA0A11913p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11913g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03107"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX20"
FT                   /protein_id="CAH03107.1"
FT                   /translation="MVFPICNENLFTEVCKSVNEDPSDVLRLAKKTAGRRSEKLKKRRW
FT                   RQCKVEEEEEEDPDVVPPTPKDKTIAFGKRRNRKENRNSHLFFKKYQILTSHSTLITGK
FT                   KNVHRKRCKVPTEDENDVPVLSTIKRDSLLRVSI"
FT   gene            <1031062..>1034418
FT                   /locus_tag="KLLA0_A11935g"
FT                   /old_locus_tag="KLLA-ORF9975"
FT   CDS_pept        1031062..1034418
FT                   /locus_tag="KLLA0_A11935g"
FT                   /old_locus_tag="KLLA-ORF9975"
FT                   /product="KLLA0A11935p"
FT                   /note="some similarities with uniprot|P32768 Saccharomyces
FT                   cerevisiae YAR050W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11935g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03108"
FT                   /db_xref="GOA:Q6CX19"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX19"
FT                   /protein_id="CAH03108.1"
FT                   /translation="MMLTKGFSLLLLFLLPFSNAESQNTDGGTILGCKPSKNSPSSGFE
FT                   VAYYHYPMVPSGKGCYNYDATYQTEAYQHGGYETYGGGLIGKSSGVTDLTFKSTAASNS
FT                   CSKPVKARLPSNYNYNTQITVTNFSMLITGYFYAPKTGSYEFILDYIDDLTYLNVGAGR
FT                   AFDCCGKTSSVSNPGPFDLSVMWPQTQNTATVYLLGGFYYPLRIFYINREGVGGLTVTF
FT                   KDADGVLHKTFKNFIFSIPDGKECPVPVHTTTVPWDESYTTTFTTVSEYTNDSGKTVTE
FT                   NVIVVQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTAT
FT                   TTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTY
FT                   ATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIP
FT                   TIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYVKT
FT                   PVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGH
FT                   TSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSW
FT                   GGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYA
FT                   TEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGE
FT                   DGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETI
FT                   YYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEK
FT                   TTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPTVKTIYSVQTPESVKPSFSGWFS
FT                   NTTTSHTITSSSTSSDSTTSDITSTEPIFSLTTVTTTSNGVTTVYTTTCPIDTTLTEST
FT                   SCESLTSKSKTEHETTSSQISYSTNSKEEEGEEDVFNNERPTSTESNEELISSTQIVSL
FT                   SQTEVTPSSDIIITSYASSATETVQEQHSFEGETQTLSSSSSTADTISVFEGSAVKLLV
FT                   TPFIAVFLALL"
FT   gene            <1041208..>1041834
FT                   /locus_tag="KLLA0_A11957g"
FT                   /old_locus_tag="KLLA-ORF9965"
FT   CDS_pept        1041208..1041834
FT                   /locus_tag="KLLA0_A11957g"
FT                   /old_locus_tag="KLLA-ORF9965"
FT                   /product="KLLA0A11957p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11957g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03109"
FT                   /db_xref="GOA:Q6CX18"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX18"
FT                   /protein_id="CAH03109.1"
FT                   /translation="MQSSEIKSASPYQPLTEGESDNLSQLSYSQLGRDLHRGIFSHSIA
FT                   EHPTGALWLRGLILIIIILSGGIVYYSHSNVSEDGAIVCSVLICVCLLVMGATMLFMIL
FT                   TPTQEILHNPDDGLFFLKLIATGYSWEQIGRIMNSYLFQRGLWWSNSCIYDGQQCYVLF
FT                   INYTKCCNDSNIQPFIEQTQAKVAENMSLKWDRIQFPNELQSTDV"
FT   gene            complement(<1041901..>1043079)
FT                   /locus_tag="KLLA0_A11979g"
FT                   /old_locus_tag="KLLA-ORF9964"
FT   CDS_pept        complement(1041901..1043079)
FT                   /locus_tag="KLLA0_A11979g"
FT                   /old_locus_tag="KLLA-ORF9964"
FT                   /product="KLLA0A11979p"
FT                   /note="some similarities with uniprot|Q87020 Killer virus
FT                   of S KIL K2 killer toxin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A11979g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03110"
FT                   /db_xref="GOA:Q6CX17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX17"
FT                   /protein_id="CAH03110.1"
FT                   /translation="MLVSDSSVDGGERRSSFNDVDLENLKETLDGRHFCLFPQPWKTGK
FT                   QLAFLVSCFLCLAFVYFRFSNEQDLPNANMPFGKSPLEKKSVGTFFAAAGTVFFGVIAK
FT                   GAFVVAKAACNPAALAAIAAFNVAGASGCIGAYAVGALCAAISAGLAVESGSQGWQWYK
FT                   GSGVAKREIECEVYHYIPLINNTIFGGSLHTSDIFQSINSTDPLVVDSLQHIGVIYDNS
FT                   SNNIDLGADFLNKRSQLTPLMYTWTANYTGFMTTTYVQPEHLTLSVREYANTSSHNFTW
FT                   IKLAEVEWLSFNTYGINVDTAHIVTDHMQTDADDVMYGLGDLVTVQVQPCTQQDECYGY
FT                   HNKFCLAAGQSSTMGASSDIVGKVYFQQSSKRVYACNIIAKFKGTFIYLNIG"
FT   gene            <1044941..>1045321
FT                   /locus_tag="KLLA0_A12001g"
FT   CDS_pept        1044941..1045321
FT                   /locus_tag="KLLA0_A12001g"
FT                   /product="KLLA0A12001p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A12001g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03111"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX16"
FT                   /protein_id="CAH03111.2"
FT                   /translation="MDVPNNYPTLFCSEQYILPINSNTTLDDARGCGHLWGEKHKCKGW
FT                   PSKFFAVDPPIYEYGNYVGKAGAEYYSCGSDYTLEQTENTTLQQSWQCGVFEGANVKAN
FT                   SSPPKLKASVFLYLLMLVAYIL"
FT   repeat_region   complement(1045676..1045815)
FT                   /locus_tag="KLLA0_A12012t"
FT                   /old_locus_tag="Klla0A.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   mobile_element  complement(1046924..1047346)
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLLA0_A12023t"
FT                   /old_locus_tag="Klla0A.retrotransposon.3"
FT   mobile_element  complement(1047531..1048025)
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLLA0_A12034t"
FT                   /old_locus_tag="Klla0A.retrotransposon.4"
FT   gene            complement(<1048618..>1049781)
FT                   /locus_tag="KLLA0_A12045g"
FT                   /old_locus_tag="KLLA-ORF9956"
FT   CDS_pept        complement(1048618..1049781)
FT                   /locus_tag="KLLA0_A12045g"
FT                   /old_locus_tag="KLLA-ORF9956"
FT                   /product="KLLA0A12045p"
FT                   /note="some similarities with uniprot|P53054 Saccharomyces
FT                   cerevisiae YGL262W"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A12045g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03113"
FT                   /db_xref="GOA:Q6CX15"
FT                   /db_xref="InterPro:IPR035237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX15"
FT                   /protein_id="CAH03113.1"
FT                   /translation="MIMSQDKSQNSLHKVSPFKSWKLTLIKFLILFCVFFGLISCYHFY
FT                   REAQREAGHTGAINVVDKSVEHPNYNLPKYTDTVSTAEEDGGVSIFVLGKRNHWNWIGN
FT                   AAVAGFLISAGALTGGWAVASCMTIAGPACWVGIAVAMVAGTVGTIFATAAGRPGNGWT
FT                   SSNAKREESSSFSFGDSTYLKVEDGRADRVNSTITDAGLTFKGLWEVYDTVSLKKRSNN
FT                   VTDTVHMLQFDSPLGSHAAVHLNTGLDSMVNDITEDENPGSLESTLRYTDQKVLHKRYN
FT                   YFDAQWISWAWDNANNDLLRIAANDRGLEEEEYDSSVYNYFRDSPAWKYCWTVTDNPHP
FT                   GEGEDYNQLGAENAIHGELYFNTYGGVDGYCNDNKDGAQCSGNACEE"
FT   gene            complement(<1050804..>1051145)
FT                   /locus_tag="KLLA0_A12067g"
FT                   /old_locus_tag="KLLA-ORF9953"
FT   CDS_pept        complement(1050804..1051145)
FT                   /locus_tag="KLLA0_A12067g"
FT                   /old_locus_tag="KLLA-ORF9953"
FT                   /product="KLLA0A12067p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A12067g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03114"
FT                   /db_xref="GOA:Q6CX14"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX14"
FT                   /protein_id="CAH03114.1"
FT                   /translation="MVQDQSQYAVREAPSTKSWKTILIQFLILFVFFFGLISCYHLYRE
FT                   AQRQAGHSNDVNIAEKAGGASNYVLVKHDHWNWIGNSAVAGFLISAGALTGYACWYRRY
FT                   HSCNFHGEI"
FT   repeat_region   complement(1051470..1051828)
FT                   /locus_tag="KLLA0_A12078t"
FT                   /old_locus_tag="Klla0A.LTR.4"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <1052066..>1052611
FT                   /locus_tag="KLLA0_A12089g"
FT                   /old_locus_tag="KLLA-ORF9951"
FT   CDS_pept        1052066..1052611
FT                   /locus_tag="KLLA0_A12089g"
FT                   /old_locus_tag="KLLA-ORF9951"
FT                   /product="KLLA0A12089p"
FT                   /note="similar to uniprot|Q5WCY3 Bacillus clausii ABC3243
FT                   paiA Septation and degradation transcriptional repressor of
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLLA0_A12089g"
FT                   /db_xref="EnsemblGenomes-Tr:CAH03115"
FT                   /db_xref="GOA:Q6CX13"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CX13"
FT                   /protein_id="CAH03115.1"
FT                   /translation="MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEEN
FT                   LEAMFEESFNDAVLKKEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQR
FT                   IYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHS
FT                   FFVGDDEQRDYIMEKVIT"
FT   gene            <1053491..>1054758
FT                   /pseudo
FT                   /locus_tag="KLLA0_A12112g"
FT                   /old_locus_tag="pseudo-Klla0A-1053491-1054758"
FT   mobile_element  complement(1054728..1060266)
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLLA0_A12134t"
FT                   /old_locus_tag="Klla0A.retrotransposon.5"
XX
SQ   Sequence 1062590 BP; 321553 A; 208091 C; 207795 G; 325151 T; 0 other;
     aaccggcgcc agtgtgctgg gaccacatac ctaatcaaat ccgtacacca catacctaat        60
     caaatccgta caccacatac ctaatcaaat ccgtacacca catacctaat caaatccgta       120
     caccacatac ctaatcaaat ccgtacacca catacctaat caaatccgta caccacatac       180
     ctaatcaaat ccgtacacca catacctaat caaatccgta caccacatac ctaatcaaat       240
     ccgtacacca catacctaat caaatccgta caccacatac ctaatcaaat ccgtacacca       300
     catacctaat caaatccgta caccacatac ctaatcaaat ccgtacacca catacctaat       360
     caaatccgta caccacatac ctaatcaaat ccgtacacca catacctaat caaaaccaaa       420
     tccgtacacc acatacctaa tcaaatccgt acaccacata cctaatcaaa tccgtacacc       480
     acatacctaa tcaaatccgt acaccacata cctaatcaaa tccgtacacc acatacctaa       540
     tcaaatccgt acaccacata cctaatcaaa tccgtacacc acatacctaa tcaaatccgt       600
     acaccacata cctaatcaaa tccgtacacc ccgctcctcc ctttctggta attttacttt       660
     tatttttttc atttttttat tttttcattt tttcattttt tcattttctc attttctctt       720
     ttttaatcac tctagacgga tttcctcttc tggtaatttt ctttttctca ttttctcatt       780
     ttctcatttt ctcttttcta atcactcgaa acggatttcc tctttcggta attttgcttc       840
     tttgtttttt actttaattt ctttttcctc ttctcctctt tcgctttctc ctttcactct       900
     catccattct cattcctcaa tttatacttt ttttggcagt attcttgact gtttttcacc       960
     atttcccctt acccgcactt ccatcacatt ttctttgtca atccaccttc ttgccatggc      1020
     caatgcttgg tcctgctggg cctggtcctt gcataggata cacacgttac ccgcacaatt      1080
     atcacccatt ttcaacttct tccaactttt gctcctcttg ccatgaaact tcatttcaaa      1140
     ttacttcact tcatcacttc cttagttacc ctgctttatt ataaatcacg tgcttcccat      1200
     ctcccgcttc ccatctcccg cttcccatca cctgcttctc ttcacctgct tctcttcact      1260
     ttcatttttc atcccttctc attctacctt tctttccctc tctccctctg aatataagaa      1320
     ttctccactg tttttcacaa ttactactta cccgcactta aactacactt ctccatgtta      1380
     atcaacctta ttcctatcct atcctctgat ctcatcctgg ccgtgcctaa gctactacag      1440
     ttacccgcac aaacaattcc catcccacat ctcccatttc tgcttctctt gccaccaaac      1500
     ttcatttaaa attacttcac ttcttgaccc taatacttac cctgctttct tctatatcac      1560
     gtgcctctta tctctcctct cccacccacg cttttccatt tcacccacct tctgttctat      1620
     atcgtttcat acggcacgaa cctcagtggt tctctcctgt cccatcccat ccattctcaa      1680
     tccatacttc aatcctgttt ttgtccgggt tacccctttc cttcaaatct gtttcatttt      1740
     cctttttttc gcttttcatt tttcattttc atctctgtca tttcatacgg cacggagcta      1800
     ggcacttctc ccctgtccca tttcctcact tcttccctct ctctccctca gctttcccat      1860
     ttttttcatt tttttcattt ttcattgcac tcactattcc tgctaccaca agggtccccc      1920
     cttgtaaatg gatgaatctt gctgaacaca agggtcctcc cttgtaaatg ggtactccat      1980
     tactgaatac acgtgactac ttcaaccatc ccattttcat ttttcattgc actattcctg      2040
     ccaccacaag catcctcctc aaggggcccc ccttgtaaat ggatggatca ttgctgaata      2100
     caagggtccc cccttgtaat tggatgccct ttcctgaatt cacgtgactg attcaaccat      2160
     tttcattttc atttttcacc acgatcaatc aatcctcgtg aatcatctcc tgaacttatt      2220
     cacgtgataa ccagaggaag tgtttttcat tttcatactt cctgtccatc atccctccat      2280
     agagaggacc tctccctctg tcaatagaat acgcttctcc atacacgtga ccaccgcaaa      2340
     cactctacta acaactatct ctcgtgaatc atctcctgaa ctgtgaacta tgaactgcct      2400
     attcaatgta tactgctact ctactgttta tatcaattgc tcgtctattc ctctctctcc      2460
     ctctccttcc tccctctctc tccctcttct tcctccctct tcttcctccc tcctcccttt      2520
     cacttttcca tctgaaacct tcttttcctt ttctaaagtt gaaaaatcta ctgaaacgca      2580
     gtctccagaa tcactggaaa ctgccacagc accacgtgac tagataatgt ctttttcaca      2640
     acgacaactt ccggcgaact gaacttactt aaacaatctg tcgttctcga ctttaattat      2700
     tctttaattt actcatcaac taaactcaaa ctgcagagca ataagtccaa aaccaaacta      2760
     ctaacatcta ctaaacatct actagacatg tcatctcacc ctttccaggt cattgatttg      2820
     tgtgctcctg cagaagaaac ttcacgtctg ctattagaag ctgcaaatac tcaaggtttt      2880
     ctgtttattg acggccactc tttttctcaa caacaagtag atgctttgtt tcgcttatcc      2940
     atggagtact tcaccaatac tccccaccac gaaaagctgc aatatgcttt cgatgtcgcc      3000
     aagaattatg gatacactga ttatactcgt gaacaagggg accccagcaa ggccaaagac      3060
     ttcaaagagt gctacaattt tggttctata aatttcagca atggtactta caacggccaa      3120
     tcgcggtcta cttctgaaaa ttgtatgcag catggtgaag ttcccccatt gtttacttat      3180
     cacaatgact taattgttga cagcatcaag aaattccatg agctggccag gaatatcatg      3240
     ggattattca cggtagccct tggaatcatc caagaagatt tctttgtatc caggttcagt      3300
     gacgataaga agaacggatg tgtcatgagg ttgttgcact atcccctttt cagggatgat      3360
     ggcgttgatg gcagctctgg gattgacccg acgctaagaa ttggacctca ttcggattac      3420
     ggcgcattga cactcttgct tcaaaaggaa ggagagcaag ggctggaagt gcaattggac      3480
     ccgggctgtg accagtggac aaaggttccg tttttgactt ccagatacga aggttcggct      3540
     cctccaattg tcgttaactt cggtgacatg ttgagctttt ggacaaaagg cgttattagg      3600
     agcacgaaac acagagtgaa aattgaccct ggtgaaacga gatccagtga cagatactcc      3660
     attgtgtttt ttacccatcc tgacgcagac actaccctag atcccgttcc aagtagagtc      3720
     atcgagagta actctaatgg cattggggca cctccggtga cggcttacga gtatttgtct      3780
     gctcacctct cccgcgtgat caactcaatt cccagtcatg acggcatggt ataggctgcg      3840
     tcacattcta tgacttcttt cattttgttt tacagttttt tttacaggtt ttttttttga      3900
     gattattaat tttcaatttt ctactgtagg cagacagagt gaagaatttc taacttgatt      3960
     aactgctatt gagcaggtca gccactaact tcaaaccctg acatgtaccc tcaaatagtt      4020
     ttatatactc ccaatactta ccgtacctag taatgaggct actgaataac gctatactcc      4080
     gaaggagata cgtcggaaca ttcgctgatg agttataagg tatatcactc tctcctattg      4140
     gaacactctg ataataaaaa gtcatttatt ttgatgaaaa aagaagagtg aatttgaatc      4200
     tttggatcta gaacttgaca acacgactgc ataaatgacc agcatgaggg ccggtggtga      4260
     ggaaggcctt tcacatgttt ccctctgcaa ctggtatttg tgcacctgta aattatcaac      4320
     cggtcgagag agacgaagtc tgccacagag acaacagcac actctcgaag ttcgaacgtc      4380
     tcagtaattg caatctattg gaaaaaaata ccagtattga tgtctgcaga tattctgctg      4440
     ggtcatctca tcttttatga caaattttga ctctatctct tttgattcta ctcgtgttgg      4500
     tatgtatttt cttctttttt cttaacctgg aaacatataa atatacctct aaagaatctg      4560
     acgttgcaca ccaactgacg gaatactcca cggtcagttt ttatctttac aatctcggac      4620
     aacttgaatg agtgcaactc ttcagagaat catgtccgag aataacgcta ccttcagaga      4680
     gaaaggagag accgctacca gcttggaaac ttcaaacatt ccttcagcag gagaattgaa      4740
     agatcctggc agactcgaaa aggagcaaac tatttatgaa tttgagactg tgccagaaga      4800
     tgaggatgat agctacaaca aaataaaagt tccagatgga ggctatggct gggtggtggt      4860
     tttctcatcc ttcttgttaa acttctgcac ctctggtgcg tcgtatggtt acggtgttta      4920
     cttgtcatat tacatggata gtggaaaata cgaaactgga ggtaaactcg actatgctgc      4980
     cattggggga ttgagctttg gtgttggggt tcttttttct cccttgtaca actatatatt      5040
     gataaacact tcaccaagga agctcatttc gcttggaatc gtcattcaga atgttgccgc      5100
     gttactagct gccttttcta ccaaattatg gcaggtgtat ctgactcaag gtgtgttcat      5160
     ctcaataggt acaggcgcaa tatgctttcc aaacactaca atagccgcac catggtttag      5220
     gaagaaaaga tccctagctc tggggattac cgtggccggt acgggggttg gaggaatcgt      5280
     tttcaacctc tccacccaac gcattattga taattatgat tccaagtggg cgttgatttc      5340
     tcaatgtatc atatgctcag tgctgagtac tgtagcggtg cttttgatta gaaccagaag      5400
     agacgaggtt cagaagtatt ctgatacgcc cacaacagca gtggcgctgg atatgttcaa      5460
     gtacccagtg atatggttat tgatcctttg ggtgtgtttc accatgcttg gttatgttgt      5520
     tcaggtctat tctctgttct cgtttacgat ttctctcggc tacacttcca aacaagcctc      5580
     ggcggtgtcc tgtgttatat gtgtgggaat cattgttgga agacctcttg tgggacttgc      5640
     cgccgataag ttcggagcgg tgacaacagg gatgttctgc catctgattg tagctattct      5700
     gtgttatgga atgtggattc cgtgcagaaa ttacgcaaca gttgtcgtgt tcggtctctt      5760
     cgagggaatg ttgatgggat caatatggct actactcact tccataataa cacggttggt      5820
     cggtttgcca aaactagaag cggtgtattc ggtagtctgg atgtttcttg gagcgtgtgc      5880
     tattgtgtca cctgtgattg gtatttctct tgcaaagaac aatgttaagc caggggagaa      5940
     cgcctacttg tacacggcag tttactgtgg aacagcgtac ctgttggcag cgttagctct      6000
     ttggtgcatt cgcggtatta ttatcgcacg cgacaaagta agtttggttg aaaagactgg      6060
     ctacgatgat ggtgagctac atttgagggt aaaccttgtc gatgcgctga aaggaatggc      6120
     gcactacggc aagttatatc gaaaggtgtg agaaacttga cagtgttgtt ccaagacgtt      6180
     gtagagactt ttccagttag tcaagtattg gaagaatggc tgaatctagt gtagtccagg      6240
     agaaagtata tagcatctag tagttgaaca tcaaatccaa gcttataaac tgaggattct      6300
     ttgtcccctc tcccattcga tgttgataac ctattcgtta ttgatctaca ttaaccaatg      6360
     tgccaaatag aagaaaccaa agaaaacgtc gaagaagcat cgaatcacat ggtaaatatt      6420
     attcactaat aactctaacc tcgaatttaa tacccggagc tttccatcat tgcctaaaca      6480
     caaagctgaa atgacaggca tcagattttg ttctatcaac gaatcctttc ttaagagagt      6540
     agaaaaattg tcagataact gccaaatgct aaggccccat aataccaatt acaaaacgca      6600
     atgcttttgc cacaaaccga ttgcccattg cagaatacgg catcctcgac atctcttgtt      6660
     actgccccgg caatgatctg ttttactgca gaattgccca cagttgttga tcgctctttg      6720
     tttcaaacca cttggagtag ctactaatgt gtggggctcg gctatggttt ctgtaaagga      6780
     accatttaca ctagcttgta cctcctcgct ttcaataaaa ttagctacat taaagtgtta      6840
     gtgactagcg aaaaagtctg aagttgcagc aactgttgcg aacgattccc aactgtagaa      6900
     tgacccgttt tcgaagtatg cactcacatt caaaaagtac ccactactgt tgtcggcgga      6960
     tgagataacg gtgaatgtat cgccagctaa actttgatcg aacaaacgga aattcggaat      7020
     ggaactagca agtaataaac attccaagct gaccatcgta attgtgctat tggacttatt      7080
     tggttgcttg aatcagaaac tttcagcaat aaataattgt tgctggaaga gtttaagctt      7140
     caagttgtat tatcttggca tttttatatc tacgtacctt ttacatgtga ggaatgcggt      7200
     tttatcttgt agatgtctgt ttcacttacg ttgctgcata tattcgttcc ttacattttc      7260
     aatgcagtgc aaaaaatggc taacaataaa agcagaagat gaagaaaatt gaaaaagtca      7320
     aagataacga agctccggta tgtggctagt cagacctgtg cagaaccatg cagaccagtc      7380
     cagcgtttat tttcgtttcc tttttccctt ttttgcaaat tttgacgttg cctgtatctc      7440
     attccttcat gagctagcaa tagcaggtaa taacgtagaa tgttgaagtg aaggaagaag      7500
     ctgcggggaa agtgtgttca gcttttagac ttaattttca tggtactacg tgatctctgg      7560
     aggaaataat cctcaagctt ggtttttagg cactgcgaac ttgtcgctga gcataattca      7620
     acttaatcca tgttttctgg agcctttaac aataaatcct gattatgcac tgcttttcat      7680
     tccgtattag gtataatgat ttcgggtgtt ttgggatttt cactgatcat agctcttaga      7740
     cttaatattt tcgattgcct tgaggttcaa caaccagtat ttcttggtta tgatcccaca      7800
     gcctctgttt gagcaattat cttcgcgtga taacatgtat cggaggaagt agatcttttg      7860
     agaaaaaggc ttggcaccta cgctacctga tatacacaaa cagtaagcga tgatgacacg      7920
     tagcagttcc tttaatgtgg tccctggcac gaatgtgtac cggtgtcagg tatcaaacac      7980
     taaacactca ttcgtattta ccaaagatat aaaataggtg ttgtttactg gatctgtcgt      8040
     aatatcttta gctgtatatt cacttagtat tttttgatga tcggtttata tattatcatt      8100
     tagacttcgc tcagtataga taatctaata ccgccgccat gtacattagc ttggtttatt      8160
     tggaagtttt attgtccttt tcgctacttt ctccggctgc agccgctccg ctgcctgatg      8220
     caaactccac cgctgtcaac tcacttgaat tcgatatggt ttccaattcc acttcagttt      8280
     gtttcaattc cactaactat gccattgatg tttctgagct ccctcttcca gaatggttag      8340
     atgactggga ttctttatta cttgctatgc cgtgcggtga tgaaattttc gtttctgttc      8400
     caaaagatct ggacagcaac actacagcaa agatactggc ttattcttta gcttctggta      8460
     ttgcagtgga taattggaat agtgaactgc agaagagaga aaacattcag gcagatcttg      8520
     atgccttctg ggaaacaggc actgttgagc tagactcgct atcaattgta caaaattgat      8580
     tgcacaagaa tgttgtttct ttgcggttgt aggggtattt ctaaggcgtc atttagtgaa      8640
     ccattgctaa ataagaagtt gagctgagag caactaggat cagcatcaag gctacagtgt      8700
     ttggtgattg aaagcccaat ctgaaaagta tataagtaga tggtttcttc atccaatttt      8760
     tccatctgga tttgatgaca tattaattat tgttctacat taacttgtat gtcagatgta      8820
     agaaaccaag gagagcaccg taagtaattt acttaactag tcgatcacca atttaattat      8880
     ccatttattt cattaacaac tacaagtcag aatggcatcc aattacgtta atactactaa      8940
     ccctctaggc caagccccta ctaccaaaca tgatgaatat ccagtccaac attcctaaaa      9000
     taatagcagt gagaactgtc tgaaaaacag ctcttcgaat aacaaccgta acccgagaat      9060
     tcctcacatg aggggattaa cgcaaaccaa acgcctcatg aacatttgcc aaagtctaaa      9120
     gtcactaaaa atcgctacgt ggatttaata actgccatca gaaccaccat atgtgtggcc      9180
     tgagacaaat cttttcgtaa cttctcggat gaatctgatt atgaaatttt cacccaggca      9240
     aacgtttaac tcagagtctt agaagagggt gacttgaagc taaagtttgt ggccatagat      9300
     ttgactgtaa aggccctatt tgctccagat atagctcatt aattgataaa catcttagat      9360
     cttataggag cgggactatt ttacagtttc gacacaccgt gcctgttctc agagaatggt      9420
     ggctctatcg caaaaattta cagttcttcg acacatttcc ggattccaat aaacatgtgt      9480
     caaaacctga agcaagaatg ccttgttcag tctcagttcg gccgcaccag aaacgtcctg      9540
     tcgcttcaag acatttaaat agatagggtt tatgagtgtt gttccctggc gttgtaggag      9600
     cacttctaag gcgccagtta ttgaaccaat gctaaataag aagctgaagc tgggatgaac      9660
     taggatcaag tatagagcac actttttgat tggcaagcca atccaagaag tatacaagtg      9720
     gaaggcttct taatccaatt tctccaattg tatttgacaa cgtatcgatt acttttctag      9780
     tcaaagttat gtgtcactca gaagaaagca aggaggacac ggatttttga ctgaaatgta      9840
     tttatattat ctaggtcatg gtcgcgaaag agtttataca taaatgctta ctcagtaagc      9900
     tttgaagaac aaaaaactgg atacatctct gtaaatgaga agaacgaatg cagagcatgc      9960
     gattgatcct tttatagggt atgagaaatg ctatgatgct agcatggtgt tagtagatcg     10020
     gcagtgtgct ggtgatgtca gtaatgcaaa ataacataac atgtaatact tattcgttgc     10080
     agctatcttt ttttgttaga cttatttgtt actaacagga ccattgtact ccacttcatt     10140
     gtagtcccag tagaaagtaa gttcggtgat gttagacacc tgttggattt cgcaactgga     10200
     aacatagtca attccattca atctgtctgc gatgtaatcg tcaaagtcct cgataggaca     10260
     ggagaaccct ggacctgagg tgcaacctgg aactggaata acaacatcgt taacaatgta     10320
     acgaacataa gaggaatttc tacattttaa tttttcagtg aagatacgac ctcccatagg     10380
     cgtcacccag cttagcttct ggatatcctg gaactcaacc tgttccagag agtattcagt     10440
     gacaccattg tcgaaaaggc caagtgccga aacgaattgt tgaatatcgg tatcatgaga     10500
     aaaagaaagc cagaccttat tatccaaatc atcagcttgt gtgaaaagat tgtaagaagc     10560
     gttgagtaac actgaaccaa ttggtttaac cagagggttg cctaaacctc tgccatagaa     10620
     atttgtaaca tcagaatagt acgagtaggc aatcaaatca ttgcgctcaa agagatcaca     10680
     aacggtagaa ctacccttaa tatttgttac aaatgcacac cagtctacca acagttctat     10740
     gtcatcttgc tccaaagtta gattcaagtt ggagttcttt ttcatccatc tgtttttgat     10800
     atcagttaag taagatagtg taacattttc gaagtactcg tcaccaaggt cgccattgta     10860
     ggaaacacaa gaatcaccag gggtaagaga gtttgcgccg gctgtttcat tttcttgaat     10920
     aatttgaaga tcaagttgaa cattaagctc ttcttccaac gcagaaactg cgtatttagc     10980
     agtttgatag actctcccag aactagatgt aaaaactggt gtatagttac cgaaaagttc     11040
     cccgtagttg aaagcaatgt attttcccaa aatttcagcg gtttttgatc ccatataagg     11100
     attggaaggg tcaacatcgg aagaattggt taattgatca aaatatttgg tatctgacac     11160
     aaaaaactca taatcattga aaatttccaa aggaccgtcg aattgaccct ggaacacctt     11220
     taatttgtcc catagtgcga tcatcagttt accttttgac gcggttggat atctctctcc     11280
     atgtcttgcc aacatttgga catgttcaac ggtacactgg tccggaactt ctaccggaat     11340
     tccaaaggat tgtgggtaat cgtagtgagg accctgacca ttcaaaaacg gaaagatgga     11400
     tgcatctgct gtactgcttt tgagtgcata gcagactgta ccgttatcct ttgaaatagg     11460
     agccgcatgg atcgatgata gtgataagaa agtcaccaga atggaaagca tcttatccta     11520
     ggcttggcga ttttgatttt ttgaatcttc ctttgctttt tagcttaaaa tactcccatt     11580
     cactattatg acgaagaact tcctagggag ctcatctcat cgcgtactgt tgtctttctt     11640
     ttataactca attgtatggc agttcacata tttgagttga acattgtggc gtgctacacg     11700
     tgcaagtatg ttgaagaatc attgagctta ttctccaaaa gtttgcagtt tctattcagt     11760
     atttcagtgt atattcaaat gtcattgaga gtttagtgct acttttacaa ccatcactgt     11820
     cgtaaccaat atgacaaaaa aaaaaaacat ctacatcagt gccttcttga tctgtgttca     11880
     cccacctact tttttcgcta tgcaccaatc cgcagatatt gacacttatg actgcacgtg     11940
     tgtcaaatat ggttgaaaaa aactgagaaa cagcagtttc ggcatttaat agttcagttt     12000
     aattactcct cttgaaagga aaatacatga ttaccattca tattttcggt ctaactgctg     12060
     atgtgttagt agaaacttgt ttgtttctac tcttcagtgc ttctcttctg caggaaaact     12120
     gctcaatgaa agatgaaaca cttcaaatta cacactggca atttattaag gttatgtatg     12180
     cattatttaa ggtttaaaac aaagtcatga tagaagaaag gctagaacta aaatttgggg     12240
     acaagactac actcaaatag caggagcagc cgaaaaatat agctctgaag tcttgtgttt     12300
     tcgtcagtag gtgcttgtct tttgaaattg ggtttattgc ctcttttgtc aaacgctaaa     12360
     gcttattatt tagaactgcg aatataacct cataatctgg aacattctga acggaatgag     12420
     tgattaacgg attaaggtgt tctagcgaga gttgtgaatt gatgctcctt ttattattca     12480
     ctttctgttc ttttcttgaa aagacacaag gtagaaacct gacgataatt attaaagtcc     12540
     tttaccaact atagacagat gggtactctc acctcaccta cggtttactg caaattagag     12600
     cattgtgcaa gttcttcaac ttcacttcat ttataggatg ctgttaaaga cactatgacg     12660
     aactgatcat caagataatg gcaccgtacg cgatctaacc gtagttacga caatagaggt     12720
     ttgcgttgac actacggaat ttacgttcct gtgacctcgt ggtagatagt tacactgatg     12780
     cagttcgcat taatacaaaa aatgtatcac ggacgcagca agaagtttgc aatagaatgg     12840
     gaaaactcat gatgaaacga acctcttata attctcttca tggttatttt aggaatcaag     12900
     taaaacttgc tctgcatcat gaccaacctc atccgccata ttcttaagaa atgttgaaca     12960
     acagctattg gagtccatgg tgctcaattc cacgaattta ttatcatacc tccattgtga     13020
     gtgtgagcaa catattatga tcactagaca ttaattattt aataattatt aacagttttt     13080
     aagtggagtt ctttcttatg tcttcttttc taaattttgt ttcgaacatc ttttctggtg     13140
     atttaacaca agctacacag tctcggttaa tcccttatta ttccttctgt ggcttgttat     13200
     ttactctcat gcgtgatgtt tatgcataaa ttttatcata tatcgacgca ataaacatta     13260
     aaatcacgtg cttctttggt aacgcaatga aggaaccttg aaacagccag cttagtcatg     13320
     atgccaatta cgctacattg aatcctgcta tgtgggaatg gatgatattc agaatttgtg     13380
     gtaggagttt gacttattaa gcatattatt tataatgttc tccttagttt cttctgtcag     13440
     gcggacacat taatgtagaa caacactaaa tatgatgtca gatccaatgg ggaaattggt     13500
     tgaggaaacc ttctacttat ataattttga attagcttct caatcgccga acgctgcgat     13560
     cttgatccaa gttcggcaca ggttcagctt aacggtaagc aatgattcca tgaatggcct     13620
     tggaagttcc cttacaccac cattaacaac aaacgtttta aaaattaagt aaccagacat     13680
     tgttattcat gttcaatttt cataagattt tcttcttatt agcgctctcg ttttatgaca     13740
     acactcagat actttttcgt ttcatcacta attaacaata cggtctacta tgcagtagaa     13800
     gttttcaaca aaatatttct gccggaacta aaatgcttgt tgagggaaag tactgacatg     13860
     aaaagcactt tatttagtaa ggttttatgc attcgttcct ctttgtataa gatatatttt     13920
     taataactga tcggtatagt aacgtctgct ttttgtgttt ttgttcatag aaggtaccat     13980
     ggagtgactc ggtacattaa acttgtagct ggctgattat tatgcgacaa aatctttaga     14040
     agtctgaaaa attcccttcg aaacagcaaa attgatagct ccccaattgg tatgctgaag     14100
     tatttattaa acatttcctt gtgatttcat ggaagaaatg ttcagaggcc attagcagtc     14160
     ataaagtgtg tcgataaaaa gctatataaa actagacact aagtaaaaaa ttgaggtaaa     14220
     aatccccttg attcaatcaa gcagcaaagt gcttcaagat atcttcagca gccttgatac     14280
     cactaacagc catagcaccg aaagttggac ccattctatt caaaccagca tgttcagcaa     14340
     cttccatacc agcaaagtaa actgaaccaa ccttatcgta tgcaccagcg ttcttaacaa     14400
     cagcgtcttc agctctgttc atgtccaaac ccttcatacc agcgtaggac ttagaggaat     14460
     cgatggaagc catacgttta acagtgaaag caccaaatgg accatcgtga ccacaacaag     14520
     acaagataac accatgcttc tgtgataaat ccctttcgcc attatccttg taaccagaca     14580
     attcgatgac gtttggatcc atacaagatt gggtgtcgtg attttgagtg actagagtcc     14640
     agttagtaac aacaccagcg acgttgacgt gctgagaatt atcatcggct ggtctggtga     14700
     caagatcttc aactgcagta gcattgaaca tcttcacgtt agggaacttc aatacttcac     14760
     tcaatacagt agacatgaac aaagcagcgt gtttaacaac aacgtaatga ccctcatctt     14820
     catatggaat gttcaattcg tccaagaatt tgtctgctgg tttacgcatg atcatggcag     14880
     agaacaattg acctcctaac caacatccac cacctggagc aacgttggct tcaataatgg     14940
     caattttcaa gtcaggtctg ttcttagcaa tgacgtatgc agcagataga ccacttgaac     15000
     ctgcaccaat gataacaaca tcggatacgg cgaacttgtc caaatctttg aaataacgag     15060
     aggtcattgc acgagaaaca gttgcttccc taattggagc aaatgcaaag tctgaccagt     15120
     cgtcttgttt gacaacatca gacaaacagt gttcgacact ttgagattgg actgatagtt     15180
     tgttttgagt ttgagtttgg gtggtagaca tttttgttct gttgttgcta cttgtaaagt     15240
     atcctttgaa tttagctgct actgttctac agcgagaatc attgatataa cacaaatata     15300
     ataccagaag gttaaaaggg aaaaggttga aagagtgggc ctttttataa ttttagttct     15360
     ctaactagaa tgctcactgc ctcttaaact tcgaacaaag accgtggttt cacgaggctt     15420
     atcgtcaccc acaacgttgg ttggacatga acctgttagc attccatacc atattacttt     15480
     gccttttttt tttttactgt taaaactaat ttccttaatg tctgtaccct tactccgtta     15540
     ttatacgaat aagcgtcagt taggaatatc ttgttaacag tgatagagat atccgccaag     15600
     gttccatgaa aattggctga ttaccaaatc gagagtaaac gggaaagata atcgttcgtt     15660
     tccaaaagaa aaatgccccc aaacgttctc tttaacacat cagttgatcg ctcagtagat     15720
     tttgtccttt ttgtgagtat taactcttgg cctttagttg aatttctacc ctttctatcg     15780
     ctgcatataa aaaaaatact gttttccaga gtaactctta gaacaggcga cagttttttt     15840
     tttgttcttt tccaacatta cctgcatccc acacaatttc cttaagggac ataattgctg     15900
     acgagagcat cgtaaattaa catatacctg tgtgtatggt ctggcgtttg tcgatagaag     15960
     acctcattgg ctgccattat ttgcaatttg aggtatgaac cgaaaacgaa ggtttttagc     16020
     tcatcgttgg cgaaaaaacg tcagtttagg gtgcaaaaag taaacttggt tggaaagaga     16080
     tacaggtagc ccaagataga tgacgcagta gtacaagatt tctgaattga aatctacatt     16140
     tccggtccat tgaaagagtt gtttgaattt atttcgtgtt aagatgtggt agcctttctt     16200
     ccttcatttt cagtacatag atacgtgaaa ggcgattgga actatccacc agatcaaatt     16260
     cggttatcct atccttagaa ttggcactga catgccaact tctatgaatc aagaattact     16320
     tttatttttt ggtactctag gtgggaaagg cacgcattga ttcacaatag agtgtccaac     16380
     ggtttgagac attttgggtt ggctgtttcg acatccaact agaaataaat cacgttttgg     16440
     ttatttaagt gaagacaata ctttgccagt taaaatgcat aagcctgtga cttgaaattc     16500
     taatatttga gagattgtga agtgtcaccg gctttgggcg gttggttctc ttccttagaa     16560
     tacttaccaa aggggtcttt tttacgatgt cgttcattgt attgcattgt ttttttgacc     16620
     tcagcgcata cccataatat cattcgtcaa caataaagtc taaaaaatat taaaacagtg     16680
     aggcatatca gattataggt ataatgtagg ctccttaagt ttaaacaagg ttgtacctac     16740
     ttttcaggct gaacatacca gcatcgctcg aaggaaacgt tgtagatata gtcatatgct     16800
     gctaaggtga attgcaaaag caaaaccgta gatcttatct ttgaacccta tgaacggaag     16860
     acatgcagtg ctggtcatga gaacagacat gtccaagttt cttaatatgc atcaaataag     16920
     tacgttttta ccagtccatc attcaagtac tagtacatac ccttttgctt ctgctatgct     16980
     atcctatcag agcattcatt tatagcttag gatgatgaaa ttttgttcaa gaatgcttaa     17040
     tttttgcctt tttgtacctc gtctctcaaa actcaagaat cataagttct ttgtttgata     17100
     aatgctgctt gaaataatac cccgcgagta atatacgtgc cgttactaga agaaattata     17160
     tcaccattca cacttatatt cttttcatta agattactta cttaacttac ttatttagtg     17220
     aagatcaacg ttgtaaacag attcaaacca ccgttcatca agatcagatc gcaaattaat     17280
     tatcatgaca agtcttacga gaaatttaga gcttgtcaag atacaaaatc ggcgttggca     17340
     tatcgtaatg agatatatct ttttgatgat gatgcttctt caacgaaaac aagcgatcct     17400
     acgtatcgca tgagttgttt ttttttatcg ttttccaact aaaccctttt ttttttaggt     17460
     ttttagtatt cccattctac ctttcaacac gtcacttgat cattctaagg ttgcctctta     17520
     agctaacgct aagagtctat tctttctcag aaatcctaaa gcaaaactga gccaagacaa     17580
     tatgtttgaa ctatatagcc ctgtcaagat cctcgcatct gttgcaacaa cactttcatt     17640
     tggatactca tcaggtttgg tgaccagaac cagcgttaac acatggtacc ctactctcat     17700
     taaaccatgg tttacaccac caaacaagct tttcccaatt gcttggtcat