(data stored in ACNUC27125 zone)

EMBL: CR382131

ID   CR382131; SV 1; linear; genomic DNA; STD; FUN; 4224103 BP.
XX
AC   CR382131;
XX
PR   Project:PRJNA13837;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 14)
XX
DE   Yarrowia lipolytica CLIB122 chromosome E complete sequence
XX
KW   complete genome.
XX
OS   Yarrowia lipolytica CLIB122
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Dipodascaceae; Yarrowia.
XX
RN   [1]
RP   1-4224103
RA   Genoscope - CEA;
RT   ;
RL   Submitted (09-SEP-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-4224103
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
DR   MD5; b701b8d178eacb2624182b9644715486.
DR   BioSample; SAMEA3138171.
DR   EnsemblGenomes-Gn; EFYLIG00000000001.
DR   EnsemblGenomes-Gn; EFYLIG00000000006.
DR   EnsemblGenomes-Gn; EFYLIG00000000007.
DR   EnsemblGenomes-Gn; EFYLIG00000000012.
DR   EnsemblGenomes-Gn; EFYLIG00000000018.
DR   EnsemblGenomes-Gn; EFYLIG00000000022.
DR   EnsemblGenomes-Gn; EFYLIG00000000049.
DR   EnsemblGenomes-Gn; EFYLIG00000000050.
DR   EnsemblGenomes-Gn; EFYLIG00000000054.
DR   EnsemblGenomes-Gn; EFYLIG00000000056.
DR   EnsemblGenomes-Gn; EFYLIG00000000059.
DR   EnsemblGenomes-Gn; EFYLIG00000000065.
DR   EnsemblGenomes-Gn; EFYLIG00000000066.
DR   EnsemblGenomes-Gn; EFYLIG00000000067.
DR   EnsemblGenomes-Gn; EFYLIG00000000074.
DR   EnsemblGenomes-Gn; EFYLIG00000000085.
DR   EnsemblGenomes-Gn; EFYLIG00000000092.
DR   EnsemblGenomes-Gn; EFYLIG00000000103.
DR   EnsemblGenomes-Gn; EFYLIG00000000124.
DR   EnsemblGenomes-Gn; EFYLIG00000000131.
DR   EnsemblGenomes-Gn; EFYLIG00000000132.
DR   EnsemblGenomes-Gn; EFYLIG00000000133.
DR   EnsemblGenomes-Gn; EFYLIG00000000137.
DR   EnsemblGenomes-Gn; EFYLIG00000000146.
DR   EnsemblGenomes-Gn; EFYLIG00000000159.
DR   EnsemblGenomes-Gn; EFYLIG00000000164.
DR   EnsemblGenomes-Gn; EFYLIG00000000167.
DR   EnsemblGenomes-Gn; EFYLIG00000000168.
DR   EnsemblGenomes-Gn; EFYLIG00000000169.
DR   EnsemblGenomes-Gn; EFYLIG00000000175.
DR   EnsemblGenomes-Gn; EFYLIG00000000179.
DR   EnsemblGenomes-Gn; EFYLIG00000000203.
DR   EnsemblGenomes-Gn; EFYLIG00000000214.
DR   EnsemblGenomes-Gn; EFYLIG00000000220.
DR   EnsemblGenomes-Gn; EFYLIG00000000247.
DR   EnsemblGenomes-Gn; EFYLIG00000000248.
DR   EnsemblGenomes-Gn; EFYLIG00000000249.
DR   EnsemblGenomes-Gn; EFYLIG00000000250.
DR   EnsemblGenomes-Gn; EFYLIG00000000254.
DR   EnsemblGenomes-Gn; EFYLIG00000000257.
DR   EnsemblGenomes-Gn; EFYLIG00000000271.
DR   EnsemblGenomes-Gn; EFYLIG00000000272.
DR   EnsemblGenomes-Gn; EFYLIG00000000281.
DR   EnsemblGenomes-Gn; EFYLIG00000000286.
DR   EnsemblGenomes-Gn; EFYLIG00000000287.
DR   EnsemblGenomes-Gn; EFYLIG00000000305.
DR   EnsemblGenomes-Gn; EFYLIG00000000308.
DR   EnsemblGenomes-Gn; EFYLIG00000000312.
DR   EnsemblGenomes-Gn; EFYLIG00000000313.
DR   EnsemblGenomes-Gn; EFYLIG00000000316.
DR   EnsemblGenomes-Gn; EFYLIG00000000329.
DR   EnsemblGenomes-Gn; EFYLIG00000000338.
DR   EnsemblGenomes-Gn; EFYLIG00000000339.
DR   EnsemblGenomes-Gn; EFYLIG00000000344.
DR   EnsemblGenomes-Gn; EFYLIG00000000345.
DR   EnsemblGenomes-Gn; EFYLIG00000000349.
DR   EnsemblGenomes-Gn; EFYLIG00000000355.
DR   EnsemblGenomes-Gn; EFYLIG00000000358.
DR   EnsemblGenomes-Gn; EFYLIG00000000373.
DR   EnsemblGenomes-Gn; EFYLIG00000000380.
DR   EnsemblGenomes-Gn; EFYLIG00000000385.
DR   EnsemblGenomes-Gn; EFYLIG00000000386.
DR   EnsemblGenomes-Gn; EFYLIG00000000402.
DR   EnsemblGenomes-Gn; EFYLIG00000000418.
DR   EnsemblGenomes-Gn; EFYLIG00000000422.
DR   EnsemblGenomes-Gn; EFYLIG00000000423.
DR   EnsemblGenomes-Gn; EFYLIG00000000427.
DR   EnsemblGenomes-Gn; EFYLIG00000000431.
DR   EnsemblGenomes-Gn; EFYLIG00000000432.
DR   EnsemblGenomes-Gn; EFYLIG00000000433.
DR   EnsemblGenomes-Gn; EFYLIG00000000435.
DR   EnsemblGenomes-Gn; EFYLIG00000000443.
DR   EnsemblGenomes-Gn; EFYLIG00000000445.
DR   EnsemblGenomes-Gn; EFYLIG00000000446.
DR   EnsemblGenomes-Gn; EFYLIG00000000467.
DR   EnsemblGenomes-Gn; EFYLIG00000000471.
DR   EnsemblGenomes-Gn; EFYLIG00000000495.
DR   EnsemblGenomes-Gn; EFYLIG00000000496.
DR   EnsemblGenomes-Gn; EFYLIG00000000500.
DR   EnsemblGenomes-Gn; EFYLIG00000000503.
DR   EnsemblGenomes-Gn; EFYLIG00000000505.
DR   EnsemblGenomes-Gn; EFYLIG00000000515.
DR   EnsemblGenomes-Gn; EFYLIG00000000525.
DR   EnsemblGenomes-Gn; EFYLIG00000000527.
DR   EnsemblGenomes-Gn; EFYLIG00000000530.
DR   EnsemblGenomes-Gn; EFYLIG00000000533.
DR   EnsemblGenomes-Gn; EFYLIG00000000540.
DR   EnsemblGenomes-Gn; EFYLIG00000000547.
DR   EnsemblGenomes-Gn; EFYLIG00000000548.
DR   EnsemblGenomes-Gn; EFYLIG00000000555.
DR   EnsemblGenomes-Gn; EFYLIG00000000558.
DR   EnsemblGenomes-Gn; EFYLIG00000000561.
DR   EnsemblGenomes-Gn; EFYLIG00000000562.
DR   EnsemblGenomes-Gn; EFYLIG00000000567.
DR   EnsemblGenomes-Gn; EFYLIG00000000579.
DR   EnsemblGenomes-Gn; EFYLIG00000000584.
DR   EnsemblGenomes-Gn; EFYLIG00000000589.
DR   EnsemblGenomes-Gn; EFYLIG00000000592.
DR   EnsemblGenomes-Gn; EFYLIG00000000593.
DR   EnsemblGenomes-Gn; EFYLIG00000000610.
DR   EnsemblGenomes-Gn; EFYLIG00000000611.
DR   EnsemblGenomes-Gn; EFYLIG00000000614.
DR   EnsemblGenomes-Gn; EFYLIG00000000624.
DR   EnsemblGenomes-Gn; EFYLIG00000000630.
DR   EnsemblGenomes-Gn; EFYLIG00000000635.
DR   EnsemblGenomes-Gn; EFYLIG00000000649.
DR   EnsemblGenomes-Gn; EFYLIG00000000652.
DR   EnsemblGenomes-Gn; ENSRNA049654323.
DR   EnsemblGenomes-Gn; ENSRNA049654345.
DR   EnsemblGenomes-Gn; ENSRNA049654366.
DR   EnsemblGenomes-Gn; ENSRNA049654383.
DR   EnsemblGenomes-Gn; ENSRNA049654397.
DR   EnsemblGenomes-Gn; ENSRNA049654411.
DR   EnsemblGenomes-Gn; ENSRNA049654433.
DR   EnsemblGenomes-Gn; ENSRNA049654450.
DR   EnsemblGenomes-Gn; ENSRNA049654471.
DR   EnsemblGenomes-Gn; ENSRNA049654483.
DR   EnsemblGenomes-Gn; ENSRNA049654504.
DR   EnsemblGenomes-Gn; ENSRNA049654521.
DR   EnsemblGenomes-Gn; ENSRNA049654533.
DR   EnsemblGenomes-Gn; ENSRNA049654556.
DR   EnsemblGenomes-Gn; ENSRNA049654570.
DR   EnsemblGenomes-Gn; ENSRNA049654585.
DR   EnsemblGenomes-Gn; ENSRNA049654596.
DR   EnsemblGenomes-Gn; ENSRNA049654621.
DR   EnsemblGenomes-Gn; ENSRNA049654637.
DR   EnsemblGenomes-Gn; ENSRNA049654656.
DR   EnsemblGenomes-Gn; ENSRNA049654679.
DR   EnsemblGenomes-Gn; ENSRNA049654704.
DR   EnsemblGenomes-Gn; ENSRNA049654720.
DR   EnsemblGenomes-Gn; ENSRNA049654742.
DR   EnsemblGenomes-Gn; ENSRNA049654752.
DR   EnsemblGenomes-Gn; ENSRNA049654771.
DR   EnsemblGenomes-Gn; ENSRNA049654781.
DR   EnsemblGenomes-Gn; ENSRNA049654795.
DR   EnsemblGenomes-Gn; ENSRNA049654807.
DR   EnsemblGenomes-Gn; ENSRNA049654818.
DR   EnsemblGenomes-Gn; ENSRNA049654832.
DR   EnsemblGenomes-Gn; ENSRNA049654849.
DR   EnsemblGenomes-Gn; ENSRNA049654862.
DR   EnsemblGenomes-Gn; ENSRNA049654878.
DR   EnsemblGenomes-Gn; ENSRNA049654897.
DR   EnsemblGenomes-Gn; ENSRNA049654905.
DR   EnsemblGenomes-Gn; ENSRNA049654930.
DR   EnsemblGenomes-Gn; ENSRNA049654943.
DR   EnsemblGenomes-Gn; ENSRNA049654950.
DR   EnsemblGenomes-Gn; ENSRNA049654967.
DR   EnsemblGenomes-Gn; ENSRNA049654978.
DR   EnsemblGenomes-Gn; ENSRNA049654996.
DR   EnsemblGenomes-Gn; ENSRNA049655003.
DR   EnsemblGenomes-Gn; ENSRNA049655020.
DR   EnsemblGenomes-Gn; ENSRNA049655036.
DR   EnsemblGenomes-Gn; ENSRNA049655047.
DR   EnsemblGenomes-Gn; ENSRNA049655062.
DR   EnsemblGenomes-Gn; ENSRNA049655077.
DR   EnsemblGenomes-Gn; ENSRNA049655086.
DR   EnsemblGenomes-Gn; ENSRNA049655105.
DR   EnsemblGenomes-Gn; ENSRNA049655116.
DR   EnsemblGenomes-Gn; ENSRNA049655132.
DR   EnsemblGenomes-Gn; ENSRNA049655143.
DR   EnsemblGenomes-Gn; ENSRNA049655155.
DR   EnsemblGenomes-Gn; ENSRNA049655168.
DR   EnsemblGenomes-Gn; ENSRNA049655180.
DR   EnsemblGenomes-Gn; ENSRNA049655195.
DR   EnsemblGenomes-Gn; ENSRNA049655212.
DR   EnsemblGenomes-Gn; ENSRNA049655234.
DR   EnsemblGenomes-Gn; ENSRNA049655246.
DR   EnsemblGenomes-Gn; ENSRNA049655252.
DR   EnsemblGenomes-Gn; ENSRNA049655262.
DR   EnsemblGenomes-Gn; ENSRNA049655278.
DR   EnsemblGenomes-Gn; ENSRNA049655297.
DR   EnsemblGenomes-Gn; ENSRNA049655310.
DR   EnsemblGenomes-Gn; ENSRNA049655324.
DR   EnsemblGenomes-Gn; ENSRNA049655335.
DR   EnsemblGenomes-Gn; ENSRNA049655344.
DR   EnsemblGenomes-Gn; ENSRNA049655360.
DR   EnsemblGenomes-Gn; ENSRNA049655374.
DR   EnsemblGenomes-Gn; ENSRNA049655385.
DR   EnsemblGenomes-Gn; ENSRNA049655403.
DR   EnsemblGenomes-Gn; ENSRNA049655416.
DR   EnsemblGenomes-Gn; ENSRNA049655422.
DR   EnsemblGenomes-Gn; ENSRNA049655432.
DR   EnsemblGenomes-Gn; ENSRNA049655442.
DR   EnsemblGenomes-Gn; ENSRNA049655453.
DR   EnsemblGenomes-Gn; ENSRNA049655459.
DR   EnsemblGenomes-Gn; ENSRNA049655470.
DR   EnsemblGenomes-Gn; ENSRNA049655479.
DR   EnsemblGenomes-Gn; ENSRNA049655494.
DR   EnsemblGenomes-Gn; ENSRNA049655499.
DR   EnsemblGenomes-Gn; ENSRNA049671263.
DR   EnsemblGenomes-Gn; ENSRNA049671276.
DR   EnsemblGenomes-Gn; ENSRNA049671295.
DR   EnsemblGenomes-Gn; ENSRNA049671322.
DR   EnsemblGenomes-Gn; ENSRNA049671339.
DR   EnsemblGenomes-Gn; ENSRNA049671370.
DR   EnsemblGenomes-Gn; ENSRNA049671388.
DR   EnsemblGenomes-Gn; ENSRNA049671416.
DR   EnsemblGenomes-Gn; ENSRNA049671430.
DR   EnsemblGenomes-Gn; ENSRNA049671458.
DR   EnsemblGenomes-Gn; ENSRNA049671477.
DR   EnsemblGenomes-Gn; ENSRNA049671494.
DR   EnsemblGenomes-Gn; ENSRNA049671515.
DR   EnsemblGenomes-Gn; ENSRNA049671531.
DR   EnsemblGenomes-Gn; ENSRNA049671556.
DR   EnsemblGenomes-Gn; ENSRNA049671572.
DR   EnsemblGenomes-Gn; ENSRNA049671598.
DR   EnsemblGenomes-Gn; ENSRNA049671622.
DR   EnsemblGenomes-Gn; ENSRNA049671666.
DR   EnsemblGenomes-Gn; YALI0_E00352r.
DR   EnsemblGenomes-Gn; YALI0_E00374r.
DR   EnsemblGenomes-Gn; YALI0_E00440r.
DR   EnsemblGenomes-Gn; YALI0_E01342r.
DR   EnsemblGenomes-Gn; YALI0_E01422r.
DR   EnsemblGenomes-Gn; YALI0_E01716r.
DR   EnsemblGenomes-Gn; YALI0_E02464r.
DR   EnsemblGenomes-Gn; YALI0_E02926r.
DR   EnsemblGenomes-Gn; YALI0_E02970r.
DR   EnsemblGenomes-Gn; YALI0_E03652r.
DR   EnsemblGenomes-Gn; YALI0_E04895r.
DR   EnsemblGenomes-Gn; YALI0_E06259r.
DR   EnsemblGenomes-Gn; YALI0_E06303r.
DR   EnsemblGenomes-Gn; YALI0_E06963r.
DR   EnsemblGenomes-Gn; YALI0_E07007r.
DR   EnsemblGenomes-Gn; YALI0_E07227r.
DR   EnsemblGenomes-Gn; YALI0_E07348r.
DR   EnsemblGenomes-Gn; YALI0_E07359r.
DR   EnsemblGenomes-Gn; YALI0_E07403r.
DR   EnsemblGenomes-Gn; YALI0_E07755r.
DR   EnsemblGenomes-Gn; YALI0_E07854r.
DR   EnsemblGenomes-Gn; YALI0_E08107r.
DR   EnsemblGenomes-Gn; YALI0_E08118r.
DR   EnsemblGenomes-Gn; YALI0_E08272r.
DR   EnsemblGenomes-Gn; YALI0_E08404r.
DR   EnsemblGenomes-Gn; YALI0_E08668r.
DR   EnsemblGenomes-Gn; YALI0_E08712r.
DR   EnsemblGenomes-Gn; YALI0_E08778r.
DR   EnsemblGenomes-Gn; YALI0_E10945r.
DR   EnsemblGenomes-Gn; YALI0_E10967r.
DR   EnsemblGenomes-Gn; YALI0_E11231r.
DR   EnsemblGenomes-Gn; YALI0_E11275r.
DR   EnsemblGenomes-Gn; YALI0_E11506r.
DR   EnsemblGenomes-Gn; YALI0_E11759r.
DR   EnsemblGenomes-Gn; YALI0_E12265r.
DR   EnsemblGenomes-Gn; YALI0_E12749r.
DR   EnsemblGenomes-Gn; YALI0_E12793r.
DR   EnsemblGenomes-Gn; YALI0_E12815r.
DR   EnsemblGenomes-Gn; YALI0_E12903r.
DR   EnsemblGenomes-Gn; YALI0_E13816r.
DR   EnsemblGenomes-Gn; YALI0_E14245r.
DR   EnsemblGenomes-Gn; YALI0_E14278r.
DR   EnsemblGenomes-Gn; YALI0_E14421r.
DR   EnsemblGenomes-Gn; YALI0_E14531r.
DR   EnsemblGenomes-Gn; YALI0_E14861r.
DR   EnsemblGenomes-Gn; YALI0_E14883r.
DR   EnsemblGenomes-Gn; YALI0_E15950r.
DR   EnsemblGenomes-Gn; YALI0_E16082r.
DR   EnsemblGenomes-Gn; YALI0_E17039r.
DR   EnsemblGenomes-Gn; YALI0_E17237r.
DR   EnsemblGenomes-Gn; YALI0_E17501r.
DR   EnsemblGenomes-Gn; YALI0_E17603r.
DR   EnsemblGenomes-Gn; YALI0_E18370r.
DR   EnsemblGenomes-Gn; YALI0_E19096r.
DR   EnsemblGenomes-Gn; YALI0_E19173r.
DR   EnsemblGenomes-Gn; YALI0_E19316r.
DR   EnsemblGenomes-Gn; YALI0_E19833r.
DR   EnsemblGenomes-Gn; YALI0_E19844r.
DR   EnsemblGenomes-Gn; YALI0_E19855r.
DR   EnsemblGenomes-Gn; YALI0_E20075r.
DR   EnsemblGenomes-Gn; YALI0_E20317r.
DR   EnsemblGenomes-Gn; YALI0_E21263r.
DR   EnsemblGenomes-Gn; YALI0_E21461r.
DR   EnsemblGenomes-Gn; YALI0_E21714r.
DR   EnsemblGenomes-Gn; YALI0_E22110r.
DR   EnsemblGenomes-Gn; YALI0_E22154r.
DR   EnsemblGenomes-Gn; YALI0_E22308r.
DR   EnsemblGenomes-Gn; YALI0_E22528r.
DR   EnsemblGenomes-Gn; YALI0_E22693r.
DR   EnsemblGenomes-Gn; YALI0_E23485r.
DR   EnsemblGenomes-Gn; YALI0_E23837r.
DR   EnsemblGenomes-Gn; YALI0_E23881r.
DR   EnsemblGenomes-Gn; YALI0_E24112r.
DR   EnsemblGenomes-Gn; YALI0_E24871r.
DR   EnsemblGenomes-Gn; YALI0_E25157r.
DR   EnsemblGenomes-Gn; YALI0_E25234r.
DR   EnsemblGenomes-Gn; YALI0_E25245r.
DR   EnsemblGenomes-Gn; YALI0_E25289r.
DR   EnsemblGenomes-Gn; YALI0_E25311r.
DR   EnsemblGenomes-Gn; YALI0_E25355r.
DR   EnsemblGenomes-Gn; YALI0_E25377r.
DR   EnsemblGenomes-Gn; YALI0_E25465r.
DR   EnsemblGenomes-Gn; YALI0_E25509r.
DR   EnsemblGenomes-Gn; YALI0_E25520r.
DR   EnsemblGenomes-Gn; YALI0_E25564r.
DR   EnsemblGenomes-Gn; YALI0_E26103r.
DR   EnsemblGenomes-Gn; YALI0_E26213r.
DR   EnsemblGenomes-Gn; YALI0_E26400r.
DR   EnsemblGenomes-Gn; YALI0_E26411r.
DR   EnsemblGenomes-Gn; YALI0_E26675r.
DR   EnsemblGenomes-Gn; YALI0_E27318r.
DR   EnsemblGenomes-Gn; YALI0_E27324r.
DR   EnsemblGenomes-Gn; YALI0_E27610r.
DR   EnsemblGenomes-Gn; YALI0_E28028r.
DR   EnsemblGenomes-Gn; YALI0_E28072r.
DR   EnsemblGenomes-Gn; YALI0_E28116r.
DR   EnsemblGenomes-Gn; YALI0_E28682r.
DR   EnsemblGenomes-Gn; YALI0_E28765r.
DR   EnsemblGenomes-Gn; YALI0_E29799r.
DR   EnsemblGenomes-Gn; YALI0_E29821r.
DR   EnsemblGenomes-Gn; YALI0_E30041r.
DR   EnsemblGenomes-Gn; YALI0_E30195r.
DR   EnsemblGenomes-Gn; YALI0_E30239r.
DR   EnsemblGenomes-Gn; YALI0_E30250r.
DR   EnsemblGenomes-Gn; YALI0_E30437r.
DR   EnsemblGenomes-Gn; YALI0_E30459r.
DR   EnsemblGenomes-Gn; YALI0_E31947r.
DR   EnsemblGenomes-Gn; YALI0_E32923r.
DR   EnsemblGenomes-Tr; EFYLIT00000000001.
DR   EnsemblGenomes-Tr; EFYLIT00000000006.
DR   EnsemblGenomes-Tr; EFYLIT00000000007.
DR   EnsemblGenomes-Tr; EFYLIT00000000012.
DR   EnsemblGenomes-Tr; EFYLIT00000000018.
DR   EnsemblGenomes-Tr; EFYLIT00000000022.
DR   EnsemblGenomes-Tr; EFYLIT00000000049.
DR   EnsemblGenomes-Tr; EFYLIT00000000050.
DR   EnsemblGenomes-Tr; EFYLIT00000000054.
DR   EnsemblGenomes-Tr; EFYLIT00000000056.
DR   EnsemblGenomes-Tr; EFYLIT00000000059.
DR   EnsemblGenomes-Tr; EFYLIT00000000065.
DR   EnsemblGenomes-Tr; EFYLIT00000000066.
DR   EnsemblGenomes-Tr; EFYLIT00000000067.
DR   EnsemblGenomes-Tr; EFYLIT00000000074.
DR   EnsemblGenomes-Tr; EFYLIT00000000085.
DR   EnsemblGenomes-Tr; EFYLIT00000000092.
DR   EnsemblGenomes-Tr; EFYLIT00000000103.
DR   EnsemblGenomes-Tr; EFYLIT00000000124.
DR   EnsemblGenomes-Tr; EFYLIT00000000131.
DR   EnsemblGenomes-Tr; EFYLIT00000000132.
DR   EnsemblGenomes-Tr; EFYLIT00000000133.
DR   EnsemblGenomes-Tr; EFYLIT00000000137.
DR   EnsemblGenomes-Tr; EFYLIT00000000146.
DR   EnsemblGenomes-Tr; EFYLIT00000000159.
DR   EnsemblGenomes-Tr; EFYLIT00000000164.
DR   EnsemblGenomes-Tr; EFYLIT00000000167.
DR   EnsemblGenomes-Tr; EFYLIT00000000168.
DR   EnsemblGenomes-Tr; EFYLIT00000000169.
DR   EnsemblGenomes-Tr; EFYLIT00000000175.
DR   EnsemblGenomes-Tr; EFYLIT00000000179.
DR   EnsemblGenomes-Tr; EFYLIT00000000203.
DR   EnsemblGenomes-Tr; EFYLIT00000000214.
DR   EnsemblGenomes-Tr; EFYLIT00000000220.
DR   EnsemblGenomes-Tr; EFYLIT00000000247.
DR   EnsemblGenomes-Tr; EFYLIT00000000248.
DR   EnsemblGenomes-Tr; EFYLIT00000000249.
DR   EnsemblGenomes-Tr; EFYLIT00000000250.
DR   EnsemblGenomes-Tr; EFYLIT00000000254.
DR   EnsemblGenomes-Tr; EFYLIT00000000257.
DR   EnsemblGenomes-Tr; EFYLIT00000000271.
DR   EnsemblGenomes-Tr; EFYLIT00000000272.
DR   EnsemblGenomes-Tr; EFYLIT00000000281.
DR   EnsemblGenomes-Tr; EFYLIT00000000286.
DR   EnsemblGenomes-Tr; EFYLIT00000000287.
DR   EnsemblGenomes-Tr; EFYLIT00000000305.
DR   EnsemblGenomes-Tr; EFYLIT00000000308.
DR   EnsemblGenomes-Tr; EFYLIT00000000312.
DR   EnsemblGenomes-Tr; EFYLIT00000000313.
DR   EnsemblGenomes-Tr; EFYLIT00000000316.
DR   EnsemblGenomes-Tr; EFYLIT00000000329.
DR   EnsemblGenomes-Tr; EFYLIT00000000338.
DR   EnsemblGenomes-Tr; EFYLIT00000000339.
DR   EnsemblGenomes-Tr; EFYLIT00000000344.
DR   EnsemblGenomes-Tr; EFYLIT00000000345.
DR   EnsemblGenomes-Tr; EFYLIT00000000349.
DR   EnsemblGenomes-Tr; EFYLIT00000000355.
DR   EnsemblGenomes-Tr; EFYLIT00000000358.
DR   EnsemblGenomes-Tr; EFYLIT00000000373.
DR   EnsemblGenomes-Tr; EFYLIT00000000380.
DR   EnsemblGenomes-Tr; EFYLIT00000000385.
DR   EnsemblGenomes-Tr; EFYLIT00000000386.
DR   EnsemblGenomes-Tr; EFYLIT00000000402.
DR   EnsemblGenomes-Tr; EFYLIT00000000418.
DR   EnsemblGenomes-Tr; EFYLIT00000000422.
DR   EnsemblGenomes-Tr; EFYLIT00000000423.
DR   EnsemblGenomes-Tr; EFYLIT00000000427.
DR   EnsemblGenomes-Tr; EFYLIT00000000431.
DR   EnsemblGenomes-Tr; EFYLIT00000000432.
DR   EnsemblGenomes-Tr; EFYLIT00000000433.
DR   EnsemblGenomes-Tr; EFYLIT00000000435.
DR   EnsemblGenomes-Tr; EFYLIT00000000443.
DR   EnsemblGenomes-Tr; EFYLIT00000000445.
DR   EnsemblGenomes-Tr; EFYLIT00000000446.
DR   EnsemblGenomes-Tr; EFYLIT00000000467.
DR   EnsemblGenomes-Tr; EFYLIT00000000471.
DR   EnsemblGenomes-Tr; EFYLIT00000000495.
DR   EnsemblGenomes-Tr; EFYLIT00000000496.
DR   EnsemblGenomes-Tr; EFYLIT00000000500.
DR   EnsemblGenomes-Tr; EFYLIT00000000503.
DR   EnsemblGenomes-Tr; EFYLIT00000000505.
DR   EnsemblGenomes-Tr; EFYLIT00000000515.
DR   EnsemblGenomes-Tr; EFYLIT00000000525.
DR   EnsemblGenomes-Tr; EFYLIT00000000527.
DR   EnsemblGenomes-Tr; EFYLIT00000000530.
DR   EnsemblGenomes-Tr; EFYLIT00000000533.
DR   EnsemblGenomes-Tr; EFYLIT00000000540.
DR   EnsemblGenomes-Tr; EFYLIT00000000547.
DR   EnsemblGenomes-Tr; EFYLIT00000000548.
DR   EnsemblGenomes-Tr; EFYLIT00000000555.
DR   EnsemblGenomes-Tr; EFYLIT00000000558.
DR   EnsemblGenomes-Tr; EFYLIT00000000561.
DR   EnsemblGenomes-Tr; EFYLIT00000000562.
DR   EnsemblGenomes-Tr; EFYLIT00000000567.
DR   EnsemblGenomes-Tr; EFYLIT00000000579.
DR   EnsemblGenomes-Tr; EFYLIT00000000584.
DR   EnsemblGenomes-Tr; EFYLIT00000000589.
DR   EnsemblGenomes-Tr; EFYLIT00000000592.
DR   EnsemblGenomes-Tr; EFYLIT00000000593.
DR   EnsemblGenomes-Tr; EFYLIT00000000610.
DR   EnsemblGenomes-Tr; EFYLIT00000000611.
DR   EnsemblGenomes-Tr; EFYLIT00000000614.
DR   EnsemblGenomes-Tr; EFYLIT00000000624.
DR   EnsemblGenomes-Tr; EFYLIT00000000630.
DR   EnsemblGenomes-Tr; EFYLIT00000000635.
DR   EnsemblGenomes-Tr; EFYLIT00000000649.
DR   EnsemblGenomes-Tr; EFYLIT00000000652.
DR   EnsemblGenomes-Tr; YALI0_E00352r.
DR   EnsemblGenomes-Tr; YALI0_E00374r.
DR   EnsemblGenomes-Tr; YALI0_E00440r.
DR   EnsemblGenomes-Tr; YALI0_E01342r.
DR   EnsemblGenomes-Tr; YALI0_E01422r.
DR   EnsemblGenomes-Tr; YALI0_E01716r.
DR   EnsemblGenomes-Tr; YALI0_E02464r.
DR   EnsemblGenomes-Tr; YALI0_E02926r.
DR   EnsemblGenomes-Tr; YALI0_E02970r.
DR   EnsemblGenomes-Tr; YALI0_E03652r.
DR   EnsemblGenomes-Tr; YALI0_E04895r.
DR   EnsemblGenomes-Tr; YALI0_E06259r.
DR   EnsemblGenomes-Tr; YALI0_E06303r.
DR   EnsemblGenomes-Tr; YALI0_E06963r.
DR   EnsemblGenomes-Tr; YALI0_E07007r.
DR   EnsemblGenomes-Tr; YALI0_E07227r.
DR   EnsemblGenomes-Tr; YALI0_E07348r.
DR   EnsemblGenomes-Tr; YALI0_E07359r.
DR   EnsemblGenomes-Tr; YALI0_E07403r.
DR   EnsemblGenomes-Tr; YALI0_E07755r.
DR   EnsemblGenomes-Tr; YALI0_E07854r.
DR   EnsemblGenomes-Tr; YALI0_E08107r.
DR   EnsemblGenomes-Tr; YALI0_E08118r.
DR   EnsemblGenomes-Tr; YALI0_E08272r.
DR   EnsemblGenomes-Tr; YALI0_E08404r.
DR   EnsemblGenomes-Tr; YALI0_E08668r.
DR   EnsemblGenomes-Tr; YALI0_E08712r.
DR   EnsemblGenomes-Tr; YALI0_E08778r.
DR   EnsemblGenomes-Tr; YALI0_E10945r.
DR   EnsemblGenomes-Tr; YALI0_E10967r.
DR   EnsemblGenomes-Tr; YALI0_E11231r.
DR   EnsemblGenomes-Tr; YALI0_E11275r.
DR   EnsemblGenomes-Tr; YALI0_E11506r.
DR   EnsemblGenomes-Tr; YALI0_E11759r.
DR   EnsemblGenomes-Tr; YALI0_E12265r.
DR   EnsemblGenomes-Tr; YALI0_E12749r.
DR   EnsemblGenomes-Tr; YALI0_E12793r.
DR   EnsemblGenomes-Tr; YALI0_E12815r.
DR   EnsemblGenomes-Tr; YALI0_E12903r.
DR   EnsemblGenomes-Tr; YALI0_E13816r.
DR   EnsemblGenomes-Tr; YALI0_E14245r.
DR   EnsemblGenomes-Tr; YALI0_E14278r.
DR   EnsemblGenomes-Tr; YALI0_E14421r.
DR   EnsemblGenomes-Tr; YALI0_E14531r.
DR   EnsemblGenomes-Tr; YALI0_E14861r.
DR   EnsemblGenomes-Tr; YALI0_E14883r.
DR   EnsemblGenomes-Tr; YALI0_E15950r.
DR   EnsemblGenomes-Tr; YALI0_E16082r.
DR   EnsemblGenomes-Tr; YALI0_E17039r.
DR   EnsemblGenomes-Tr; YALI0_E17237r.
DR   EnsemblGenomes-Tr; YALI0_E17501r.
DR   EnsemblGenomes-Tr; YALI0_E17603r.
DR   EnsemblGenomes-Tr; YALI0_E18370r.
DR   EnsemblGenomes-Tr; YALI0_E19096r.
DR   EnsemblGenomes-Tr; YALI0_E19173r.
DR   EnsemblGenomes-Tr; YALI0_E19316r.
DR   EnsemblGenomes-Tr; YALI0_E19833r.
DR   EnsemblGenomes-Tr; YALI0_E19844r.
DR   EnsemblGenomes-Tr; YALI0_E19855r.
DR   EnsemblGenomes-Tr; YALI0_E20075r.
DR   EnsemblGenomes-Tr; YALI0_E20317r.
DR   EnsemblGenomes-Tr; YALI0_E21263r.
DR   EnsemblGenomes-Tr; YALI0_E21461r.
DR   EnsemblGenomes-Tr; YALI0_E21714r.
DR   EnsemblGenomes-Tr; YALI0_E22110r.
DR   EnsemblGenomes-Tr; YALI0_E22154r.
DR   EnsemblGenomes-Tr; YALI0_E22308r.
DR   EnsemblGenomes-Tr; YALI0_E22528r.
DR   EnsemblGenomes-Tr; YALI0_E22693r.
DR   EnsemblGenomes-Tr; YALI0_E23485r.
DR   EnsemblGenomes-Tr; YALI0_E23837r.
DR   EnsemblGenomes-Tr; YALI0_E23881r.
DR   EnsemblGenomes-Tr; YALI0_E24112r.
DR   EnsemblGenomes-Tr; YALI0_E24871r.
DR   EnsemblGenomes-Tr; YALI0_E25157r.
DR   EnsemblGenomes-Tr; YALI0_E25234r.
DR   EnsemblGenomes-Tr; YALI0_E25245r.
DR   EnsemblGenomes-Tr; YALI0_E25289r.
DR   EnsemblGenomes-Tr; YALI0_E25311r.
DR   EnsemblGenomes-Tr; YALI0_E25355r.
DR   EnsemblGenomes-Tr; YALI0_E25377r.
DR   EnsemblGenomes-Tr; YALI0_E25465r.
DR   EnsemblGenomes-Tr; YALI0_E25509r.
DR   EnsemblGenomes-Tr; YALI0_E25520r.
DR   EnsemblGenomes-Tr; YALI0_E25564r.
DR   EnsemblGenomes-Tr; YALI0_E26103r.
DR   EnsemblGenomes-Tr; YALI0_E26213r.
DR   EnsemblGenomes-Tr; YALI0_E26400r.
DR   EnsemblGenomes-Tr; YALI0_E26411r.
DR   EnsemblGenomes-Tr; YALI0_E26675r.
DR   EnsemblGenomes-Tr; YALI0_E27318r.
DR   EnsemblGenomes-Tr; YALI0_E27324r.
DR   EnsemblGenomes-Tr; YALI0_E27610r.
DR   EnsemblGenomes-Tr; YALI0_E28028r.
DR   EnsemblGenomes-Tr; YALI0_E28072r.
DR   EnsemblGenomes-Tr; YALI0_E28116r.
DR   EnsemblGenomes-Tr; YALI0_E28682r.
DR   EnsemblGenomes-Tr; YALI0_E28765r.
DR   EnsemblGenomes-Tr; YALI0_E29799r.
DR   EnsemblGenomes-Tr; YALI0_E29821r.
DR   EnsemblGenomes-Tr; YALI0_E30041r.
DR   EnsemblGenomes-Tr; YALI0_E30195r.
DR   EnsemblGenomes-Tr; YALI0_E30239r.
DR   EnsemblGenomes-Tr; YALI0_E30250r.
DR   EnsemblGenomes-Tr; YALI0_E30437r.
DR   EnsemblGenomes-Tr; YALI0_E30459r.
DR   EnsemblGenomes-Tr; YALI0_E31947r.
DR   EnsemblGenomes-Tr; YALI0_E32923r.
DR   GOA; C0HLB1.
DR   GOA; Q12724.
DR   InterPro; IPR001754; OMPdeCOase_dom.
DR   InterPro; IPR011060; RibuloseP-bd_barrel.
DR   InterPro; IPR014732; OMPdecase.
DR   InterPro; IPR018089; OMPdecase_AS.
DR   PDB; 5FL7; X-ray.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00009; RNaseP_nuc.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF01223; snR13.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 725054; 0.
DR   UniProtKB/Swiss-Prot; C0HLB1; ATP5E_YARLI.
DR   UniProtKB/Swiss-Prot; Q12724; PYRF_YARLI.
XX
CC   Yarrowia lipolytica sequence is made of 6 chromosomes (A to F). The
CC   sequence was annotated by the Genolevures Consortium. For more information
CC   go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4224103
FT                   /organism="Yarrowia lipolytica CLIB122"
FT                   /chromosome="E"
FT                   /strain="CLIB122"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Yali0E"
FT                   /db_xref="taxon:284591"
FT   gene            complement(<435..>1553)
FT                   /locus_tag="YALI0_E00110g"
FT                   /old_locus_tag="YALI-IPF10721"
FT   CDS_pept        complement(435..1553)
FT                   /locus_tag="YALI0_E00110g"
FT                   /old_locus_tag="YALI-IPF10721"
FT                   /product="YALI0E00110p"
FT                   /note="similar to uniprot|P08540|PHOX_KLULA Kluyveromyces
FT                   lactis KLLA0B14839g Potential acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78938"
FT                   /db_xref="GOA:Q6C7K3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7K3"
FT                   /protein_id="CAG78938.1"
FT                   /translation="MKIDIALVVLLATAVSAAPPTFSKIQPSPDAIASAAATAKSNHWK
FT                   DEGYETVKGQVFDKYYQIWLENTNYDKAFGQADLKALTDEGILLTNYWSLTHPSQPNYI
FT                   AAVSGDYFGDMTDSFKRVPEEVATVADLLDTKHISWGEYQEHQPYTGYDGYEFKNADGA
FT                   NDYVRKHNPLINYDSVANKKERLGNLKNFTEFYKDLKNADLPQWAFITPNMTNDGHDSD
FT                   IEVAGKWSSSFIRPLLKNPTFYDNNLIILTFDENHNYLTKNRVYAVLLGGSIPDHLKGT
FT                   TDDTFYDHYTNLATVQANWKLPHLGRKDVDANIFKFVADKLDIKNDDVDTTWKFNNVPE
FT                   SGYFQNKNKGIPAPDVNAVGRSGNHILPSLRN"
FT   gene            complement(<2299..>3738)
FT                   /locus_tag="YALI0_E00132g"
FT                   /old_locus_tag="YALI-IPF4109"
FT                   /old_locus_tag="YALI-CDS2506.1"
FT   CDS_pept        complement(2299..3738)
FT                   /locus_tag="YALI0_E00132g"
FT                   /old_locus_tag="YALI-IPF4109"
FT                   /old_locus_tag="YALI-CDS2506.1"
FT                   /product="YALI0E00132p"
FT                   /note="similar to uniprot|Q13356 Homo sapiens PPIL2
FT                   Peptidyl- prolyl cis-trans isomerase like 2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78939"
FT                   /db_xref="GOA:Q6C7K2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7K2"
FT                   /protein_id="CAG78939.1"
FT                   /translation="MGKNTDKLYITQSEWALGDHSVGGGKKSEAQSGVQKNPFWHCTIG
FT                   QQPIEHKNMMCDKLGYVYDIKNIVPYIVKQGKKAGKKGVPHPVEPGATLTRTDLMKLTV
FT                   TVNGEGKIIDPVSFKEMSKYHNAVVVRPSKRVYLEDTIKELGKSGRDPVSDEAFTKTDV
FT                   LRLRNFAEMEEGDGTLVKKGEADSSAQDIKPTDRTGQTTTHHVAASLTSTTYVPTTQVT
FT                   VIEEDLVDKLKPKMAELKDPVYALLTINCQGKRGQINLELYPYNAPLTVYNFVKLAQKG
FT                   YYDGTIFHRNIKHFMIQGGDPTGTGSGGESIFGKTFRDECGTFNPHTHDSRGVLSMANR
FT                   GKGTNSSQFFITYSRAPHLDGKHTVFGRVVDNSFLTTLELSETVDDKPVKNITLESVSV
FT                   SSDPFSFLEGGHINAQEANKKTTPMDDSPFLKKQTGESGKIGRYLKLSEPAEDAADDPT
FT                   SSISQKRKRITSLANSNFSGW"
FT   gene            complement(<3976..>6357)
FT                   /locus_tag="YALI0_E00154g"
FT                   /old_locus_tag="YALI-IPF4107"
FT                   /old_locus_tag="YALI-CDS0851.1"
FT   CDS_pept        complement(3976..6357)
FT                   /locus_tag="YALI0_E00154g"
FT                   /old_locus_tag="YALI-IPF4107"
FT                   /old_locus_tag="YALI-CDS0851.1"
FT                   /product="YALI0E00154p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014w RTS1 potential regulatory subunit of protein
FT                   phosphatase 2A possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78940"
FT                   /db_xref="GOA:Q6C7K1"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7K1"
FT                   /protein_id="CAG78940.1"
FT                   /translation="MMRGFKQRMLSRSKSHSESSTKNKKKEDGPKRTFSLGDRKKTPEP
FT                   TPAAATPSNVQAAATPVSSSSSASSITSVSGSSGNNNSSSNNNSNNNITSGATNTTNSS
FT                   NANTTNPATSSNSNPSTGNVSSMLTPQQPAQSQAALQGLQQNQQQQGQQMDTNTPPAIL
FT                   VEGPTQLGSAQASSHVTMGHVTGHMSTHSGTPHHHPSSPGQLETMPTDLEPPKRHSFEL
FT                   LNADGPEVKTPRRHNSSRLEISKERELERLPGFNEVPFRKRAELFLQKVKQCNTIFDFG
FT                   DPSSDIQGKDIKRMALHELLDFVANTRITITDEMYAQVVGMFGKNIFRPTPPLVNPVGE
FT                   VFDPDEDEPVCEVAWPHMQLVYEFFLKFIESPDFNHTSAKKFIDHRFVQNLLELFDSED
FT                   IRERDCLKTTLHRIYGKFLNLRAYIRRSINNVFFQFIYETERFNGVAELLEILGSIING
FT                   FALPLKDEHKIFLSRVLIPLHKAKTLSLYHPQLAYCVVQFLEKDPSLTEEVILGLLRYW
FT                   PKVNSSKEVMFLNEIEDIFEVMEPTEFQRIQIPLFSQLAKCISSQHFQVAERALYYWNN
FT                   EYFCTLMSENITEILPVIFPALYENSRGHWNRTIHSMVYNTMKMIMEANPQLFDQCTMV
FT                   YQERQDLKEEHEALVAKWWDMVVERAANSQENVDSPQFAKLLNQAQEEFSMLKTEDRDL
FT                   QMSGIPEEGEEDSNKLANNQGPEEGMEHDHHEQHQQHQGLGQHEQQQQQQQGVEQQQQP
FT                   HNIQPLGVVTNHETPVVAHNDEEHTGFHTPRGSSDFPFGY"
FT   gene            complement(<8889..>13804)
FT                   /locus_tag="YALI0_E00176g"
FT                   /old_locus_tag="YALI-IPF40321"
FT   CDS_pept        complement(join(8889..13647,13779..13804))
FT                   /locus_tag="YALI0_E00176g"
FT                   /old_locus_tag="YALI-IPF40321"
FT                   /product="YALI0E00176p"
FT                   /note="similar to uniprot|P19524 Saccharomyces cerevisiae
FT                   YOR326w MYO2 myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78941"
FT                   /db_xref="GOA:Q6C7K0"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036103"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7K0"
FT                   /protein_id="CAG78941.1"
FT                   /translation="MAISYEPGIRCWIRDEKEGWVGAEVVDQKTDGEKVTINLTLENGE
FT                   EKSVETSVSVLKSSAEVPQLPLRNPPILESTEDLTSLSYLNEPSVLHAIRTRYQMLNIY
FT                   TYSGIVLIATNPFQRVDNLYTPDIIQAYAGKTRGELEPHLFAIAEDAYRCMLRDKKDQT
FT                   IVVSGESGAGKTVSAKYIMRYFATVEDPLAPRKRDVSQGDSLSHVEEQILATNPIMEAF
FT                   GNAKTTRNDNSSRFGKYLEINFNKDVDIVGARIRTFLLERSRLVFQPATERNYHIFYQL
FT                   VKGASPELAKALGVEGGVPAFRYLNQGGNDTIEGVDDSEEFKLTGASLETIGIAKPEQE
FT                   SLWNILAGILHIGNIEIGQTRQDAVLSSDEPSLIKACELLQIDPVQFAKWITKKQIVTR
FT                   ADKIVSNQTHKQSLVVRDSVSKHIYTSLFDWLVSELNGGLCDPKVQEQVETFIGVLDIF
FT                   GFEHFKKNSFEQFCINYANEKLQQEFNQHVFKLEQDEYVQEEINWTFIDFSDNQPCIDL
FT                   IEAKLGILSLLDEESRLPAGSDDGWCTKLYQQLDNPQNKHFKKPRFGNTSFVVAHYAQD
FT                   VNYEAEGFVEKNRDAVPDEHLEVLMATKNDFLKNILDVAANIAAENAPAAPTKPGLRAP
FT                   KKPTLGRIFKGSLIDLMTTINSTNVHYIRCIKPNEEKAAWSFSAPIVLSQLRACGVLET
FT                   IRISCAGFPSRWSYEEFISRYYMLVPSAEWASMEVRDLCNLILEKTIKEEDKFQLGKTK
FT                   IFFRAGMLAYLERLRSDRLNECAIVIQKNVRKRFYRQKYLDTRQSIIAAQTLFRAHIAR
FT                   ERFQELRKEQAAVKIQSAWRGFSGRRDFKQQREGIVRLQAIFRGVLVRRNIQEVAHKGA
FT                   ALTIQRNFRGYVARKEYRNKLQNIVLIQSLIRRRQAKQQLKQLKVEAKSEKHFKEVQYR
FT                   LENKVVELTQSLTAKRDENKKLLAEMDMLNARSAAATAKSTENSSRVEELENAAEEKER
FT                   AHQEEVQTMELKLAALDKQYQASVAQLTELEDANAALKQELEAKTKEVADKIEATNVHI
FT                   DTNKSLSEQLEQAKHEIEKLKQNGVVASDMASVSPVRGTPGTAMNAKRRNIKRRSLTSA
FT                   GIVDGAAAFTPRPSAAGAAAGAAMGAAAGANAEQMMASLGVNGQIEQLLESQSDELYDE
FT                   VIEGLIHKLNIPIPHTSDDQFLPREVLFPAHILNLITSEMWRLGFIKESERFLARVMEA
FT                   IQKHILELSGEAVIYPGAFWLSNVHEIMSFVCLAQANIAQNVDIMDEMGEYEFQQYGRL
FT                   VHVVKADLENLEFNIYHTWMKELKKLLDKMIVPAIVLSQALPGFMTTDSNGRFLAKMFT
FT                   SNVSYSMDDLLNLFNKVYKAMTCYFNEKHSVRQSLMELLSMIGVKAFNDLLMRKNFLSW
FT                   KRGLQINYNITRIEEWCKSHDIADGVVKLEHLMQSAKLLQLKKSTLEDIEIIYDICWIL
FT                   TPSQIHRLIGQYLSADYEAPISSEIMNTISEKVKLEKNAVLLLETSPLEDSGPFEICEP
FT                   RLLKRLDSYIPAVLQVPLIRRFVELTTLASGQNNEDQHGRIDGDISEEAAADSVSADQM
FT                   VPEESTNGYQEVASQ"
FT   gene            <15919..>17214
FT                   /locus_tag="YALI0_E00198g"
FT                   /old_locus_tag="YALI-IPF4100"
FT                   /old_locus_tag="YALI-CDS2952.1"
FT   CDS_pept        15919..17214
FT                   /locus_tag="YALI0_E00198g"
FT                   /old_locus_tag="YALI-IPF4100"
FT                   /old_locus_tag="YALI-CDS2952.1"
FT                   /product="YALI0E00198p"
FT                   /note="some similarities with uniprot|P12754 Saccharomyces
FT                   cerevisiae YGR083c GCD2 translation initiation factor eIF2B
FT                   71 kDa (delta)subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78942"
FT                   /db_xref="GOA:Q6C7J9"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J9"
FT                   /protein_id="CAG78942.1"
FT                   /translation="MSELTPAQLKAQKKAAKAAKRAASKEASGQAPTRDPREAKKEQQQ
FT                   AAAKEGGSSSNTGNNSNNTQGGSNQSSASASSKEDRTRASRPALFGHLEKAGKVTAADA
FT                   GKDVHPEVITLALRYSSYQIVGSSDRARTLLQAFQRVIADYETPEGTTLSRNLTTHLGH
FT                   QIDFVISARPLSVSMGNAIRWLKQEISVVSIDMSDQAAKDMLVEKIDEYIKEKIDVSGS
FT                   VIVESAVNDIADGDTVLTFAHSEVVENTFIAAHQAGKRFKIIVVDSRPLHEGRKLARDL
FT                   SARGIECIYILVSALAHVLDDVSRVFLGAHAMLSNGALLSRVGSALIATAAKRKNIPVI
FT                   VLCESMKFSDRVQLDSVTLNELAFPEMLANTYISDKKKLPEDKAKTSLKYLNLCYDLTP
FT                   AANLTKIITELGHLPPSAVPVIMREYKSAYTM"
FT   gene            complement(<17780..>18472)
FT                   /locus_tag="YALI0_E00220g"
FT                   /old_locus_tag="YALI-IPF11608"
FT                   /old_locus_tag="YALI-CDS6065.1"
FT   CDS_pept        complement(join(17780..17801,18177..18472))
FT                   /locus_tag="YALI0_E00220g"
FT                   /old_locus_tag="YALI-IPF11608"
FT                   /old_locus_tag="YALI-CDS6065.1"
FT                   /product="YALI0E00220p"
FT                   /note="similar to uniprot|P28778 Saccharomyces cerevisiae
FT                   YKL003c MRP17 ribosomal protein of the small subunit
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78943"
FT                   /db_xref="GOA:Q6C7J8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J8"
FT                   /protein_id="CAG78943.2"
FT                   /translation="MLYELVGIASVTPAHAAAKQAVTQIGRMIIGNRGVVRLIECWRFK
FT                   PLPQIMKAQQKSYVVGDYFYMKFDCSPGAQGEIMRAVQADPRLIRTFCVKLNEKSSKTL
FT                   I"
FT   gene            <20096..>20614
FT                   /locus_tag="YALI0_E00242g"
FT                   /old_locus_tag="YALI-IPF11609"
FT                   /old_locus_tag="YALI-CDS5743.1"
FT   CDS_pept        20096..20614
FT                   /locus_tag="YALI0_E00242g"
FT                   /old_locus_tag="YALI-IPF11609"
FT                   /old_locus_tag="YALI-CDS5743.1"
FT                   /product="YALI0E00242p"
FT                   /note="similar to uniprot|P39726 Saccharomyces cerevisiae
FT                   YAL044c GCV3 glycine decarboxylase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78944"
FT                   /db_xref="GOA:Q6C7J7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J7"
FT                   /protein_id="CAG78944.1"
FT                   /translation="MLRTLARSSLRFAPRATMAPTMAPLTMMRLNHTLIKGSIPDKYSN
FT                   KYTLKFTEDHDWVAFHEDGVAFIGITKYAAEALGDATFVEVEEAGNEIEKDDAFGNVES
FT                   VKATNDIIAPFDFEVVESNFDVADTPSLINKEPNGNGYLAKVKPIEGAEETEGLLTAEE
FT                   YDEFLKNAH"
FT   gene            <21500..>23068
FT                   /locus_tag="YALI0_E00264g"
FT                   /old_locus_tag="YALI-IPF4096"
FT                   /old_locus_tag="YALI-CDS2178.1"
FT   CDS_pept        21500..23068
FT                   /locus_tag="YALI0_E00264g"
FT                   /old_locus_tag="YALI-IPF4096"
FT                   /old_locus_tag="YALI-CDS2178.1"
FT                   /product="YALI0E00264p"
FT                   /note="similar to uniprot|P46367 Saccharomyces cerevisiae
FT                   YOR374w ALD4 aldehyde dehydrogenase mitochondrial possible
FT                   transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78945"
FT                   /db_xref="GOA:Q6C7J6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J6"
FT                   /protein_id="CAG78945.1"
FT                   /translation="MLRRITLNQFKGGLRRLSTLTPVKNEPLTLPNGAKYEQPVGLFIN
FT                   GEFVKSQSGKRFETENPTTETPIISVYEAGEADANAAVEAAKNAFKNWGFKTAPSERGV
FT                   LLNKLADLIERDLDLISAIETTDNGKVFAQAQGDVALVVKVLRYYAGFADKIGGDLVQT
FT                   NDGFFNYTRKEPLGVCGQIIPWNFPLLMWAWKIAPALTTGNTVVLKTAESTPLSALYAC
FT                   KLSQEAGFPKGVLNVVSGYGPVGGVLSAHPDIKKIAFTGSTATGKQVAKTALTSNLKKT
FT                   TMELGGKSPNIIFDDANLEDALSAAALGIFFNSGEVCCAGSRLFVQAGVYDQVVEAFKK
FT                   KAESVKVGDPFDPNSLQGPQQNKNQFKKILGYIEQGQKEGAHLLCGGSAQAGPNKGYFI
FT                   QPTVFTDVNNDMSIVREEIFGPVLTITKFNTVDEVIDMANDSEYGLAAGIHTTDINKAH
FT                   YVAENIASGTIWVNCYNAFHEAVPFGGYKQSGFGKEMGRDGLENYLQTKAVRVKLDERK
FT                   WADKQ"
FT   gene            <23920..>24873
FT                   /locus_tag="YALI0_E00286g"
FT                   /old_locus_tag="YALI-IPF4095"
FT                   /old_locus_tag="YALI-CDS4184.1"
FT   CDS_pept        23920..24873
FT                   /locus_tag="YALI0_E00286g"
FT                   /old_locus_tag="YALI-IPF4095"
FT                   /old_locus_tag="YALI-CDS4184.1"
FT                   /product="YALI0E00286p"
FT                   /note="similar to uniprot|CAD70715 Yarrowia lipolytica LIP7
FT                   lipase or uniprot|CAD70716 Yarrowia lipolytica LIP8 lipase
FT                   possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78946"
FT                   /db_xref="GOA:Q6C7J5"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J5"
FT                   /protein_id="CAG78946.1"
FT                   /translation="MRPFTTLVLLLLLITQTCAISEATYELLQFHSQLSDIAYCVQTMR
FT                   GPTQLRHPFKCGVQCRKTQFEGLEVVHTFVHKPARPALTGYMAVDHTNQTKYVVFRGTN
FT                   SLEDSMLDLSFGYEPTASPSFLNDTCPECKVQRAILEAYDAFWAENCDQLSDFLYEDYP
FT                   HYSLSLTGHSLGGVAAALLATDIKLQGLDPLLINFGQPQYANLAYAQLVDSLFFPQTDK
FT                   EVIDPLYDSPQRRLYRVTHWNDLFVSLPGQRGFFHSLGEVYISYPWVKPPRRTIRYCEG
FT                   PQSEYCHGGDYNPLERANFLKNHLAYFGWIGYCPYL"
FT   gene            <25491..>27263
FT                   /locus_tag="YALI0_E00308g"
FT                   /old_locus_tag="YALI-IPF4094"
FT                   /old_locus_tag="YALI-CDS1662.1"
FT   CDS_pept        25491..27263
FT                   /locus_tag="YALI0_E00308g"
FT                   /old_locus_tag="YALI-IPF4094"
FT                   /old_locus_tag="YALI-CDS1662.1"
FT                   /product="YALI0E00308p"
FT                   /note="weakly similar to uniprot|P38680 Neurospora crassa
FT                   MTR N- amino acid transport system protein
FT                   (Methyltryptophan resistance protein) possible
FT                   transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78947"
FT                   /db_xref="GOA:Q6C7J4"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J4"
FT                   /protein_id="CAG78947.1"
FT                   /translation="MPQKNTDHSEVEELQGNVEEVQYDVPELHIPTTNELLDSTEPFQI
FT                   YYHYAAMQRAREDALPGSRFRSIFSKYTRKTDEKQSESDPCYDTPSDDGTGVSDVDPEK
FT                   HAAQSSGGIISQIPGASQELAIANMSARTATWMSVFFLTTTDILGPSSAPWAISQLGWF
FT                   PGVMLFTVLGVAAVYTGWLIYKMFLKLDSPEFPMKTFGDLALRVYGKGFRWGVDILQSL
FT                   QLLCNVAVIILGNGQGLSQIYSPLCFSVWCIIFMVAGILLGQIKRLSNFSYVANAAIWM
FT                   NLFVVFATMGIAATKPPNYVGGAQQNNLPNSTDPVRTKAIEEYAFQDQLGAVMNIVYSY
FT                   GGAMVFVEFLSEMRKPREFLKGMLSAQGVIFVCYLLYGLLVYAYQGQYTVNPGNQGLGS
FT                   HNWQIAVNVISVVSSLIAAGLYGNVGIKVVYITLIRRAIPALPGLDDGIKGRIAWALMV
FT                   FIYWAVAFVIASAIPQFSSLTSLVGAACILQFSYTFPPFMYMGLTIREEASKLDTVDLE
FT                   TRTVIKYDSWRSMARWKRGIMSRPWWVLVNFVLFLASLATAILGIYSSIYSLVEAFDAP
FT                   GAATVSFGCKPPVA"
FT   gene            complement(<29203..>30618)
FT                   /locus_tag="YALI0_E00330g"
FT                   /old_locus_tag="YALI-IPF4093"
FT                   /old_locus_tag="YALI-CDS2582.1"
FT   CDS_pept        complement(29203..30618)
FT                   /locus_tag="YALI0_E00330g"
FT                   /old_locus_tag="YALI-IPF4093"
FT                   /old_locus_tag="YALI-CDS2582.1"
FT                   /product="YALI0E00330p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78948"
FT                   /db_xref="GOA:Q6C7J3"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J3"
FT                   /protein_id="CAG78948.1"
FT                   /translation="MWFNCCLRRHTEYDDKDLPLTGQHPRLSNSGSSDSAATLNDENEL
FT                   EKEYSYSINREPGATREPQFARLQKNQPPARKSWATSLGFAPQTPMNNVYNIECDGVPE
FT                   TLERLLALHGRPTHAAMLDKSYSLYIPPDHASVICFKVAQKVAVVYGDPLCAAEHMPGV
FT                   FQNFRKHCRAQGWKTAIVGAGPEMADHGREAKWGLMEFGVEHVINPQTNPGFGRTINRW
FT                   NRNLQKEGVSLNVYSPKDGIDPQLERDLMQVYADWRQSRVDRHLPQAYSTVLNPFALRT
FT                   SRHLYTLGPDGKPNSWACLMQVGGHKGYLIEPCIAREDAGQGTTEFLTTNATRILKEEG
FT                   LEYLTFGLAPREEMGELSGMNKIIQESTRSLYKTTCKALALNGKQAFHEKFKPDDNLRG
FT                   PLYLLYPSGCHHLGGVRAVLEVTHISISEVWTRSRAAAAKEKAKKREERKQKRSMESDR
FT                   SVQSHGPIPPVAA"
FT   gene            <36748..>36828
FT                   /locus_tag="YALI0_E00352r"
FT   tRNA            join(36748..36785,36793..36828)
FT                   /locus_tag="YALI0_E00352r"
FT                   /product="transfer RNA Glu (CTC) cove"
FT   gene            <36833..>36951
FT                   /locus_tag="YALI0_E00374r"
FT                   /old_locus_tag="YALI0E00354r"
FT   rRNA            36833..36951
FT                   /locus_tag="YALI0_E00374r"
FT                   /old_locus_tag="YALI0E00354r"
FT                   /note="5S RNA"
FT   gene            <37222..>37863
FT                   /locus_tag="YALI0_E00396g"
FT                   /old_locus_tag="YALI-IPF4091"
FT                   /old_locus_tag="YALI-CDS5334.1"
FT   CDS_pept        37222..37863
FT                   /locus_tag="YALI0_E00396g"
FT                   /old_locus_tag="YALI-IPF4091"
FT                   /old_locus_tag="YALI-CDS5334.1"
FT                   /product="YALI0E00396p"
FT                   /note="similar to uniprot|Q9P6Q7 Schizosaccharomyces pombe
FT                   SPAC644.03C"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78949"
FT                   /db_xref="GOA:Q6C7J2"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J2"
FT                   /protein_id="CAG78949.1"
FT                   /translation="MQVFEWAFGKRQTPQEKLRKHQRALERTQRELDRERVKLEGQEKK
FT                   LIADIKKSAKAGQTGACKVMAKDLVRTRSYIQKFYQMKTQLQAISLRIQTVRSNEQMMQ
FT                   SMKGATRLLQGMNKSMNLPQLTRIAMEFERENDIMDQRQEMMDDSIDDAMEDDEVESED
FT                   IVNQVLDEIGIDLGQSMGAVPDGIQGQQERVAVAEGGDDDLEARLGALRR"
FT   gene            complement(<38094..>38690)
FT                   /locus_tag="YALI0_E00418g"
FT                   /old_locus_tag="YALI-IPF4089"
FT                   /old_locus_tag="YALI-CDS5508.1"
FT   CDS_pept        complement(38094..38690)
FT                   /locus_tag="YALI0_E00418g"
FT                   /old_locus_tag="YALI-IPF4089"
FT                   /old_locus_tag="YALI-CDS5508.1"
FT                   /product="YALI0E00418p"
FT                   /note="highly similar to uniprot|Q9C2Y6 Saccharomyces
FT                   pastorianus MET14-CA Adenosine-5 -phosphosulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78950"
FT                   /db_xref="GOA:Q6C7J1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J1"
FT                   /protein_id="CAG78950.1"
FT                   /translation="MATNITWHEGLTHDERAKLVGQKGVTLWFTGLSASGKSTIATALE
FT                   QFLLQNKINSYRLDGDNVRFGLNKDLGFSEADRNENIRRISEVAKLFTDSTCVTLTSFI
FT                   SPYKKDRQSARELHEASNLPFVEVYVDVPIEVAEQRDPKGLYKKARAGTIPEFTGISAP
FT                   YEAPEKPEIHIKSHETSIEDAVKQIYQYLQDKKYV"
FT   gene            <43742..>43814
FT                   /locus_tag="YALI0_E00440r"
FT   tRNA            43742..43814
FT                   /locus_tag="YALI0_E00440r"
FT                   /product="transfer RNA Val (CAC) cove score=69.00"
FT   gene            <45084..>46466
FT                   /locus_tag="YALI0_E00462g"
FT                   /old_locus_tag="YALI-IPF4088"
FT                   /old_locus_tag="YALI-CDS2699.1"
FT   CDS_pept        45084..46466
FT                   /locus_tag="YALI0_E00462g"
FT                   /old_locus_tag="YALI-IPF4088"
FT                   /old_locus_tag="YALI-CDS2699.1"
FT                   /product="YALI0E00462p"
FT                   /note="some similarities with uniprot|Q08269 Saccharomyces
FT                   cerevisiae YOL130w ALR1 divalent cation transporter
FT                   possible transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78951"
FT                   /db_xref="GOA:Q6C7J0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7J0"
FT                   /protein_id="CAG78951.1"
FT                   /translation="MTEVYEYSPSGMRARRPSVDGASQHSDQDVCYPHDDNKEGFEIDF
FT                   TALDDFNGEDDVPCGVANADMGSRVVRVAPQDHFAFFSTECEETIRANEFSEIFKDGCK
FT                   AKELFDAHKGTWWLDCYDPTDAEMKLLAKAFGIHPLTVEDIQHREAREKVEMFRNYYFV
FT                   AFHAYEQDVESDDFMEMVPFYLCVFPEGVISFHYSPVPHCATVRKRIRQLKDHVTVTPD
FT                   WICYAVIDDITDSFAPVIREIEQEGEIVEQTVFDARDDGFNEMLRRIGKARAKTLSMMR
FT                   LLSGKADVVGMFTKRVSEGLSDHVPKGHISLYLGDIQDHIVTMYQSLIAHEKILSRSHL
FT                   NYLSQLQVQSIDATHRVTDTLGKITVIGTILIPMNFVTGLFAMNVRIPGESTDENPGNF
FT                   GWFFGILGVLLCIIVTATLVAKWYLAHVEKKIRGNFRNSASDNSIRSMRSKRSKHTINT
FT                   IV"
FT   gene            complement(<47002..>49563)
FT                   /locus_tag="YALI0_E00484g"
FT                   /old_locus_tag="YALI-IPF4085"
FT                   /old_locus_tag="YALI-CDS0706.1"
FT   CDS_pept        complement(47002..49563)
FT                   /locus_tag="YALI0_E00484g"
FT                   /old_locus_tag="YALI-IPF4085"
FT                   /old_locus_tag="YALI-CDS0706.1"
FT                   /product="YALI0E00484p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I9"
FT                   /protein_id="CAG78952.1"
FT                   /translation="MLRITRAQLISKVCVRQTQSITPLASRGLKSSAIARFADANELET
FT                   TSLTGRKFVPKFAQEEHLQIRWRNKPRTEPPVTLPRKAASLPIDTSYATLFTSTPVPAT
FT                   QSREKYKEFVKSANANLHYLKIPKNMRPLIFREKNSDVLEELNILYPGGEPVTPLPPRT
FT                   MAITSGIVSSVINNAETLEDLYAAREFLHDAVIYAPDQTNPGQLLALYNKYIEVGGFGK
FT                   AESMLRDPVLSEYLLQEAARVGTLRSKVLYRAKNKTKGLRDTVNGLRRVYKIDVTKSGH
FT                   VELPVELLFIYYLASTGLASDFPKDIVQQVRKYKIDPDMTAKREGATEAALRSRILFKN
FT                   FVASATQTLEETNAKGLKNVPQAAANDMYLDAKITLDALSSPTNDWNIDTQGLAKQLKA
FT                   YIALLHNENVDKKAVEDKINFYANSRKDNGMSAEAEEAAEKVAAARNNADPTYSEEVRE
FT                   GIYDKEPTVDGKTVEQLDAEEAEIGREAKAHKKAAPIKDDGMSPEAKAAAEKVAAARND
FT                   PAPTYSEEVREGIHDKEPTVDGKTVEQLDAEEAKIATEAKANKKAAAPNTDGMSPEAKA
FT                   AAEKVAAARNDPAPTYSEEVREGIYDQEPTVDGKTVDQLDAEEAKIATQAKLHPYKAGQ
FT                   SSSIKDDGMSPEAKAAADKVAAARNDPAPTYSEEVREGIYDAEPTVDGKTVEQLDAEEA
FT                   KIATQAKLNPYKKAAAPSTDGMSAEAKAAAEKVAAARSNTDPTYSEEVREGIYDKEPTV
FT                   DGKTVEQLDAEEAEIGREAKAHKKATPIKDDGMSPEAKAAAEKVAAARNDPAPTYSEEV
FT                   REGIHDKEPTVDGKTVEQLDAEEAKIATDAKLRREGKLPKE"
FT   gene            <49851..>52736
FT                   /locus_tag="YALI0_E00506g"
FT                   /old_locus_tag="YALI-IPF4083"
FT                   /old_locus_tag="YALI-CDS0504.1"
FT   CDS_pept        49851..52736
FT                   /locus_tag="YALI0_E00506g"
FT                   /old_locus_tag="YALI-IPF4083"
FT                   /old_locus_tag="YALI-CDS0504.1"
FT                   /product="YALI0E00506p"
FT                   /note="weakly similar to uniprot|O13807 Schizosaccharomyces
FT                   pombe Putative (Xeroderma pigmentosum- group E like) DNA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78953"
FT                   /db_xref="GOA:Q6C7I8"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031297"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I8"
FT                   /protein_id="CAG78953.1"
FT                   /translation="MYAYSVLHAASSITGAVWAKIEAAGRHKLVVAKTRSLEVYSVDDE
FT                   LTKLYAVEMGSAILGITADESRVPSQVITLLEDGSVYSWQWKYVGDKLTHTGTCMVKAF
FT                   QKYEGQSMVTRGNTTVVSATNGGPQLWITPKGNSAIKVSLGYGGVGLSVSNAFVADGTL
FT                   AVLYRDSLNNVGMAYVNEKSKGTTEIGCASGSDFSISDSASLLVSVTLPCNGVLVVSDV
FT                   SVLYYPPFSKKVSGTYKIPDDQLLRADFPKNLIISAASKMQDGVVVLSSDVGDVLVITL
FT                   SSDGSSLDVALVEKPAESALQFPPTSLVRMDDGLFFAASHHDNSVVFKLNNVDKSTSGN
FT                   KRRKVWSYSELNIVSNIAPINDITLTSGPLQQLIVYAACGGYTSGSVSKLYHCLDPIVE
FT                   EEIPLGDGADQVWWFDNDLALFVKYMTHCAVLRLENGSLVELDNEAVMNEYGFVLEESL
FT                   WLGQFDGRDVQVTSSGIRAKGICLEIPVTSASFSDGTLMVASEKELYSLKTLTELTEPI
FT                   SLTSSPWCYAKNGDKVYVSYLNGGTFELMSNQEVSSDPASSMVVMDGYSIFGYPDGQVR
FT                   VLEADFVRRLGIAPVKLLPLWDGRIVAYSSDGLGIVDITSIDDSCMVPFIEGTIPINVS
FT                   ALNSRKRISYIVSGDMYVAELPEPSLGIVSEQFNALVRRICLVDDKVVVAMAERDIDDS
FT                   GAESVSYRVALLSHELRVLDMFDLNPYESLESLISYGPKVYVGTGIDDKDSPTEGRVIV
FT                   FSIANDKLKVEFEKQVPGCAYSLSVLRRDHSKGKGKPHIVVGCNAVLDDCNLDDLKLLN
FT                   QTKTPTIALKSSSFGDDIVVGDLIYGYNVYKLANKLEPLEIKSSEPMFTSAVELLSGPR
FT                   VVYSRSDGTVGINDGEKVTEHKFPDKMMNAIRRVPGDTFVVNRGKGLAVCAGVEGGLYL
FT                   ISEIEEDDENYTLEIQGETPAAGECGFYHKV"
FT   gene            <53347..>54861
FT                   /locus_tag="YALI0_E00528g"
FT                   /old_locus_tag="YALI-IPF4082"
FT                   /old_locus_tag="YALI-CDS2322.1"
FT   CDS_pept        53347..54861
FT                   /locus_tag="YALI0_E00528g"
FT                   /old_locus_tag="YALI-IPF4082"
FT                   /old_locus_tag="YALI-CDS2322.1"
FT                   /product="YALI0E00528p"
FT                   /note="some similarities with uniprot|Q07950 Saccharomyces
FT                   cerevisiae YLR020C possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78954"
FT                   /db_xref="GOA:Q6C7I7"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I7"
FT                   /protein_id="CAG78954.1"
FT                   /translation="MAYSSSTSVNDIYLQDFSQRQSSSSVLDRSSSRNGHLTPSHTGQG
FT                   VYSQTTAAMSPQSATSEAPLNGSMERKEFSKETKNRSIPNDIAHRFVAAIAAAFFLCVV
FT                   MTCALFSYIVRSRTPARLPEVQRQRNQTTTKNDKRLTMDLSYYANLLGFVLDEYEVTTS
FT                   DGFILDLKRLHKQGQEPTGEPILMVHGLLQSSAAYLTSGKDSIAAYFLEQGYDVWLGDN
FT                   RCGFQPKHTKYKKSDSRMWHWDITEMGTEDLPALVNYVLKVTGREELIYFGHSQGTTQA
FT                   FLGMSRDFYPALGHKIKLFVALAPAVYAGPLIDRWYFQYCRNMSLERWKWSFGIHSYIP
FT                   LMNTMHSIFPKRLYGFFGYIMFNYMFDWTDEWWDRNLRNRQFLYSPTFVSSQLMQWWLG
FT                   PNHFSKYRGILPDKAGVKWYDQNFPKLVLVIPTNDMLVDAEKIYERITQVETDVTLVDT
FT                   IRVVDYSHLDVLWAMDVVDKVCKPVHEIIKHQEREKSELPEIRLTT"
FT   gene            <55856..>56438
FT                   /locus_tag="YALI0_E00550g"
FT                   /old_locus_tag="YALI-IPF11596"
FT                   /old_locus_tag="YALI-CDS6225.1"
FT   CDS_pept        join(55856..55984,56148..56438)
FT                   /locus_tag="YALI0_E00550g"
FT                   /old_locus_tag="YALI-IPF11596"
FT                   /old_locus_tag="YALI-CDS6225.1"
FT                   /product="YALI0E00550p"
FT                   /note="similar to uniprot|P36105 Saccharomyces cerevisiae
FT                   YKL006w RPL14A ribosomal protein or uniprot|P38754
FT                   Saccharomyces cerevisiae YHL001w RPL14B ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78955"
FT                   /db_xref="GOA:Q6C7I6"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I6"
FT                   /protein_id="CAG78955.1"
FT                   /translation="MTEVKSVNWRLVEAGRIVLINRSDNKSTQGKLAIIAEIVDHGRVL
FT                   IDGPTTGVARQVANLKHVTLTPHVVEGVKRGMKSKTIKAKVEASPAFKEWSESSWAKKI
FT                   AQRERRRHLTDFERFQVMVHRRERKAALAKAVAKA"
FT   gene            complement(<57099..>57464)
FT                   /locus_tag="YALI0_E00572g"
FT                   /old_locus_tag="YALI-IPF11600"
FT                   /old_locus_tag="YALI-CDS5979.1"
FT   CDS_pept        complement(57099..57464)
FT                   /locus_tag="YALI0_E00572g"
FT                   /old_locus_tag="YALI-IPF11600"
FT                   /old_locus_tag="YALI-CDS5979.1"
FT                   /product="YALI0E00572p"
FT                   /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
FT                   YAL044W-A"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78956"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I5"
FT                   /protein_id="CAG78956.1"
FT                   /translation="MLRIRPVLRQTTLLRHMSSSNTPITDAINSRVKQEFTPVFFKVNN
FT                   DSHKHAHHAAMRGSDNTIESHFRLTIVSDKFEGKSAPIRHRMVYKLFEEEMAQPNGLHA
FT                   LSLTTKTPKEWEALEKK"
FT   gene            <58972..>59755
FT                   /locus_tag="YALI0_E00594g"
FT                   /old_locus_tag="YALI-IPF40090"
FT   CDS_pept        join(58972..59061,59507..59755)
FT                   /locus_tag="YALI0_E00594g"
FT                   /old_locus_tag="YALI-IPF40090"
FT                   /product="YALI0E00594p"
FT                   /note="highly similar to uniprot|P33328 Saccharomyces
FT                   cerevisiae YOR327c SNC2 synaptobrevin (v-SNARE) homolog
FT                   present on post-Golgi vesicles possible transmembrane
FT                   segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78957"
FT                   /db_xref="GOA:Q6C7I4"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I4"
FT                   /protein_id="CAG78957.1"
FT                   /translation="MSSSVPYDPYIPGGESNAPGGNHKTAAIQAQIDDTVGIMRENINK
FT                   VAERGERLDSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDFKMKICLIIGVIILIVVIV
FT                   VPIAIHFS"
FT   gene            <61293..>61619
FT                   /locus_tag="YALI0_E00616g"
FT                   /old_locus_tag="YALI-IPF11594"
FT   CDS_pept        61293..61619
FT                   /locus_tag="YALI0_E00616g"
FT                   /old_locus_tag="YALI-IPF11594"
FT                   /product="YALI0E00616p"
FT                   /note="some similarities with YALI0C10670g Yarrowia
FT                   lipolytica"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78958"
FT                   /db_xref="GOA:Q6C7I3"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I3"
FT                   /protein_id="CAG78958.1"
FT                   /translation="MTVADLYIVHQRGTYYNGIYMFVVEVGNFLVLVPSGYITLNLSWR
FT                   MVYIIVVIIAGVQFVMTLLFFEKTNYRVSGYSSCRTVRAGRGSIVRRIQQTESISWNRR
FT                   CCPF"
FT   gene            complement(<63212..>64591)
FT                   /locus_tag="YALI0_E00638g"
FT                   /old_locus_tag="YALI-IPF4079"
FT                   /old_locus_tag="YALI-CDS2715.1"
FT   CDS_pept        complement(63212..64591)
FT                   /locus_tag="YALI0_E00638g"
FT                   /old_locus_tag="YALI-IPF4079"
FT                   /old_locus_tag="YALI-CDS2715.1"
FT                   /product="YALI0E00638p"
FT                   /note="similar to uniprot|Q9TEM3 Emericella nidulans MCSA
FT                   Methylcitrate synthase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78959"
FT                   /db_xref="GOA:Q6C7I2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I2"
FT                   /protein_id="CAG78959.1"
FT                   /translation="MIPLRTARVARTSVSSMVQKRFASDLKGALKEAIPAKLELFKKVK
FT                   SEYSQKSLGDCKVENLLGGMRGLKCMLWEGSVLDADEGIRFHGKTIKECQEVLPKAVEG
FT                   GEMLPESMLWFLFTGKVPTEEQVRGLSRELAEKGEVPEFVNKMLDNLPPTLHPMTQFSM
FT                   AVSALNHDSKFAKAYERGIPKSEYWEYTFDDSIDLIAKLPQIAAKIYQNSYLGGGPLPG
FT                   KIDLNRDWSYNYAAMMGKGDETGFVDLLRLYFALHGDHEGGNVSAHATHLVGSALSDPY
FT                   LSYSAGLQGLAGPLHGLAAQEVLRFILDMEKNVPKGYSNEDLVKYLWSVLKSGRVIPGY
FT                   GHAVLRKPDPRFEALMNFANSRQEIRDDPVFQLVSRTSEVATGVLTEHGKTKNPHPNVD
FT                   SSSGVLFHHYGIHETLYYTVTFGVSRALGPLPQLVWDRILGLPIERPKSLSLEEIIKVA
FT                   K"
FT   gene            <65963..>67501
FT                   /locus_tag="YALI0_E00660g"
FT                   /old_locus_tag="YALI-IPF4076"
FT                   /old_locus_tag="YALI-CDS2260.1"
FT   CDS_pept        65963..67501
FT                   /locus_tag="YALI0_E00660g"
FT                   /old_locus_tag="YALI-IPF4076"
FT                   /old_locus_tag="YALI-CDS2260.1"
FT                   /product="YALI0E00660p"
FT                   /note="similar to uniprot|P38074 Saccharomyces cerevisiae
FT                   YBR034c HNRNP arginine N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78960"
FT                   /db_xref="GOA:Q6C7I1"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I1"
FT                   /protein_id="CAG78960.1"
FT                   /translation="MSDDEREIDITDLSVRDNELDFCDDASDDEYAGDVTCLFSEATFA
FT                   TTKELFEHMKEKYNFDWAEHKPKESIDQIKLVNYIRKHKEAPKAGETLSDEYMTPVLEN
FT                   DMLIMRLLEEDDDEEEKEVDPVERLQQENEFLKQKLIEANRLLASATDDSSANANKSTL
FT                   SSYDTNYFDSYAHNEIHMQMLKDRVRTESYRDFFYHNKDKIKGKVVLDVGCGSGILSMF
FT                   AAKAGARRVYGVDNSDIFEKTILNVKENGYDDVITLIRGKIEDISKNPAAFGITEKVDI
FT                   IVSEWMGYGLLFESMLDSVLVARDALKPELMAPSQTTLVVCASDDTEYLDNVAYWDDVY
FT                   EFKMTAMKPKNVESAKFVECPIEVYPKETVVSTFGVIRELELHTLTLGDLADFTSDFKI
FT                   VMEKDADVTLLIVHFDTFFTVDRETHTIEKDSQTGSWPSQGTGISFSTGPHVTPTHWKA
FT                   AGLPLQKKYPLKKGDVIEGTMRFKKGHENSRDLHIVLDTKVGGDDISKVYNISA"
FT   gene            complement(<67612..>68385)
FT                   /locus_tag="YALI0_E00682g"
FT                   /old_locus_tag="YALI-IPF4074"
FT                   /old_locus_tag="YALI-CDS4827.1"
FT   CDS_pept        complement(67612..68385)
FT                   /locus_tag="YALI0_E00682g"
FT                   /old_locus_tag="YALI-IPF4074"
FT                   /old_locus_tag="YALI-CDS4827.1"
FT                   /product="YALI0E00682p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78961"
FT                   /db_xref="GOA:Q6C7I0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7I0"
FT                   /protein_id="CAG78961.1"
FT                   /translation="MQLDYASDEETLVTVCHKLAPVTTLNQVFLFMTGPHVGTYALLSL
FT                   WIGLDNHNIGMFLGLYVMGQIIIRLPYMIPPKPLQTPRHLNALLVRYLLSIISVILTTS
FT                   AIVRMDYIDPYMRFGVLTLTRLYIGYVGSRLQLLPAFALCTWMTPEMIQHRQVWKKIVP
FT                   ANTYENHLAGAAILTLIWFKGKHLWPLALASEIIEVCTLGWRCFNISVDQPIQTSDLTF
FT                   NDLDLNVVAKIGCDNSKKGQAEYKRRMGFVTLFEE"
FT   gene            complement(<69876..>70715)
FT                   /locus_tag="YALI0_E00704g"
FT                   /old_locus_tag="YALI-IPF4072"
FT                   /old_locus_tag="YALI-CDS4601.1"
FT   CDS_pept        complement(69876..70715)
FT                   /locus_tag="YALI0_E00704g"
FT                   /old_locus_tag="YALI-IPF4072"
FT                   /old_locus_tag="YALI-CDS4601.1"
FT                   /product="YALI0E00704p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78962"
FT                   /db_xref="GOA:Q6C7H9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H9"
FT                   /protein_id="CAG78962.1"
FT                   /translation="MSHHFEQRYDTTDEKLVIERCEQMKAGLGVNRATKNMASPLGRFS
FT                   LGAGWLMHWLYLHDTSLTGNMRTIVPVAGFVALVGVAFFISKAVVPKPIVFSEPNSHVT
FT                   INYYRFLFVVLSTRLYINGKFGLSSDGAVDYTVLGLKIAILIASQFWATLITKRLRYLP
FT                   GFGLPQVFSKKTLDRFGSMIFTKYVDVGLGVAWAFPLSYVALYAIVQPKDDGFELLGWP
FT                   LKALGLYVMAQVYGVHHKMAIPYFAYFHPVESLRFMEYGIDVTTEQGKLALQRRLGL"
FT   gene            complement(<71803..>73137)
FT                   /locus_tag="YALI0_E00726g"
FT                   /old_locus_tag="YALI-IPF4071"
FT                   /old_locus_tag="YALI-CDS2847.1"
FT   CDS_pept        complement(71803..73137)
FT                   /locus_tag="YALI0_E00726g"
FT                   /old_locus_tag="YALI-IPF4071"
FT                   /old_locus_tag="YALI-CDS2847.1"
FT                   /product="YALI0E00726p"
FT                   /note="highly similar to uniprot|P02557 Saccharomyces
FT                   cerevisiae YFL037w TUB2 beta-tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78963"
FT                   /db_xref="GOA:Q6C7H8"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002453"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR013838"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H8"
FT                   /protein_id="CAG78963.1"
FT                   /translation="MREIVHLSIGQCGNQIGSAFWQTISGEHGIGADGVYGGEEDIQRE
FT                   RLNVYYNEAAANKYVPRAVLVDLEPGTMDAVKGGPYGELFRPDNFVFGQSSAGNNWAKG
FT                   HYTEGAELVDQVLDVVRREAENCDSLQGFQITHSLGGGTGSGMGTLMIAKIREEFPERM
FT                   MATFSVVPSPKVSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICMRTLQLPHPVY
FT                   GDLNHLVSSVMSGVTTCLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTSLKSANF
FT                   RSLSVPELTQQMFDSRNMMAASDPKHGRYLTAAAFFRGKVSVKEVEDQMLSVQTRNSNY
FT                   FVEWIPHNVQTAVCSQPPKGLPMSGTFVGNSTSIQELFKRVGDQFSAMFRRKAFLHWYT
FT                   SEGMDEMEFSEAESNMNDLVCEYQQYQEAQVDDEEGEFYDEQDMM"
FT   gene            <75969..>77336
FT                   /locus_tag="YALI0_E00748g"
FT                   /old_locus_tag="YALI-IPF4069"
FT                   /old_locus_tag="YALI-CDS2743.1"
FT   CDS_pept        75969..77336
FT                   /locus_tag="YALI0_E00748g"
FT                   /old_locus_tag="YALI-IPF4069"
FT                   /old_locus_tag="YALI-CDS2743.1"
FT                   /product="YALI0E00748p"
FT                   /note="weakly similar to uniprot|Q12436 Saccharomyces
FT                   cerevisiae YLR130c ZRT2 low affininty zinc transporter
FT                   possible transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78964"
FT                   /db_xref="GOA:Q6C7H7"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H7"
FT                   /protein_id="CAG78964.1"
FT                   /translation="MRLVSFLPLLLIHTTAATSADTTAVDLSDFYAGTNPSALDSAISV
FT                   PEGNYKPKHVVHISRRRLICRTNEDTGEEICKVDNSDPQESIIEEVDCSKKERNTNVGL
FT                   RVGALFAVLGTSALGVFPPVLAESIWRINLETLPMTFIKQFGTGVVLSTAFVHLGAEAT
FT                   EEFNNPCIGEVEYKPTPLAFVLAGLFISFLIEYLGARLLRWRANTLEARRNENQDCEET
FT                   KCGHDHDHGHIIDNTGGDTEDSDNGGEPVQEIVEDVIEKAPSRLSSSSVRRSTTQTTAP
FT                   PPPIAGGCHSHGLIDPTDKFSVWIMEAGIIFHSVLVGVTVSLAEEDTFITLFIAILFHQ
FT                   MFEGVGLGSRIAGLKESRLISKCLMCLWFSIITPIGMAIGLGVLDHFEENPTTLWALGS
FT                   IDGLCCGVLVYAGVVEMLGFDWLFGDLQDAPPLRVCVGLVGLTLGMLLMSLVGHWA"
FT   gene            complement(<77644..>78597)
FT                   /locus_tag="YALI0_E00770g"
FT                   /old_locus_tag="YALI-IPF4067"
FT                   /old_locus_tag="YALI-CDS4183.1"
FT   CDS_pept        complement(77644..78597)
FT                   /locus_tag="YALI0_E00770g"
FT                   /old_locus_tag="YALI-IPF4067"
FT                   /old_locus_tag="YALI-CDS4183.1"
FT                   /product="YALI0E00770p"
FT                   /note="highly similar to uniprot|P41819 Saccharomyces
FT                   cerevisiae YPL266w DIM1 rRNA (adenine-N6 N6-)-
FT                   dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78965"
FT                   /db_xref="GOA:Q6C7H6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7H6"
FT                   /protein_id="CAG78965.1"
FT                   /translation="MAKAPAKKFSGGAQRESAGGEQRKTAVFKMNTDLGQHILKNPLVA
FT                   QGIVDKSDIKPSDTVLEVGPGTGNLTVRILEKARKVIAVEMDPRMAAELTKRVQGKPEQ
FT                   KKLEIMLGDCIKTELPYFDVCISNTPYQISSPLVFKLLNQPRPPRVSVLMFQHEFAMRL
FT                   LARPGDSLYCRLSVNVQMWAKVSHVMKVGRGNFRPPPNVESSVVKIEVKNPRPPIDFNE
FT                   WDGLLRVCFVRKNKTINAGFKTSAVLAVLEKNYQTWLSTQGEIIPEGSNLSDVVKQKIN
FT                   KILTDTGIGEMRSAKCDQTEFLTLLNEFHKAGIYFA"
FT   gene            complement(<79801..>81939)
FT                   /locus_tag="YALI0_E00792g"
FT                   /old_locus_tag="YALI-IPF4066"
FT                   /old_locus_tag="YALI-CDS1113.1"
FT   CDS_pept        complement(79801..81939)
FT                   /locus_tag="YALI0_E00792g"
FT                   /old_locus_tag="YALI-IPF4066"
FT                   /old_locus_tag="YALI-CDS1113.1"
FT                   /product="YALI0E00792p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78966"
FT                   /db_xref="GOA:Q6C7H5"
FT                   /db_xref="InterPro:IPR013889"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H5"
FT                   /protein_id="CAG78966.1"
FT                   /translation="MLSTCASNLEKQRDDFVRLNGWETWDIDYVRPSSIGLHEFVNQRK
FT                   ATLEPVLKNSSSEGEWFLEHTDLLPRLVALVKDTPRLVVLAAGNEDDIDNNDGHNAEDT
FT                   DHDKERLEGIATLCHQMEVAIEYTELCEQVIGHIDAEISQCMSTVFEIKEKRLESSFTG
FT                   QISASQLDHVAKEVYPWLTRQDKSIKETFCQLNDTKIKPLTVSLGFIPERVAQFSSRCE
FT                   PIFPTFSSLVNMNWTNLEQQWHNLKGEFALVNEELSTKKWSSILQLAIDQLGEDLDAAL
FT                   LTVLQRVCNDKNMFVEEVKVLSTKRLSTNSSIFSECSETTEISDHGAISPRLSFAPQFP
FT                   VNRRLHMRVVSLDRFSPKPVIKRHSTSENHVLRDIDSSKLNQQIESDKQLQERNDYANI
FT                   SSSDLSNSSSSSVIVSTPDSDALEASEPVVPLKDIQLPPSTSSHKKSPLHDMSVIMETL
FT                   ESIESPTASLGEGTTLRDSKDSKCGCNSGPIPNAAIFNKFRSLKTTKSFIPVTNSPNRL
FT                   LHRYPQLGSKPSTPDSASICSLSSCSDTSFGSSIGSTSTVKLGETPSLQPNGSSRQSLI
FT                   PLPSPNRPASRSSSRLGSYATPLATPTRKPRLSYSGTGAAGLSGMRSVSDTPVLTDASR
FT                   RRSESSTSSNSRRSSFLPSPVKRQSLMPPSTPRAVSREGYNSYHSGRVSREGIRGASSR
FT                   DGMSLANAGVRIAKPVVR"
FT   gene            complement(<82867..>83928)
FT                   /locus_tag="YALI0_E00814g"
FT                   /old_locus_tag="YALI-IPF4065"
FT                   /old_locus_tag="YALI-CDS3755.1"
FT   CDS_pept        complement(82867..83928)
FT                   /locus_tag="YALI0_E00814g"
FT                   /old_locus_tag="YALI-IPF4065"
FT                   /old_locus_tag="YALI-CDS3755.1"
FT                   /product="YALI0E00814p"
FT                   /note="uniprot|Q8J0I8 Yarrowia lipolytica Alternative
FT                   oxidase possible transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78967"
FT                   /db_xref="GOA:Q8J0I8"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J0I8"
FT                   /protein_id="CAG78967.1"
FT                   /translation="MTVRDWANRGQTYVNARAPNLLGRFRSTDDEDENNPSTELATDTT
FT                   SAYGSTAASVVTMANSKPDDVSLYATSSHHHEYFTGSAWIHPVYTKEQMDALEVNHRKT
FT                   ETFSDRVALRAILLMRIIFDLCTGYKHPKEGEAHLPKFRMTTRQWLDRFLFLESIAGVP
FT                   GMVAGMIRHLHSLRALRRDRAWIESLVEEAYNERMHLLTFLKLQKPSVQMRTGLLIGQI
FT                   IFYNLFFISYLISPATCHRFVGYLEEEAVITYTRCLEDIDAGRLPELASMEVPDIARTY
FT                   WHMEDDCTMRDLIQYVRADEAKHCEVNHTFGNLHQTSDRNPFALVIDNGRPQPSKDLTT
FT                   FRSVGWRRDEIAN"
FT   gene            complement(<84740..>86191)
FT                   /locus_tag="YALI0_E00836g"
FT                   /old_locus_tag="YALI-IPF4063"
FT                   /old_locus_tag="YALI-CDS2476.1"
FT   CDS_pept        complement(84740..86191)
FT                   /locus_tag="YALI0_E00836g"
FT                   /old_locus_tag="YALI-IPF4063"
FT                   /old_locus_tag="YALI-CDS2476.1"
FT                   /product="YALI0E00836p"
FT                   /note="similar to uniprot|P08465 Saccharomyces cerevisiae
FT                   YNL277w MET2 homoserine O-acetyltransferase possible
FT                   transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78968"
FT                   /db_xref="GOA:Q6C7H3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H3"
FT                   /protein_id="CAG78968.1"
FT                   /translation="MKFRRTKVVKENPFSGLVSDQEIAHVPEYQLESGVTIYNVPIAYK
FT                   TWGVLNEAGNNAMVICHALTGSADVSDWWGPLIGPGRAFDPTRFFIVCLNSLGSPYGSA
FT                   SPCTADNTPGADKNTYYGPEFPLVTVRDDVNIHRLVLDDLGIKQIACCIGGSMGGMLTL
FT                   EYAFFGKDYVRTFVALATSARHSAWCISWGEAQRQCIYSDPKYDDGYYSFEDPPSSGLG
FT                   AARMAALLTYRSRDSFENKFGRDTPDPTRHKTINGPQRRGPQTASEEHWLIHNDGHMRG
FT                   KKMADEEGSSTPTANGVSQPSSVSTNGSILDDTSSVSSSSSFVPLAVKKKPPTHFSAQN
FT                   YLRYQSDKFTKRFDANCYIAITRKLDTHDVSRERAESVEAALQTLEQNALIIGIKSDGL
FT                   FTFAEQELIAANVKNSHLVTIDSPEGHDAFLLDFALINKEIVEFLAANVPDIINTNGVS
FT                   WEEAKVGELGKSSLFGEAEVEITQW"
FT   gene            <87797..>88861
FT                   /locus_tag="YALI0_E00858g"
FT                   /old_locus_tag="YALI-IPF4062"
FT                   /old_locus_tag="YALI-CDS3750.1"
FT   CDS_pept        87797..88861
FT                   /locus_tag="YALI0_E00858g"
FT                   /old_locus_tag="YALI-IPF4062"
FT                   /old_locus_tag="YALI-CDS3750.1"
FT                   /product="YALI0E00858p"
FT                   /note="weakly similar to uniprot|Q8BX66 Mus musculus
FT                   Similar to ribonuclease P protein subunit P40"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78969"
FT                   /db_xref="InterPro:IPR013893"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H2"
FT                   /protein_id="CAG78969.1"
FT                   /translation="MSRTRIQYKAPVEKHVKEQNLPCGVDVVFPSNGSLQSSVETLIEQ
FT                   YSKELKSYTVKGPLSMFFAPREDGSSFSASVFQKSDAWIISKSRIDSDNVFAVWRGNVH
FT                   MSLTRSTYQTSGLNGKKSRYGDKYLISFNLRNPNFHIGTKQHNRFLFGLEQLDKLHPDL
FT                   EYSVTVHANDARYVSEYLSNVKEVPLKTTVSERNVLVPSMTPPVVPELTDAHSGAKVDV
FT                   SQKYRDHLFESWALGLQEWVGLASIGAGRIASDDNVNNLFSQYQVEDGQPANVTNIQVV
FT                   GMCPLLASKLKILGEQTNAPFFAFTVYGVQDTPYSWDNKEHQYDNGGENDYTIIDIGDD
FT                   VLSFETVGHSDMYI"
FT   gene            complement(<89038..>91215)
FT                   /locus_tag="YALI0_E00880g"
FT                   /old_locus_tag="YALI-IPF4059"
FT                   /old_locus_tag="YALI-CDS1059.1"
FT   CDS_pept        complement(89038..91215)
FT                   /locus_tag="YALI0_E00880g"
FT                   /old_locus_tag="YALI-IPF4059"
FT                   /old_locus_tag="YALI-CDS1059.1"
FT                   /product="YALI0E00880p"
FT                   /note="similar to uniprot|O43129 Aspergillus fumigatus MDR2
FT                   Multidrug resistance protein 2 possible transmembrane
FT                   segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78970"
FT                   /db_xref="GOA:Q6C7H1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030260"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H1"
FT                   /protein_id="CAG78970.1"
FT                   /translation="MLPRVARLSPLWHARSPLRPLPVRSLFLRPSSPSVYPTLAARPFS
FT                   SYLPILNQNKSKGISDDDATPVNVSPSERAKAAGDINLQAKLTSRNSDKNQGVGDIFRL
FT                   FRLVKDEVWPLIGAFTLLFLSAAISMTVPLSIGKIMDVVSEDEKDPEDADQRKVFGLPL
FT                   KQFYIALGGLFIIGAMCNMGRVYCLRVISERLSARLRAQLYKRTVTQDAEFFDANRVGD
FT                   LISRLSTDAQVVAKSVTNNMSDGVRSIISGVVGLGMMSYVSLKLATFMMLVAPPVAIIA
FT                   VIYGKKLRHISRELQTAVGGLTKVSEERLGNIRTAQSFGGEIQEVRLYNSKIRAVFDIG
FT                   KKDAMANGMFHGFFSLSGNMTILALLVMGSQMVSTGQLSLGDLTSFMLYAGYTGGAMHS
FT                   VSSFYSELMKGAGAASRLFELNDREPAINATKGPHLESARGNIDFNHVAFAYPTRPSLP
FT                   IFTDLNFSIPAGSNVCIVGPSGGGKSTITSLLLRFYDPTKGYISIGGNNIRDFNVRSLR
FT                   KQIGVVSQEPVLFSGTIASNIRYGKPEATRDEIIEAARKANCTFLADFPQGIDTQVGAR
FT                   GTQLSGGQKQRIAIARALIKNPAILILDEATSALDTDSESSVNEALQRLMDGNSTTISI
FT                   AHRLSTIKRADRVIVLSNEGTVAEQGKFTELYANHDSALSNLLRAKEEEEVAEPKITEG
FT                   EKATIEGEIESEISEEEAKDIEENRGNLIKN"
FT   gene            <92525..>95662
FT                   /locus_tag="YALI0_E00902g"
FT                   /old_locus_tag="YALI-IPF4057"
FT                   /old_locus_tag="YALI-CDS0392.1"
FT   CDS_pept        92525..95662
FT                   /locus_tag="YALI0_E00902g"
FT                   /old_locus_tag="YALI-IPF4057"
FT                   /old_locus_tag="YALI-CDS0392.1"
FT                   /product="YALI0E00902p"
FT                   /note="weakly similar to uniprot|P39985 Saccharomyces
FT                   cerevisiae YEL055c POL5 DNA polymerase V"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78971"
FT                   /db_xref="GOA:Q6C7H0"
FT                   /db_xref="InterPro:IPR007015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7H0"
FT                   /protein_id="CAG78971.1"
FT                   /translation="MASERPDQEYIDTFWKLSSNDPEERVEGCKELISTTDSDVKWNYG
FT                   IKRLIKGLASPKPSARLGFSTALTEFVSLPYGLTVDGYFDLLNEHLPLASGMKTKEIRN
FT                   TLLGRLFGIQAISGSQLLRIDDSEGFQRFIDYAVEISVKKAWLRELAFFAIVQFIKREL
FT                   GSKKKLADKSYIIEKLKDTKLDKTPEAVAVYLTIGGEEWDPLAKNNAVELGKILKDVSS
FT                   PQDDDNSKQKGNWSPKPNFVWPMILQILSEDEVEEVKESKKSKKDDKKKDKKKDKKKEE
FT                   IKDDSERITLPVFWNIVVDQSLFSQSASPERKYWGFEILQLALGIVSKDKVGILLSPNL
FT                   LRTLINQLGSSDRLLNKAAKHVVTKLCELAPTPVGPEIIKALLLNPGGSLNFDRLTKTK
FT                   TIHNMLANIDTSAVPTIIELLKQVFIAPEEKAGKALDGKRQWALDQMLGLVRRFQVEAL
FT                   ANADVDWIDEIIKFMIRWGFFKDNSGKKRKHDESDFVPLSHRTVKDCLGRFNSVLSSVL
FT                   NTARPDSNTWAYSAWNYLSGMMSEYELIYDIGQSTKGEKSGDEDEDEDDDEDDEDDEDA
FT                   MEVDAGEEVTEIKDKSVKTLDKIRHLRLSPHGDNALLKSFEVLFSLVLLQLYQQDEESI
FT                   GVLSDLLECYGKIREEDDEVLTDIIVSFISRRSALLKKMVDVVWEGLVLENKVNMQLVF
FT                   DVLKTEENVKGQEKLFGEEGEEDEDEEDEDEIERANAAMGNDDSDDDEEDADGEDNDSD
FT                   DSDDSDSDSDSDSDSDSESNSLSHNDISEADRKLTLALSEALGTKEEEDASDNDTDSSM
FT                   DDDQMLALDSQLATIFKERAQVEGDKENGKKVLTKNQQKKKDAAEAKESIVQFKHKALD
FT                   LIAVYLKSYVNREWGLEIFECGFILLDLVGATKDRALSDKTQTVLKQRLYKLRYQNFVA
FT                   EDAESELEELLAKCHDQALAASNPGHANVLAGMSMLVSKALEDRGQIEQVVRQYGDTML
FT                   EWINKPKSKLGPNMFFDLANWAGDLRKRAKEVKKAQVELTETINEEMAEKEEENNE"
FT   gene            complement(<96668..>97876)
FT                   /locus_tag="YALI0_E00924g"
FT                   /old_locus_tag="YALI-IPF4052"
FT                   /old_locus_tag="YALI-CDS3212.1"
FT   CDS_pept        complement(96668..97876)
FT                   /locus_tag="YALI0_E00924g"
FT                   /old_locus_tag="YALI-IPF4052"
FT                   /old_locus_tag="YALI-CDS3212.1"
FT                   /product="YALI0E00924p"
FT                   /note="weakly similar to uniprot|P38151 Saccharomyces
FT                   cerevisiae YBR233w PBP2 PAB1 binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78972"
FT                   /db_xref="GOA:Q6C7G9"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G9"
FT                   /protein_id="CAG78972.1"
FT                   /translation="MVKRSHNQLNEDEAHMRFIVASEQAEKLLIKKQQSLRELSKSLCI
FT                   KIKFSPFINTHTDRVMSITGTPENIGSTIGSLVRTWTGNNDDSSAQFTIQMIIPEPMVA
FT                   KIVGFKGYGLRKLHRKSGAAIEAIKDGLPDSTDRLFTATGVADSLHRAVYFTSLIFQEY
FT                   TGLLKRFEQESSPYEPRDNINPLRRRITGTYIPPDSPAHFVSRKKKTAETKHKHTMEVI
FT                   AGSSPNQPMVVSGSREAVSSACTKVEDLPQESIETLPCSPPPETEYKLASKRFESPPPS
FT                   PLLLDTPVKSQKEECILVCPPSPPLSIDDNVVTKRLMVTCPMVGTMLSLSEELLNLMRQ
FT                   NSGAAIRVKEIVSHEQIQLIITGTKSQVSRVMEDLTLTTRNSYLFTKAIEQSECEYLEE
FT                   QDA"
FT   gene            <101862..>102446
FT                   /locus_tag="YALI0_E00946g"
FT                   /old_locus_tag="YALI-IPF4051"
FT                   /old_locus_tag="YALI-CDS5537.1"
FT   CDS_pept        101862..102446
FT                   /locus_tag="YALI0_E00946g"
FT                   /old_locus_tag="YALI-IPF4051"
FT                   /old_locus_tag="YALI-CDS5537.1"
FT                   /product="YALI0E00946p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78973"
FT                   /db_xref="GOA:Q6C7G8"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7G8"
FT                   /protein_id="CAG78973.1"
FT                   /translation="MTNEDLLSDSENDEDFAYKSDKEEDFSDSDDESRKLQRRIDAENK
FT                   QAMAKEEVKVDKDAMRKIYEEMKSGSGAANEIKPVTVKKPDVTTTQTTQQETASTTPTA
FT                   STTSTTTSTTSAPAPASIPSSAATNKVKKPKRPKKGSLLDAMNKPKKKLNTLEQSKADW
FT                   GAFVDKEGIGHDLSQHNKDGYLEKRDFLDTH"
FT   gene            complement(<102773..>104830)
FT                   /locus_tag="YALI0_E00968g"
FT                   /old_locus_tag="YALI-IPF4050"
FT                   /old_locus_tag="YALI-CDS1217.1"
FT   CDS_pept        complement(102773..104830)
FT                   /locus_tag="YALI0_E00968g"
FT                   /old_locus_tag="YALI-IPF4050"
FT                   /old_locus_tag="YALI-CDS1217.1"
FT                   /product="YALI0E00968p"
FT                   /note="similar to uniprot|P53134 Saccharomyces cerevisiae
FT                   YGL114w possible transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78974"
FT                   /db_xref="GOA:Q6C7G7"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G7"
FT                   /protein_id="CAG78974.1"
FT                   /translation="MHELVILSTRSEDDSRPTESSNMQYSLLQNDTIVHLRRQVTLRAT
FT                   IAGLAIGSMILFSNFQFGLQTGWVSMMSLPSALISYAVFRAFPGLTKEFPFTREENVYA
FT                   QSVAVAVGTGPLAFGLVGIVPAIEKLLTPEENSGEPIFMHIGQLILWSLSLSLFGVFFA
FT                   VLLRRQVIVREQLKFPSGSATATMISVLHEREKVKAIVEADIEEEEEEENQDNRENDNQ
FT                   DQEQEQEQEQEQEQSQDPDQNRHVDQEEDAVSPSSYPSYARQVKILKISFAISATCTLI
FT                   QHFLPILRNLPVFGNWLAKNYLWTFNPSPGYIGQGFIMGLHTTSSMLLGCILGWGILAP
FT                   YSQYKGWAPGPIDDWKTGGQGWILWISLALMVGDSVVSLLVLTYKQVWHYFHAFQDTES
FT                   AYTSTEADDVEHEHPEYDLSSRFAGIGILLSSVLCLVGIKIVFPQIHLIQIIVSVFIAL
FT                   LLSVLGVRALGETDLNPVSGIGKISQIFLSLIPNSTILSNLVAGAIAEAGAQQAGDLMQ
FT                   DLKTGHLIGAYPKSQFIAQITGSLFSVFLSGLVYRLYMSVYEIPGSLFRIPTAIIWVDC
FT                   ARLVMGGGLPEKVGTFTAVFGVIGSALAILRDHVSLLPSGVAIGVGLYNVPSFTLARFL
FT                   GGVIAYFYQRRHPEAHIDIIVCSSGLILGEGIMSIVTMLLTALTEEHNHG"
FT   gene            <108979..>109602
FT                   /locus_tag="YALI0_E00990g"
FT                   /old_locus_tag="YALI-IPF4048"
FT                   /old_locus_tag="YALI-CDS5404.1"
FT   CDS_pept        108979..109602
FT                   /locus_tag="YALI0_E00990g"
FT                   /old_locus_tag="YALI-IPF4048"
FT                   /old_locus_tag="YALI-CDS5404.1"
FT                   /product="YALI0E00990p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78975"
FT                   /db_xref="GOA:Q6C7G6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G6"
FT                   /protein_id="CAG78975.1"
FT                   /translation="MGYTTPDSHIIGDHSFLDGGATPKFDGPMVRVSEKHQQAQDFVQT
FT                   LKTHAGRATNFNLHPSQPARPLLIHLALILAISLAVYLCFRVLNRTLRMLVRKIAPQSP
FT                   ITSAVPSPLKLDEKINLSPNSQASSGSPPMHTPTTPFEISELETGNWSSPSAPVSTSIS
FT                   TNAHNSREVDYHTDLPGRTASPAFVGHCSEREVPLDGFRVTTRC"
FT   gene            complement(<111182..>111748)
FT                   /locus_tag="YALI0_E01012g"
FT                   /old_locus_tag="YALI-IPF4047"
FT                   /old_locus_tag="YALI-CDS5606.1"
FT   CDS_pept        complement(111182..111748)
FT                   /locus_tag="YALI0_E01012g"
FT                   /old_locus_tag="YALI-IPF4047"
FT                   /old_locus_tag="YALI-CDS5606.1"
FT                   /product="YALI0E01012p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78976"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G5"
FT                   /protein_id="CAG78976.1"
FT                   /translation="MDDSLGIVKSHSAVQPHLPDIPFWPLFDTKEMTASRSRFHIGRQR
FT                   SEMRRYTWICVLKVSSTKHLRLWAAMISLVNRSKTSVPSEDREPSQYEHQTAGAWAGFC
FT                   CLCIVTKKCFHVTWGCVEYLRQLQPYNAVWRSLNDTTEPSYETLKTANNTDNAVTLRFE
FT                   LGSQKVSPDARLGNHVRDGYNPRLC"
FT   gap             113107..113206
FT                   /estimated_length=unknown
FT                   /note="gap of 100 nt"
FT   gene            <117557..>119554
FT                   /locus_tag="YALI0_E01034g"
FT                   /old_locus_tag="YALI-IPF4259"
FT                   /old_locus_tag="YALI-CDS1283.1"
FT   CDS_pept        117557..119554
FT                   /locus_tag="YALI0_E01034g"
FT                   /old_locus_tag="YALI-IPF4259"
FT                   /old_locus_tag="YALI-CDS1283.1"
FT                   /product="YALI0E01034p"
FT                   /note="some similarities with uniprot|Q09174
FT                   Schizosaccharomyces pombe SPCC736.04C Alpha-1 2-
FT                   galactosyltransferase possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78977"
FT                   /db_xref="GOA:Q6C7G4"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G4"
FT                   /protein_id="CAG78977.1"
FT                   /translation="MAVGALLYRWGWDLQSRSRNQNPHKRFLATSGSHSFRPKHSSRHR
FT                   TFLVCTARILCCNHPSKSVGNRFCTRCTSDNLYIFSTAFADVSPYDLHTVTPSTHAMPR
FT                   VSSTIGLAVLIALVMLVGVSLRPQSLSPFDKYAYNSSPSPSAGRAQAVSKAQVFHTSAS
FT                   PPKVVVAQTGLPGPVAQASGLAKAGQAAGKQVGPPPSPEQKPYDYEGPIVIMPDNLEKD
FT                   IEEYKARKKKEEEKRQKKEKEQKEAAEKKKQEDEKKKKEDAEKKKKEEEKRKEEEKKRK
FT                   EEEKKKKEEEEAKSREEEQKLRIQELAGDDSSFNSLKAKVEKFEKELEPLKKDLEAAKK
FT                   HKEETKKKDEEMRKEKEKEAAKKLSNGLQGDFHKLERAEIKAIVENPLNYTEAEKTDGG
FT                   HVAPYGGKVVILSASNNKTKSEQYMLERALLNRQEYCNMHGYTCRFINLDQVDDGKHHI
FT                   VWAKIKAIEMVFETDPEVEWVWWMDTDMIILNPYIELGEHILSDRALVERLTYGRPIRS
FT                   ADASFKGEIYHSKGQIEAKDIHLLLTQDFFGINAGSFFLRKSQFSKFLLDLWYDQHFID
FT                   KNYVFREQQALNHLLRSHKTVLQHTGLYPQRLFNSYLGNEKDVWKFKEDDLAVHFAGCG
FT                   SSRTCEDKFSRYMKIRKRVPKEFQVEFPKD"
FT   gene            complement(<120740..>123553)
FT                   /locus_tag="YALI0_E01056g"
FT                   /old_locus_tag="YALI-IPF4256"
FT                   /old_locus_tag="YALI-CDS0547.1"
FT   CDS_pept        complement(120740..123553)
FT                   /locus_tag="YALI0_E01056g"
FT                   /old_locus_tag="YALI-IPF4256"
FT                   /old_locus_tag="YALI-CDS0547.1"
FT                   /product="YALI0E01056p"
FT                   /note="uniprot|Q9HFV0 Yarrowia lipolytica C1-THFS protein
FT                   C1- tetrahydrofolate synthase precursor mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78978"
FT                   /db_xref="GOA:F2Z650"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z650"
FT                   /protein_id="CAG78978.1"
FT                   /translation="MASIIDGNSIAKNIRERLHTEIADVQQTNPRFQPSLVIIQVGDRP
FT                   DSSTYVRMKLKAADEAAIKCELKKLDENVSQHELLREITHLNEDPSVDGVLVQLPLPKH
FT                   IDETTITNAVAADKDVDGFGPLNIGELAKRGGNPSFVACTPKGVMELLKVAGIDVAGKT
FT                   AVVLGRSDIVGAPVSYLLRNADATVTVVHSKTANIPEIVKTADIVVAAIGQPGFVKGEW
FT                   LKPGAVVIDVGTNYIPDDTKKSGQRLVGDVDFESAKNVASHITPVPGGVGPMTVAMLLD
FT                   NVVLSAKRQAEKLTARSITPLPLKKENPVPSDFAISRAQEPKHITEVAAEIGVLPSELE
FT                   PYGAYKAKVQLPILDRLAHRKNGKYVLVTGITPTPLGEGKSTTTIGLVQALGAHLGKMA
FT                   FANVRQPSMGPTFGIKGGAAGGGYAQVIPMDEFNMHLTGDIHAISAANNLLAAAIDTRM
FT                   FHESTQKDAALYKRLVPAKKGVRTFTRGMQTRLKKLGIDKTNPDDLTEEEIAKFVRLDI
FT                   DPETITWRRVVDCNDRHLRGITVGQAPTEKGRTRETGFDISVASECMAILALANDLEDM
FT                   RERLGNMVIGSSKNGDPVTCDDIGAGGALTALMKDAIKPNLMQTLEGTPVFVHAGPFAN
FT                   ISIGANSVLADKMALKLAGTEPNESDDKAGFVVTEAGFDFTMGGERFFNIKCRSSGLAP
FT                   DVVVIVATVRALKSHGGGPEVKAGAPLPKEYTEENVELLREGCKNLGKHIENARQYGLP
FT                   VVVAINEFVSDTAAEHDVIREEALKYGAEDAVVAKHWAEGGAGAVDLAQAVVDASNKID
FT                   KDFKLLYEADTTAEEKLNTIAQKMYGAKDVELSELARKKIDAYTKQGFGNLPICVAKTQ
FT                   YSLSHDPTLKGVPTGFTVPIRDVRASVGAGYLYALAAEIQTIPGLPTHCGFMNVEVNDK
FT                   GEIEGLF"
FT   gene            complement(<124563..>125894)
FT                   /locus_tag="YALI0_E01078g"
FT                   /old_locus_tag="YALI-IPF4252"
FT                   /old_locus_tag="YALI-CDS2855.1"
FT   CDS_pept        complement(124563..125894)
FT                   /locus_tag="YALI0_E01078g"
FT                   /old_locus_tag="YALI-IPF4252"
FT                   /old_locus_tag="YALI-CDS2855.1"
FT                   /product="YALI0E01078p"
FT                   /note="similar to uniprot|P14743 Saccharomyces cerevisiae
FT                   YLR195c NMT1 N-myristoyltransferase (Glycylpeptide N-
FT                   tetradecanoyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78979"
FT                   /db_xref="GOA:Q6C7G2"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7G2"
FT                   /protein_id="CAG78979.1"
FT                   /translation="MSADKFNEILKMFQQQMAMQDIPDREKAKKWEEYLFWKTQPVPKF
FT                   DEDIDSEGPIEHKKLEDVRPTPYNLPAEYEWSDVDIENPEHIQEVYDLLYDNYVEDDDA
FT                   TFRFKYSASFLDWALKPPGWQKTWYPCVRVAATGKMVAFISAIPTSIQLRDNDLIKAVE
FT                   INFLCVHKKLRSKRLAPVLIKEITRRVNQKDIWQALYTAGVVLPSPVSTCRYYHRPLNW
FT                   TKLYEIGFSAIPPNQTAASMVARYTLPKEVPLKVRAMTKADVKAVHAILQNYLSAASEM
FT                   SQHFSEEEVAHWFVDPISEDKNDDKIVYSYVVEEDGKVIDFFSFYKLDHTVLKEWATES
FT                   NLRAAYGFYYATSSLSSAKARQDRVKELIGSAVILANNLGFEVYNELTLLDNPSHLDDL
FT                   KFGCGDGYLNYYLFNYRAQPVHGGLDKQKQLEQLDGKGVGVIML"
FT   gene            <126860..>128389
FT                   /locus_tag="YALI0_E01100g"
FT                   /old_locus_tag="YALI-IPF4250"
FT                   /old_locus_tag="YALI-CDS2282.1"
FT   CDS_pept        126860..128389
FT                   /locus_tag="YALI0_E01100g"
FT                   /old_locus_tag="YALI-IPF4250"
FT                   /old_locus_tag="YALI-CDS2282.1"
FT                   /product="YALI0E01100p"
FT                   /note="similar to uniprot|P21304 Saccharomyces cerevisiae
FT                   YLR196w PWP1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78980"
FT                   /db_xref="GOA:Q6C7G1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7G1"
FT                   /protein_id="CAG78980.1"
FT                   /translation="MISATKWVPRGYATEFPVKYTMDDEELERLSELAKLKIEEAKNEM
FT                   EDIEDATEEDVEALEEKAKLDEEIDNDPDLKEFGFDTYDDEPDSKLGLEGDGMDTDDDE
FT                   DEDEDENNEDEEGGELNLGSKHKVEGKDGEDPYISLPTQQDLDEEREELQILPTDNLIL
FT                   ATKTEDEISHLEVYVYDPEEANLYVHHDIMLPSFPLCVEWVNYNPREQGPGNFAAIGTF
FT                   EPEIEIWNLDVVDGVYPEVILGERDEKDKKKKGKKTNKINAERHTDAVLSLSSNPHHVN
FT                   LLCSGSADTTVKLWDLSNGKAASSFTFHSDKVSAVQWNPVEGTVLLSGGYDKKAIVSDL
FT                   RSEDKKVWKVDSDVESMNWKPCGTQFLVGTDSGMLYNFDVRNESKPLWTLQAHDSPLSA
FT                   FDYNKYIDGAIVTSSASTREVKIWRETNKDDKYSLSMVANRDLSCGKVFSVGFNPDQAC
FT                   AGTLCAGGHGGELKVWDMFGTKAVREAFDIKSSNHSNDVIGQAFDDEEEDE"
FT   gene            complement(<128769..>129545)
FT                   /locus_tag="YALI0_E01122g"
FT                   /old_locus_tag="YALI-IPF4247"
FT                   /old_locus_tag="YALI-CDS4816.1"
FT   CDS_pept        complement(128769..129545)
FT                   /locus_tag="YALI0_E01122g"
FT                   /old_locus_tag="YALI-IPF4247"
FT                   /old_locus_tag="YALI-CDS4816.1"
FT                   /product="YALI0E01122p"
FT                   /note="highly similar to KLLA0C06446g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78981"
FT                   /db_xref="GOA:Q6C7G0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="InterPro:IPR041174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7G0"
FT                   /protein_id="CAG78981.1"
FT                   /translation="MGAPTAKRQTQATEPTTDAPVAIPQTEGAEEDEVMISMDGPREDI
FT                   AVLQEKDDDAEMTLDQDGKPRFASAVNAGEGVKPGRMKVPIPPHRMAPLKNEWMKIYPP
FT                   LVEQLKLQVRMNPRKKQLELRTCSNTVDNSALQKGTDFVRAFTLGFDVDDAMAIIRLDE
FT                   LYVETFEIKDVKTLQGDHLGRAIGRIAGKDGKTKFAIENASRTRVVLADSKIHILGGFT
FT                   NIKIAREAIVSLILGSPPGKVYGNLRIVASRMKERF"
FT   gene            <130270..>132159
FT                   /locus_tag="YALI0_E01144g"
FT                   /old_locus_tag="YALI-IPF4246"
FT                   /old_locus_tag="YALI-CDS1445.1"
FT   CDS_pept        130270..132159
FT                   /locus_tag="YALI0_E01144g"
FT                   /old_locus_tag="YALI-IPF4246"
FT                   /old_locus_tag="YALI-CDS1445.1"
FT                   /product="YALI0E01144p"
FT                   /note="similar to KLLA0B04246g Kluyveromyces lactis
FT                   possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78982"
FT                   /db_xref="GOA:Q6C7F9"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F9"
FT                   /protein_id="CAG78982.1"
FT                   /translation="MATLHRVSRLCTRRLALPSQRSSWLKLTTLSPRPFLTHPTTLPVT
FT                   PWYSLRHSFHSTSGVRAELEETSRNVRKSSENLHNAAKELGSKSEGEKTVTDTDSVTDT
FT                   KPEDKPRWKRPTKEEMLSTATGFYNRMRVRFKWALFRQDRPTNMDDISAFLSWFMVGNI
FT                   VWIVLGTTTFFSLVLFTMNTVFAQEWIASKIGNIVSRQTGMSVVFEEAIVPHWKGGVIQ
FT                   FRNVFVSRRPGGGHKARKGSQGEAAALAGEKQYGSLSSAPPDDDGNYTQFDLTIETVDV
FT                   TLSFSKYMSGKGILKEVEVKGIRGVVDRNHLRWKRNQDPRNNRNVHKTGDFEIENFKLE
FT                   DALVSLHQPGRDKPFNVSVFNMELPQLRKHWLFYDLLSANNLSGSYDNSLFTIHPRQIH
FT                   GVPSSQLNEDKTWKKVSRLRVDKVNIEHLNRGVQGAFGWIVSGNVDLLADLMLPSDTDD
FT                   YTMSEMMKDVLERWEHTLMRRGRKSGDPISMPGGSHSDEPLTTSAQAAQAQKYLVLDLR
FT                   VQLNDVRAAVPLFNTDLNYVNNAMIRPIVAYINSRDTYIPINCRVVKKVDDFAGSWTMY
FT                   DSGLMDNISEEVYQAFAENVSNDEARHRRMKKVSLWSLQLAAQLLLLSIGTIA"
FT   gene            complement(<132305..>133531)
FT                   /locus_tag="YALI0_E01166g"
FT                   /old_locus_tag="YALI-IPF4244"
FT                   /old_locus_tag="YALI-CDS3155.1"
FT   CDS_pept        complement(132305..133531)
FT                   /locus_tag="YALI0_E01166g"
FT                   /old_locus_tag="YALI-IPF4244"
FT                   /old_locus_tag="YALI-CDS3155.1"
FT                   /product="YALI0E01166p"
FT                   /note="some similarities with uniprot|Q8I5S6 Plasmodium
FT                   falciparum PFL0625C Eukaryotic translation initiation
FT                   factor 3 subunit 10"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78983"
FT                   /db_xref="InterPro:IPR026822"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F8"
FT                   /protein_id="CAG78983.1"
FT                   /translation="MYSWCTYQLHKTALSIYTSRKSYTVSTHTVQHKILFPMISFNLKG
FT                   SKADTRPKKEQRPEESHGSLFEIEKETSNVKQVSEFVAGELPEKERLKLEEETRLREEK
FT                   AKTKKIIYLEEKNWRQDLVERREADLAQEEENPPKNEEVEEWKPQYGLSVFASRGGKIQ
FT                   EQRELQALRQDINALPDMASVEDYASMPVEDFGAALFRGMESALPQRVVTQAAKVPDKR
FT                   PALLGLGAKTLEEHLPEELGTWGKASRPKPEYTPVVMRNVRTGEIVDEKQVEKERESER
FT                   DGAIDQEREGSYDSRRDRDSRRPHSSRDRDRDRERSPKRSSRRDRDRRDDDRDRDRGDR
FT                   DRRGRRGEDDRSSQTDNDRRRRDRGGERDRDRRDRDERDRRDRDRRDRRDRDRDNNRRD
FT                   RDRDRARRR"
FT   gene            <134051..>135793
FT                   /locus_tag="YALI0_E01188g"
FT                   /old_locus_tag="YALI-IPF4243"
FT                   /old_locus_tag="YALI-CDS1729.1"
FT   CDS_pept        134051..135793
FT                   /locus_tag="YALI0_E01188g"
FT                   /old_locus_tag="YALI-IPF4243"
FT                   /old_locus_tag="YALI-CDS1729.1"
FT                   /product="YALI0E01188p"
FT                   /note="some similarities with uniprot|Q9P865 Candida
FT                   albicans She9 protein possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78984"
FT                   /db_xref="GOA:Q6C7F7"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7F7"
FT                   /protein_id="CAG78984.1"
FT                   /translation="MLTRRMQCLRGAGVFRTVAALPLLAQRPNFYRPLTCSALRRNNDH
FT                   SYRHESRKDKEMQDLKESRKMREQEALDDAAFRNTFEFAVEKTRDSDGKSPEPEVEIDV
FT                   DREAQTPWDPVGSQSRHETRQEHRERFDDIKKTLPSSVHESQPQMYKWFGEKMDQIQAG
FT                   ALTAGQTLNEVTGYKAIEKLKLSIEKLEDEVLEARAEVREAKRMYSDAISERSNSQREV
FT                   NELLQRKHNWTPADLERFTELYRNDHANEHSVNDAKKRLGECEHHVEDLTLQLSKQILT
FT                   RYHEEQIWSDKIRRASTWGTWILMGFNVVLFIVVQLGLEPWKRRRLVGSFEDKVKESLQ
FT                   EWEARNEARRLEEATMAATATQAITELQRRIESPHVSKADVVEAEAEINSIKTNLATWF
FT                   KEREEEEKEEIAKEAHELAVIAEDPDMTDVHHKPHPPQPVDTERVVRPHLVENFEHHVA
FT                   DPVHHPTLPITSTPVLEEDAPPPRIHPLVQMSPDSPDDGTKTFTATRDGYDVHPLVVRP
FT                   TTPPHFMLQVWGAAKLSVESATNKTVAVVRSTFQTAEQRPFESTIVASLGGLCGGLVTF
FT                   LYLR"
FT   gene            <138714..>139751
FT                   /locus_tag="YALI0_E01210g"
FT                   /old_locus_tag="YALI-IPF4241"
FT                   /old_locus_tag="YALI-CDS3839.1"
FT   CDS_pept        138714..139751
FT                   /locus_tag="YALI0_E01210g"
FT                   /old_locus_tag="YALI-IPF4241"
FT                   /old_locus_tag="YALI-CDS3839.1"
FT                   /product="YALI0E01210p"
FT                   /note="similar to uniprot|Q6C2I9 Yarrowia lipolytica
FT                   YALI0F07535g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F6"
FT                   /protein_id="CAG78985.1"
FT                   /translation="MVAIKNTLALTVLASVVSAQNPIVASLINDIVEGIAAAKTDNDIS
FT                   DEAATSEIQSVVGIIQQNTDVQQLVSQVIPIAAMGLNDDNFPQVLSAAHATLEAFQGSP
FT                   EYPEAVKGLKDVLPHYDVQEALGNVQNNLGNVLALITPSLPTLTPNHSEQWEAATKNVQ
FT                   ALAASLGFLPGGDDKQAEATSAEASKTEASASASATEASSKAEATSEAPKSEEASKTEE
FT                   SKSEESKAESKTEDASSAAATSAEASKTESKAESKTDASASASGSASGSASGSASGSAS
FT                   GSAAASSSAESSKPTSASVSATGGPSVAPSASPTVTAEQGNGASAYNLALGGVVGAAAM
FT                   VVALL"
FT   gene            complement(<140009..>142423)
FT                   /locus_tag="YALI0_E01232g"
FT                   /old_locus_tag="YALI-IPF4237"
FT                   /old_locus_tag="YALI-CDS0828.1"
FT   CDS_pept        complement(140009..142423)
FT                   /locus_tag="YALI0_E01232g"
FT                   /old_locus_tag="YALI-IPF4237"
FT                   /old_locus_tag="YALI-CDS0828.1"
FT                   /product="YALI0E01232p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78986"
FT                   /db_xref="GOA:Q6C7F5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="InterPro:IPR039874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F5"
FT                   /protein_id="CAG78986.1"
FT                   /translation="MATPRTTKRYGRTGSATRRQPEQMTLMSSFLSARDSPSPGLSNTT
FT                   PTTRERERNDSVALKSAGAKIDFGASEDPNQGASNSPLVGRVTKPTATRDSKTRPTLFR
FT                   RTRGASIFDTEPYKKADMTSGGSSSEPVATADPPTSAGRAATRAKRNSTKDSTSSNDTS
FT                   VHESQDNGFESPASDTPRTKRQTGKPTATATPQAQKNTGTPTAKGKKPAKRQTATPTTK
FT                   VRLTRSRSRSSSPAVKNSAPDKEDTLVKSSSSNGSSNGISPRSSQTLFSSQLVDTGNKL
FT                   AIDIDLEDTQNDMDVDTQTQTKVDIQAEKDKDDRIVFGPKRLFASAENNGLSGTSIFGS
FT                   AQKRKIRGLRTSTPSKKMTGKNKVVDGDIQMGLQDKPTPSSSFGSSFESSQGSQEPVRA
FT                   PLSVTTNKRTYGANRSYLADSPTKKESIYDSIMSESSDESEQEELNIKSVHELRETGGN
FT                   ARFMDEMEYLAEGLEDEGSSRRTTLLEICKKAKDPDFIRKLKTTDYADKILHVLPQVVE
FT                   TDQVASFLVLFIAQKIFGDNGANVLDTVINDPKFLDSIFLCLDNTESILRDKKSSKVFQ
FT                   KVLKEFVDGTTSASDDEPTPSPALAAIATLSTLQTYPGASGSTILKACLQPNNWDKFRK
FT                   FATNEFEKKGYKVLQLVVFFLDFCQSDIFFSSLASTLDELSTQLQKGQVNSTLVDLSLP
FT                   VLRLLIVHTNESSIPELDGSFVLKCITLAETLHERSEDTKLYEVYLLCLGFLENIIGAL
FT                   TSDYKKVYDIFTRLARGKEDKHCQAFLTLLRKNVATRGALKLSAQEKAELE"
FT   gene            complement(<142755..>143918)
FT                   /locus_tag="YALI0_E01254g"
FT                   /old_locus_tag="YALI-IPF4236"
FT                   /old_locus_tag="YALI-CDS3379.1"
FT   CDS_pept        complement(142755..143918)
FT                   /locus_tag="YALI0_E01254g"
FT                   /old_locus_tag="YALI-IPF4236"
FT                   /old_locus_tag="YALI-CDS3379.1"
FT                   /product="YALI0E01254p"
FT                   /note="similar to uniprot|P07172 Saccharomyces cerevisiae
FT                   YIL116w HIS5 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78987"
FT                   /db_xref="GOA:Q6C7F4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F4"
FT                   /protein_id="CAG78987.1"
FT                   /translation="MPNTKFNLETLARPNIRALVPYRCARDDYDSGVLLDANENPHGPA
FT                   IKTNQEESEYSLNRYPDPRQNFVKQLLCDLRNAERQVPKPITPDNIFMGVGSDEAIDAL
FT                   IRCFCVPGKDKLLTCPPTYGMYSVSAQINDVGVTKVPLAADFSLRPDAIIEALNADPTI
FT                   KLLYICSPGNPTAKLVDEDDVRKVLNADWNGVVVVDEAYIDFTREGASVSTLVNEFPNL
FT                   VVMQTLSKSFGLAGVRAGFTFSSVEIAALLNNMKAPYNISTPAAEFAARALSQEGVKLM
FT                   RTYTKDILEQRARILDALPTIEGVGRVIGGMDANFLLFEILNKAGEPDTELAFKVYEQL
FT                   AESRDVVVRFRGKEPGCAGALRVSIGTKTETDVLLDQLKQAIAALRQ"
FT   gene            <144388..>148451
FT                   /locus_tag="YALI0_E01276g"
FT                   /old_locus_tag="YALI-IPF40325"
FT   CDS_pept        join(144388..144423,144468..148451)
FT                   /locus_tag="YALI0_E01276g"
FT                   /old_locus_tag="YALI-IPF40325"
FT                   /product="YALI0E01276p"
FT                   /note="weakly similar to uniprot|P40477 Saccharomyces
FT                   cerevisiae YIL115c NUP159 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78988"
FT                   /db_xref="GOA:Q6C7F3"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR037686"
FT                   /db_xref="InterPro:IPR039462"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F3"
FT                   /protein_id="CAG78988.1"
FT                   /translation="MTIATLEETHTDKFGFKGLAGGQIQVVPGWGEEELGRKLVQLFDV
FT                   ANSSGLFVAAGNDDAFVVGKLSDLHEIGFTSEFKKSLEDKVTKHKLNGKPSHVGFTSDE
FT                   KSIYAGVDGELRVFATDKPDTQLKSIVLGDDIAQVLPNPRVASDAAVVTANGSLFFLDL
FT                   AKGTSKRIEVPESVTRASWSPKGKQLVAGTSGNCSIYQLRPDGSTAAVVEAPTNNEDEV
FT                   LSGTAEVTEILWLETHLFFVSYSKVDDEDTESSSYLIFRDKNGPTTYKKAEEDLSPPFG
FT                   DASRGRSWFSAVLRDYAGLDYLIATNFAPSTEITMLTKDEILRATDDSMNATMPYTDFD
FT                   TSAIGIGLDVTSKDDVDTPIPGASTSDPLPLLWILNNEGRLAGWHIVSLDGIKQHTAGV
FT                   EPLQKAISEAAKEASTAASLFGGDGGSSQQKTASPSPFAAGPGTASPFAAGASPFAADA
FT                   SPFAAGASGSPFAAGASKLSFSNFKNPTLPDEKPKSENTPTFGSSKFGDMKFGNSSFGS
FT                   SSFGSSGPGGSGGAFGAKVTFGSGSNPKEPSPVPEAQSTQPTSTPTIQKMDDDSDDEGH
FT                   NFKFDESMADDLEPTTEGDQTDQLLAALAKDDAPAAKDAPSKDGDSALFAPLTAQKGMG
FT                   LTSRHAKAKKDDKKDDKEDDTKPVPSFGFNLNKTSASATGKSKFGSQATGGSGFTFGKD
FT                   SNSESPFLAAAASNPFAGKGFFGSTEKKDEAEEKPKTDSAASNEPKITELSSGDDEGES
FT                   KKSEQSIADKPKELQVKDQSQPMERVSSREKTPIKELIKKFDSSSSQDLNKEDLQKLKA
FT                   ASGQTKSTPEVAVEDEDDEQEDDALEKLDQASFAKHTTHGKSDTDPAKFDDDAQEKAAL
FT                   EKLDEAGFAKEASSGSSGEAPKTSVKFDDDAEEDEALKRLNEASFTKEANGSSNQEGDS
FT                   SFAQFDEDDENEFDEFDDDYEDYEGEFTEENVDEEDEEDADYVHVHDERNQTESIDETY
FT                   EFDDGDDEHDDDFDNSVVDPSLKPPALPVSGVYSGFEPASSLPAAAVERAPMVSTETQT
FT                   EPEPEPAHEQPEPEPEPEPFAMPLPVPSMKMFEDSSTETPKTLGAAMEQIYLEVESEFE
FT                   TLTENYHLLETYLRDQDAFQEEEYALSITEVEKWRLGGAYELANEVFEELEKVSPYAAK
FT                   FEGADDDINKCNKGLGVLEYKIARYQSLRPKEEKEEVLRQRALSAREQKLKNSLRVKTE
FT                   KIRSDLIDLEATVTQMKAQTIFLNGGTYSTSITRIQDTIGRITENFRERLANLDAIEAT
FT                   ETLDNLSLASAGDVKAITTGDSSFVGPDESSYFIVPSDAPFANSFRQLMGGRQVM"
FT   gene            <150690..>151079
FT                   /locus_tag="YALI0_E01298g"
FT                   /old_locus_tag="YALI-IPF11573"
FT                   /old_locus_tag="YALI-CDS5941.1"
FT   CDS_pept        150690..151079
FT                   /locus_tag="YALI0_E01298g"
FT                   /old_locus_tag="YALI-IPF11573"
FT                   /old_locus_tag="YALI-CDS5941.1"
FT                   /product="YALI0E01298p"
FT                   /note="uniprot|Q8J0I7 Yarrowia lipolytica Putative sterol
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78989"
FT                   /db_xref="GOA:P80547"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="PDB:4JGX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80547"
FT                   /protein_id="CAG78989.1"
FT                   /translation="MSLKVDGFTSSIIFDVIRDGLNDPSQAKQKAESIKKANAIIVFNL
FT                   KNKAGKTESWYLDLKNDGDVGKGNKSPKGDADIQLTLSDDHFQQLVEGKANAQRLFMTG
FT                   KLKVKGNVMKAAAIEGILKNAQNNL"
FT   gene            complement(<152502..>153275)
FT                   /locus_tag="YALI0_E01320g"
FT                   /old_locus_tag="YALI-IPF40324"
FT   CDS_pept        complement(join(152502..153110,153174..153275))
FT                   /locus_tag="YALI0_E01320g"
FT                   /old_locus_tag="YALI-IPF40324"
FT                   /product="YALI0E01320p"
FT                   /note="weakly similar to uniprot|P53237 Saccharomyces
FT                   cerevisiae YGR057c LST7 required for amino acid permease
FT                   transport from the Golgi to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78990"
FT                   /db_xref="GOA:Q6C7F1"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="InterPro:IPR037520"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F1"
FT                   /protein_id="CAG78990.1"
FT                   /translation="MGHDKVLNLGQTCRTTTFINASTNTFLHQIMALLLCFAHFCDLHG
FT                   PTSILCCQKTKETTPNECSTCANCQLILPNDATTLRSNIGEHTYVSSQCAVGEDDYSKV
FT                   RKACLKLLSSETTFSDTPLMFGDSSGATIGYVFKVNDNESRGGIRKYGFLCLGEEKRLM
FT                   DNWIPITERFESMGGWIKTQVTKHQEMKDKSDWADSFRREAFTKPKNLVSMTKDDEFYV
FT                   KVHAGLSDLLNKVA"
FT   gene            complement(<153302..>153373)
FT                   /locus_tag="YALI0_E01342r"
FT   tRNA            complement(153302..153373)
FT                   /locus_tag="YALI0_E01342r"
FT                   /product="transfer RNA iMet (CAT) cove score=71.15"
FT   gene            complement(<153817..>154959)
FT                   /locus_tag="YALI0_E01364g"
FT                   /old_locus_tag="YALI-IPF4228"
FT                   /old_locus_tag="YALI-CDS3458.1"
FT   CDS_pept        complement(153817..154959)
FT                   /locus_tag="YALI0_E01364g"
FT                   /old_locus_tag="YALI-IPF4228"
FT                   /old_locus_tag="YALI-CDS3458.1"
FT                   /product="YALI0E01364p"
FT                   /note="weakly similar to uniprot|P18851 Saccharomyces
FT                   cerevisiae YOR212w STE4 GTP-binding protein beta subunit of
FT                   the pheromone pathway"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78991"
FT                   /db_xref="GOA:Q6C7F0"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7F0"
FT                   /protein_id="CAG78991.1"
FT                   /translation="MTDILRPDTPPSPTVEDLHERLSLLKGKCAAMRENIVHQRSQFMN
FT                   ATLPSLATDLRPISSTPLKVRHKLKGHRGKINSCDWASNSQYVLSVAMDGLALMWDAYS
FT                   SLKSRVFLLPSCYVLSCALPPSCGYLASGGLDNRVSIHSMTQSADETDPSVPYGSGSST
FT                   RMKGLTKSEPMAILKGHSAYVADLCFLTDQQIISASGDMTCCIWDVNTGRRVSTLYDHL
FT                   GDVSSVTKHPSKMQIVATASNDKTVKIWDLRIARCVQTFQGHNKDVTSVDFFPDGNAVL
FT                   SGGDDSTARLFDMRTDCQMNIYSAPDIMSPVNSVAVTPSGRIMFCGHDTGEVVAWDTIK
FT                   CTYLGPITKHLGPVTKVKVSPDGVGVLSSSWDETMTVLSL"
FT   gene            complement(<156538..>158106)
FT                   /locus_tag="YALI0_E01386g"
FT                   /old_locus_tag="YALI-IPF4227"
FT                   /old_locus_tag="YALI-CDS2179.1"
FT   CDS_pept        complement(156538..158106)
FT                   /locus_tag="YALI0_E01386g"
FT                   /old_locus_tag="YALI-IPF4227"
FT                   /old_locus_tag="YALI-CDS2179.1"
FT                   /product="YALI0E01386p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78992"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E9"
FT                   /protein_id="CAG78992.1"
FT                   /translation="MSLLSLPPETIAVILAFTSVEDLHNLRNSCCCLREAVDNSSHALT
FT                   AARALCAPWMQPADGSSAAGWLSLAMAELRRRDTMHGHARHHHQADYHHTSYHDALDLT
FT                   SPTDGLASLPLVEYAEEPEPVQTINHNLAPEASLYADIFPDGTLSISRAISDEYETKLC
FT                   FRRQIVFTHNFPIYPQTYGDYASNVYTPPVDGVQELNYARKTWFWRVVRNILEDDRVIR
FT                   RFHVSKAMYDGYLTALLRLRSTKLAPGMSPEMEWHRLGHSGSSSAGSTSDSSTGSIGLC
FT                   EEYELLRQKCIAPGRRNNIKTQSIRIHMPCSESARVFVYGHDTFICISNSLEDPVLKRN
FT                   DFFWVDWANSKTFRLCSTISPHGPTHPQHQHHPFIVDNRFFLLYRNQLVEWAMNASSQF
FT                   VPIGKTRLDLSYRRDFSLMPLLDTRTPVITGQMFVDTNNRSYSKVTLGDSSNSFHVLGV
FT                   LNGQKRDWTYQYLRELTEKLAMYRMPLNTWCHLDKILPHVVLSGGVQGEEQERIRGAVS
FT                   PTHSI"
FT   gene            <159324..>161354
FT                   /locus_tag="YALI0_E01408g"
FT                   /old_locus_tag="YALI-IPF4226"
FT                   /old_locus_tag="YALI-CDS1249.1"
FT   CDS_pept        159324..161354
FT                   /locus_tag="YALI0_E01408g"
FT                   /old_locus_tag="YALI-IPF4226"
FT                   /old_locus_tag="YALI-CDS1249.1"
FT                   /product="YALI0E01408p"
FT                   /note="weakly similar to uniprot|Q9HEL5 Neurospora crassa
FT                   12F11.110 putative Phosphoinositide phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78993"
FT                   /db_xref="GOA:Q6C7E8"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR022158"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E8"
FT                   /protein_id="CAG78993.1"
FT                   /translation="MQITLTQQGLTLQSQNGTRSLLDFATKSLTTLQDDTDSQNDTDGA
FT                   SVDTESPSLECLGIFGIFPIDVHSLAVITKREQVATLQNAPLYKITGALLIPLSYQRAR
FT                   AVFEASQNNTTAEPRRSTDSNESRGSSVADSEPSETETGTPSPVSPSTLKFIRECQKFL
FT                   SSGALFYSPKLNLHQSLKQGLLNKESKCSSYYLNYNRNRLFKDTEFELKIIQGHVGQVK
FT                   PESSNISVVLISRRSRHRIGARYLRRGIDDDANCANWVETEQLLVTPKYILSYVIVRGS
FT                   LPVFFQQSPYKLKPTPRVLRGAEATRKVFNTHFDRIESHYGSVTGVNLVEASSTSNEFK
FT                   VGNLYKKLCEQNGKELEWFDFHHACKGMKFERVSELFNSDVVQAGVDNFLWDGLNLQTG
FT                   NPTSVVQSGIFRVNCIDCLDRTNVVQTEIAKRVLEQQLEELNHDADNIVSSAYYHMWAD
FT                   NGDAISRQYSNTNALKGEFTRNRKRDFKGVVTDVGLTLTRFYSGMVSDFFRQALFDFLV
FT                   GNVDERVFSEFDETCASSDPRMYSKSAIEVASEICQDDVISGWWLESLQNSSNKYIVLL
FT                   TDTSIYVCQFDFMTERVSDFEKVDVDTISSVQFLGSSGSQVVISTSDKQFRLRNPTYNE
FT                   HMGDKLRQYCSEREIEVHDGDEQSTTFVSRMEQRLKRLIWA"
FT   gene            <161748..>162008
FT                   /gene="SNR17"
FT                   /locus_tag="YALI0_E01422r"
FT   ncRNA           161748..162008
FT                   /gene="SNR17"
FT                   /locus_tag="YALI0_E01422r"
FT                   /product="U3 RNA"
FT                   /note="C/D snoRNA SNR17 (U3 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<162381..>164597)
FT                   /locus_tag="YALI0_E01430g"
FT                   /old_locus_tag="YALI-IPF4225"
FT                   /old_locus_tag="YALI-CDS1017.1"
FT   CDS_pept        complement(162381..164597)
FT                   /locus_tag="YALI0_E01430g"
FT                   /old_locus_tag="YALI-IPF4225"
FT                   /old_locus_tag="YALI-CDS1017.1"
FT                   /product="YALI0E01430p"
FT                   /note="some similarities with uniprot|Q04383 Saccharomyces
FT                   cerevisiae YDR501w PLM2 PLasmid Maintenance mutant shows
FT                   2mu-m plasmid instability"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78994"
FT                   /db_xref="GOA:Q6C7E7"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E7"
FT                   /protein_id="CAG78994.1"
FT                   /translation="MYPNPHSLTRTILPIFLQQHHHHLSTLTKTTNMDTAIPSSPPKKL
FT                   LPAFPAMGKFVAGETTGITHVYRDESDDVLVPGIMSSSPVKRSHATAFGKDTNTNRSSP
FT                   VSHDTNSPPPSSPCPRHYSEDDIGDVTMTSINSDVSNDVSGAEAVAADTVDKLHLQSML
FT                   SREPRTALTSLPIVNLTRPSPNRINSLIMDKRVNQNKDLLSKPTTQELLAIMGEYYPPV
FT                   AIGRSSLQSQVVLSKSNRQISRRHVTTWYDLERHVIAISCSGWNGCRVMSSGRVFRTTE
FT                   NVTLLEEAKLKYGDIFEPSTETKDGQENAPCSSSSFGTFLFKNDRMEVDASEILVDVRG
FT                   ERFMIRLSDEGEEVADEDAEMTTDETDDEELVPLTSVSDNKLNTMKTDLNTKNTDTHFS
FT                   KKQKVVEEPIKATTGFPAVDKENQTQTPAVSTPATVTSTPTTVSSTPSSAKRSAKASNK
FT                   PVLKTVKVMKPVARQNVVRQVTRPAGRLEKPKMLEQKHAEKVAIDKTVKPVADKPIENA
FT                   PEKIETKAEPKAVKKPSEKSAESSEPVEPIQKPTEPIKPVIPSAVMASHARETTPVPQV
FT                   TMAASKSTPKSTPKAVAATPKSVSTPKTATSTPKRKKSPSPEIPLSPSKIDLKAIRNLV
FT                   CNHLAFSRLSCTPLQTVMAVSPKISMVPKSQLQQILRDIDCIGIIHREGKDASGKPLEE
FT                   EYYYVPERDSDKDRVKLVNETKGGAGVRSCRKVHKQYYWKKPTL"
FT   gene            <165297..>166020
FT                   /locus_tag="YALI0_E01452g"
FT                   /old_locus_tag="YALI-IPF40089"
FT   CDS_pept        join(165297..165303,165773..166020)
FT                   /locus_tag="YALI0_E01452g"
FT                   /old_locus_tag="YALI-IPF40089"
FT                   /product="YALI0E01452p"
FT                   /note="highly similar to uniprot|P49166 Saccharomyces
FT                   cerevisiae YLR185w RPL37A ribosomal protein L37.e or
FT                   uniprot|P51402 Saccharomyces cerevisiae YDR500c RPL35B
FT                   ribosomal protein L.37.e"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78995"
FT                   /db_xref="GOA:Q6C7E6"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E6"
FT                   /protein_id="CAG78995.1"
FT                   /translation="MTKGTTSFGKKHTKSHTLCTRCGKRSFHCQKKTCASCGYPSAKIR
FT                   SYNWGQKAKRRHTTGTGRMRSLKLVDRKFRNGFGNKASE"
FT   gene            complement(<166958..>169210)
FT                   /locus_tag="YALI0_E01474g"
FT                   /old_locus_tag="YALI-IPF4223"
FT                   /old_locus_tag="YALI-CDS0976.1"
FT   CDS_pept        complement(166958..169210)
FT                   /locus_tag="YALI0_E01474g"
FT                   /old_locus_tag="YALI-IPF4223"
FT                   /old_locus_tag="YALI-CDS0976.1"
FT                   /product="YALI0E01474p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E5"
FT                   /protein_id="CAG78996.1"
FT                   /translation="MLPLSLNAQLSKLDVEFDDDFFDEIDSGLAMASQMSKPIAPPTRA
FT                   DTRSIPTAKRDVRKDSARTDASETRIQADITMMAPDLNPKDAEIMYKQLDIENKELKRE
FT                   QTKQQDLMRLAENKLATATARHNHELAMAKKQHISVTAELEEKVKALQLEVERQNSNFA
FT                   FLQQELEITNKESRSSVHKPGTQRSRSSRDHSVTNVTRESDNPRKRKISGADEWGAMLP
FT                   KRAAKVATIDLNEEEEADFPDLDGPRFSKSARPTMADKRNTHRQGNGNGHKRAPSNMEN
FT                   ETIDLIDDIDTDFNDIDVVLTTEARPKMTSKAVVFKGTNEASWKHVQSTRYADIVAEYF
FT                   YTKQKIPQGEIVAETPALPFYLQDDKALDGVIKTMKDALLDNINNLNHFDMAQPFHYLR
FT                   EANLNVEVLNNIYTSIVAPGTHLIPAADITVLCEWVIKCRLLEDTRPLWQVDQNITPEV
FT                   SEEKGRKKSSRARRAAARRRGIKPDWMNFDSTLAEQSFRTSSNFQADICYNMYATACHV
FT                   VRFLRNYVELQYNQWTRGSPREKDVTSLIKMCVFLNNLSIATLRCDSMDILCTIVAEFN
FT                   PDPEVTESLETKQKITPFSAKLTAPKDRFYCVGFDLNVKGYSDGMRSPSEPLIPWSKIL
FT                   NDLDGELVAPLRKFQILACRKVMRLFYLLWKTDFALSHISDPAYAEMWMFSEVVETLTR
FT                   SLDNYSDPQLSKDCIRVLSLLKDDGIPKLTRRLFLSCLSRLQDIGIPELHTVAAMA"
FT   gene            <170217..>170993
FT                   /locus_tag="YALI0_E01496g"
FT                   /old_locus_tag="YALI-IPF4221"
FT                   /old_locus_tag="YALI-CDS4815.1"
FT   CDS_pept        170217..170993
FT                   /locus_tag="YALI0_E01496g"
FT                   /old_locus_tag="YALI-IPF4221"
FT                   /old_locus_tag="YALI-CDS4815.1"
FT                   /product="YALI0E01496p"
FT                   /note="highly similar to uniprot|Q06287 Saccharomyces
FT                   cerevisiae YLR186w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78997"
FT                   /db_xref="GOA:Q6C7E4"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E4"
FT                   /protein_id="CAG78997.1"
FT                   /translation="MKKEAKPVKPNDKPNDLQASKKDNKIENPSFVPEQPKPLSSKDKD
FT                   TKRLIVVLSQACLETHKIPSSGGDKYALLNCDDHQGLLKRMQRDIAEARPDITHQCLLT
FT                   LLDSPISKAGKLQVYISTARNVLIEVNPCVRIPRTFKRFSGLMVQLLHELSIRSVNSEE
FT                   KLLKVIKNPITDHLPHKCRKVTLSFDAPVVKTQDYIEKLDDDESICVFVGAMARGKDSF
FT                   ADEFVDEKIGLSNYPLSASVACSKFCHGAEDAWGIQ"
FT   gene            <174787..>175410
FT                   /locus_tag="YALI0_E01518g"
FT                   /old_locus_tag="YALI-IPF4219"
FT                   /old_locus_tag="YALI-CDS5405.1"
FT   CDS_pept        174787..175410
FT                   /locus_tag="YALI0_E01518g"
FT                   /old_locus_tag="YALI-IPF4219"
FT                   /old_locus_tag="YALI-CDS5405.1"
FT                   /product="YALI0E01518p"
FT                   /note="similar to DEHA0E16456g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78998"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E3"
FT                   /protein_id="CAG78998.1"
FT                   /translation="MACPLTPPYVFNSACSDDDKIQLKRRGDFADKVFLKKFKVLPSAD
FT                   SSESESCSETEIRPVSQRQRSVSATKLRRRRSFAPSSDVQARQRCLEYLVSAIDEVWAR
FT                   FCACTSFAEDQHYAYDMPSPKQDVDEDDEEIEDSGKLQALKERLTKAKYYLQDLSDVSD
FT                   MDASVSFWNRWDLVKYAVIEFVEDNGEEDDVIEGVCSELEEGRL"
FT   gene            complement(<176245..>176682)
FT                   /locus_tag="YALI0_E01540g"
FT                   /old_locus_tag="YALI-IPF20659"
FT   CDS_pept        complement(176245..176682)
FT                   /locus_tag="YALI0_E01540g"
FT                   /old_locus_tag="YALI-IPF20659"
FT                   /product="YALI0E01540p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG78999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E2"
FT                   /protein_id="CAG78999.1"
FT                   /translation="MEALGDLYTAGLHNVGLVPLSDVDAQRRCTVYLEDAVEKLKELIK
FT                   SEEVELSNKKTEPGAVPDNTLNELKNTLTILSNTGGIVQPSKGRYTYKNYTYKASQKFW
FT                   DYWDKIKKQVVEINEGVTRHSDDFNQKMATADALEKGRTIY"
FT   gene            <178951..>180033
FT                   /locus_tag="YALI0_E01562g"
FT                   /old_locus_tag="YALI-IPF4401"
FT                   /old_locus_tag="YALI-CDS3692.1"
FT   CDS_pept        178951..180033
FT                   /locus_tag="YALI0_E01562g"
FT                   /old_locus_tag="YALI-IPF4401"
FT                   /old_locus_tag="YALI-CDS3692.1"
FT                   /product="YALI0E01562p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79000"
FT                   /db_xref="GOA:Q6C7E1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E1"
FT                   /protein_id="CAG79000.1"
FT                   /translation="MLHLLPPEVLENVLGNLETLNDLLALSHTCHFARSVVLHNDQRFK
FT                   PHVQHLCQYMTPVSSWHSSLLRLPRNANNLGTPVDDTWTMSPAVFATEPTKDLLRLPHE
FT                   RLQTHFNRSPQQITHLFHDVRHRSLYGPIPDSQDTLFELRSGVGPVTRINMSTMSRSKA
FT                   PPHSCLHHLDTKVAIIEKFPQLNRLNHMNKRVVTGSRQHLRNVTTEVLVIDNDGEAVPL
FT                   ATFTDTISCRGEPHGSLCLSVAVCGTYVACIVGYSLFLFTKRDDQLYLADSYKLDALYS
FT                   PVSDSHNQECLLLQRSRSSGPGHDILFNISSKTVSVVEGGIYAISIDTNVWRFDDAFLQ
FT                   QCSVSPQEEMHWTSAEVMCG"
FT   gene            <180821..>181855
FT                   /locus_tag="YALI0_E01584g"
FT                   /old_locus_tag="YALI-IPF4402"
FT                   /old_locus_tag="YALI-CDS3849.1"
FT   CDS_pept        180821..181855
FT                   /locus_tag="YALI0_E01584g"
FT                   /old_locus_tag="YALI-IPF4402"
FT                   /old_locus_tag="YALI-CDS3849.1"
FT                   /product="YALI0E01584p"
FT                   /note="similar to DEHA0E11000g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79001"
FT                   /db_xref="GOA:Q6C7E0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7E0"
FT                   /protein_id="CAG79001.1"
FT                   /translation="MESLPIIDLALAQDPATKPQLLEDLKNALFRIGFLYLVNHGVEKE
FT                   ARALQKFSPKAFTDLSHQEKESIAMLNNPHFIGYTALGSETTAAKTDQREQFDFGSYGK
FT                   ESSWKEGDEPYKRLDGPNRFPEGKTGEEMKQAVTAYLDAMKEMNFKFLQLVAECLNLPK
FT                   NSVTDFLGEMDRLKLIRYPPGDGQGVGPHKDSSGMFTYVLQDQTGGLQVLNSEGKWIDA
FT                   TPIQDSLVCNIAQGFEALTDGHCGATTHQVQSQPKERHSIAYFCGVRLDLTREAVQEQC
FT                   RFIKDKIPSPQDARKREVDVASEFISEKYSCFGEAHLRNRIVSHRDVGKKWYPDLYDKY
FT                   ISDY"
FT   gene            <182922..>184604
FT                   /locus_tag="YALI0_E01606g"
FT                   /old_locus_tag="YALI-IPF4403"
FT                   /old_locus_tag="YALI-CDS1896.1"
FT   CDS_pept        182922..184604
FT                   /locus_tag="YALI0_E01606g"
FT                   /old_locus_tag="YALI-IPF4403"
FT                   /old_locus_tag="YALI-CDS1896.1"
FT                   /product="YALI0E01606p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79002"
FT                   /db_xref="GOA:Q6C7D9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7D9"
FT                   /protein_id="CAG79002.1"
FT                   /translation="MSDFKSDLKRGQSRKKRETLSCNPCRKRKRKCDHGTPCSNCVKLN
FT                   IEATCEYGSNSRWEESKDKEVKSPAFITQTSLDFLSNASSVSEIIHLFEKHLPIQTAPN
FT                   NNPLSIFSYKTEEYESAIANEPLPKNISDILIENYRNLVDPFFPIIDWKEFEEHYENLY
FT                   PGQAGPTPPSPPQPPSFLALIYTVYALSCKSCAFDSLLHTLHASAVIHFSDRAEQYLNR
FT                   IPLLVTSSIDDFRAALLYIYSSFSGDCLMVGWSLCGLLVTMSQRILPPFTASSDVKEAA
FT                   NHLISVSGTFFDACQAFVGHKSGLEYPQLPFSSYPFLHTTQKLYMFTRGLQNSHDSSDP
FT                   AELLRIDQIINTLPQGDPMEFMKKLALTTQWHKANLLLFRCGKIDRLSGLMSLLKLLEN
FT                   QFYLYSAPPQIQQYILFHWNNIYYHVFTGVIVLALELEATDPLPPLDPSVFPNLSKLNL
FT                   EEDKNWKSTLLAVLRDQYFDLRVNSECASARAHMITSAFLAQDTHMECPRPFGPFHKML
FT                   CLPSGFYICRFDRSYFQCGYGMELDRQIGRALYDSKESSKVFL"
FT   gene            <184985..>186484
FT                   /locus_tag="YALI0_E01628g"
FT                   /old_locus_tag="YALI-IPF4405"
FT                   /old_locus_tag="YALI-CDS2351.1"
FT   CDS_pept        184985..186484
FT                   /locus_tag="YALI0_E01628g"
FT                   /old_locus_tag="YALI-IPF4405"
FT                   /old_locus_tag="YALI-CDS2351.1"
FT                   /product="YALI0E01628p"
FT                   /note="similar to uniprot|Q04305 Saccharomyces cerevisiae
FT                   YMR093w and KLLA0F13772g Kluyveromyces lactis and
FT                   CAGL0J01265g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79003"
FT                   /db_xref="GOA:Q6C7D8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7D8"
FT                   /protein_id="CAG79003.1"
FT                   /translation="MSAPLNRLTIAKEVKKGSDLTPEQKFWKTYRSPLLVKEYNAISHV
FT                   SFNHHNDFAVTSSTRIQIFSGKTRKVTKTISRFKDTVYCGEFRSDGKLIVAGDATGLVQ
FT                   IFDAVSRNILVTLQASQLATHVTKFHPTNLTTLLTASDDRSVKLYDITSSTPLIEFEGA
FT                   QDYVRCGEFVDANVVAAGSYDGTVRLYDARSGKTPISSLAQDHPVEDVLYHNGMVLSAG
FT                   GPIVKAWDMTTGKTIRQMGNFSKTVTCLAPTHGASGFFAGSLDGHVKVFDDTSFKVTYG
FT                   WKYGSGVLCTGMSLDSQHIVAGLVSGIVAVRTQQPKKDEKISNGRVLDQKAAVEEEKKK
FT                   KAEGPVLGGTKYEGQFEHVIVEEHERPNKKLLKRYENLLLGFRWGDALDAALSGEHLET
FT                   SVLALEELKKRGKVRAALLNRDEDSLEPLFEFATKAIADSRYINIVADYVAVVLDMYTS
FT                   VITKSPILEERVSEFYDALKSEVETAKESKKIQGMLELLSV"
FT   gene            complement(<186671..>187895)
FT                   /locus_tag="YALI0_E01650g"
FT                   /old_locus_tag="YALI-IPF40330"
FT   CDS_pept        complement(join(186671..187737,187790..187895))
FT                   /locus_tag="YALI0_E01650g"
FT                   /old_locus_tag="YALI-IPF40330"
FT                   /product="YALI0E01650p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79004"
FT                   /db_xref="GOA:Q6C7D7"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="InterPro:IPR040203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7D7"
FT                   /protein_id="CAG79004.1"
FT                   /translation="MDIQTLRSEIKAWERAYADKHGRKPTPKEVKADPIAKKYHLYNKF
FT                   KKAESAGTGPSTPKRASKLHSSLNYKPVSFSVKTPEKQISKNRRRSVSKQQHADIVTPS
FT                   HRSLTFSKAPALSRTPQKQLQDTPKAATPKPSPSVPLGPTPSIHGRVVSLLEGLDGTPV
FT                   KEFATPGNVSTPVKVVSITSETPTNKPALDVNDEFTTPAYLNRISVDVSPFEKRLSFAE
FT                   RIRQSVVESPIKQMSPEKELSPANQTEEYDDDEDAWRELEGLPPKPKEPKIVDVTFDGE
FT                   EPDELDEIMGTVEVHNPYDEPVQDDLDWVHETALEGETALSAPIYKEGGIKKRKHQTQK
FT                   RTTKKAIVRVESEQHKKAKVDNDNFSTTNRLNTGFKVNMGQKQWASRFKK"
FT   gene            <188465..>190432
FT                   /locus_tag="YALI0_E01672g"
FT                   /old_locus_tag="YALI-IPF4409"
FT                   /old_locus_tag="YALI-CDS1324.1"
FT   CDS_pept        188465..190432
FT                   /locus_tag="YALI0_E01672g"
FT                   /old_locus_tag="YALI-IPF4409"
FT                   /old_locus_tag="YALI-CDS1324.1"
FT                   /product="YALI0E01672p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79005"
FT                   /db_xref="GOA:Q6C7D6"
FT                   /db_xref="InterPro:IPR040152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7D6"
FT                   /protein_id="CAG79005.1"
FT                   /translation="MIRVFLRQGRVLRPSTLQYRLRHFSDDKKPTQGLDFRALNNEIGG
FT                   ERQDKSSVENDNTPVSQAINGDIIGASSTSSETPSKPWYLRDQPEVKEEPVNIDLGLPD
FT                   GAMNDIAKQLARDAIYDIKYIPEQDILIGSGKSSRHIYKAGREVMGVLKHQHDVLPTAE
FT                   GLFKKNAQRMSYRRMLKKARKQNLEFPDSEWVVIDSQMGFHVHIFTAEKRELVNLEDLY
FT                   KFEMDEEEVEISPEDFAWAEKGQKNVIDGDEFLSGQHNSDPFLRSDSITGLPKKPSNNP
FT                   FDGGIGSGQRRSLHTSAPAATTLAVDFDGGSAAAKDDESKSHPSIIPLFMYQKWATQGD
FT                   KDQVLAKYDDLQPHANRKEIVLSAITNFLKLPTTGFNDVPQAVEELFEVFSPSDASNPE
FT                   WKEAFKALVNAYALNHKCVPTQALVDYLVAQQASGAAVVNWQVSEIVRATIDSTQYEQV
FT                   GVTSLKEWQRVVDAKIQIIKQLIESFGLVAPVRLLANDRFIRRVARSLTQRTSASFGLD
FT                   LVAKPETTKHPLDLRLKLLEESLPIKMLNRKTLFVFFAAYANSYAWNPFFKLLKRCHKE
FT                   TKTDNAHVQTIISLVLNSRDETAYYRLMESELGLLCDAQGELPLDKDIAVKLEKLMDNI
FT                   DPEGRRFQQLRHKTNTQLYS"
FT   gene            <191088..>191927
FT                   /locus_tag="YALI0_E01694g"
FT                   /old_locus_tag="YALI-IPF40331"
FT   CDS_pept        join(191088..191124,191266..191927)
FT                   /locus_tag="YALI0_E01694g"
FT                   /old_locus_tag="YALI-IPF40331"
FT                   /product="YALI0E01694p"
FT                   /note="similar to DEHA0D03091g Debaryomyces hansenii and
FT                   KLLA0D03388g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79006"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7D5"
FT                   /protein_id="CAG79006.2"
FT                   /translation="MSAQTERRIIGDDYNHATDGEYKKLRDMAHKEYERRKELSQKSQQ
FT                   AYKSGDGAGAKQLSEEAKKHGEKMDQYNRQAAEYVFRENNTDSAHDEIDLHGLYVEEAE
FT                   EFLGQRIQAAMQRGDPVVKAIVGKGLHSSGGVAKIKPAVEKLCNEHRLRHHIDPKNAGV
FT                   MIIELPNGPQQPGQVYQQPGPQQQPHYQQQQHQGNYQGNQYHQQQQQGQGKNDNLLVNI
FT                   LCFCINKFLK"
FT   gene            <192166..>192237
FT                   /locus_tag="YALI0_E01716r"
FT   tRNA            192166..192237
FT                   /locus_tag="YALI0_E01716r"
FT                   /product="transfer RNA His (GTG) cove score=66.09"
FT   gene            complement(<192425..>193261)
FT                   /locus_tag="YALI0_E01738g"
FT                   /old_locus_tag="YALI-IPF4412"
FT                   /old_locus_tag="YALI-CDS4612.1"
FT   CDS_pept        complement(192425..193261)
FT                   /locus_tag="YALI0_E01738g"
FT                   /old_locus_tag="YALI-IPF4412"
FT                   /old_locus_tag="YALI-CDS4612.1"
FT                   /product="YALI0E01738p"
FT                   /note="similar to uniprot|Q9P7V4 Schizosaccharomyces pombe
FT                   SPAC30.02C"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79007"
FT                   /db_xref="GOA:Q6C7D4"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7D4"
FT                   /protein_id="CAG79007.1"
FT                   /translation="MPLLLITGYPSAGKTTRAMQIKDYFEKKIQETGSNLTVEVINDES
FT                   LGLSKDSYKESRTEKMTRGEQISAVKRLVSKNTIVILDNMTYIKGFRYQLWCEAKAVAT
FT                   NYGVAHVGAPVDVCKEYNSIHPNKWEDDLFDALVFRYEEPNGANKWDSPLFTIPHIDKD
FT                   ISGEEMWNALVHRKVLKPNQATVLKPATSTDYLYELDKKTQTIVSEILDIQRDNVGGLV
FT                   KLDGGNHSLQLPIDAVSLPELQRMRRQFVTLNKMRALGDDRIIPLFIEFLEKNFDE"
FT   gene            <193622..>194818
FT                   /locus_tag="YALI0_E01760g"
FT                   /old_locus_tag="YALI-IPF4414"
FT                   /old_locus_tag="YALI-CDS3254.1"
FT   CDS_pept        193622..194818
FT                   /locus_tag="YALI0_E01760g"
FT                   /old_locus_tag="YALI-IPF4414"
FT                   /old_locus_tag="YALI-CDS3254.1"
FT                   /product="YALI0E01760p"
FT                   /note="similar to KLLA0F02904g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79008"
FT                   /db_xref="GOA:Q6C7D3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7D3"
FT                   /protein_id="CAG79008.1"
FT                   /translation="MREYQVNMAASICRCGAELLTRRGIRMLSTSTVATQSRSGSPTDT
FT                   QKRPNKISQEKQDKPKSLFVPRTSFDPVQVSTSNFTHFHKEFLKKGMSMHPHLTLELRD
FT                   ARAPLSTGNVLLSNSFSSAIGSNRLYLYSKSDASLLDDETLKQWHPQGNYLQIDCRSRQ
FT                   AAVKIMKYAATVFQKIDPPPPVGFNMLICGMPNVGKSTLVNTMRRLVVEKTNDWKMQGK
FT                   KRSVAPVGQQAGVTRALSNRIKVCDSPNIFVFDSPGLFMPSIANSETMIKLALLKCIKE
FT                   SLVDPIVQADYLLYALNRDDPKSYRDLCPPTNDINDILVALRRKWRSTPNQDAGTALRW
FT                   INEWVSGKKGKVMLDAATPEAFDTYNQKESERMRAWMVKFQQRGKEKGGNRASKIFRA"
FT   gene            <196313..>198130
FT                   /locus_tag="YALI0_E01782g"
FT                   /old_locus_tag="YALI-IPF4416"
FT                   /old_locus_tag="YALI-CDS1579.1"
FT   CDS_pept        196313..198130
FT                   /locus_tag="YALI0_E01782g"
FT                   /old_locus_tag="YALI-IPF4416"
FT                   /old_locus_tag="YALI-CDS1579.1"
FT                   /product="YALI0E01782p"
FT                   /note="similar to uniprot|Q03532 Saccharomyces cerevisiae
FT                   YMR290c HAS1 helicase associated with SET1P"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79009"
FT                   /db_xref="GOA:Q6C7D2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7D2"
FT                   /protein_id="CAG79009.1"
FT                   /translation="MGLTKKEKVEKKARSVVKGKADKKAKVEKPSSKPAKSAKPSKSKD
FT                   EVDELDDEFDEVEGLLEKGDVEEEDEEETNGNEDSEMSDDDEKDVEIEEEDDGEGSDLE
FT                   EEESTAVVTTAPADAEVVHIASDAERKPFSTIPLSENTMQSLKDMGFETMTPVQEKTIP
FT                   PLLAGRDVLGAAKTGSGKTLAFLIPAIEMLRKLKFKPRNGTGVIVVSPTRELALQIYGV
FT                   ARDLMANHSQTLGIVIGGNNRRQEEEKLNKGVNLLVCTPGRLLDHLQNSQGFVFKNLKA
FT                   LIIDEADRILEIGFEQEMKEIIKILPKERQSMLFSATQTTKVEDLARISLKKGPLYLNV
FT                   DEHNVSSTAEGLEQGYVVCDSDKRFLLLFSFLKRNAGKKIIVFLSSCNSVKFYGELLNY
FT                   IDLPVLDLHGKQKQQKRTNTFFEFINAKQGVLICTDVAARGLDIPKVDWIIQFDPPDDP
FT                   RDYIHRVGRTARGSASGKSIMFLTPSELGFLRYLKAAKVPLNEYEFPNKKIANVQSQLE
FT                   KLISSNYWLNTSAKDGYRAYLQAYASHHLKTVYQIDKLDLVKVAKSFGFNVPPKVNISI
FT                   GASGKGAKSIKGKDNHKKRGGPGGKKFTR"
FT   gene            complement(<198421..>199425)
FT                   /locus_tag="YALI0_E01804g"
FT                   /old_locus_tag="YALI-IPF4417"
FT                   /old_locus_tag="YALI-CDS3964.1"
FT   CDS_pept        complement(198421..199425)
FT                   /locus_tag="YALI0_E01804g"
FT                   /old_locus_tag="YALI-IPF4417"
FT                   /old_locus_tag="YALI-CDS3964.1"
FT                   /product="YALI0E01804p"
FT                   /note="weakly similar to uniprot|Q03289 Saccharomyces
FT                   cerevisiae YDR459c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79010"
FT                   /db_xref="GOA:Q6C7D1"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7D1"
FT                   /protein_id="CAG79010.1"
FT                   /translation="MNRAAFRQALRIVFPGVILGLLGYGTYAYCYILCWNLYHHMGYRA
FT                   GLALLIVYCILKTLVFIYWAAVVIVGPGKVTGVSPLQIFIPGSEVVDEKAQAIVSRQIN
FT                   PKLPDTYICDGWGMPKWCSECQTHKPDRTHHSAIVGHCVPKMDHMCFWVGTVIGQHNYK
FT                   IFLQYTTLFSTYLIYTLVTTAVFTPRMGQYRRDRGAPDSIPNGNIIALLILTGAWAAFC
FT                   TSVCLQSFWGVCRNLTAMEGLGRKQGDMVLVNFRYEGKRIIQPLREEDPLPFDQGFAKN
FT                   WRQVFGTNPLIWFLPFPVVPAAEDYFSNAYGQKFLERIPARWLEGDGREMAAV"
FT   gene            <200057..>201097
FT                   /locus_tag="YALI0_E01826g"
FT                   /old_locus_tag="YALI-IPF4418"
FT                   /old_locus_tag="YALI-CDS3826.1"
FT   CDS_pept        200057..201097
FT                   /locus_tag="YALI0_E01826g"
FT                   /old_locus_tag="YALI-IPF4418"
FT                   /old_locus_tag="YALI-CDS3826.1"
FT                   /product="YALI0E01826p"
FT                   /note="similar to uniprot|Q03290 Saccharomyces cerevisiae
FT                   YDR460w TFB3 TFIIH subunit (transcription/repair factor)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79011"
FT                   /db_xref="GOA:Q6C7D0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7D0"
FT                   /protein_id="CAG79011.1"
FT                   /translation="MSEDGDICPICKSSRYLNPDMKFLVNPQCYHKMCESCVDRLFAYG
FT                   PVTCPHNGCEKILRKNKFKTQIFEDVAVEKEVDVRQRVMSVMNKREDEFDTLNDYNAYL
FT                   EKIEDSIFTLLNGTADEKDALTKEIEAYEKEHKAEIIANNKLRDEEDKYEQQKEDWMKE
FT                   QRKANYLMAVEEQRAAQEDKEAAKRELVHQLATSNKDASSIEQNVQKTALKRSSARTVN
FT                   FQPMPTSRYFEKVKKESSKPETPFTPFNGDRQIPALFEVQDHYDDKVIEPLAHDIQHQA
FT                   GGFTLKAAYARILQQAFFGLGVDVQTELLAEENGNSNGTAVPVKTEEDPVKLEEPSIQV
FT                   KVESTV"
FT   gene            complement(<201291..>201800)
FT                   /locus_tag="YALI0_E01848g"
FT                   /old_locus_tag="YALI-IPF11569"
FT                   /old_locus_tag="YALI-CDS5768.1"
FT   CDS_pept        complement(201291..201800)
FT                   /locus_tag="YALI0_E01848g"
FT                   /old_locus_tag="YALI-IPF11569"
FT                   /old_locus_tag="YALI-CDS5768.1"
FT                   /product="YALI0E01848p"
FT                   /note="similar to wi|NCU02935.1 Neurospora crassa NCU02935.
FT                   1 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79012"
FT                   /db_xref="GOA:Q6C7C9"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7C9"
FT                   /protein_id="CAG79012.1"
FT                   /translation="MKFPQFDQEIAISYFSDVKNAGQIRNELLSGNPDYQVAFINANTL
FT                   LSSKHLLAAVYRAVSDQEAGSMKTKNVHSEVLFCLGGNNNIMDSLRRFGIQDDTTNIVA
FT                   VKIGGGEYTKLVEGTEEPFTDEQIAKNTDIKLVKKVYKLPGTVSLDDRAQVETAAIGAL
FT                   LLRGFS"
FT   gene            <202254..>204018
FT                   /locus_tag="YALI0_E01870g"
FT                   /old_locus_tag="YALI-IPF40332"
FT   CDS_pept        join(202254..202266,202310..204018)
FT                   /locus_tag="YALI0_E01870g"
FT                   /old_locus_tag="YALI-IPF40332"
FT                   /product="YALI0E01870p"
FT                   /note="similar to uniprot|P46680 Saccharomyces cerevisiae
FT                   YMR092c AIP1 actin cytoskeleton component"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79013"
FT                   /db_xref="GOA:Q6C7C8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C8"
FT                   /protein_id="CAG79013.1"
FT                   /translation="MISPVKTSVASPATTKGVAVHLSYNPKTNEVAYANTKAVLLVNLD
FT                   KPNEARQFNGHIAPTTVAKFSPSGFYVCSGDQAGNVKVWDPVSFNIKYEAKIGNGRIND
FT                   LNWDADSQRIIAVGDGTERYGHCFTFDTGNTVGEISGHGAQVNAVAIKPVRPYRAATVG
FT                   DDATLVFYKGPPFKFDHTVKQQHSNYIHDVAFSPDGKWLVSVGADRKAVLYNQDGEPVK
FT                   TIDAHGGSIYSVSWAQDSTHFATASADNTVKVFDVEGKEIDTFKFDQFQVGVVWAGDSL
FT                   VSVGLDGTLSFSSVSIDALSKLSLTESKVIAHQQPISAVETLKGKIYSGSVDGSILEWT
FT                   GDKASPSDASHSTYIVSLSDCDGSLASVAWDDTYKLNNTVYSIGTQPKAADSRGSLSAI
FT                   VTENTLHILDSGKLVKKVSIDRGSAVAIADQVVVGSKSGELSVYSTTGEKQFDLPPLRA
FT                   AATKLALSENGNLLAAGESTGKIILYDLSTKSVVTSRWTFHTAQINDIDWLGNEYIASV
FT                   SLDTNIYIYSVKTPMKNLKSLNAHKEGATAVRWLANNEIVTGGADAVLKWWSVELS"
FT   gene            complement(<204698..>205939)
FT                   /locus_tag="YALI0_E01892g"
FT                   /old_locus_tag="YALI-IPF4422"
FT                   /old_locus_tag="YALI-CDS3105.1"
FT   CDS_pept        complement(204698..205939)
FT                   /locus_tag="YALI0_E01892g"
FT                   /old_locus_tag="YALI-IPF4422"
FT                   /old_locus_tag="YALI-CDS3105.1"
FT                   /product="YALI0E01892p"
FT                   /note="similar to uniprot|Q9HEK0 Neurospora crassa 15E11.
FT                   10 Probable alpha-1 2-mannosyltransferase possible
FT                   transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79014"
FT                   /db_xref="GOA:Q6C7C7"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C7"
FT                   /protein_id="CAG79014.1"
FT                   /translation="MTPLIVRRLFLLLVTASLGLLVFLIYFSLQDDWTRTHADFLKEES
FT                   IYKQPNDAFLQYTEPKEDLTPKNNPLLEEVDEPVSAKPLVRATDTRRTKAALISLVRNK
FT                   ELDGIVDAMVQVEDTFNHKFGYPWIFFNDEEFTDEFKEKVREQTDSEVKFELIEKKDWD
FT                   APRWIDKDKAKKAGKKLEDAGVRYGAMDSYHKMCRWNSGMFYKHKAMDDYDWYWRVEPD
FT                   TQYYCDIDYDVFAYMEDNDKVYGFTIALFDNPKTVATLWPETKSFLMKNKEYLHKDNAM
FT                   QFLLNPSRPDWNAQAGGYSTCHFWSNFEIASLKFFRGDAYAQWFEHLDKQGGFFYERWG
FT                   DAPVHSVGAGLFANQSQIHWFKDIGYYHFPYFNCPKSKKCHGCKPGRFTTDDLKDSLMP
FT                   ENCLPQYLKYMGDR"
FT   gene            <206144..>206545
FT                   /locus_tag="YALI0_E01914g"
FT                   /old_locus_tag="YALI-IPF40088"
FT   CDS_pept        join(206144..206169,206257..206545)
FT                   /locus_tag="YALI0_E01914g"
FT                   /old_locus_tag="YALI-IPF40088"
FT                   /product="YALI0E01914p"
FT                   /note="similar to uniprot|Q9UR27 Schizosaccharomyces pombe
FT                   Putative mitochondrial 60S ribosomal protein L31 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79015"
FT                   /db_xref="GOA:Q6C7C6"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C6"
FT                   /protein_id="CAG79015.1"
FT                   /translation="MVTFGGYVHKQRYRWRLSPTQKAGQRKRMKAVDSVMDVLRSSMEK
FT                   LGVTPKFLIKAETECPPSSAMLPKDKYTVFSKNHKGYRKSVHRVPNFTKTTNRKNPLGF
FT                   "
FT   gene            complement(<207077..>207811)
FT                   /locus_tag="YALI0_E01936g"
FT                   /old_locus_tag="YALI-IPF4423"
FT                   /old_locus_tag="YALI-CDS4970.1"
FT   CDS_pept        complement(207077..207811)
FT                   /locus_tag="YALI0_E01936g"
FT                   /old_locus_tag="YALI-IPF4423"
FT                   /old_locus_tag="YALI-CDS4970.1"
FT                   /product="YALI0E01936p"
FT                   /note="similar to uniprot|P34247 Saccharomyces cerevisiae
FT                   YKL099C U3 small nucleolar RNA-associated protein 11 (U3
FT                   snoRNA-associated protein 11)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79016"
FT                   /db_xref="GOA:Q6C7C5"
FT                   /db_xref="InterPro:IPR007144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C5"
FT                   /protein_id="CAG79016.1"
FT                   /translation="MARLVHNIQKKQHRERSQIAERRHLGLLEKKKDYKLRAENYHAKE
FT                   AKLKLLRKKAKERNPDEFYFGMHSTKTDEHGIGYKENPLDVAERELSADAKKLLQTQDA
FT                   TYVRTMRLKELRVIERMQAELMPKATGKHTIFVNSEKEQEEFDPAEYFKTDKTLLNKRE
FT                   NRLKLDQLEQKQTHAQELDEGINKERVSRLKKLAAHIERERELAIVEHRLDLDRELAKG
FT                   GEKEKVVKDGNVSYKWKAERKK"
FT   gene            <208361..>209302
FT                   /locus_tag="YALI0_E01958g"
FT                   /old_locus_tag="YALI-IPF10719"
FT                   /old_locus_tag="YALI-CDS4221.1"
FT   CDS_pept        208361..209302
FT                   /locus_tag="YALI0_E01958g"
FT                   /old_locus_tag="YALI-IPF10719"
FT                   /old_locus_tag="YALI-CDS4221.1"
FT                   /product="YALI0E01958p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C4"
FT                   /protein_id="CAG79017.1"
FT                   /translation="MSFQERCMELKQILNFDVDIFTAIIIGLAAQRPVRIHTHHPDVVE
FT                   KCALVVAANILGYDQRLLYRCDADADVDHFLNGVSDWRESAQTDKQLMPFLILRNVASL
FT                   SNECQALLLEILQTGKTTYRGVTYSKPPGFLLLSVSKSDVYMFEYLRDEFFVYHECHVD
FT                   GEVNIAQLIESISEEKTASPPLMTAADIKKLHDKAAQVSIVAELQRYMQDIIVHIRCHR
FT                   VVARAIKPKAARDFTLFVRHMCVLNDSDFATPSVIAVAARKLLPSSVHIASPEFEPSLA
FT                   YGSDYKLIEEYITSWDGALVVEDVLNRVKAPV"
FT   gene            complement(<209453..>210022)
FT                   /locus_tag="YALI0_E01980g"
FT                   /old_locus_tag="YALI-IPF2522"
FT                   /old_locus_tag="YALI-CDS5593.1"
FT   CDS_pept        complement(209453..210022)
FT                   /locus_tag="YALI0_E01980g"
FT                   /old_locus_tag="YALI-IPF2522"
FT                   /old_locus_tag="YALI-CDS5593.1"
FT                   /product="YALI0E01980p"
FT                   /note="weakly similar to uniprot|Q04477 Saccharomyces
FT                   cerevisiae YMR117c SPC24 spindle pole body protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79018"
FT                   /db_xref="GOA:Q6C7C3"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="InterPro:IPR038066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7C3"
FT                   /protein_id="CAG79018.1"
FT                   /translation="MDPIDLLRDVAKSFSTNEEIASTERVSVDITRLSLFREAKLAEAR
FT                   DKLQDQIRQRDLCQESVAGDSTTSERTQHVHELEREKMRLARAINDLEETLNATQAATS
FT                   KLNAELELVEKESQQPIESAVENDSSAALQLKLFRTLGVTFDAEKPEKYTKCMIRSNTT
FT                   SNVATLDLNVKEYSGFFITNYIWDKL"
FT   gene            <211453..>211833
FT                   /locus_tag="YALI0_E02002g"
FT                   /old_locus_tag="YALI-IPF20636"
FT   CDS_pept        211453..211833
FT                   /locus_tag="YALI0_E02002g"
FT                   /old_locus_tag="YALI-IPF20636"
FT                   /product="YALI0E02002p"
FT                   /note="weakly similar to uniprot|P36064 Saccharomyces
FT                   cerevisiae YKL137w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79019"
FT                   /db_xref="GOA:Q6C7C2"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C2"
FT                   /protein_id="CAG79019.1"
FT                   /translation="MLPEHGFEHDQPTNPLHSNDVYPQKSGAVPLWFLSPKEENEVREE
FT                   TRRLARIACADVLKVFSDCTKGRTVSMLWACRIEKANMMECMASHSTMEDFDRARDEFV
FT                   QKKADAMAENKERLARERTKSN"
FT   gene            <212727..>216101
FT                   /locus_tag="YALI0_E02024g"
FT                   /old_locus_tag="YALI-IPF2521"
FT                   /old_locus_tag="YALI-CDS0312.1"
FT   CDS_pept        212727..216101
FT                   /locus_tag="YALI0_E02024g"
FT                   /old_locus_tag="YALI-IPF2521"
FT                   /old_locus_tag="YALI-CDS0312.1"
FT                   /product="YALI0E02024p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7C1"
FT                   /protein_id="CAG79020.1"
FT                   /translation="MPNIIDKAKEVFSSSKNDATTEADKAENLPSKAGQEVKSQGQTEL
FT                   KNAEGKVTDAAGTKGKLAQAAGPGGAKNLGEGELKNLEGQIPGQAGQYVGGGKGGEAAG
FT                   IAAGAAGVGGAGAAGSAGHGSQTGTTGTTGQTGYGSQTGTTGTTGTTGQTGYGSQTGST
FT                   GTTGQSGYGSQTGATGTTGQTGYGSSGAAGSTGQPGYSSTGQAESAYGSAGSHGTTGSN
FT                   TTGTGSHVHGATQPGQGQSLGQEVKSHVPGTAEHSASQGSHNVGSGTAGATGAGVGAGT
FT                   GYAAGSGSHGASTGQTGYGSSATGTHGASTGAAGTNTAGGAQYDNPEQVLSGQGTQGTQ
FT                   GSHTSHTGHHGHHHGHHGSGAATGAATGAAAGTGAGYAGQTGSAGTHGASSTGQTGYGS
FT                   SSTGQTGSTGARGTHESLGEKAYDAKTDAKSHIPGTSEHSATHGHSTGTHGASTGSSGV
FT                   QGQGISGTHGASGSFAPTHTNHNVTTGPEGVEHHIHHHHHHLEGDAAGAGVGAGAGAAT
FT                   GSHGTHGASTGATGASSQPGYSKGDSTHKHGSHSQSGYDHSSSKDQYPAQGKQYSHTTH
FT                   DDTRGLNSSSSSEPVQGTGYKSSSSGPAVGGGKYSSNPSAHSIGGDFANVGNPSANHAT
FT                   TGEKLRGETDDITRGVSGVNLRGNEAATGAGLAGATGYAKKVEDGSAPYPGTTGEPTSE
FT                   YAHTGTHGSRGNTTGATGTHSGTTTDEAGNETIGERISNAASAVSAAVFGTGEEQGNTH
FT                   TANSTAPGAYNQSGTTGTHGTTGQTGYGSSTTGQPGYGSTAGTTGQYGSSTGPHGTNET
FT                   LGDKAYEAKTDAKSHIPGTTEHSATHGTHGTHHGNTAGVTGAGAGAGAGAGYAAGQQGQ
FT                   GQYGQQGQGQYGQQGQGQYGQQGQGQGQSFVETAKSYIPGTEENIASKQEQEYTQGQPG
FT                   QYSQGQTGHSQGQTGQYSQGQTGQYSQGQTGQHSQGQTGQHSQGQRGQQGSGAVETAKS
FT                   YVPGTDEHAASKDQSKGQSGEHDSHKGGSSVLATGDDKESKNLRKAQEEAIKQPLPTLK
FT                   GTDVAVEAERAQQGQHINYNQASGDPSDSKSTMIIRDGLGPQEDIEGPVGAGHAKVEEE
FT                   STKGAGEPSLDATAARV"
FT   gene            <217479..>221329
FT                   /locus_tag="YALI0_E02046g"
FT                   /old_locus_tag="YALI-IPF40272"
FT   CDS_pept        join(217479..217697,217862..221329)
FT                   /locus_tag="YALI0_E02046g"
FT                   /old_locus_tag="YALI-IPF40272"
FT                   /product="YALI0E02046p"
FT                   /note="similar to uniprot|Q04439 Saccharomyces cerevisiae
FT                   YMR109w MYO5 myosin I"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79021"
FT                   /db_xref="GOA:Q6C7C0"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035535"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036072"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7C0"
FT                   /protein_id="CAG79021.1"
FT                   /translation="MAVTKRAGRRAQGGTQPAKGAQGVKKATFESGKKREVGVSDLTLL
FT                   SKVSEEAINENLKKRFENGTIYTYIGHVLISVNPFRDLGIYTDAVLESYKGKNRLEVPP
FT                   HVFSIAESMYYNMKSYSENQCVIISGESGAGKTEASKRIMQYIASASGGSSSNIQKIKD
FT                   MVLATNPLLEAFGCAKTLRNDNSSRHGKYLEIQFNNQAEPVGANITNYLLEKGRVVGQI
FT                   RNERNFHIFYQFAKAASENYRSTFGIQPPEAYTYTSASGCTSVNGINDEAEFKETLAAM
FT                   NLIGLTQAEQDNLFKLLAAILWIGNMSFVEDKDGNAAIADVSVPNFVAYLLEVDAESVV
FT                   KAVTQRIMETSRGGRRGSVYEVALNIAQATSVRDALAKGIYNNLFDWIVERVNQSLRAP
FT                   QDAARTIGILDIYGFEIFESNSFEQICINYVNEKLQQIFIQLTLKTEQDEYVREQIAWT
FT                   PINYFNNKIVCDLIEEKRPPGIFAALNDACATAHADPNAADENFIQRMSMVGQNPHFEQ
FT                   RQRKFVIKHYAGDVTYDVKGITDKNKDQLLKDILILLQKSGNPFLVSLFPDPVNTDNRR
FT                   RPPTASDKIKKSANDLVTTLSAAQPSYIRTIKPNQNRSPTEYDEKAVLHQVKYLGLQEN
FT                   VRIRRAGFAYRQTFEKFVERFMLLSGKTSYAGDYIWQGSAYDATLCILRDAGIPQTEYQ
FT                   MGTTKVFIKTPETLFALEHMRDMWWHNMAARIQRAWRRYLAYKTECAIKIQRFWRLKRG
FT                   LDGLKEIQFRDSGHKLLGGRKERRTYSLIGYRRFQGDYLGCNNGSGFGDFLMKQIGVTD
FT                   KVFFSCRGQLQQSRLGRSSVRVPRTFILTKNNFYVVAQQIHQKQLVVTNEYTIPVRNIT
FT                   HMSMSNLRDDWFCLNQASSPYGDQLMWCVFKTELAVQLRVVKPGVDIRIGPQIDYFKKQ
FT                   GKKASVKFQKTTTLQTKFDMYKSGSVQVPPGAPPNSVSKETPRGRAKGSRGGAPSRPAA
FT                   RGNAAHTPTPGAAALGYQQHQPGSAQPASPRARKAPPPAPNSRGNGHAESAQPQAYNNL
FT                   QPHYQSLVNPRSGQGQQQQQHHQAYQQPTAAQPAATSYSPAPAKAAPPPPPPAPPAAPA
FT                   APAEPTYKALYDYVANGLNQLSISAGEQVLISVKEDQGWWLAKRMDGSEEGWTPAAYLE
FT                   EVQGGAAAPPPAAPTAGGASAGASLAEALKQKQQSNQTLGAGIADAIKARTGRPADDDD
FT                   DDW"
FT   gene            <221863..>224091
FT                   /locus_tag="YALI0_E02068g"
FT                   /old_locus_tag="YALI-IPF40271"
FT   CDS_pept        join(221863..221877,221926..224091)
FT                   /locus_tag="YALI0_E02068g"
FT                   /old_locus_tag="YALI-IPF40271"
FT                   /product="YALI0E02068p"
FT                   /note="weakly similar to uniprot|Q7RX73 Neurospora crassa
FT                   NCU00077.1 and uniprot|Q9HGM8 Schizosaccharomyces pombe
FT                   SPBC543.03C Putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79022"
FT                   /db_xref="GOA:Q6C7B9"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="InterPro:IPR024193"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7B9"
FT                   /protein_id="CAG79022.1"
FT                   /translation="MASKEATVYVVDLHESMGREMARGHDSKEVTDLNWGLQYIYSEIS
FT                   NKILSGRKTDVVGLVGVHTDTTQNMFEEESGFEHIDIITPIQQFNLDTLLEAKKQLVPN
FT                   SDNKGDLISGIVVAVQMIKLYTKALKYIRNIVVLTNGQGNMNLGDSGGIIKQLNENRII
FT                   LKVMGVDFDDEEVDYFEEDKPEHKRENELKLKEFVDRCEDSVFATYKEARDSLDIPKVK
FT                   AVNPVRAFQGNLVLSDPEQQPPQRVMSIGVEVFPCTRRATAMTASSYAMSKIEPATIST
FT                   PSQNNLQAVKWDRQYYVNDESGIGGKKELDRDTLENGYRYGSEIVYITKEEEEAIMFPT
FT                   SASLQVIGFVNKKSVPPYMLMGHTDYIIGQRGNNRDAVAISAFARALFETDNFGLARYV
FT                   NKDGKDPQIVVLMPYIRAELEGLVFCQLPFAEDERKFILPSLTSLETRSGNKTVTTHSR
FT                   LLPTKEMLDAMDDYVDAMDLSKLKGEDDEPWLTMEECFNPSIHHIRNVVKECAVSQDYG
FT                   KIPEPLPILTRFSQPAEELTEEAKPQLELLKHLFDIKEQFREAKKRKTEVTVGQTGLDL
FT                   DALLEGELEVKLESSQTLSSNVKSEPGRQTASQSSQNSQQLSLDPENICPDFIRTLNKI
FT                   DTKATSDEEFRSGATNLYKQTITLLEEKLESSKGNDAYNEIIGVLQTMREQADEMEIPD
FT                   VFTAAKGQFVSKLERGDLGGQKNVLVAQINSI"
FT   gene            complement(<224212..>225861)
FT                   /locus_tag="YALI0_E02090g"
FT                   /old_locus_tag="YALI-IPF2510"
FT                   /old_locus_tag="YALI-CDS1963.1"
FT   CDS_pept        complement(224212..225861)
FT                   /locus_tag="YALI0_E02090g"
FT                   /old_locus_tag="YALI-IPF2510"
FT                   /old_locus_tag="YALI-CDS1963.1"
FT                   /product="YALI0E02090p"
FT                   /note="similar to uniprot|P37012 Saccharomyces cerevisiae
FT                   YMR105c PGM2 phosphoglucomutase major isoform or
FT                   uniprot|P33401 Saccharomyces cerevisiae YKL127w PGM1
FT                   phosphoglucomutase minor isoform"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79023"
FT                   /db_xref="GOA:Q6C7B8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B8"
FT                   /protein_id="CAG79023.1"
FT                   /translation="MPAVATTPFEGQKPGTSGLRKKVTVFQQPHYTENFVQAIMDSIPE
FT                   GAKDATLVIGGDGRYYNDKVCQIIAEIAAGNGVKKLIVGQDGILSTPAASHVIRKRGAT
FT                   GGIILTASHNPGGPTEDFGIKYNLANGGPAPESVTNKIFDVTTKIKEYQRVDVGEVDLK
FT                   TVGTKQYGPIEIEIIDSVADYVAMIKDIFDLELIKDFLKSNPDFKVLFDGLNGVTGSYA
FT                   QAIFLGELGLDKSSIQNCTPLPDFGGLHPDPNLTYAKTLVDAVDSGSIPFGAASDGDGD
FT                   RNMIYGANTFVSPGDSVAIIADHADKIPYFKKQGVYGLARSMPTSNALDLVGKKKGLNV
FT                   YEVPTGWKFFCALFDSDKLSICGEESFGTGSNHIREKDGLWAVIAWLNIIAGVGKEDPK
FT                   KASIAAIQEDFWKTYGRTFFTRYDYENVSSEGAAKVVAGLNDKLNSLVGTKIGSLEVAE
FT                   AGDFEYTDLDGSVSSHQGLYVKFTNGARFVIRLSGTGSSGATIRLYVEKHESDPSKFGE
FT                   SAQDYLEDIINEVVSYLKFKELVGRDEPTVRT"
FT   gene            <227215..>228825
FT                   /locus_tag="YALI0_E02112g"
FT                   /old_locus_tag="YALI-IPF2508"
FT                   /old_locus_tag="YALI-CDS2046.1"
FT   CDS_pept        227215..228825
FT                   /locus_tag="YALI0_E02112g"
FT                   /old_locus_tag="YALI-IPF2508"
FT                   /old_locus_tag="YALI-CDS2046.1"
FT                   /product="YALI0E02112p"
FT                   /note="weakly similar to uniprot|O53294 Mycobacterium
FT                   tuberculosis monoxygenase (Monooxygenase flavin-binding
FT                   family) possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79024"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B7"
FT                   /protein_id="CAG79024.1"
FT                   /translation="MKPLYITADIFDFITSYTNIDLYRQPNTMTKLHSQVLIVGGGFSG
FT                   IATSIKLLKDWKVTDFHVYDRNEKFGGTWAANTYPGAASDIPAVWYCLASDPKIDWESA
FT                   YPSQQELSEYIAGVVDKYGLKSFATFNSEIERIEWIPNERLWKATIAHNGNTITHTARV
FT                   LFMGQGCLVTPNHVKIKGMEDFQGPIMHTAEWKPFDYDNKDVVVIGNGCSAAQVTSEVA
FT                   KTAKSVTQFARSPQWIVPRTPVTIGPILRTILSWFPFLIPVLRFFVFCLLEMNWNMFRG
FT                   GWWSDFDRSMRTKVAVKIAKKNMPEKYHETAIPKYQLGCKRIIFDCGYWAALKMESVLL
FT                   TFDKLVEVGKNSVKDINGNQYPADLIVDATGFNIGRSMTSVDVIGENGMPLSEFWDGKV
FT                   AAYETVMVPNYPNMFMLFGPNATTGHNSVIFGIENGLKFVESVASDVIQGRSDYVTVKP
FT                   QAYDQWVQRIQAAIKQTNFATGGCVSWYMSVGEATHNAVSYPWTQLRFWWRARFPHYDD
FT                   IYVENKSQKVTPGKAIKAE"
FT   gene            <229389..>230477
FT                   /locus_tag="YALI0_E02134g"
FT                   /old_locus_tag="YALI-IPF40270"
FT   CDS_pept        join(229389..229414,229472..230477)
FT                   /locus_tag="YALI0_E02134g"
FT                   /old_locus_tag="YALI-IPF40270"
FT                   /product="YALI0E02134p"
FT                   /note="similar to uniprot|P48510 Saccharomyces cerevisiae
FT                   YMR276w DSK2 ubiquitin-like protein possible transmembrane
FT                   segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79025"
FT                   /db_xref="GOA:Q6C7B6"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B6"
FT                   /protein_id="CAG79025.1"
FT                   /translation="MSDFEIIIKSSDKKVPVSVNNDTLVSKVKEQMAKELDIPAERQRL
FT                   IYSGRVLKDGETVGSYNIKEGHSVHLVKGAAPQGSSAASAASATSAITNTASSNPASTG
FT                   IPNNIASGAGAGNPLAALTGAQFAGHGINPQMFGDQFGQPPSEEDFINMMRQPGYRESV
FT                   EAMLNNPQMLDMMINSNPQLAAMGPQARQMLQSDHMRQMMTNPEVMQGMMQIQRAMNPE
FT                   AQGSAFPAPGAAPGAGAGTDGAGAGAGAGAGGAAGGANANNMANFMQMMGGGGFGGLGG
FT                   GNAFSAPAAEPEDTRPPEERYESQLRQLNELGFYEFDRNVRALRRSGGNVQGAIEALLD
FT                   GGV"
FT   gene            complement(<230799..>232346)
FT                   /locus_tag="YALI0_E02156g"
FT                   /old_locus_tag="YALI-IPF2505"
FT                   /old_locus_tag="YALI-CDS2231.1"
FT   CDS_pept        complement(230799..232346)
FT                   /locus_tag="YALI0_E02156g"
FT                   /old_locus_tag="YALI-IPF2505"
FT                   /old_locus_tag="YALI-CDS2231.1"
FT                   /product="YALI0E02156p"
FT                   /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
FT                   YLR138w NHA1 putative Na+/H+ antiporter possible
FT                   transmembrane segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79026"
FT                   /db_xref="GOA:Q6C7B5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B5"
FT                   /protein_id="CAG79026.1"
FT                   /translation="MPVLNISNFNIVTACLGGFALVFGLISYVVKEHCYMGEALPALLF
FT                   GLIFNKAKWVIPEEYGNVREITLEFSRLVLGIQLVLAGVQLPAKYLVKEWRSFFFLLVP
FT                   VMTTMWVVTALIIWLIFPNLRYLDALIIGSCVTPTDPVLSNSVVKGKFAEKYVSESLRN
FT                   IISAESGANDGFGYPFLFLALYIDRYSGTKIAKEWIVETILYEILLSVAYGAVIGYLGQ
FT                   ELLGYAKKFNFVDDESFLVFVFALGLFILGTAGMIGTDDLLAAFIAGNAFTWNDWFREE
FT                   TKDDTLQPTLDLMLNFAIFLWVGVVMPWGQFNQPHLNLPVWRFVLCGICVLVFRRLPAM
FT                   LVFYKFIPTIKNIKEALFAGFFGPIGIGAIFYLHTALNKLDEFVEENEHGEAHTYDPHW
FT                   LITVMYPLVYFLILSSVVVHGITIPVSMLGKQLPTTLSRTMTMTRSFSRSRSASRDRTP
FT                   RDPEGHVKIDAISNPTDLRQNIHVVDESGTTDDSQDTYTRPAPEIGFVIPDRRGDQV"
FT   gene            complement(<236678..>238957)
FT                   /locus_tag="YALI0_E02178g"
FT                   /old_locus_tag="YALI-IPF2504"
FT                   /old_locus_tag="YALI-CDS0941.1"
FT   CDS_pept        complement(236678..238957)
FT                   /locus_tag="YALI0_E02178g"
FT                   /old_locus_tag="YALI-IPF2504"
FT                   /old_locus_tag="YALI-CDS0941.1"
FT                   /product="YALI0E02178p"
FT                   /note="some similarities with uniprot|Q01165 Magnaporthe
FT                   grisea Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79027"
FT                   /db_xref="GOA:Q6C7B4"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B4"
FT                   /protein_id="CAG79027.1"
FT                   /translation="MLNNQERRKRKQYPPESLYKACMEVIRTNSTHKAAGKKWNVPDST
FT                   VSWRIRLLKQHGSLQPDWIEKMRISYKELALKMNWAHSNNKKLSEAHERGLLDHVKFQH
FT                   SIARPVKLKDISKIANYLLKANGNTETVGKNWASNFVTRHNLLEVKRPVSLEQARIDGT
FT                   THDKLEEFITTITSQTLEEVLPENRWNMDETGFQQGEGRGGQVVGLRGEPAIQSVTGRS
FT                   ATTTVIETVSATGKSTRALVIFKGKTVQGQWFPKGSRAEDYKDMVFEFSDSGFTNNNTA
FT                   WKWLTQVFIPDTMPKDKYGNDAPHIRRILYMDGHHSHTQKRFLLKCIEHNITTVLLPPH
FT                   TSHITQPLDVGVFSSMKHWYKDLAGNEGKVGNLTDAGPHVFLTVINEVREKALTESNIA
FT                   SGWRASGLWPLDPEKIRSNPRLIRENGNKEPLGAVRQDYTSQDTVRAIFPINTPTPAVP
FT                   DMPLQPSLEELENSIHDDTHDETYKCTSESESDGSGSSDSSDSDVSASDIIVNDGAMDA
FT                   SDYEFLAAVNEELLERQNNANQVDADETLGSQQAFHNFSSSHWHHDDCIEKIFCKETYP
FT                   PMENPPTGGNALLTWAHSTHPAMRDFLIHGLKPFVEMIDRLVGDLYHMQEDATMRQHEI
FT                   DIVRSKTKRIRVNRSAPDQVISSQDVFAAIGAREDRGNARRERSARSTGEEPTQEEPTQ
FT                   EEPTQEDSTRQQSTRQQSTRQRSTRRAGPFSKVPPSLFADSPTSDTSSGPQDDNCPSSD
FT                   SLMLSD"
FT   gene            <241292..>242911
FT                   /locus_tag="YALI0_E02200g"
FT                   /old_locus_tag="YALI-IPF2503"
FT                   /old_locus_tag="YALI-CDS2028.1"
FT   CDS_pept        241292..242911
FT                   /locus_tag="YALI0_E02200g"
FT                   /old_locus_tag="YALI-IPF2503"
FT                   /old_locus_tag="YALI-CDS2028.1"
FT                   /product="YALI0E02200p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79028"
FT                   /db_xref="GOA:Q6C7B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B3"
FT                   /protein_id="CAG79028.1"
FT                   /translation="MASYKPYPGSDSSNPTSSPGEANNNHYSTPRLSSPAAAESNRHTS
FT                   VSTLPATAEWDQLPYPSFNNSIHHKSQRSTSPRSPRSPMLPPQTISNRRFSPRESPAIS
FT                   RQPSQRTRARSSTVTSDDGRSVFMSEFRKHSGSGARPDMKGLYADQVGSEQAIASDDDS
FT                   LVIPGTMPRSNPIPRSEIESEPMERTSSSKRSSKIFTRGRVSPDGSIAGDDSESGFMAK
FT                   VSKLLKTKESKQDLINDILADEAANGNSQMYEEHYQQMQAGTLPVETQPSAVAFSPQYP
FT                   LPYHYPETVAHIQIPPAGTQLDKSAEYDLMMQRQQEEFAADLEPGDSKVPKRKSNSKKS
FT                   RSASPSLHGIGIDGIDGMMMVDGSIDPLTAGHFTHSKHHRSKSKTSKKSPTMSPAMLPT
FT                   NPQSKTVPYPSHLSRNSSPPIDILELSALDKPSSSRRKMKRSSKKSQTDYGKIMRHLYN
FT                   SIPSLDVIVKVVMEPVETARKSEYPNLAIVIAVVELLVFIWLLYQAIIIVEFACAVIRF
FT                   ICYPAIYILKAIASPFASIKRV"
FT   gene            complement(<243112..>244467)
FT                   /locus_tag="YALI0_E02222g"
FT                   /old_locus_tag="YALI-IPF2502"
FT                   /old_locus_tag="YALI-CDS2783.1"
FT   CDS_pept        complement(243112..244467)
FT                   /locus_tag="YALI0_E02222g"
FT                   /old_locus_tag="YALI-IPF2502"
FT                   /old_locus_tag="YALI-CDS2783.1"
FT                   /product="YALI0E02222p"
FT                   /note="uniprot|Q70ML1 Yarrowia lipolytica Alpha 1-6
FT                   mannosyltransferase involved in secreted protein
FT                   glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79029"
FT                   /db_xref="GOA:F2Z612"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z612"
FT                   /protein_id="CAG79029.1"
FT                   /translation="MISRDKKPNELPKYEKTGGVDYRTDFKPRKPSPLSRPNLQVPQIT
FT                   KLRLAAVFVAVTLIVFLFGSHHEVSYSDVLQSVQGYKQYVSDSIKQGSISSQSPAEAHR
FT                   KPLGEVSFVDLRDAAGDWSKNSPLNQRVLVCMPLRNVEKVVPIMASHLRNLTYDHNLID
FT                   LAFLISDTDDNTVNVLEDEINSIQSDADPKMPFNKITLLFRDFGSAVGTDFSDRHGVAV
FT                   QGVRRKLMGRARNWLLSSLLEPTHSWVYWRDADIETSPPTIIEDLMKHNVDVIVPNVWR
FT                   PLPDWLGSEQPYDLNSWQESQPALDLAATLDEDEVIVEGYAEYPTYRPHLAYVRNADGN
FT                   PDEQVDLDGIGGVSILARSRVFLSGAHFTGFTFENHAETEAFGKMCKKMGFTVRGLPHY
FT                   TVWHMYEPSEDDLKEMMRREKEEKEKEKQEKGTTENKDLEVNEAPEVKELEA"
FT   gene            complement(<246054..>247841)
FT                   /locus_tag="YALI0_E02244g"
FT                   /old_locus_tag="YALI-IPF2501"
FT                   /old_locus_tag="YALI-CDS1638.1"
FT   CDS_pept        complement(246054..247841)
FT                   /locus_tag="YALI0_E02244g"
FT                   /old_locus_tag="YALI-IPF2501"
FT                   /old_locus_tag="YALI-CDS1638.1"
FT                   /product="YALI0E02244p"
FT                   /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
FT                   YMR278w and DEHA0F03432g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79030"
FT                   /db_xref="GOA:Q6C7B1"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B1"
FT                   /protein_id="CAG79030.1"
FT                   /translation="MTTTLVKQWLDLDQNPVTRKQIEDLQTANDTKQLETLLSKRISFG
FT                   TAGLRARMEAGFARMNDVTVLQASIGLASYVDREVPDATSKGVVIGHDHRHNSEQFAKL
FT                   TALAFVNKGFKVYLFKGLVHTPIVPFAIDALGASCGVMVTASHNPAADNGYKVYWGNGC
FT                   QIIPPHDTGIAAEIDALADKTTKFEWDLSKLDKLIEGETIDNRTEMQQKYNDNLKNLVH
FT                   HKFEPSGPLASGVVYTAMHGVGYLPSIEAFKLFGIPLEDVFSVRKQQEPNPDFPTVAFP
FT                   NPEEHGALDLAMKLGDAQGADLIVANDPDADRFAVAVKENGDKWVQLTGNQIGILFSAY
FT                   QWDQYKNSGKKIAMLNSTVSSQMLKFMAEKEGFLYEDTLTGFKWIGNRAIDLEKEGYTV
FT                   PFAYEEAIGYMFPGVHDKDGVSASLVFLQLAQAYGGGAKLIEKLNSLYDKYGHFAEKNG
FT                   YYIAKTPELTTEAFKHVRSYFKGRFQKGDYPKTIGPFDVTSWRDLTTGYDSTTPDHKPT
FT                   LPVSPSTEMITATLATHDNPDEFIRFTARGSGTEPKLKIYIDAKAASTERAQELAQETW
FT                   DALDEEWWRPEESGLQRVH"
FT   gene            complement(<248871..>249605)
FT                   /locus_tag="YALI0_E02266g"
FT                   /old_locus_tag="YALI-IPF2498"
FT                   /old_locus_tag="YALI-CDS4966.1"
FT   CDS_pept        complement(248871..249605)
FT                   /locus_tag="YALI0_E02266g"
FT                   /old_locus_tag="YALI-IPF2498"
FT                   /old_locus_tag="YALI-CDS4966.1"
FT                   /product="YALI0E02266p"
FT                   /note="weakly similar to uniprot|Q9P3Q3 Neurospora crassa
FT                   B24P7.320 Related to cytosolic Cu/Zn superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79031"
FT                   /db_xref="GOA:Q6C7B0"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7B0"
FT                   /protein_id="CAG79031.1"
FT                   /translation="MLFKSVVVSTLAAAALAQKNTTDGVTGKLGDAAIINDNPVGEVYE
FT                   VVFDKEGTVKGKITFTAAKNGTGVDVSVDLEGKFDGVEGPYPYHIHALPVPANGSCAAT
FT                   LAHLDPYQRGQKPECDASKPETCEVGDLSGKHGKIPSANGSTTHFHTEYTELYASTKDG
FT                   IGAFLGNVSVVIHAPNTSRLACANIELKKGSAVAGGNSTSNHTASGKPSGTAAANANGA
FT                   GISGVSQIVVGGAAIFAAAALL"
FT   gene            <253044..>253994
FT                   /locus_tag="YALI0_E02288g"
FT                   /old_locus_tag="YALI-IPF2497"
FT                   /old_locus_tag="YALI-CDS4193.1"
FT   CDS_pept        253044..253994
FT                   /locus_tag="YALI0_E02288g"
FT                   /old_locus_tag="YALI-IPF2497"
FT                   /old_locus_tag="YALI-CDS4193.1"
FT                   /product="YALI0E02288p"
FT                   /note="similar to uniprot|P38066 Saccharomyces cerevisiae
FT                   YBL033c RIB1 GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79032"
FT                   /db_xref="GOA:Q6C7A9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A9"
FT                   /protein_id="CAG79032.1"
FT                   /translation="MSKPIDIPDTSEEVSQIDLVSPTFTPTESQVGTPDAIPVTEEESG
FT                   APVLKLSATLPEVECLVRARIPTTNGTEIFLHLYTNNVDKKEHLAIVFGNHIRSKSLDR
FT                   PREGETEMDRMTRGAYTGRLFPGRQSSKEGVPSTRTPEPASKAPDTTLVRIHSECYTGE
FT                   TAWSARCDCGEQLDEAARLMGNKNSGVIVYLRQEGRGIGLGEKLKAYNLQDLGADTVQA
FT                   NLMLKHPADGRDFGLATAILQDLDQTKIQLLTNNPDKIAAVEGPNKEVTVVERVPMVPL
FT                   AWKDKSKGIHSDEVDGYLRTKIERMGHLLSEPMAK"
FT   gene            <255377..>255883
FT                   /locus_tag="YALI0_E02310g"
FT                   /old_locus_tag="YALI-IPF2495"
FT                   /old_locus_tag="YALI-CDS5780.1"
FT   CDS_pept        255377..255883
FT                   /locus_tag="YALI0_E02310g"
FT                   /old_locus_tag="YALI-IPF2495"
FT                   /old_locus_tag="YALI-CDS5780.1"
FT                   /product="YALI0E02310p"
FT                   /note="highly similar to uniprot|P40581 Saccharomyces
FT                   cerevisiae YIR037w HYR1 glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79033"
FT                   /db_xref="GOA:Q6C7A8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A8"
FT                   /protein_id="CAG79033.1"
FT                   /translation="MSAEKTNTAFYNLAPLDKNGEPFPFKQLEGKVVLIVNVASKCGFT
FT                   PQYKGLEEVYQKYKDQGFTIIGFPCNQFGGQEPGSADEISSFCQLNYGVTFPVLQKINV
FT                   NGNDADPVYVYLKEQKAGLLGFRGIKWNFEKFLVDKHGNVVDRYASLKTPAGLESTIET
FT                   LLKKP"
FT   gene            complement(<256357..>259502)
FT                   /locus_tag="YALI0_E02332g"
FT                   /old_locus_tag="YALI-IPF40269"
FT   CDS_pept        complement(join(256357..259398,259458..259502))
FT                   /locus_tag="YALI0_E02332g"
FT                   /old_locus_tag="YALI-IPF40269"
FT                   /product="YALI0E02332p"
FT                   /note="similar to DEHA0C09174g Debaryomyces hansenii and
FT                   uniprot|Q08773 Saccharomyces cerevisiae YOR304w ISW2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79034"
FT                   /db_xref="GOA:Q6C7A7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036306"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A7"
FT                   /protein_id="CAG79034.1"
FT                   /translation="MSGPAPIDLDKSNPGSSMVSTVTTPNRDTPPVQLSTEDLLNIRSG
FT                   YLLPDKGLGKPKQKSIPELVKKIKHLYGLSDVFEYFLKSKGESDPNYRKAMEQAKEELG
FT                   LNKTTEKPTGGARHRKTEKEEDAELMQGEEEAENSVETVFETSPGYIQGTLREYQVQGL
FT                   NWMVSLYEHGLSGILADEMGLGKTLQTISFLGYLRYFRGIPGPHLVCVPKSTLDNWARE
FT                   FAKWTPEVNVLVLQGDKEGRAQLIQDRLLTCDFDVCITSYEMVLREKGYLRRFAWQYIV
FT                   IDEAHRIKNEESSLSQIIRLFHTENRLLITGTPLQNNLHELWALLNYILPDVFQDSAAF
FT                   DAWFGEDQSGDQDAAVNQLHKILRPFLLRRVKADVEKSLLPKKEINLYVGMSDMQVKWY
FT                   QKILEKDIDAVNGQIGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLVYN
FT                   AGKMVILDKLLKRIQEQGSRVLIFSQMSRVLDILEDYCLFRGYKYCRIDGQTAHEDRIN
FT                   AIDAYNKEGSEKFVFLLTTRAGGLGINLTTADQVVLYDSDWNPQADLQAMDRAHRIGQT
FT                   KQVYVYRFITENAVEEKVIERATQKLRLDKLVIQQGRSQSKVNNNAQNKDDLLNMIQFG
FT                   AEKVFNRGKGEEQEEADLDIDDILKRGQQKTMELNSRYDSLGLDDLQKFTSDSAYEWNG
FT                   EDFKKKDTSKTNKPFVWIAPNKRERKENYSIDSYYREMLNQGAAAGKNAAPKAPKAPKQ
FT                   LNIQDHQFYPQRLIDIQEKETSYYRKQIGYKVPLPDGAEEELEMRESERDLEQQEIDNA
FT                   EPLTEEEEEEKVDLSTKGFSNWNRRDFTNFIQASARHGRNNFAAIATEFEDKTQADIKK
FT                   YAGVFWQRYTEINGFDRYIQQIEAGEDKAKKQNHQNTLLTRKVEGYEAPLQQMVIVYPA
FT                   GQKKIYSEDEDRYILVQLYRYGLETEGVYEMIRDAIRASPVFRFDWFFLSRTPAELARR
FT                   GQTLLSYVGKEYDGAGEKRKSSSTPDVETPKKSAKKKKA"
FT   gene            complement(<260163..>260683)
FT                   /locus_tag="YALI0_E02343g"
FT   CDS_pept        complement(join(260163..260467,260608..260683))
FT                   /locus_tag="YALI0_E02343g"
FT                   /product="YALI0E02343p"
FT                   /note="similar to uniprot|Q7RYX8 Neurospora crassa
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02343g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64323"
FT                   /db_xref="GOA:B5FVG9"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVG9"
FT                   /protein_id="CAR64323.1"
FT                   /translation="MCKHITNAQVSIRTQCCRKWYDCPQCHEEAEDHPLRKTTEMTFAC
FT                   KKCRKAFRKDLTDFDEADSFCPYCDNNFMIPAETPETKQLDAIAEGTHEIRLPGSGDKI
FT                   LDSRMMRKEDIPQDLWDELDNI"
FT   gene            <261158..>262180
FT                   /locus_tag="YALI0_E02354g"
FT                   /old_locus_tag="YALI-IPF2489"
FT                   /old_locus_tag="YALI-CDS3890.1"
FT   CDS_pept        261158..262180
FT                   /locus_tag="YALI0_E02354g"
FT                   /old_locus_tag="YALI-IPF2489"
FT                   /old_locus_tag="YALI-CDS3890.1"
FT                   /product="YALI0E02354p"
FT                   /note="similar to uniprot|P52920 Saccharomyces cerevisiae
FT                   YGL091c NBP35 nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79035"
FT                   /db_xref="GOA:Q6C7A6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028601"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C7A6"
FT                   /protein_id="CAG79035.1"
FT                   /translation="MPSLVDPVANKTDEGNNRTDLKAPEPEHCPGTESEEAGKADACQG
FT                   CPNQDICASAPKGPDPDLPLIKDRMKGVKHKILVLSGKGGVGKSTFSSLLGWGFASDLD
FT                   REVGLMDIDICGPSLPKMMGSEGEQIHTSLSGWSPIYVSDNLGMMSVGFMLPNQDDAII
FT                   WRGAKKNGLIKQFLKDVDWGNLDYLVVDTPPGTSDEHLSVTQYLKESGVDGAVVITTPQ
FT                   EVALLDVRKELDFCRKSGIKIIGLVENMSGFVCPNCKGESFIFAPTTGGGKALAEEFNI
FT                   PFLGSVPLDPRIGKSCDHGESFVEEYPDSPATTAILDVIRQIREAVGDPQEDEDDDMDE
FT                   "
FT   gene            complement(<262259..>264148)
FT                   /locus_tag="YALI0_E02376g"
FT                   /old_locus_tag="YALI-IPF2488"
FT                   /old_locus_tag="YALI-CDS1443.1"
FT   CDS_pept        complement(262259..264148)
FT                   /locus_tag="YALI0_E02376g"
FT                   /old_locus_tag="YALI-IPF2488"
FT                   /old_locus_tag="YALI-CDS1443.1"
FT                   /product="YALI0E02376p"
FT                   /note="some similarities with uniprot|Q7SAG2 Neurospora
FT                   crassa NCU06988.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79036"
FT                   /db_xref="GOA:Q6C7A5"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A5"
FT                   /protein_id="CAG79036.1"
FT                   /translation="MSHEILLVLAGNISPLVTSSVLDGLENSWHRTLHTAERQLLNQFA
FT                   ECGRLFSSIDERVKSTMYATSALSRREAGISVAFTPCCQAVVEVLERRVVRKYLMELAD
FT                   LEKRLLGGDVTYTSTGGAAETIPLSQIQLKITSPWTRRLEYTHELLDFFYFSDLSEEDR
FT                   RAVDPNDLSTFPFVSGSTIYSRLQSDVQVGYPDLQNLVQECIIALEKCWLRQFSRWLLY
FT                   GKLPSSFSAAHDFMVLPVADLDRDEVTAEYEIVKGSFLHPISEQSTNDALSVGMLIAQA
FT                   SNNNDTEMLKSVGKLAKSICGYSEKTMAFPMKTLAIEELIRYTKKQVYSNLLDSILPTA
FT                   EVQKLLTLFRGIYLLGDGEFSMVFLDALEQKKNGSIAFSAALNYLIDEKHNEFLASVPK
FT                   YLSYKKSTSYTSSFSDFVTGYHYKLRYRLRWPVTIIVSPSVMPSLSAIFDMLLAIRKTI
FT                   LQLNDLWRQRRVYYSRSRSSDFILWESLAFVYYFLESYWAHVQADLIDLRFEKLVIVAQ
FT                   VNDNHDSDILAKISAELESFAYGLYDLLNLNNREIVNTFKQFLIACTQIYAEVSRTFKD
FT                   QEDINIDTDKLSNVKVLALRLLAMFSDVQQERLARGDAAAGVDELLVKFSDYR"
FT   gene            complement(<264621..>268565)
FT                   /locus_tag="YALI0_E02398g"
FT                   /old_locus_tag="YALI-IPF40268"
FT   CDS_pept        complement(join(264621..268465,268541..268565))
FT                   /locus_tag="YALI0_E02398g"
FT                   /old_locus_tag="YALI-IPF40268"
FT                   /product="YALI0E02398p"
FT                   /note="similar to uniprot|CAD70763 Neurospora crassa 80A10.
FT                   060 Related to 5-oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79037"
FT                   /db_xref="GOA:Q6C7A4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A4"
FT                   /protein_id="CAG79037.2"
FT                   /translation="MGGIRIAIDRGGTFTDVYAHCPDQEIVLKLLSVDPANYEDAPTEG
FT                   IRRILEKAIGKKIPKGEPIDLSEVESVRMGTTVATNALLERKGDRVAFLVTKGFGDILT
FT                   IGQQARPNIFDLSVKKLKKLYEVVYEVDERVVPDAAGEVTGDTGEKYHVFQTPDKAVVV
FT                   AELEKIKASGIDSLAIAFMHGYSFTEHEEMVAKWARDIGFEVSVSHELQPQIKLVSRAN
FT                   SATASAYLSPTTRRYITQFGKGFKGGLDEVGRKLLFMQSDGGLTHWNQFSGLKAILSGP
FT                   AGGVVGFSRTAYDDSQKPNPKPVLGFDMGGTSTDVSRYAGTLPHIFETTTAQVTIQSPQ
FT                   LDISTVAAGGGSILFWRNGLFAVGPESASAHPGPACYRKGGPLTVTDANLFLGRLVVSQ
FT                   FPNIFGPNENEPLDSEIVKKKFQELTDEINKDQGSDLTPHNVALGFLQVANETMCRPIR
FT                   SLTEGKGYITSGHDLCSFGGAGGQHACDVAQSLGISRVVIPKYSSILSAYGMALADVVV
FT                   DTQQPADAILGDTALGELKERLSVLAKEATATLMSQGFTEGDVECEKYLNLRYRGSESL
FT                   MMVAQQGEGDYTSFAKQFTELHKQEFGFTLDRDILVADVRVRAVGKTGYNPEHPIQELT
FT                   KAKSNGVTTPKATNTQKVYFDESWHDCCVFKIADLQTGDQVAGPALIIDATQTLVVASN
FT                   GKATVLDNHVIIELDETVKEIDSGDHIDLVELSIFSHRFMSIAEQMGQTLQKTAISTNI
FT                   KERLDFSCALFDQDGDLVANAPHIPVHLGSMSSAVRYQVEHWKGDLHEGDVLVCNHPAY
FT                   GGSHLPDITVVTPVFDETGKVAFFCASRGHHSDIGGISAGSMPPFSKELWEEGATIQAF
FT                   KVVSKGKYDEAGMVRLLFDEPSKYPGCEGSRSLQDSLSDLQAQIAANNKGIRLIEALIE
FT                   DFGLNVVQKYMKAIQQNAEEAVRKLLIGAREKRETTVFTARDQLDEGTPIVLTITIADD
FT                   GSARFDFSGTGPQVYGNLNAPKSVTYSAILYVLRSLIDADIPLNGGCLKPIEIFIPNNT
FT                   VLAPSADAATVGGNVETSQRVTDVVLKAFEAMGASQGTCNNLTFGISPQMLKDKECTAT
FT                   ETFGYYETIAGGAGAGPTWNGQSGVQVHMTNTRSTDPEIFEKRYPAILREFSVRRGSGG
FT                   AGEFTGGNGVVRDIQFTQPVQCSILSERRSSAPYGMKGGESGKPGMNLWVRKNGTTATL
FT                   GGKNTVRMSPGERIIIQTPGGGGYGHVKEDKSSKAEEAQKSETHSFIPRASGSIHERAA
FT                   AQGAL"
FT   gene            complement(<269480..>271333)
FT                   /locus_tag="YALI0_E02420g"
FT                   /old_locus_tag="YALI-IPF2484"
FT                   /old_locus_tag="YALI-CDS1509.1"
FT   CDS_pept        complement(269480..271333)
FT                   /locus_tag="YALI0_E02420g"
FT                   /old_locus_tag="YALI-IPF2484"
FT                   /old_locus_tag="YALI-CDS1509.1"
FT                   /product="YALI0E02420p"
FT                   /note="weakly similar to uniprot|P40557 Saccharomyces
FT                   cerevisiae YIL005w related to protein disulfide isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79038"
FT                   /db_xref="GOA:Q6C7A3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A3"
FT                   /protein_id="CAG79038.1"
FT                   /translation="MRITRLLLLAAAAVAAVIPTPKPEGEEEAPAPCPEISGKEWETTV
FT                   AEGTYWVKFYSPQCGHCQMLAPKWERMYQEIGNDVASRHDFHIAAVNCLADGDLCNQEN
FT                   INVYPTLNLYKNGKKVETYDLRKGTQPSRLAKFVEEKIKEASGISKLEGDEEKIASTKK
FT                   ANVNVEGLSVDLNPTNFKALVSDDPTGWYIKYYLPSCPHCVAMDDAWNEVAAKFKNQLN
FT                   VGEINCAKYADFCRGQGIEYYPAVTFQIGELSVTYNGERTTDALTLFGLQAVEARDMKS
FT                   VNQLEFEELRQKHPETVSYIYLHDEALFPEDLQALQKFAINVVAHANVYKSDDKKLVDK
FT                   FSVTRLPALVAVNNDYTDEMSFEVYPEYDVGHLRNSERLLQFARRTWLPLMPELTPINQ
FT                   DSVFADGRIVVLALVDREDKFATKVAIDELKQSATKYFKAKMHARQKELDLLRIQRHSE
FT                   RAKLLKEKDPKLQKKLEKDDTSVPTRPPVQFAWIDADKYSKWIESRFRFNWDDRKANAP
FT                   IIVIDDAKNVQFFDTDDKNARLEPSDAEQLARVLDLIEKNNSRQLFPRSTRGFFASWFI
FT                   FVWGLKTYILLVFVLLAVAKMGKRYLRHRRSAATPTLGKWE"
FT   gene            <273345..>275842
FT                   /locus_tag="YALI0_E02442g"
FT                   /old_locus_tag="YALI-IPF40267"
FT   CDS_pept        join(273345..273408,273696..275842)
FT                   /locus_tag="YALI0_E02442g"
FT                   /old_locus_tag="YALI-IPF40267"
FT                   /product="YALI0E02442p"
FT                   /note="some similarities with uniprot|Q9URT4
FT                   Schizosaccahromyces pombe AMS2 CENP-A multicopy suppressor
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79039"
FT                   /db_xref="GOA:Q6C7A2"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR042403"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A2"
FT                   /protein_id="CAG79039.1"
FT                   /translation="MSTPNPMHSRRAAPTMRPKIKLKLLYELNGSSCLARTQFPVDVFA
FT                   ANDIAFANFKQCFSAINSASPEILASASETDYAVYVADCTEADEPMVGRGLLSQLLARP
FT                   EVDISDTSTLLTGGVVSGRITSSLLSFIPGHAQETVEIRLRFVTIHKASQIASLMSMFL
FT                   YSSIQQSLSDEQVSQICDGRWISDLQEQGIWEQLLEFKNSVLAEDDNPTRRIISPKKAL
FT                   SPFQSSPITVAPALSAPSVNPDEGIRLVGKISDPQSSSGLLSSSPSRHQTIIRSGRAQE
FT                   IDKAKEQGQVEKENGNECYNCRTLHASSWRKCTTHDDDGVFTIILCNPCGLWFVNKKEH
FT                   RPRKYWGKMRDGRPIPPSKRGPRKKSDKTTLVKAEKKPVLKLHDKPLGIQTSIDLTNDA
FT                   RKSTPSSQNPTPVSSHTMAPTPMGSTPVPSHHTQGLNRTHVQENPHLNKRPFQALTQSL
FT                   QQPPEFESSQTLASRTASLPVSDRGAKRHKTDVASRPSCDAVHSAAIYKPTQFQAATSS
FT                   PAVTPTMESTATMPSSPGTQTRSNRASAPGSPPRTNSASSSTPFLQPKALPPLPPITPQ
FT                   KVRLTPSKKDKTPDFLVGLSPSRWLSAYLGSSRSPSQFSSHTSPVDHNTVNFFSESDLF
FT                   TESPFRGLYQGVRSEPFTQSTAGSMPPPSADDDYNMNVLPSSPSIFRMYKDNSDLFSSS
FT                   SQSTEATSPINKLQQIARNSPDAHKSLEESEEIGNTNKTNKA"
FT   gene            complement(<276656..>276747)
FT                   /locus_tag="YALI0_E02464r"
FT   tRNA            complement(join(276656..276692,276709..276747))
FT                   /locus_tag="YALI0_E02464r"
FT                   /product="transfer RNA Asn (GTT) cove"
FT   gene            complement(<277666..>279747)
FT                   /locus_tag="YALI0_E02508g"
FT                   /old_locus_tag="YALI-IPF40266"
FT   CDS_pept        complement(join(277666..279623,279717..279747))
FT                   /locus_tag="YALI0_E02508g"
FT                   /old_locus_tag="YALI-IPF40266"
FT                   /product="YALI0E02508p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79040"
FT                   /db_xref="GOA:Q6C7A1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032429"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR040227"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A1"
FT                   /protein_id="CAG79040.1"
FT                   /translation="MWVWSHGEATYHLFPSEFIIGRDKSHVLNMDGKSISRNHVQLIID
FT                   KDDSKCEIVSIKKPRIDTGVYVNGLQLKSEERFSIHRSTTYRVQVGRKEDSYFTLKWRP
FT                   LSFSYHEDEEETLLNEIIKGSDIRMQRYFSEDTTHYVKGKKNSSKLLLAMIKGVYVVGQ
FT                   QFLNELLNRKNEGLAVIWPDESDYVPEPELAIDTSRIQLWAGMTFAFSDRQQLEMLGPV
FT                   ITEGDGKAICLYLEDDTSTTRTIVDDLQRHAGKKVVVRSHEKKYQQIIMDAMGELANKD
FT                   IIVIDAADLLPAVKECNPSILWHKAQSLSKNIPRPKVERLDTVLMPPEEPENKKPSKPA
FT                   SRPAVNRVKRAPPKQMDLLNFFVKEETDSPPQPEITSSQDKQSQPPSSKGSSQRRPLKQ
FT                   RARVEPIDNLLLFQQPLKRQKVDNNAETEGKETADSAEELVIDDADIVMDNIDLHEESL
FT                   ISEAAPQNTHKPVDFSSAVQNIKSEHAKEEEANLDTESLAQLSIEVKEGSIAVRRPPPL
FT                   QATRMMSVVNAARYDGRRNFKKFKKQLPGYAENTTHGSFSRFDRRFVALVPDKPAQSDQ
FT                   TSIDDMLHAGENLTDRRIRILRERGEPQKKYRALDDDGEDGAEEADDDDLFLKDSEPEE
FT                   ESEVQTSHAAITIDDDSEDETAFKFSK"
FT   gene            complement(<280113..>280608)
FT                   /locus_tag="YALI0_E02530g"
FT                   /old_locus_tag="YALI-IPF40087"
FT   CDS_pept        complement(join(280113..280438,280499..280519,
FT                   280593..280608))
FT                   /locus_tag="YALI0_E02530g"
FT                   /old_locus_tag="YALI-IPF40087"
FT                   /product="YALI0E02530p"
FT                   /note="some similarities with uniprot|Q8LG23 Arabidopsis
FT                   thaliana RNA-binding protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79041"
FT                   /db_xref="GOA:Q6C7A0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR033744"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C7A0"
FT                   /protein_id="CAG79041.2"
FT                   /translation="MGITENEPTPLRSTEGWIIIVDNLHPEISEEDLTDFYSTYGDVQV
FT                   AHVNLDRRTGYAKGYALLQFATKDDADTAIAETNGVEFLEHNLEVSFAFHEADTSISQH
FT                   RIRGSENRSRSPGRRR"
FT   gene            <280937..>282265
FT                   /locus_tag="YALI0_E02552g"
FT                   /old_locus_tag="YALI-IPF2480"
FT                   /old_locus_tag="YALI-CDS2861.1"
FT   CDS_pept        280937..282265
FT                   /locus_tag="YALI0_E02552g"
FT                   /old_locus_tag="YALI-IPF2480"
FT                   /old_locus_tag="YALI-CDS2861.1"
FT                   /product="YALI0E02552p"
FT                   /note="similar to uniprot|P38719 Saccharomyces cerevisiae
FT                   YHR169w DBP8"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79042"
FT                   /db_xref="GOA:Q6C799"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C799"
FT                   /protein_id="CAG79042.1"
FT                   /translation="MSFTDLGLPEWLNESLSNMAITKPSAIQKACIPQIMKGKDCIGGA
FT                   RTGSGKTIAFAAPMLAEWSKDPCGIFGLVLTPTRELAIQIAEQFTALGANMNIRVALIY
FT                   GGVDMVKQSLELQKMPHFVIATPGRLADHIRSSGEDTIRGFRRVRYVVMDEADRLLTPG
FT                   FVPDLKTCMDLLPDPSKRQTLLFTATVTDAVRALKDRTGEKGPPFIHEIASDIAVPSTL
FT                   TQSYLFLPGYVREAYLWAILTHPDNEKKSAIIFVNRTQTAETLRRMLMALDVKTASLHS
FT                   EMRQQERVNALGRFRAQAARVLVATDVASRGLDIPTVEMVINFDLPADADDYIHRVGRT
FT                   ARAGRKGQSVSLVTERDVTRVTNIEERVGTKMEKYDLIEDDKVVEEYLTPASTAKRQAV
FT                   LDMEAENFGERKRIQRKKAGLDVDMKSKNKKPKRVAKGKSDKK"
FT   gene            complement(<282529..>282909)
FT                   /locus_tag="YALI0_E02574g"
FT                   /old_locus_tag="YALI-IPF20594"
FT   CDS_pept        complement(282529..282909)
FT                   /locus_tag="YALI0_E02574g"
FT                   /old_locus_tag="YALI-IPF20594"
FT                   /product="YALI0E02574p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79043"
FT                   /db_xref="GOA:Q6C798"
FT                   /db_xref="InterPro:IPR040424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C798"
FT                   /protein_id="CAG79043.1"
FT                   /translation="MNQQWDDSQLVATWDKAYEEYLKYHKKSTTEGAVINEMRTDKEQK
FT                   EMPEEDDDADMNDTADTANKLLEAAEISNISNDETSMANPGSGSASAPTGPSLDHLDES
FT                   VRSLVMAWYWAGYYQGLYEGKK"
FT   gene            <283099..>284292
FT                   /locus_tag="YALI0_E02596g"
FT                   /old_locus_tag="YALI-IPF2479"
FT                   /old_locus_tag="YALI-CDS3265.1"
FT   CDS_pept        283099..284292
FT                   /locus_tag="YALI0_E02596g"
FT                   /old_locus_tag="YALI-IPF2479"
FT                   /old_locus_tag="YALI-CDS3265.1"
FT                   /product="YALI0E02596p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C797"
FT                   /protein_id="CAG79044.1"
FT                   /translation="MNGHGSNLKDLGQVLLPNNEQFKNDGDSGDGEELPMFPPSENIGL
FT                   TFKSDGLLPLLFFVLPPEGDLQRKEFADLKHMLEKGGAILAPEPSNNTYNICYTEETLI
FT                   PQKYESYKIWYTADLIRRCMDCQCFDEDIVEAEMILVPNFRHLTNDSVNHEDEWCLDQA
FT                   PSLNWSPQDLFFSTDLLRPIMRISGSEYRKLISGSQLQADPAGSQGTRIGVDGVDVEME
FT                   GNNSNHAPVVKLEDIIDESTTPPLADALVLNAPRTEILHRPSHRALQVYIQNRQKWQNL
FT                   IDRLPHHEVVYLQRVTDLLSGDFDEVYHQVSYHGDDYDAINSQPGRWNSVHDVYLTDVT
FT                   ESKELAQYSVEQKFNRKKYLEETLTVNKVAEWLANFQPTKYGHPIHTITSHQTLTNY"
FT   gene            complement(<284398..>286500)
FT                   /locus_tag="YALI0_E02618g"
FT                   /old_locus_tag="YALI-IPF2478"
FT                   /old_locus_tag="YALI-CDS1161.1"
FT   CDS_pept        complement(284398..286500)
FT                   /locus_tag="YALI0_E02618g"
FT                   /old_locus_tag="YALI-IPF2478"
FT                   /old_locus_tag="YALI-CDS1161.1"
FT                   /product="YALI0E02618p"
FT                   /note="similar to uniprot|P53313 Saccharomyces cerevisiae
FT                   YGR245c SDA1 required for normal organization of the actin
FT                   cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79045"
FT                   /db_xref="GOA:Q6C796"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027312"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C796"
FT                   /protein_id="CAG79045.1"
FT                   /translation="MAKRKRAALLPTNIALLQNLVRRDPPSYKEEFLLQYQHYESIRDI
FT                   YMNSPQTENSEEFGDLVGFVAQVASCYPKETANFPDELSKLILDHHQHLDEDLREKLIQ
FT                   SMVLLKNKGVITPEKLIATLFPILLITGSKQLRTQIYSNIVTIVKGANTGSKAQKLNKS
FT                   VQALLFNVLSTGESSGLWATKLTRELWRRGIWDDSRTVEIMAQATLHGEAKIAISGVRF
FT                   FLGADKEREEANAEDSDSDASAEIGALKHRLQINKNSRKRGRKAESAMNKLLKKRKGNG
FT                   GVSATYLNFSALHLLRDPQGFADQLFTNLCKYRYDLEQKIQIMNLVSRMIGTHKLTVLG
FT                   IYSHFLKYLTPKQKDVTQIMAAAAQASHDLVPPDAITPMIRKIADEFVSDGVSAEVCSA
FT                   GINTIREILARNPLAIEAPLLQDLTAYKGSKAKAVVMAARSLVSLYREVAPEMLARKDR
FT                   GKEASMAMSADAKAGTSSRLQYGIEKGQTGIEGLELLAKWKADQVQEEDDEKAWEVDSD
FT                   SDDDSDDSESGWINIEDDKEYNISDSEDEEELDDEAKAAKAQAAADAAAEAQNIMATKI
FT                   LTPADFAKLEELKAQAGFDKLMGKKLTNEDEVDARGLIGPVKYKQLREERIAQAQEGRE
FT                   GREKFGSRKGKRDAPHSTTNREKARKKNFMMTIHKKDVQGKAKRSLIEKKRLLRAHIDK
FT                   QKKKGF"
FT   gene            <288941..>290053
FT                   /locus_tag="YALI0_E02640g"
FT                   /old_locus_tag="YALI-IPF2473"
FT                   /old_locus_tag="YALI-CDS3573.1"
FT   CDS_pept        288941..290053
FT                   /locus_tag="YALI0_E02640g"
FT                   /old_locus_tag="YALI-IPF2473"
FT                   /old_locus_tag="YALI-CDS3573.1"
FT                   /product="YALI0E02640p"
FT                   /note="uniprot|CAD70714 Yarrowia lipolytica Lipase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79046"
FT                   /db_xref="GOA:F2Z6D8"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z6D8"
FT                   /protein_id="CAG79046.1"
FT                   /translation="MKFSATLLFCASTLIAAATIAPLAPRGNQTKIINGFQVTDLVNDA
FT                   GDELLLFKDLTNSSWPGDTSTSTNGVTLYSGAIKAWTSSDVAAVSQTSYNYLEKQAKLA
FT                   NIAYCGGSSLLTAPFTCAYQCKEFPNMKLVSTWGDSRTLSALVAGYLSIDHTDKEIVVG
FT                   FRGSHTLKDWIVDLMVLRKAVDDSYPGCDNCRVHHGFYSAYKATLARFDNDLKKLVAEN
FT                   PGYRVSVVGHSLGGAVALLAATDFKNRGYDTYLTTFGQPVVGNTGFANYVDDLWFGSET
FT                   PNTLSGDSSRRYYRVTHKSDVVPRVPFWPGYTPNAGEVYISVAEINPPVSALRYCDGEV
FT                   NDQCLHGNSLLSLINLTAHHNYFIYIGGDC"
FT   gene            <291082..>291631
FT                   /locus_tag="YALI0_E02662g"
FT                   /old_locus_tag="YALI-IPF40086"
FT   CDS_pept        join(291082,291258..291631)
FT                   /locus_tag="YALI0_E02662g"
FT                   /old_locus_tag="YALI-IPF40086"
FT                   /product="YALI0E02662p"
FT                   /note="highly similar to uniprot|Q8WZY7 Neurospora crassa
FT                   Probable autophagy protein AUT7 and uniprot|P38182
FT                   Saccharomyces cerevisiae YBL078c AUT7 essential for
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79047"
FT                   /db_xref="GOA:Q6C794"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C794"
FT                   /protein_id="CAG79047.2"
FT                   /translation="MRSKFKDEHPFEKRRAEAERIRKKYDDRVPVICEKVEKSDIPVID
FT                   KKKYLVPADLTVGQFVYVIRKRIKLSSERAIFIFVDDVLPPTAALMSSIYEEHKDEDGF
FT                   LYVTYSGENTFGDLEQYRLE"
FT   gene            complement(<293292..>295000)
FT                   /locus_tag="YALI0_E02684g"
FT                   /old_locus_tag="YALI-IPF40264"
FT   CDS_pept        complement(join(293292..294599,294911..295000))
FT                   /locus_tag="YALI0_E02684g"
FT                   /old_locus_tag="YALI-IPF40264"
FT                   /product="YALI0E02684p"
FT                   /note="highly similar to uniprot|P00890 Saccharomyces
FT                   cerevisiae YNR001c CIT1 citrate (si)-synthase mitochondrial
FT                   possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79048"
FT                   /db_xref="GOA:Q6C793"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C793"
FT                   /protein_id="CAG79048.1"
FT                   /translation="MISAIRPAVRSSVRVAPMANTAFRAYSTQDGLKERFAELIPENVE
FT                   KIKKLRKEKGNTVIGEVILDQAYGGMRGIKGLVWEGSVLDPEEGIRFRGLTIPDLQKQL
FT                   PHAPGGKEPLPEGLFWLLLTGEIPTDAQVKGLSADWASRAEIPKHVEELIDRCPPTLHP
FT                   MAQLGIAVNALESESQFTKAYEKGVNKKEYWQYTYEDSMNLIAKLPVIASRIYRNLFKD
FT                   GKIVGSIDNSLDYSANFASLLGFGDNKEFIELLRLYLTIHADHEGGNVSAHTTKLVGSA
FT                   LSSPFLSLSAGLNGLAGPLHGRANQEVLEWILEMKSKIGSDVTKEDIEKYLWDTLKAGR
FT                   VVPGYGHAVLRKTDPRYTAQREFALEHMPDYDLFHLVSTIYEVAPKVLTEHGKTKNPWP
FT                   NVDSHSGVLLQYYGLTEQSYYTVLFGVSRAIGVLPQLIMDRAYGAPIERPKSFSTEKYA
FT                   ELVGLKL"
FT   gene            <296739..>300988
FT                   /locus_tag="YALI0_E02706g"
FT                   /old_locus_tag="YALI-IPF20585"
FT   CDS_pept        join(296739..297063,297114..300988)
FT                   /locus_tag="YALI0_E02706g"
FT                   /old_locus_tag="YALI-IPF20585"
FT                   /product="YALI0E02706p"
FT                   /note="similar to uniprot|P38181 Saccharomyces cerevisiae
FT                   YBL079w NUP170 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79049"
FT                   /db_xref="GOA:Q6C792"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR042533"
FT                   /db_xref="InterPro:IPR042537"
FT                   /db_xref="InterPro:IPR042538"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C792"
FT                   /protein_id="CAG79049.1"
FT                   /translation="MGNHSTGKVSNSSFGNALRPSAGLHNGHNGLASSSVPGLGNGVVN
FT                   HVLGAVPISSSSSSWLQTKKPKELGTVSVNEMSAKQPLELGSEFVEAYLNRDDKYPELD
FT                   RLVMQGQLSEYIFAQSGDLGALTPFTRTEVINMPDELYEQYNHTETSTKMGMFSEIDRI
FT                   WMTVDNRIYFWSYIDQAYHAFEGLEHTITSVSLVKPKANTFIDLISHVLVLTTPLEVYL
FT                   VAVGYNKTTDEFELFDTGMHTSIKGLDVDQVIASKDTGRVFFTGPGDGTNVYELIYNNQ
FT                   DRWFRDKCSKVCRTKNSIVASLQPIAIGEVAGEGTGILGKLVSSFLPSHEREVIVQMVI
FT                   DDSRKLLYTLSSTSTMRVYHMATDDLKLTFTYTFPQVLSHLQMITASTPTSHAPNHGAH
FT                   GHAHGHGTASHTGTNSRTKPATPLISKQTKIVSIKPVMATESSQIHLVAVTSSGWRLYI
FT                   RAARSYTFGAGGTAPSASNPPTFMQVIQVRFPPSSSPEAVPPMQSKVLSGTLGTSRLFE
FT                   PGHFFAVVPAETEEEGDKAMPTSDRVFVAAPDTGRILYQQSSLAAAANPVYIENASFLE
FT                   VDGFVQSIQLLTPPFRATNHPEGFGNESACQYEKSAHQKVAVLTQTGLHIYERTLPYET
FT                   FQRLGGDVKTFFDLYGRTETCATALSLASMNISSPEERELARKVYIEVGGRAHLVDDDT
FT                   NYGITAASVTPTGTTSSPPQVVKLSGRFEGLATYLSRAIRPLWQQNVFALVPRVVNGEA
FT                   KEQFVLKLSREHIEDAQVRLIEISEFLTKNKTFIEGLAGADRVVLGGNRAEETALLAEH
FT                   TALNALVKLVNNMKEATALLQLLQDETASAPNGIESIMVYLTPAAREQMAKLKFFELVT
FT                   RKAGIDLAKELVTCLVNKAIADGGSVESVASILEDRCNSYCSASDVLTYKAIEALKRAK
FT                   DVGVRDPELRQQLLAESVRLFEKTAGSLSIDSLSESIDLYCEQGYYTGAIQVALSVAQE
FT                   MDRANVAAAYILDDMPEGDVRQETYEKRVKVYSMVFGVLERVVEDSPVNSPVPNEAYDI
FT                   ALASTDEVFQYCFYDWFIETGNSARLLDLDTPYILPYLVNNAKKSVNMADLLWCYYQMR
FT                   GSVISAAEVLFDIATSTKFVLPLAQRIECLSRARGYVNCPAPITSRQQLAQLTTRIQEL
FT                   LEVSSIQDDILTNVKKDPRFHDARRQETMAKLDGPIMGVSELFNLYADPLQYLESCLAL
FT                   FQVSDYRQNDEILNCWNKLIVQTDQKGEEDHDGDRAQSYEYVANMVQRLGKQFMVSEFV
FT                   FPYDQLIPILELYRVQHQPDSPVGWVVDTFLGASLGYETVYTCLSDMIERREYPFSEEH
FT                   AMRLLALDVIYLLEKWLAESRGIAQIQNVVSADMLDTLEQYTSQGDVAGLRRRLRI"
FT   gene            complement(<301246..>303309)
FT                   /locus_tag="YALI0_E02728g"
FT                   /old_locus_tag="YALI-IPF2465"
FT                   /old_locus_tag="YALI-CDS1209.1"
FT   CDS_pept        complement(301246..303309)
FT                   /locus_tag="YALI0_E02728g"
FT                   /old_locus_tag="YALI-IPF2465"
FT                   /old_locus_tag="YALI-CDS1209.1"
FT                   /product="YALI0E02728p"
FT                   /note="highly similar to DEHA0F08019g Debaryomyces hansenii
FT                   and uniprot|P49367 Saccharomyces cerevisiae YDR234w LYS4
FT                   homoaconitase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79050"
FT                   /db_xref="GOA:Q6C791"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR039386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C791"
FT                   /protein_id="CAG79050.1"
FT                   /translation="MFAFRNRAVTQTLLVRRYSTKRIPQNLTEKIVQRYAVGLPEGKQV
FT                   QSGDYVSIRPSHCMTHDNSWPVATKFKGLGAKAVKDNRQVVMTLDHDVQNKSEKNLEKY
FT                   ANIENFAGEQGIDFYPAGRGIGHQVMVEEGYAFPYNLTVASDSHSNMYGGIGCLGTPIV
FT                   RTDAASVWATGQTWWQIPPVARVELKGQLPAGVFGKDVIIALCGIFNNDEVLNHAIEFV
FT                   GDGVEHLSVDERLTIANMTTEWGALTGLFPVDETLRQWYEYRLTRLPQPHARVNDGTVA
FT                   ALKDAVQADTDAKYAKNLTIDLSTLSPFLSGPNSVKVYNSLADLSAQDIKINKAYLVSC
FT                   TNSRLSDIEAAANVIKNNKVAEGVEFYVAAASSFVQKDAEASGAWQTLINAGAKPLPAG
FT                   CGPCIGLGTGLLEDGEVGISATNRNFKGRMGSKDALAYLASPEVVAASAVLGKIGFPEE
FT                   VYGSPVPGAKGVSSSISVTEAVEAEADAEAAESDPAPSGGVLDGFPAQITGELVLCDAD
FT                   NINTDGIYPGKYTYQDDVPREKMAEVCMENYDPDFGSKTGAGDIIVSGFNFGTGSSREQ
FT                   AATCILARDMQLVIAGSFGNIFSRNSINNALLTLEIPALINKLRKRYEGQPAELTRRTG
FT                   WFATWDVPAATVTVTDGKNGPVILKQKVGELGQNLQEIIVKGGLEGWVKAQL"
FT   gene            <304193..>305842
FT                   /locus_tag="YALI0_E02750g"
FT                   /old_locus_tag="YALI-IPF2462"
FT                   /old_locus_tag="YALI-CDS1962.1"
FT   CDS_pept        304193..305842
FT                   /locus_tag="YALI0_E02750g"
FT                   /old_locus_tag="YALI-IPF2462"
FT                   /old_locus_tag="YALI-CDS1962.1"
FT                   /product="YALI0E02750p"
FT                   /note="uniprot|Q8WZL9 Yarrowia lipolytica YALI0E02750g hel
FT                   putative RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79051"
FT                   /db_xref="GOA:Q6C790"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C790"
FT                   /protein_id="CAG79051.1"
FT                   /translation="MNLAQWSIIQNGAKIVAHMGTGNNAYIIACYSNSRPAVMLPLLIQ
FT                   MNHTNTNIAVVVHTETAAKRYSKEIEETSKVAGTPCSSQCFLRWDSLPIDSKCTYFTPE
FT                   SFLKAFGQQQEIPYTHIIVLDTHERLQWGETVLAVLKKVYTGPLVLCCSPLPKAIGYLQ
FT                   DFYEGASIIALQDIEVVDMHYLDHPSCNLVDTAVDTAVNISSMEGDGHIIMFLSTREEV
FT                   LLVIRGINDRLQSQQKGGDVSVVPFYKAMKREELEELYDALDKRGGRTIIVATAMAQDY
FT                   TSLPPDIKYVVDSGLQTSQEGKQIWATKLDCEIRANRVSSTGGKVYRLFTEEMFEDLID
FT                   MCPAEVMVDKLDQVVLYWLSLGVKNILTLETPSKYPQRLLSSALTTLHHASLISNDGQL
FT                   TRVAQSVSSLSICLPFIPTRFIAAIGHSLSESCTSQILSIVAMELAGGLNEAYYTPKEV
FT                   VKREEAKNIHALFQVEEGPYITLLNIYESACTPKLKHTRWFVEHFLNYQMIRMATNIRH
FT                   ELASVIGVGAVNADKDEQMTGCLEIVKRYFDE"
FT   gene            <306226..>307620
FT                   /locus_tag="YALI0_E02772g"
FT                   /old_locus_tag="YALI-IPF2460"
FT                   /old_locus_tag="YALI-CDS2654.1"
FT   CDS_pept        306226..307620
FT                   /locus_tag="YALI0_E02772g"
FT                   /old_locus_tag="YALI-IPF2460"
FT                   /old_locus_tag="YALI-CDS2654.1"
FT                   /product="YALI0E02772p"
FT                   /note="uniprot|Q8WZM0 Yarrowia lipolytica histone N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79052"
FT                   /db_xref="GOA:Q8WZM0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037800"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WZM0"
FT                   /protein_id="CAG79052.1"
FT                   /translation="MDSDTESVKRRKSSGSESESSVRDPKRTKIEDEDFQENGIDDEDE
FT                   EEEEEEAKDEGDEDDEEKGEDDEEDDEEKEGEDGEGEEEDEEEDEEKKREEEEKYVTSF
FT                   NFDGVEYKYKERPAVIEEREGKIEFRVVNNDNSKENLMILTGLKNIFQKQLPKMPREYI
FT                   ARLVYDRSHVSMAVVRKPLTVVGGITFRPFDTRKFAEIVFCAISSTEQVRGYGAHLMNH
FT                   LKDYVKATSPVMYFLTYADNYAIGYFKKQGFSKEISLDRSVWMGYIKDYEGGTLMQCSM
FT                   LPRIRYLDVNKILLLQKALIHKKIRAISKSHVVRKGLDHFRDSTTPVDPMTIPGLKEAG
FT                   WTPEMDELARRPKRGPHFAVMQHVLSELQNHASAWPFAQAVNRDEVPDYYEVIKEPMDL
FT                   STMEQRLEADSYKTMEEFVYDARLVFNNCRAYNNETTTYYKNANKLEKFMVAKIKEIPE
FT                   YSHLVE"
FT   gene            complement(<307791..>308844)
FT                   /locus_tag="YALI0_E02794g"
FT                   /old_locus_tag="YALI-IPF40263"
FT   CDS_pept        complement(join(307791..308456,308749..308844))
FT                   /locus_tag="YALI0_E02794g"
FT                   /old_locus_tag="YALI-IPF40263"
FT                   /product="YALI0E02794p"
FT                   /note="highly similar to uniprot|P32379 Saccharomyces
FT                   cerevisiae YGR253c PUP2 20S proteasome subunit(alpha5)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79053"
FT                   /db_xref="GOA:Q6C788"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C788"
FT                   /protein_id="CAG79053.1"
FT                   /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATKDG
FT                   VVLGVEKRITSSLLEASSIEKIVEIDKHIGCAMSGLTADARTMIDHARVESVQHDLYYD
FT                   EPINVETVTQAVCDLALRFGEGAEGEERIMSRPFGVALLIAGYDDDHGAQLYHAEPSGT
FT                   FYRYEAKAIGSGSEGAQAELQNEYHKDMTLEEGEVLVLKILKQVMEEKLDSKNVQLSSV
FT                   TKSEGFKIYDDDKMVSVVAKLDSEVGDEEQV"
FT   gene            <309508..>311877
FT                   /locus_tag="YALI0_E02816g"
FT                   /old_locus_tag="YALI-IPF2458"
FT                   /old_locus_tag="YALI-CDS0863.1"
FT   CDS_pept        309508..311877
FT                   /locus_tag="YALI0_E02816g"
FT                   /old_locus_tag="YALI-IPF2458"
FT                   /old_locus_tag="YALI-CDS0863.1"
FT                   /product="YALI0E02816p"
FT                   /note="weakly similar to uniprot|Q9Y705 Schizosaccharomyces
FT                   pombe SPBC365.15 Spindle pole body component alp4 (Altered
FT                   polarity protein 4)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79054"
FT                   /db_xref="GOA:Q6C787"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C787"
FT                   /protein_id="CAG79054.1"
FT                   /translation="MEVDDPRQGQGHDQGLSGIKTKKSTITTTTTTQHIRSHSSHPQQE
FT                   APLYVPKVSLNPSTSLPLLACRLMPQPKCSEVTRNTPRPRNIETYALDVQEVLVMEDLL
FT                   NVLMGHEGVYINYSDSYNPRLELDRLKGPDYRTARGLDPSFKDFTRACIKIASTYVSLS
FT                   AFVDKMTRDRRGLVNGALAASIRKLLKEYVKLAQGLEYSLRFESGLTLHKFHLKLMTIG
FT                   GILHETHELAKDILREDEVRFHNATLEPSNDLDALLAKFRENSVEIDTRGYGISLNGSS
FT                   MCRGGITLKVIAERLNAHSGDPTANQLLTRLLNDASKPYLQMLSRWIYQGVILDPYGEF
FT                   CIQENGDLATGNEGAYDEYWEQRYSVRKDELPLLLSQSNLLEKVLLAGKYLNIVRECGG
FT                   GDTSKDAAVNWESIQDPALVPSIASASDESNRALLSLLLSSHNLFDRLASLKHYFFLDR
FT                   ADYYINFQDIAWTELARPASQSSVTKLQYLLDLCLRQPGSITSTDQYKDDVVASLAPTT
FT                   VWDYLLQIVCATDPNESGWESDSRKMSMDDMPVSCAFQLDFKVPFPLSLVISRRALIRY
FT                   QILFRHLAELKNLERLLSIVWLEMAKSRHWRYPTSDERLHKWKAFSNILRIKMVEFVKQ
FT                   LLYHCTAEVIEPNWKRLQEKFKSASNVDELIADHITFLDTCLKECMLTNEKLIRVQQKI
FT                   FGYIRFFVNTIQARSHFLEIVDPSHLSDFERSRLQPVYDRNGATIPNDTLVERMNRLVK
FT                   TTDTNFSHSCKVFKDALEFFAATESTSLLALSARLS"
FT   gene            <312183..>312725
FT                   /locus_tag="YALI0_E02827g"
FT   CDS_pept        312183..312725
FT                   /locus_tag="YALI0_E02827g"
FT                   /product="YALI0E02827p"
FT                   /note="weakly similar to uniprot|P41912 Saccharomyces
FT                   cerevisiae YOL110W SHR5 RAS modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02827g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64324"
FT                   /db_xref="GOA:P0C0R1"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C0R1"
FT                   /protein_id="CAR64324.1"
FT                   /translation="MTSFFNYHEYISSNDRAQTHHPNIYVEYGQSDTKLRRCVRVPRDY
FT                   SVVGDEYPYFSTHFVGEEPGAYPSEEGPTYDSRSPLKDIISYQEYNDIVGTINGYMKRA
FT                   FSPWQKCQFIETVLSFLTLWIFERLFASNNERVLAQLDEYIDQLNSKNADRFILINPRK
FT                   NGFLSLDFLVMVGEPNI"
FT   gene            complement(<312863..>315313)
FT                   /locus_tag="YALI0_E02838g"
FT                   /old_locus_tag="YALI-IPF2457"
FT                   /old_locus_tag="YALI-CDS0794.1"
FT   CDS_pept        complement(312863..315313)
FT                   /locus_tag="YALI0_E02838g"
FT                   /old_locus_tag="YALI-IPF2457"
FT                   /old_locus_tag="YALI-CDS0794.1"
FT                   /product="YALI0E02838p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C786"
FT                   /protein_id="CAG79055.1"
FT                   /translation="MVKKNNKRPGTKGASVQNGGSSGDIASPADNTNTSLFSDSSLQFP
FT                   TTLKEALIKPEQLYHRKEGLLLDYDAEFVSDAKAEGTFKPKADREYILSFPEIDDSDFP
FT                   AEECPTLTFQEHAQIRDAIASPKTKELSPAVEKKLKDIYTRNKDLIVLSMSGGDPRGLS
FT                   DLYLRVCMQTRCVRFMRSDQILLWVTSMELYRAEARDKEVEILKKAPQYKAKQAVFNFA
FT                   PLRDKFLDIACHSVMQKFSYSSTRLGVPWVQNHEFYIMLEAIKHVVFSDGVSSPLNRLL
FT                   DKYQQVIRIQDTLRLYNRPAVDKGAAERKSICGKLALSRHFKDPKEISDFIIQTFASWV
FT                   PNCRGLSSQMRRKIDDAPKREVKACAKNYESRFFTRYRSYADDTMERMSQWEIAALGKN
FT                   ENNIVCSADMLTDVYVDPKNPELLRGKVCLAEGGYLEAVYDDRARRDRNVLSSTYEIIS
FT                   RPFDDPGTLFVKKGNFSRVVSVLKDCGQEDAIFVQMPLKEDTLSLTKNINNCDFLNGNG
FT                   VRFSTMNRESRNIPKAHHKTPFTTPFSAFYTPTSFRSPMPLDTVLIDISGPYPMTLTGC
FT                   QWLMVVFDYSSLAFFTVTAKSLASLNREMIKWLDETPRRLFPRHYKSEPLVGCIQYHGP
FT                   DSSPAAPYHKNIPNSPRKALFEHCKEKRIFLQDYQGMRYSRYHTSTQSERQTTQVVEEL
FT                   VLIPARNALWQCKITESRKEQLWDYAVDYVVQKHNHTFDVGIGSYVVEWGLPPTPYANL
FT                   SMPLLLHGDDDRRNDLTRELYHQYFFGDPMNPGFWVLKCVGKVLYVYDEMNNTVATTVL
FT                   KTPA"
FT   gene            <315550..>316089
FT                   /locus_tag="YALI0_E02860g"
FT                   /old_locus_tag="YALI-IPF2455"
FT                   /old_locus_tag="YALI-CDS5686.1"
FT   CDS_pept        315550..316089
FT                   /locus_tag="YALI0_E02860g"
FT                   /old_locus_tag="YALI-IPF2455"
FT                   /old_locus_tag="YALI-CDS5686.1"
FT                   /product="YALI0E02860p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79056"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C785"
FT                   /protein_id="CAG79056.1"
FT                   /translation="MPPANWPSNIVFIKENIYSNQLTSEELANIGLTPAKAKTRPTPNG
FT                   SPTNKLIKIKKISDPKHPANGQFGLFANQKLPAKSHVIDYVGYVHPDRESDPSSDYDIS
FT                   LDSALGIGIDAQRWGCEARMINDYRGINATNNVIFDNRMVGKELRIAVFVGPKDVNKGE
FT                   ELCINYGKGFWKGRAG"
FT   gene            complement(<316656..>317321)
FT                   /locus_tag="YALI0_E02882g"
FT                   /old_locus_tag="YALI-IPF2454"
FT                   /old_locus_tag="YALI-CDS5231.1"
FT   CDS_pept        complement(316656..317321)
FT                   /locus_tag="YALI0_E02882g"
FT                   /old_locus_tag="YALI-IPF2454"
FT                   /old_locus_tag="YALI-CDS5231.1"
FT                   /product="YALI0E02882p"
FT                   /note="similar to DEHA0G25817g Debaryomyces hansenii and
FT                   uniprot|P45976 Saccharomyces cerevisiae YJR093c FIP1
FT                   component of pre-mRNA polyadenylation factor PF I possible
FT                   transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79057"
FT                   /db_xref="GOA:Q6C784"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C784"
FT                   /protein_id="CAG79057.1"
FT                   /translation="MDDDDDFLYGTEEPAVKRARVEPEGAEDDEEPHSQTTKQQEPEDD
FT                   SDSEYESDDSDIDIVIDTGAPSKLASTASAAAKKEAPAASSAAPEASDTPKEESASEER
FT                   PQPAAKMPGIDIEKVGMLDGKPITEHNLEDFEDKPWRMPGADITDYFNYGFDEFTWMAY
FT                   CDKQNQIRGEYNPQNMMAMMGMSMMGMPGMPGGGQMPMPGGEGMPDMFKMMQGMNPPK"
FT   gene            <318087..>319262
FT                   /locus_tag="YALI0_E02904g"
FT                   /old_locus_tag="YALI-IPF2453"
FT                   /old_locus_tag="YALI-CDS3337.1"
FT   CDS_pept        318087..319262
FT                   /locus_tag="YALI0_E02904g"
FT                   /old_locus_tag="YALI-IPF2453"
FT                   /old_locus_tag="YALI-CDS3337.1"
FT                   /product="YALI0E02904p"
FT                   /note="similar to uniprot|Q01159 Saccharomyces cerevisiae
FT                   YGL130w CEG1 mRNA guanylyltransferase (mRNA capping enzyme
FT                   alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79058"
FT                   /db_xref="GOA:Q6C783"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C783"
FT                   /protein_id="CAG79058.1"
FT                   /translation="MSGIVPEIPGEQAPPDAAHQLKVDVARLLQKPKLNFPGAQPVSFA
FT                   RKHIEEELFKRDYYVCEKSDGLRCLMYVTWENNPDTGPQQVTYLITRNNEFFFIPMVHF
FT                   PSNDGKPLQDTIVDGELVLTKAEPRSLHFLMFDCLACNKILLTGRPLDKRLGYLNAAIS
FT                   HPLKEYLHKNPEVARDFPFSVRVKDMQFAYNVMNVFASFPHLPHITDGLIFTCRDHPYV
FT                   SGTDERILKWKKQDENSVDFLMTMKFPIFEDTNGESWTDYDAKPEITLLVWTGRDGSRP
FT                   YGELYLTDEEWDNLKALEEPLEERVVECIKDDKKRWRYLRFRDDKTNANYITTVEKVID
FT                   SIDDPVSEKNLLDAAPKIKELWKERNRRPRDEDRKRVGGDDHDHGAKRARQ"
FT   gene            complement(<319433..>319513)
FT                   /locus_tag="YALI0_E02926r"
FT   tRNA            complement(join(319433..319468,319476..319513))
FT                   /locus_tag="YALI0_E02926r"
FT                   /product="transfer RNA Glu (CTC) cove"
FT   gene            complement(<319525..>319607)
FT                   /locus_tag="YALI0_E02970r"
FT   tRNA            complement(join(319525..319561,319570..319607))
FT                   /locus_tag="YALI0_E02970r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            <319908..>321041
FT                   /locus_tag="YALI0_E03014g"
FT                   /old_locus_tag="YALI-IPF2451"
FT                   /old_locus_tag="YALI-CDS3490.1"
FT   CDS_pept        319908..321041
FT                   /locus_tag="YALI0_E03014g"
FT                   /old_locus_tag="YALI-IPF2451"
FT                   /old_locus_tag="YALI-CDS3490.1"
FT                   /product="YALI0E03014p"
FT                   /note="weakly similar to uniprot|Q04410 Saccharomyces
FT                   cerevisiae YDR517w GRH1 Yeast (GR)ASP65 (H)omologue"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79059"
FT                   /db_xref="GOA:Q6C782"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="InterPro:IPR024958"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C782"
FT                   /protein_id="CAG79059.1"
FT                   /translation="MFAFAQKLVSQADKYINEARDEVDDQPCSHGFRILHVEPNSIAQK
FT                   AGLEALYDFIIAVDGETVDHETQEHNPYARQSLDQPVQAPVDRLTQRLTGDNVTLTVFS
FT                   SKGHTVRNVQVDASTAKPEFTEPDAIQLDSVHGGDFVRGNEYDKEALKEASTPPGLGVS
FT                   LQYTPLDVGDYVWHVLDVAPNSPAERAGLIAHSDYIVGGSGGLLASGGEDLLSRVVAVH
FT                   YSRQEDCPIQLFVYNSDYNITRPVLIMPMRGWGGAGLLGCGVGYGLLHRLPEFLGVNRP
FT                   GDTVFNADERASASPAPPQSYQAPPQGGIPAVAYQPPSAYAPPPPTGGPRRAKKPATAI
FT                   NDFSDYFAEQEKSSREADRISLAAQPVKDIPPPPKKA"
FT   gene            complement(<321501..>323015)
FT                   /locus_tag="YALI0_E03036g"
FT                   /old_locus_tag="YALI-IPF2448"
FT                   /old_locus_tag="YALI-CDS2320.1"
FT   CDS_pept        complement(321501..323015)
FT                   /locus_tag="YALI0_E03036g"
FT                   /old_locus_tag="YALI-IPF2448"
FT                   /old_locus_tag="YALI-CDS2320.1"
FT                   /product="YALI0E03036p"
FT                   /note="similar to uniprot|P55059 Humicola insolens Protein
FT                   disulfide isomerase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79060"
FT                   /db_xref="GOA:Q6C781"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C781"
FT                   /protein_id="CAG79060.1"
FT                   /translation="MKFTALTIALMGALAAASDVVKLDSDNFADFVTDNKLVLAEFFAP
FT                   WCGHCKQLAPEYESAATILKEKGIPIGKVDCTENEELCSKFEIQGYPTLKIFRGSEEDS
FT                   SLYQSARTSEAIVQYLLKQALPLVSEFANEKELNAFTKDNDVTIVAFHDEDDEKSQSTF
FT                   QRVAQKLRERFTFGHSADKALAKKYGVEKFPALVVYRNFDEKPAVYDISAGKKVFKFKP
FT                   EPLTKFIKTEAVPVIGEIGPASFQDYATSGLPLVYIFSALEKDTKQISEWVKPWAEKLK
FT                   GEAYVGVIDADLYGSHAQNVNIQEKFPAIAIENFDNKKKWAHAQDAKITKASVDKFFKE
FT                   YIEGTLEPILKSDPVPEYQDGPVHIVVGKNYKDIVLDDDKDVLIEFYAPWCGHCKILAP
FT                   IYDELGDLFFDHPEISKKVTVAKIDATTNEFPDEDVKGFPTIKLYPAGKKNAPITYPGA
FT                   RTLEGLNQFIKEHGTHKVDGLAHADEEEAPAKDTKAKKGGKIDDEL"
FT   gene            <327164..>328111
FT                   /locus_tag="YALI0_E03058g"
FT                   /old_locus_tag="YALI-IPF2447"
FT                   /old_locus_tag="YALI-CDS4202.1"
FT   CDS_pept        327164..328111
FT                   /locus_tag="YALI0_E03058g"
FT                   /old_locus_tag="YALI-IPF2447"
FT                   /old_locus_tag="YALI-CDS4202.1"
FT                   /product="YALI0E03058p"
FT                   /note="similar to DEHA0E08833g Debaryomyces hansenii
FT                   possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79061"
FT                   /db_xref="GOA:Q6C780"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C780"
FT                   /protein_id="CAG79061.1"
FT                   /translation="MAAISKDYVLSPWGKAVAGAAGAVLANTLVYPLDIVKTRLQVQVK
FT                   RKEGGPLPAFEEGHFEHYEGTVDALKKIYAANGLAGLYQGLPSCLLGVASTNFAYFYWY
FT                   GFIRDSYIKRNPGKALSTPIELLLGAVAGALAQVFTIPVAVITTRQQTSDAKSRQGFLA
FT                   TAKSVVDDDGISGLWRGLKASLVLVINPSITYGSFERLRTILFKGKLHLSPGENFLLGA
FT                   LSKAMATIATQPMIVAKVMQQSKTKGGKQFNSFVQALVFLFKEEGILGMWKGVGPQISK
FT                   GIIVQGLLFMIKDQVELFIVLLFRLMKAPTLIKG"
FT   gene            complement(<328481..>329686)
FT                   /locus_tag="YALI0_E03080g"
FT                   /old_locus_tag="YALI-IPF2446"
FT                   /old_locus_tag="YALI-CDS3220.1"
FT   CDS_pept        complement(328481..329686)
FT                   /locus_tag="YALI0_E03080g"
FT                   /old_locus_tag="YALI-IPF2446"
FT                   /old_locus_tag="YALI-CDS3220.1"
FT                   /product="YALI0E03080p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C779"
FT                   /protein_id="CAG79062.1"
FT                   /translation="MDPASALAQKLASLKHLTSNIPPGYYVIDTSSPSRSRSSTTPSSS
FT                   ASAANAIQEEDDDEGSGFAYINPELSGTTQSGRVPPISGLATESPEDLKSEKEESKKVS
FT                   YTFEMFCEDFDPTDDTIRRLFELMMVELANKREALVHKPAAGSIRKRFGSMSNLQMSAS
FT                   YHGYHSQSTGNLRHSYAGPPAPVFQGFHSGQSSVSGSFIPGSYVPPGSIPSSHAGSVSG
FT                   SMAGSIPGSGYHTPNHPYLSSLTPIHQENDTVPQVVTGFAGSRNISSPQLASSTSNISS
FT                   RMSRAFERAGSSGHNMPSSSNNPSHTNLSVLSTGSAATGPPSPSQSSPVYVPMKSPKSA
FT                   VSLNPDPRRMSQSDAWMPYAGLSARARANFGSGGRFSVTSSVSDGDAFDRMKEAEASDR
FT                   SE"
FT   gene            <331802..>334108
FT                   /locus_tag="YALI0_E03102g"
FT                   /old_locus_tag="YALI-IPF2445"
FT                   /old_locus_tag="YALI-CDS0919.1"
FT   CDS_pept        331802..334108
FT                   /locus_tag="YALI0_E03102g"
FT                   /old_locus_tag="YALI-IPF2445"
FT                   /old_locus_tag="YALI-CDS0919.1"
FT                   /product="YALI0E03102p"
FT                   /note="weakly similar to DEHA0A06006g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79063"
FT                   /db_xref="GOA:Q6C778"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C778"
FT                   /protein_id="CAG79063.1"
FT                   /translation="MPAKSDKELLNAYIYDYLLKHNMHDSARTFGAEAKVVPNVKKEDD
FT                   KDLPKPLIPIDAPQGFLYEWWALFWDIYSARGSKGGGSVPAQQYVQGTMRLRQEHAARA
FT                   QLQQQHQAQQHAQAQAAAQVQGQAQGQGQGQNPTQGPQPQGHMGMPGQGPHQPGGPFMN
FT                   GNMMFPPGQMRMGQLPQHLQQQGTGVAGANPSDDSSSPGGTSPAKRQRLSPDMGGQSHP
FT                   EQQGQHMMGTPNPNNPVFNSQVMQQLKASQGQMPNLQQQQQAQLQQYSNTLSLAQQRAM
FT                   MNAKGGPNGQPGQPGQPGQPGQPGQPGQPGQPGQPLPMGYEGMEPGFMGGNGLILNAQQ
FT                   MRQQQAGSGGAAGSGQLNGNSNALHDYQMQLMLLEQQNKKRLMVARQEQQEGQPRAEGQ
FT                   AAAAGANPGARMSGQFKRPGSSPVVGNIGDGRRVTPKLPNQPSPLIDANRASPLQSNFN
FT                   GQGDFNVVVGPSGQMMRMQQPQQQGGPPQQQGQQQGGPGQQQGGPGQQPQQGQQQGQQG
FT                   GPQGGQHRFDDPQQLPQSQNGGPQPGSAPGQLPQTQGGPQRPPSRVSQMPPPGVQGGQR
FT                   TQPSSPGQASNPGSGGSSGSAPGGTTPTQANKQLKGKKAEPKKRAKKGNQPVTPKAVSE
FT                   SPTPTTPATPSAASNQSLLSKATNFAANNKQAQAAAHAQAQAQAAAQAQSQMHMGGMGG
FT                   SSSGLELDVNGGMGLDNDSSSFLNDFSTGNEGDVGDMDFDFNSFLNTDDNAAGALKFDS
FT                   GSAFGWGEGVEAMNE"
FT   gene            <336853..>339141
FT                   /locus_tag="YALI0_E03124g"
FT                   /old_locus_tag="YALI-IPF2443"
FT                   /old_locus_tag="YALI-CDS0934.1"
FT   CDS_pept        336853..339141
FT                   /locus_tag="YALI0_E03124g"
FT                   /old_locus_tag="YALI-IPF2443"
FT                   /old_locus_tag="YALI-CDS0934.1"
FT                   /product="YALI0E03124p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79064"
FT                   /db_xref="GOA:Q6C777"
FT                   /db_xref="InterPro:IPR026859"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C777"
FT                   /protein_id="CAG79064.1"
FT                   /translation="MNVIFENTPMADYLQQADNPGMADWGLDDEYDFDSSDEDLLQSYE
FT                   GRRSYEKDPNVEENLRRIDEEDEYDTDTNTENVSSPEQQPSQHPQSHPQNTQRKHRRFA
FT                   STSAIQPLHSANENLMKRERFQLLLAGALRQSLPLVENNRFLEKFRYIVVTSQLLSEQP
FT                   PVSSKTPNFPDDKDLLPETTWATSGGCVVVVVGLFSWAVRKKAIFEGKARAMASFVATL
FT                   CLVIFMYAHSRRRLLRIIRIKAVQSARQFVLSSQGFDAAVHKSLGVIHEVEFLSKGFSF
FT                   PQKTVEGTDLDVRLCKQLRAALSASLYLSISSLTRSIRKMLNHCHKLDLEKYLDIYEVD
FT                   VMDLSLFVEDDGPIPEHDFTASSPVEALRNMVDVPEADFYGSKGANHSHKNLKFYHYKF
FT                   HLLRRVMLCCLLSMTASGTDGSEYTQWKLVSGELSRSEKLLRQLDESLVDTIYGLDHDA
FT                   KLLSHSRSDSLFGKVIDSRKGRRLSSFNLLSEPSSAASEPSKEVQQHLKQLSRLSSTLR
FT                   QIEGRMQIAREGSMSHIESASADELLTNYRTLGDDIQSLASIWQGGMSSLEAKLKNPST
FT                   SRAEKTLSFIEKQRHLSDATVDTLASPLLQQLASLGSPVHNNDYSTVSQATTLAEFEDD
FT                   VHGPAAKQSALSNTYRALCGDSTPVSSPPMSPTMLEDENGIPIQYSQFGKRRSFHQRDM
FT                   SLTTILEGIANKDKGKGLGIDTSGTVHEQREKRIARMKEEREREVDNRAAANRRGSVML
FT                   ELKTVLENR"
FT   gene            complement(<339360..>340799)
FT                   /locus_tag="YALI0_E03146g"
FT                   /old_locus_tag="YALI-IPF2442"
FT                   /old_locus_tag="YALI-CDS2504.1"
FT   CDS_pept        complement(339360..340799)
FT                   /locus_tag="YALI0_E03146g"
FT                   /old_locus_tag="YALI-IPF2442"
FT                   /old_locus_tag="YALI-CDS2504.1"
FT                   /product="YALI0E03146p"
FT                   /note="similar to uniprot|P43123 Saccharomyces cerevisiae
FT                   YDL103c QRI1 UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79065"
FT                   /db_xref="GOA:Q6C776"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C776"
FT                   /protein_id="CAG79065.1"
FT                   /translation="MSYEQLKKTYDDAGQGQVFQFWDKLSDEEKSSLLAQLAEIDPTEV
FT                   TWHAENTIPKAAKGMENPTSPIEGIPEEYSGSTLPDAPTSKYTGEWYDAGLKLIGDNKV
FT                   AVVLMAGGQGTRLGSSAPKGCYDIGLPSHKSLFQLQAERIAKIQELSGGVVPWYIMTSG
FT                   PTRGPTEAFFKGHKYFGLDEKNVVFFEQGVFPCLTDEGKIILDAPGKVAVAPDGNGGLY
FT                   LALYKSGVLDDMKKRGIEHIHTYCVDNCLARVADPVFMGFSASRGVDIATKVVRKRDAT
FT                   ESVGLIVSRDDKPQVIEYSEISDALAKAEDPSAPGLLKLRAANIVNHYYSINFFNKIPE
FT                   WFSKDNFEFRQQILPFHVAHKKIPYVDAEGKTVKPSTPNGIKLEQFVFDVFVTVPLTKF
FT                   AVLEVARADEFSPLKNAPGTGQDDPETSRAHLLEQGARWVKAAGAIVEGKQLVEVSPLT
FT                   SYGGEGLEKCKGETIKSESEI"
FT   gene            <343908..>347351
FT                   /locus_tag="YALI0_E03168g"
FT                   /old_locus_tag="YALI-IPF2439"
FT                   /old_locus_tag="YALI-CDS0293.1"
FT   CDS_pept        343908..347351
FT                   /locus_tag="YALI0_E03168g"
FT                   /old_locus_tag="YALI-IPF2439"
FT                   /old_locus_tag="YALI-CDS0293.1"
FT                   /product="YALI0E03168p"
FT                   /note="similar to uniprot|O42696 Candida albicans CaNIK1
FT                   signal transducing histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79066"
FT                   /db_xref="GOA:Q6C775"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C775"
FT                   /protein_id="CAG79066.1"
FT                   /translation="MYQLLKALNAKVYSQQREIALHSGAVVALERDLSQTRNILNSFTE
FT                   TIAPGEKRVVDTDLLDRELRKSQTANRAFQKALMEIGEVVFAVAQGDLSKKVTIHDQEM
FT                   DPEIVKFKETINKMMSQLQRFASEVTRVATEVAGGTLGGQAEGEGTVGVWRELTDNVNV
FT                   MASNLTNQVREIADVTRAVAQGDLSRKINVHAQGEILELQKTINTMVEQLRTFAFEVTR
FT                   VARETGVEGRLGGQAQIEGVEGIWRELTDNVNAMASNLTDQVRNIANVTTAVARGDLSQ
FT                   KVSADCKGEILDLKSTINKMVDRLQNFALEVTTLARSVGTEGILGGQAKVEDVEGAWKE
FT                   ITENVNVMASNLTTQVRSIAHVTTAVAQGDLSQKIDVHAQGEMLALKSTINKMVDRLQV
FT                   FASEVTRVAKDVGIDGKLGVQAQVSDVDGLWKEITTNVNTMAANLTTQVRALVQITAAA
FT                   TDGDFTRFITVEASGEMDALKTKINQMVLNLRESIQRNTAAREAAELANRAKSEFLANM
FT                   SHEIRTPMNGIIGMTQLTLDTELTQYQREMLSIVHNLANSLLTIIDDILDISKIEANRM
FT                   TIEKIAFSLRGTVFGALKTLSVKANEKPLDLVYKVDNTFPDNLVGDSFRLRQVILNLVG
FT                   NAIKFTESGEVALSVRKADDQRPGSPDEMMIEFCVSDTGIGIQSDKLDVIFDTFCQADG
FT                   STTRKFGGTGLGLSISKRLINLMGGDIWVKSEYGKGSQFFFTLAVQPADSGLSQLLDNI
FT                   APFRNHYVLFINTEHEQEVVDQLVDNMQRLNLNAWVVDSLEEAPLPEDRSGPKFDTIIV
FT                   DSLEVATKLRTLNHLKYIPLILLHPCIPQVNLKICLDLGITSYGNTPCSTNDIGNVLLP
FT                   ALESRAAPLNSDGQMKFQILLAEDNVVNQKLAVRILEKHQHRVEVVENGYEAFEAIKKK
FT                   RYDVVLMDVQMPVMGGFEATAKIREWEKQNITIRTRTPIVALTAHAMLGDRERCMQAQM
FT                   DEYLSKPLKPALLVQTINKCVHSVNQLRSLALGPTSTSSVNQILSRSGQHKSAVAASSS
FT                   AASASMLPYVAPQPTSPVLSPSLEDAIIKTTDGVVSKSPLPPSQSKPRPTIEQRSRTVT
FT                   SVPHVDYPENGGARIVAIDEGTEPEKESEQPPSNRRVNSN"
FT   gene            complement(<347572..>349188)
FT                   /locus_tag="YALI0_E03190g"
FT                   /old_locus_tag="YALI-IPF2436"
FT                   /old_locus_tag="YALI-CDS2038.1"
FT   CDS_pept        complement(347572..349188)
FT                   /locus_tag="YALI0_E03190g"
FT                   /old_locus_tag="YALI-IPF2436"
FT                   /old_locus_tag="YALI-CDS2038.1"
FT                   /product="YALI0E03190p"
FT                   /note="weakly similar to uniprot|Q27333 Drosophila
FT                   melanogaster and uniprot|P38179 Saccharomyces cerevisiae
FT                   YBL082c RHK1 mannosyltransferase possible transmembrane
FT                   segments"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79067"
FT                   /db_xref="GOA:Q6C774"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C774"
FT                   /protein_id="CAG79067.1"
FT                   /translation="MILIKNKVALKLLQLANDRKYSMTVCGVLLALEAVFLVAIIHKVP
FT                   YTEIDWKAYMEQAALILGGEYDYSKIVGGTGPMVYPGGHARIFTALYDVTSGGENIRLA
FT                   QYIYAAVYLGTQFFAFTVYLLADAPPYLFPLLCLSKRLHSIYVLRLFNDVFGTFAMTFC
FT                   VFTLQNQMWLLSGLWMSLAIGIKMNFMLYLPAFLLITLQGMSRNGLLVVFALSIVGIQV
FT                   FLALPFCNPSPDHIWSYLAGAFDLSRAFMWKWTVNWRFVGQKVFENRKFHGILLWTHLT
FT                   ALIGFACTIWNAPSGYQNPFEMFFTNPPPAPRGLTAAQRAEWDRIRQEASGNEVQFDVQ
FT                   QKRSKREQKRMQEQEEEIKKQQLAQQEGREKPPLFYSRTQFSTLVTQEYVFVTMATCNL
FT                   IGVLFARSLHYQFYSWFYWTMPFLLYRATYAISPLSPMQSTLRYEGRLSKTEIRIFFTD
FT                   IIGFVFIFGTWALQEYAWNVYPSTFWSSIIAVSCIAITIIGVYVSECRYPSANNTEAPT
FT                   SNELQKYLAKVEKENEARAKN"
FT   gene            complement(<349874..>351610)
FT                   /locus_tag="YALI0_E03212g"
FT                   /old_locus_tag="YALI-IPF2434"
FT                   /old_locus_tag="YALI-CDS1747.1"
FT   CDS_pept        complement(349874..351610)
FT                   /locus_tag="YALI0_E03212g"
FT                   /old_locus_tag="YALI-IPF2434"
FT                   /old_locus_tag="YALI-CDS1747.1"
FT                   /product="YALI0E03212p"
FT                   /note="similar to uniprot|P32891 Saccharomyces cerevisiae
FT                   YDL174c DLD1 D-lactate ferricytochrome C oxidoreductase (D-
FT                   LCR) possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79068"
FT                   /db_xref="GOA:Q6C773"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C773"
FT                   /protein_id="CAG79068.1"
FT                   /translation="MNRISRAAQSVSRIASRQLARSNFSTQARSSQPSISWGAVAGAAG
FT                   VAAGVTYFITKSDKNAVALKKEDEDVGRGIQKVLDGASLDTDFSHKPKYGGEEEFKKAL
FT                   PEFIKAIGEEYVSTDEEDIQFHGWSNVSSSNLDTLPFGVLYPKSTEEVSAIAKICHKHK
FT                   LPMVGYSGGTSLEGHLSAAYGGVCIDFSNMNKIIAIRPDDMDATVQPSVGWVDLNNEIL
FT                   KEGHRLFLAVDPGPTAQVGGMVANSCSGTNCVKYGPMRDHVVNLTVVLADGTILKTRQR
FT                   PRKTSAGYNLNHLFAGTEGTLGLITEITVKLQPIPNVTSVAVQQFPTVHAACKTAMDIL
FT                   KEGIPMAALELMDDQHMIWVNNSGYAKRKWEEKPALFMKFAGASEETVAEQVKVAKEKA
FT                   AKYTDSPLHFGRDQEEQDELWSARKNALYLALAAEKDGMKAWTTDVAVPLSQLPDIVMK
FT                   AKQSITDAGLLGGVLGHIGDGNYHAIMLYTPEQADIVTDVVHKMVDQGLAAEGTCTGEH
FT                   GVGFGKIEGLLHEVGPVSLNLMRTIKLSLDPLELLNPGKIFTDDAIQQGLKTLDNNKAG
FT                   KT"
FT   gene            complement(<352502..>354994)
FT                   /locus_tag="YALI0_E03234g"
FT                   /old_locus_tag="YALI-IPF2431"
FT                   /old_locus_tag="YALI-CDS0761.1"
FT   CDS_pept        complement(352502..354994)
FT                   /locus_tag="YALI0_E03234g"
FT                   /old_locus_tag="YALI-IPF2431"
FT                   /old_locus_tag="YALI-CDS0761.1"
FT                   /product="YALI0E03234p"
FT                   /note="some similarities with uniprot|P40310 Saccharomyces
FT                   cerevisiae YJL093c TOK1 outward-rectifier potassium channel
FT                   possible transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79069"
FT                   /db_xref="GOA:Q6C772"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C772"
FT                   /protein_id="CAG79069.1"
FT                   /translation="MGKLHPLHRKPKEEHLKVDPDSKNFKRGLHDREAVGGTNYKIAKN
FT                   NFKKKHAQHHHHIPHHLHHHVNTTDPAELADTQETLMSLKQVTNTKDIDALDYLNNLEV
FT                   SVGSSGFATWYMISSSFPLIAAAIGPLANMCAIAALTEAWLEYRDGNIPESDGGTLYNT
FT                   IKDPAWVTALNAVSLAIGVTANMSMLLNFAGRINYTASQVISICGFGSAAIMLLVLTMV
FT                   TKFVLLEDDMQLSASYWHGIMTFACYMACSILLFFNEFGHLLGFYGATFNLNQAQRGLM
FT                   LQNISLAVWTASGAGLFQYLMDLSYPDALYFCHVSILTIGLGDIHPLGNLERALIIPYA
FT                   LIGTLMLGLIISSIRSMIIDSSSKTLAWNHAERNRKKEYHELLKQTVDPEKERELFEKM
FT                   REFHKQAEKYRTWLNLTVAIITFGAFLCLGAMCFKFVEHWSYWTAVYFCLLCLTTIGYG
FT                   DVYPQSSVGKAFFIVWSMAAVPMMTILISSMGDTVIAKVVQFTDVFGDWALAFPSLNPY
FT                   SHNPPPTDPEKGEETATDSENGAKDQASKETEKDPEVKRKISELENDINTIRDLAKALN
FT                   DVFSNAIEDPLRKYSFEEWREMMHLVGRVPHLVGAGEINRSEVPQYNHEFWAQTRGHSE
FT                   EPEIPAAPSAAPVKLPPPANDSVEDVDEEIGEIASMIEQEREDELMENAKLEHNLKKSG
FT                   VSPAHYNDFSEHVDTASLVLPARVRFEEGGNNNLAFLAPKKIDGRPQFWLSDSSPLRFP
FT                   VRENRVFLKKYINALDETARTMLEKHCRQEPDLSKGNTGVIENCSCESLNEHSRSTNVG
FT                   DEDVKNNAEPTPEVGGQT"
FT   gene            <356385..>357854
FT                   /locus_tag="YALI0_E03256g"
FT                   /old_locus_tag="YALI-IPF2428"
FT                   /old_locus_tag="YALI-CDS2432.1"
FT   CDS_pept        356385..357854
FT                   /locus_tag="YALI0_E03256g"
FT                   /old_locus_tag="YALI-IPF2428"
FT                   /old_locus_tag="YALI-CDS2432.1"
FT                   /product="YALI0E03256p"
FT                   /note="some similarities with uniprot|Q03750 Saccharomyces
FT                   cerevisiae YML114c transcription initiation factor TFIID
FT                   subunit 8 (TAF65 TBP Associated Factor 65 K)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79070"
FT                   /db_xref="GOA:Q6C771"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C771"
FT                   /protein_id="CAG79070.1"
FT                   /translation="MSVSDTEKGDNALKEDKKMEDTIDDKNKELIEVKPHDPEDNNNEK
FT                   EKETETPTQTASSAEPEAKNEGKKEPSRTPEPERLAASKLQPLEVTEEYFDFEQHLMRQ
FT                   GIAKILKGRKIATTKDAFSGVAELAEQYMNEICTRLVRYTRVQRRKQPSKADLRLMMQE
FT                   CAIRTGELEQEMEESREWPVEALELSDLGSLPRDDQADYYTRYFDARVIPTRQNNKLAT
FT                   YQNPRGDYNAPWLPSFPPDHTYLATPQYTSEIPNPRVLRQRLVAEGSLAEKALRNLAWT
FT                   VQVDQAMVVHIDESDLDKLEDRLEVKQKGGINGGGDVFSILENDTNKEVKKEDFGLGDA
FT                   LRDGVSRVSTPKLEESVESPKPIIKLSFKKDTDPDPFGLGKPLKPFDVEKYPEVLRKKR
FT                   LRWNEDGSGVVTEVGRAGAYGADLMEIDATGVDECSSVLAESENCKRKSLDQQYAMALY
FT                   SIQKLGERRSNGSSATADIGIVNWRNDRFIK"
FT   gene            <358679..>360931
FT                   /locus_tag="YALI0_E03278g"
FT                   /old_locus_tag="YALI-IPF2427"
FT                   /old_locus_tag="YALI-CDS0975.1"
FT   CDS_pept        358679..360931
FT                   /locus_tag="YALI0_E03278g"
FT                   /old_locus_tag="YALI-IPF2427"
FT                   /old_locus_tag="YALI-CDS0975.1"
FT                   /product="YALI0E03278p"
FT                   /note="similar to uniprot|Q03254 Saccharomyces cerevisiae
FT                   YMR277w FCP1 TFIIF interacting component of CTD phosphatase
FT                   and DEHA0F03498g Debaryomyces hansenii possible
FT                   transmembrane segment"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79071"
FT                   /db_xref="GOA:Q6C770"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C770"
FT                   /protein_id="CAG79071.1"
FT                   /translation="MESTNIALPASTIFPVEVTAILKGAGDEIEKFAPILTFKYWHEVE
FT                   DNIGEETNVFPKPPPTMVRKEFFSNFESPVKGQIDNWSIKVGDMIESADQIVAAVQEPC
FT                   THAVQYGGMCAWCGASVADEKDYTDFSNKDRAPISMSHSTAGLTVSLSEAQRLEEGSTK
FT                   QLLKQRKLILVVDLDQTVIHVTVDPTVGEWKKDPSNPNYDAVKDVRVFSLEEMTMVSYD
FT                   GGKPVPQLCYYYVKLRPHLKEFLEVVSEKYELHIYTMATRAYAKAIAEIIDPDGRYFGD
FT                   RILSRDESGSLTQKSLQRLFPVDTSMVAIIDDRGDVWKWSKNLIRVVPYDFFVGIGDIN
FT                   SSFLPQRAGMVTPNKPPGKDERIEELDDKKEGNEQEDNPTTESNGTNEDKGKEIDNGES
FT                   DEDSDKKEHDKKVETTEGSEADEKSDPETTEEATKPSSAPAEKASPVANMLSLDKALPA
FT                   AEDERKCSLEAQQKDRPLAKLQSDLDSASSSEDESHEERHHLLVDNDNELIHVQKALLK
FT                   LHEDYYKDYDDHVKHHEDILPDVQDILSSLTYPVFGGCVFLFSGIIPIGVNIQHADISM
FT                   WVKKFGATVVEDVSKQVTHVIAASGNTRKVRQASRYKRIKFVYISWIFDCISQWKRVPV
FT                   EGHEIPQQEINENGFSDGGEHVDDDDDDDDDDLEAAQPFSLSNMDWGDELGSSDDDEDE
FT                   EEADHADDEGSNKRSHDEDDDTDSLTKRPKTVDENDGGGEGDDDFAAQLEADLLDM"
FT   gene            complement(<361259..>361864)
FT                   /locus_tag="YALI0_E03300g"
FT                   /old_locus_tag="YALI-IPF2424"
FT                   /old_locus_tag="YALI-CDS5476.1"
FT   CDS_pept        complement(361259..361864)
FT                   /locus_tag="YALI0_E03300g"
FT                   /old_locus_tag="YALI-IPF2424"
FT                   /old_locus_tag="YALI-CDS5476.1"
FT                   /product="YALI0E03300p"
FT                   /note="weakly similar to uniprot|Q6CG00 Yarrowia lipolytica
FT                   YALI0B02112g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C769"
FT                   /protein_id="CAG79072.1"
FT                   /translation="MVSVRTIAVTAALVSAVAAAPAPAPQQVENSVIPAVNDIAHMIET
FT                   VLKGVYRSLNLLTKPVGDRVTQFQNLEAVMGEINNELYDFVHHLSDTPALTLIGSFWGT
FT                   ILFNPLVHAYLLIAEQVIAVVGGFIGDGPVSIATTLFFSFKDDLALFIKALEKYFPNMT
FT                   DQITSLESATSSLGSVLSKATAEAASATTTIPGPSATA"
FT   gene            <364494..>364952
FT                   /locus_tag="YALI0_E03322g"
FT                   /old_locus_tag="YALI-IPF20546"
FT   CDS_pept        364494..364952
FT                   /locus_tag="YALI0_E03322g"
FT                   /old_locus_tag="YALI-IPF20546"
FT                   /product="YALI0E03322p"
FT                   /note="weakly similar to DEHA0A13277g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79073"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C768"
FT                   /protein_id="CAG79073.1"
FT                   /translation="MLRPISLFSGVLAGGLLYRAAFSTSAIRSDTGNRVFFRIRYSQEF
FT                   DQLKTLPTPLLCNFYIRNDPFSKTVSERLKEIVEKETSNTVNAVDVEADEPEVRDFMID
FT                   YGVNQIPTIIALRGGIVIDKYVPKKDTDLSDLKGWVDKVGGGDAPKKE"
FT   gene            <365387..>365725
FT                   /locus_tag="YALI0_E03344g"
FT                   /old_locus_tag="YALI-IPF11564"
FT                   /old_locus_tag="YALI-CDS6022.1"
FT   CDS_pept        365387..365725
FT                   /locus_tag="YALI0_E03344g"
FT                   /old_locus_tag="YALI-IPF11564"
FT                   /old_locus_tag="YALI-CDS6022.1"
FT                   /product="YALI0E03344p"
FT                   /note="similar to wi|NCU02293.1 Neurospora crassa NCU02293.
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79074"
FT                   /db_xref="GOA:Q6C767"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C767"
FT                   /protein_id="CAG79074.1"
FT                   /translation="MGLFTKTEETASVGPAGGDKDLTKKKTRQICWDSRDKFFACLDKH
FT                   NIVDAIKDSELATAKCPKEEKQYEADCIASWIDYFKQKRTMEYNKEQMLKKFEEQGAVK
FT                   VEPNVSFK"
FT   gene            complement(<365859..>366917)
FT                   /locus_tag="YALI0_E03366g"
FT                   /old_locus_tag="YALI-IPF2423"
FT                   /old_locus_tag="YALI-CDS3764.1"
FT   CDS_pept        complement(365859..366917)
FT                   /locus_tag="YALI0_E03366g"
FT                   /old_locus_tag="YALI-IPF2423"
FT                   /old_locus_tag="YALI-CDS3764.1"
FT                   /product="YALI0E03366p"
FT                   /note="similar to uniprot|P38332 Saccharomyces cerevisiae
FT                   YBR246w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79075"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C766"
FT                   /protein_id="CAG79075.1"
FT                   /translation="MEDHSNKCTITSAITDLPPCAIQIQPDDASIIFVATYKLEDDRSR
FT                   NGTVDVYKLEDDQLKLQQSCRTNSSILDLKISPFDHSFICTSQSTGNIITWRWDGSELT
FT                   QQKSYQLFDESLLVLSITFSPTFNDLMVATLTSGEVVLIRISDSELKIDRSLHEHSLEA
FT                   WISSFGGDEFPNLVMSGGDDAALMISDLRTPLYEDGEQELDYNNGVTDTISNNRIHQAG
FT                   VTSILPSWRKSHGAQIWTGSYDDTLACLDLRKTGMVAVNTRSVVSRQELGGGVWRLLPN
FT                   PKNVDTVLTCCMYNGAFILDAAGATEEEPSSIVKYYKAGHDSMVYGGDWSPNGDYVATC
FT                   SFYDKQLRIWKP"
FT   gene            <367899..>368727
FT                   /locus_tag="YALI0_E03388g"
FT                   /old_locus_tag="YALI-IPF11560"
FT                   /old_locus_tag="YALI-CDS6071.1"
FT   CDS_pept        join(367899..368076,368462..368727)
FT                   /locus_tag="YALI0_E03388g"
FT                   /old_locus_tag="YALI-IPF11560"
FT                   /old_locus_tag="YALI-CDS6071.1"
FT                   /product="YALI0E03388p"
FT                   /note="similar to uniprot|Q09196 Schizosaccharomyces pombe
FT                   Myosin regulatory light chain cdc4"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79076"
FT                   /db_xref="GOA:Q6C765"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C765"
FT                   /protein_id="CAG79076.2"
FT                   /translation="MAPLTKSQNSKSFKDAFSLFDKKGTGKIPAEALGDLLRAVGQNPT
FT                   LAEIDDLKQTIPAEFDYETFSKIVNRPSGFKSLGEPEDYIRGFQVFDKDSTGFVGVGEM
FT                   RYILTSLGEKMSDSEVDELLKGVNVTRDGNVNYVDFVKSILAQ"
FT   gene            complement(<368894..>370573)
FT                   /locus_tag="YALI0_E03410g"
FT                   /old_locus_tag="YALI-IPF2422"
FT                   /old_locus_tag="YALI-CDS1902.1"
FT   CDS_pept        complement(368894..370573)
FT                   /locus_tag="YALI0_E03410g"
FT                   /old_locus_tag="YALI-IPF2422"
FT                   /old_locus_tag="YALI-CDS1902.1"
FT                   /product="YALI0E03410p"
FT                   /note="weakly similar to uniprot|P38140 Saccharomyces
FT                   cerevisiae YBR239c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79077"
FT                   /db_xref="GOA:Q6C764"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C764"
FT                   /protein_id="CAG79077.1"
FT                   /translation="MEKPVVISQRTGKPKRRKAHRACIHCQRTHLTCDNNRPCERCVAR
FT                   GFADTCVDGVRKKLKYLDDKEDNKPSKGLSPAPGVNVQPKLSPATRSARSSSAGFPDTK
FT                   GNMQQQHMGNMPVPNTPQNGHPNLGTPGMAHTNLQGPQRQGAQQPQGGQSSTPSQLPAD
FT                   YLIHQQLLATEINQLGDLGRTGEGDFSSDWFSDLQLSGHSFQSVATNMEYSILSNMVYS
FT                   SGQPNSAVSNSLLLGNNSQSPNTHSPHNQDQPTPQAATPSAKIKQLIESNGLSAKDLNQ
FT                   YPLAGEFVNDTFLTVPEIVAFNETRRNVKDSELTTDEKLRPLSFAVAAGQPQNTNGNGN
FT                   GSEAPDSPSKSIFSSGALEAVYSNLPDYTDPIQVYTNITKPFSYTPGYHGLISYLKGRF
FT                   NKQQLVQMTKYMAEYRPSFIACTNSLKEEDLVFMEQCFQRALLEYQKFISFSGTPTLVW
FT                   RRTGQLAAVGKEFCQLSGWSEQRLIGQQTFIVELLDDNSVLEYFELFSRIAFGDSRGAT
FT                   MADCTLLTPTGAKIKTSSIWTLKRDVFGNPMMIVGNFLPILS"
FT   gene            <373706..>374890
FT                   /locus_tag="YALI0_E03432g"
FT                   /old_locus_tag="YALI-IPF2420"
FT                   /old_locus_tag="YALI-CDS3308.1"
FT   CDS_pept        373706..374890
FT                   /locus_tag="YALI0_E03432g"
FT                   /old_locus_tag="YALI-IPF2420"
FT                   /old_locus_tag="YALI-CDS3308.1"
FT                   /product="YALI0E03432p"
FT                   /note="similar to uniprot|P46672 Saccharomyces cerevisiae
FT                   YGL105w G4P1 protein with specific affinity for G4
FT                   quadruplex nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79078"
FT                   /db_xref="GOA:Q6C763"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C763"
FT                   /protein_id="CAG79078.1"
FT                   /translation="MPFDLLTKAFAKKLNLSESPLTEEELLGKLNADFPALSEIQQAEQ
FT                   NQWITLSKRVDEPTTIDQLNDALKSKTYLITDSAQASLADAAVFSALYASLKEWKEDQV
FT                   KAHRHIIRWADLIQNIGLFDLAAADKIVVNYNLEVPREIKEKPKKDDKKDAGKDPKAVK
FT                   GGKDTSKDAKKEAPKDEAPKFKGKPDPETLAALKAAKEKKKKEKKPQAQAQPEAVVPNP
FT                   GMIDFRVGHIQKAIKHPDADSLYVSTIDMGDAEGPRTVCSGLAGIIPLEDMQDRYVVCV
FT                   ANLKPVTMRGIKSCAMVLCASRENEDPHSKEVEFVNPPKGAKAGEKIFFETYDQTPEKQ
FT                   LNPKKKIWEACQAGFTTNENKEVIYKKEGEPDRKLIVKDGQVLSCNNFVGACVR"
FT   repeat_region   375298..375580
FT                   /locus_tag="YALI0_E03454t"
FT                   /old_locus_tag="Yali0E_375298_375580_repeat_region"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="LTRyl1"
FT   gap             379814..379913
FT                   /estimated_length=unknown
FT                   /note="gap of 100 nt"
FT   gene            <380848..>382836
FT                   /locus_tag="YALI0_E03476g"
FT                   /old_locus_tag="YALI-IPF4179"
FT   CDS_pept        380848..382836
FT                   /locus_tag="YALI0_E03476g"
FT                   /old_locus_tag="YALI-IPF4179"
FT                   /product="YALI0E03476p"
FT                   /note="weakly similar to uniprot|Q7RWQ3 Neurospora crassa
FT                   NCU03554.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79079"
FT                   /db_xref="GOA:Q6C762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C762"
FT                   /protein_id="CAG79079.1"
FT                   /translation="MQQEVYHFKVSWHHSQGARVCIIFRPCVISDGPSRITFIEPLRLI
FT                   STRIAAHMIKMRLKFHHLVFTVGAVLSVLLFLSLCPLTLKRIPSNYINTAVDGYYFQYH
FT                   RLTHVRHRKNWFRPSVRGIIDGSFFEVDSTAPWRVAYSSNKPGVAPAAVTQPNQRPTIV
FT                   TLNAGDEDSDILAAWKRAWYAAGFNPVVHIETDHSLQHKMEAVSQANALIFCDKHIIPL
FT                   DFRPNLPGGRMKEEFSENREKNGHHGRNSHRWKPSEYMPDLYDDNDVIDKLKGTPSKTT
FT                   IYSQIEDSLHMGLVHFESIEFIRDLVQKLSSDRVSPGEASRDFRVSMENTRALAVYTPA
FT                   NLETITGYSSLHEDTVAGMISSHKRNMFSAVFSNGLQVVDPYEGMSQIFSLPSLRLAQR
FT                   LGACPNVPLAKTCPPIAPVLEYFKLHKLTEKSHDREGEAQLVAPKFNEEHIRELQKLGC
FT                   MICQDQSQIRLLRAYNLRPRTFKIGTLAHPLTRVAAEHVSTDVDIEMVYDSSTAYESWV
FT                   HNVTHRVISSDRFGSVPKVLMMKDVLYKSFFEQSNSIWLTWEDSFVPSSETNNDIEYHL
FT                   GFVLPPEPDSRVHVKSFKSIGEGLVSPHEFFNNGETIMKAINARLHNDDGNDSILNTVE
FT                   GWNIPDTEIWRFLQELKSLHRRNQNIN"
FT   gene            <384192..>385874
FT                   /locus_tag="YALI0_E03498g"
FT                   /old_locus_tag="YALI-IPF4180"
FT                   /old_locus_tag="YALI-CDS1895.1"
FT   CDS_pept        384192..385874
FT                   /locus_tag="YALI0_E03498g"
FT                   /old_locus_tag="YALI-IPF4180"
FT                   /old_locus_tag="YALI-CDS1895.1"
FT                   /product="YALI0E03498p"
FT                   /note="weakly similar to DEHA0D15796g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79080"
FT                   /db_xref="GOA:Q6C761"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C761"
FT                   /protein_id="CAG79080.1"
FT                   /translation="MPSKGSKKPRKHGHGADLASDSLLDQLLAESDDGQEQRPAKRRGI
FT                   LASARTKKDLKNTRTAKRTMSEMAPSKASQEKPRKAARSQTIGHGASDTSGKQTKTNGK
FT                   VQKKHTQPSQNGDFTKPIGVLDMDDNDTDDHGRRSLQQETQQVITPTEVSSPPPPDPAV
FT                   GMVGGNSADEELFEVELETAEGFRYRRRLTRRELEELQAEEESTSPQGVEMMEPETENS
FT                   EMDPDHVTDSTSHSSVHVGARPKDSFVPMSPKDVSLPLKHTPVIQQQDMRKVPAKTPER
FT                   NHDNRGRRISSLGNGFEGEPHADVDAQNFYKHFEPGLPEPHKARLLLTWSGKRAMMNHK
FT                   TRMVRESAPQGLSETDETTARRIVRVIMEDIIRDMKDGKVNTSWYNRPEPDGDDHSNSR
FT                   FTKPNAQNIANAEKLALFKKRLAAQQAEIKEWAKLEAEARERLDMAKGKSQKLVAQLQK
FT                   PFDSPPTLPSLLSDVALSASTFSRQIDQVEDAVNKINSCNVRASKFCDEQFQALDNVLE
FT                   SRSRKRPRQSQDFRTIFNADRFRESTLDGEQTRDVLRTLSRLK"
FT   gene            complement(<386224..>386649)
FT                   /locus_tag="YALI0_E03520g"
FT                   /old_locus_tag="YALI-IPF13437"
FT   CDS_pept        complement(386224..386649)
FT                   /locus_tag="YALI0_E03520g"
FT                   /old_locus_tag="YALI-IPF13437"
FT                   /product="YALI0E03520p"
FT                   /note="similar to CA4622|IPF5751 Candida albicans IPF5751
FT                   TRAPP subunit of 20 kDa involved in targeting and fusion of
FT                   ER to golgi transport vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79081"
FT                   /db_xref="GOA:Q6C760"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C760"
FT                   /protein_id="CAG79081.1"
FT                   /translation="MSYYLAIVGTEDNPIYTQEFGTYRQGGDGNSRFSPEMKELAPFIL
FT                   HAAIDMVEQTASRTNQLYLRTVDNFYSHLVSAFVTAGDIKIMLLHETRNEESIRQFFQE
FT                   VHDLYVKTLLSPFYFVNQPITSPVFDQRIKSLAKKYL"
FT   gene            complement(<387010..>389376)
FT                   /locus_tag="YALI0_E03542g"
FT                   /old_locus_tag="YALI-IPF4182"
FT                   /old_locus_tag="YALI-CDS0868.1"
FT   CDS_pept        complement(387010..389376)
FT                   /locus_tag="YALI0_E03542g"
FT                   /old_locus_tag="YALI-IPF4182"
FT                   /old_locus_tag="YALI-CDS0868.1"
FT                   /product="YALI0E03542p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79082"
FT                   /db_xref="GOA:Q6C759"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="InterPro:IPR024764"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C759"
FT                   /protein_id="CAG79082.1"
FT                   /translation="MLLLCTTPPSRQIILVTSDAKNNGAFRPHPTVTASPNRHPNRITV
FT                   DTDSQINTRHLHTMLKDIRLPRIQPSATGGALAWSDDGDLSIAAGSDAVVLNVNGPITS
FT                   RDDEIDSVRDRNWAQFPETNFTINKSDTMDAIPVTAGGSTSIPGNQIQYGSGDRHVADI
FT                   AWSPTGLGKMHGCLIGLLNTTHELFIYDHRGQVEKHSWTLCHNVADVLYKRVKKETGET
FT                   NGEDHPTVVEEPTNGDSSMIDHGEDTPKGSRAGTPSVPGITEQEYTREQYYSFQIHSFA
FT                   WSPTIDKNNYVAVGTGRGEIIVLSVEANDLKIVASTFTRDRQIVKLAWDATPYGGSALV
FT                   AVTDANEVVKLTWDNEKQELGEPSTLISSSRFVIAAMSFVNGTVAVSQPHRLTWVSPEG
FT                   KIESPLWGDSNTVSDIAIHDDKVLIVTYKGGVVYWNPTSNTMEQQEQTMALLMKRLTTA
FT                   KENNGSLNGVTPSFNTLDYEAVISGAAISPHGTFLSIFYAVTPTNVLKFPIPSTVVTRV
FT                   AFVPLITPTSLSHDAVPLRPSSMAAGEAMQSSQWEFQVWGRVAQKLFKDEDGQAGMVFK
FT                   SNYLEHLATQFNLSPSQHITQHMAETNGTLEELLNSVFLSDELDKARFSAFYDLTLIPE
FT                   MQKLLFSLVLFYVSKNWDSVSPKLSGYDFAILSAFTEIAGQQEPPIPLTPELGMVTVKT
FT                   DFISESFDMNAQAQNLEVVVSTEGHTWKRCALTQLPILILDPLTPSWGPSKILNWRSLE
FT                   PSTLGYLTKTLLAVFPLCPYTGTRYYENVPQIYNE"
FT   gene            <394316..>396862
FT                   /locus_tag="YALI0_E03564g"
FT                   /old_locus_tag="YALI-IPF4183"
FT                   /old_locus_tag="YALI-CDS0722.1"
FT   CDS_pept        394316..396862
FT                   /locus_tag="YALI0_E03564g"
FT                   /old_locus_tag="YALI-IPF4183"
FT                   /old_locus_tag="YALI-CDS0722.1"
FT                   /product="YALI0E03564p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79083"
FT                   /db_xref="GOA:Q6C758"
FT                   /db_xref="InterPro:IPR038769"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C758"
FT                   /protein_id="CAG79083.1"
FT                   /translation="MSVVKSKPSLLKLRRGKRAGDTEVQVVEVKMEDGDLTVMAEPKSG
FT                   SKASKCAKSLSNAAKLPQLHRQKPHPSPPGPVRSTQSPPSPTTQTTPPLTCNTNYFPTK
FT                   RSPLSNSSSPTSPSHAASRPPLKPRSTSDSRRLSNALRDDSSQTALSSHTAASSTLSRS
FT                   QPINSNYANNGGHIHQSNSPTKTHNNQHPQPLHLPPTPPLAHSDTKAAASMGKLKLTSS
FT                   AGFFLPEPKPFENDHDGYHSHDDNNDHDHVLTPVTSQDQDPDLSLETALTPDTPSSSPD
FT                   EPGKREISRLASMVYHIKSLRNQQLYGSAEAAAQRNHEARHFSYDYDPEGSSKERYQQR
FT                   KHIPPSVWAAATRVKATLEVYHHAVSVAQKHVDREFPEVHLGYNPLQVRRNRKLRKGSH
FT                   HKPSLNINCDTVPLASSVFSKHARDSKDYKYPWEVDVPELLSDIGWRAQNKRHMVDGQG
FT                   NYVYPMAQHRQHDRRKSWVRIATPLGRSQECVDTFSSEEELRRDQSDGSNKLPSLAKLS
FT                   DNEKEKEKSHRNLGLGAGISAGPFSFSAGVGSMGMASHPKLESPSKSLVSVNRVNSSSP
FT                   EIQVTLATPTPPSVHLESSENDSPHDHESSESSVEGGPELSKLLSISRPASKVPSSASL
FT                   RAPALSIVTHNPEVSKTSLVTADQGSQLSLHSAHYDDGFNEHLTELQYLETCFMLGHLH
FT                   MASSAYGTKPPPSNAEFVREVTDIMEEGFFQLTNIYLPKVGEQYDAVGSEVDALKLELS
FT                   DKKDPLLDYLLYEAEHLVTEVSTTLNLETRKTSERLKQIECCGAARDQVWCVCYFLLEW
FT                   FVVLVMWFIWGIVTAARSVKNTFVMFYITIKWLLWM"
FT   gene            <397706..>398161
FT                   /locus_tag="YALI0_E03586g"
FT                   /old_locus_tag="YALI-IPF20521"
FT   CDS_pept        397706..398161
FT                   /locus_tag="YALI0_E03586g"
FT                   /old_locus_tag="YALI-IPF20521"
FT                   /product="YALI0E03586p"
FT                   /note="weakly similar to uniprot|Q9HEM5 Neurospora crassa
FT                   NCU01320.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79084"
FT                   /db_xref="GOA:Q6C757"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C757"
FT                   /protein_id="CAG79084.1"
FT                   /translation="MAPLPIALNGDFRYVLAASALLPAIGFFHSLNTLYWRAKSKTKFP
FT                   LLFADETVKVDPKIDAAKKRFNCAQKAHLQFTENVNLTLLAGWITGVSYPKEAAGLIAV
FT                   WAISRFLYVLAYSTGEPNRRMPPNFFNITSQVALIASAIFTSFKAIV"
FT   gene            complement(<398318..>400600)
FT                   /locus_tag="YALI0_E03608g"
FT                   /old_locus_tag="YALI-IPF4186"
FT                   /old_locus_tag="YALI-CDS0938.1"
FT   CDS_pept        complement(398318..400600)
FT                   /locus_tag="YALI0_E03608g"
FT                   /old_locus_tag="YALI-IPF4186"
FT                   /old_locus_tag="YALI-CDS0938.1"
FT                   /product="YALI0E03608p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79085"
FT                   /db_xref="GOA:Q6C756"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C756"
FT                   /protein_id="CAG79085.1"
FT                   /translation="MFLPVADQELVAQICNLRELSPDAQLAACKALKNEIIGHDEKKTR
FT                   YLECDGVVVSLVQVLQDGPWSEELRTQAAVIIASFTSGCAPLVLNEFVRLGIHRVIVTA
FT                   IVEADSHKVQYMSALLRTLAALLKVNDTVANECIEDSPQLLKALSHHISVPSTPLPVVS
FT                   LCTPLVPLLGRSRPGVQRLGEDLSEPLAARILLLTQQYLSQRDRIPSIYTEPLASAVFA
FT                   LSHVVRHSLAMKLLEGEVGTAGTNWSSGRLLQDLFLLLRAGDTQVRLAVCFLFSNLHLH
FT                   MPASQQLEIARPLLPVLVPMLSGPEDTDPRVCKTLALLCRDHIDMATLAAEARVIELAC
FT                   TLVTSRVPEVEPSNHCNQLEEVIADALLLVAAIGMHKDSFRARIVDCGVLSHVIKIMRM
FT                   KTPPSGDPRARAVRKMKISSCYLVRALSRSVSLLRTGFVDEEVVEGIIELLDETPSEPV
FT                   NAEPDNMDQTEDGESPNIEDLEVKAAIMASMCNLILPFSPFKKNIFERGVLQSIIAGVN
FT                   SDYTPLRLNSTWALRHAVLPPDNDDRLIEEAMGLLTCKRLLTLLGDTDIEVQEQAHELI
FT                   RNLMMKQANFVEVFFSQVEAREFMQLLENKIDIISRQHTETVAENTATHSSSQIKLAKT
FT                   VNEKRQVYTRMLSAIIYTLAHIAAGPEEFRFMLIEQESILVKVAEFTGHRHYDVRAACA
FT                   WLVINLTYVDNNNDRECREGAKRRARALVKLGYKEKLDAQLRDPSLDVAERTKNALITL
FT                   EWLLNEN"
FT   gene            <402371..>405331
FT                   /locus_tag="YALI0_E03630g"
FT                   /old_locus_tag="YALI-IPF4189"
FT                   /old_locus_tag="YALI-CDS0468.1"
FT   CDS_pept        402371..405331
FT                   /locus_tag="YALI0_E03630g"
FT                   /old_locus_tag="YALI-IPF4189"
FT                   /old_locus_tag="YALI-CDS0468.1"
FT                   /product="YALI0E03630p"
FT                   /note="similar to uniprot|Q08162 Saccharomyces cerevisiae
FT                   YOL021c DIS3 3 -5 exoribonuclease required for 3 end
FT                   formation of 5.8S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79086"
FT                   /db_xref="GOA:Q6C755"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033770"
FT                   /db_xref="InterPro:IPR033771"
FT                   /db_xref="InterPro:IPR041505"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C755"
FT                   /protein_id="CAG79086.1"
FT                   /translation="MSAVKRASNHSTLSQKVFVRTSKAGNATKVVREQYLRDDIPCSSQ
FT                   GCQYCKNNLYVADATGKRQEPILETQPNKTTKRGPHYLVVDTNIVLDGIDLLESDKGFY
FT                   DVIVPQIVLEEVRNRSLPIYARLRALTKNDDKRFYVFHNEYCKDTAVGRNKGESINDRN
FT                   DRAIRKVCEFYTQHLGKDYNGTAPEVVLLSNDVNNRKLAKEEGITALGLKGYVSELVDP
FT                   GQLIDMIPQRALEEEEGAKPKSGKSEALYPEYYPMSRLLGGIKNGTLFQGNLTISPYNV
FT                   LEGSVSTKAYPKPLLILGRQSLNRAFSGDQVVVELLPKDKWKTPSTSVIESEDLAANEG
FT                   GEESGDTVMSESERKLLADDALKAHKNEADAAERVQPTARVVGIIKRSWRYYVGHIAPG
FT                   SIIDDVSRGPRSVLVALMDKTLPRVRIRTRQAAALQGRRIVVAVDSWPADSRHPEGHFC
FT                   RDLGPIESKQAETEALLLEHDVEYRPFTKAVLDCLPAEGPDWKVPQDLVKEAAEKDPLV
FT                   AKRRDLRHLNICSIDPPGCQDIDDALHARVLPNGNYELGVHIADVTHFVKPDTALDQEG
FT                   ASRGTSVYLVDKRIDMLPMLLGTNLCSINPYVERYAFSVLWEMTPDGKIVNTDFTKSII
FT                   SSREAFSYAEAQARIDDPSKTDELTEGMRVLLKFSKQLKQGRIDAGALNLASPEVKVHI
FT                   DSETSDPGEVEVKELLETNSLVEEFMLLANTSVAKKIYESFPQTAMLRRHGAPPATNFE
FT                   TLNDQLRTIKGMSISLESSKALADSLDKCIDPNEPFFNTLVRIVATRSMLAAEYFSSGS
FT                   YAYPEFRHYGLASEIYTHFTSPIRRYADVVAHRQLAAAIGYEPLHQSHREKDHMESICK
FT                   NINVRHRNAQFAGRASIEYFVGQALKNVTKEEDAIHEGYVIKVFNNGVVVLVPKYGLEA
FT                   LIHIDDLGDAETAVFNEKEYKLDISGKSIRVFDKVKVKVESYKDKQEKRKVKMVLL"
FT   gene            <405759..>405830
FT                   /locus_tag="YALI0_E03652r"
FT   tRNA            405759..405830
FT                   /locus_tag="YALI0_E03652r"
FT                   /product="transfer RNA Thr (AGT) cove score=74.31"
FT   gene            complement(<406255..>408534)
FT                   /locus_tag="YALI0_E03674g"
FT                   /old_locus_tag="YALI-IPF4193"
FT                   /old_locus_tag="YALI-CDS0942.1"
FT   CDS_pept        complement(406255..408534)
FT                   /locus_tag="YALI0_E03674g"
FT                   /old_locus_tag="YALI-IPF4193"
FT                   /old_locus_tag="YALI-CDS0942.1"
FT                   /product="YALI0E03674p"
FT                   /note="similar to uniprot|P43535 Saccharomyces cerevisiae
FT                   YFR009w GCN20 positive effector of GCN2P"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79087"
FT                   /db_xref="GOA:Q6C754"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C754"
FT                   /protein_id="CAG79087.1"
FT                   /translation="MPSIAAEVTKTARNVDTVVVDYATGYIRHLENNIGPQHDLTAEAS
FT                   FIASLLVGAGVEKPAAQQLYDHMLKEFTVLQKEAINEAGASAQSQIIDQQALMSAVNHA
FT                   SNRQASVLNNNIFGVADLDHVGGRKVESRVDKKKLEKAEKKIAAKMAARAAKDAAQVQY
FT                   EASKLVTETQDSKDYDEFFLTVNPLDLGMAGAGKTKDIKIDNFDLHVGMGQRILSDTSL
FT                   TLSYGRRYGLVGQNGIGKSTLLRALSRRELPVPKHITILHVEQEITGDETSAIQSVLDA
FT                   DVWRKHLLKEQHTAVTRIAEIEAQRKTLTEQGLDDNSAEIRELDDEQVDLETNLEEVET
FT                   KLVDIESDKAESRAAAILSGLGFSQATQGNPTNSFSGGWRMRLALARALFCKPDLLLLD
FT                   EPSNMLDVPSITYLANYLQTYPSTVLVVSHDRAFLNEVATDIIYQHSERLDYYRNANFD
FT                   AFYATKEERYKNAIREYENQMAYRQHLQAFIDKFRYNAAKSSEAQSRIKKLEKLPILEL
FT                   PEEDKAVEFRFSEPEKISPPILQMQGVTFGYNPERLLLKDVDLDIQMDSRIALVGANGC
FT                   GKTTLLKLLTDQLSPVDGSISKHPRLRVGYFAQHHVDGMDLNLTPTAWLAKINPGKSEE
FT                   EYRRHLGSFGITGSIGLQKLALLSGGQKSRVAFASLCVSYPHILILDEPSNHLDTAGLD
FT                   ALADGLKNFKGGILMVSHDVDMINRVCNQIWVSEKGTVSKFDGTIKDYKKYILSHASES
FT                   GVVQQH"
FT   gene            complement(<408993..>410228)
FT                   /locus_tag="YALI0_E03696g"
FT                   /old_locus_tag="YALI-IPF4194"
FT                   /old_locus_tag="YALI-CDS3120.1"
FT   CDS_pept        complement(408993..410228)
FT                   /locus_tag="YALI0_E03696g"
FT                   /old_locus_tag="YALI-IPF4194"
FT                   /old_locus_tag="YALI-CDS3120.1"
FT                   /product="YALI0E03696p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79088"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C753"
FT                   /protein_id="CAG79088.1"
FT                   /translation="MTAIRFRIIAAITFVALLFTLMGFFIFPSPTFAIPKSKDYTNESS
FT                   SGSKEGHTELDSTNQSHDDEAVEFPVKAAYYDIANAPKRSTSSPDVYRGTRVNCDPYAL
FT                   PGYIDYDKNNFNNTHWVGYNDDCKAIHPPPILQLRDGMDFPDLRDKSVLFIGDSVDRQN
FT                   AAFSCEMIGQDVKVTYQKDYTDEVTDPAKMSGGHPRYCYSPEYNMTLSTFFFFGFDTDE
FT                   IWHDKKKSYLLPGGVWERMKLLKDIVNSRPHHNDLELIVLNVGFWELARYDRLDGYAGI
FT                   TESIYLTEEQVREYVVNLEKFVLEVQKILPNSRIVFRQMHSPRAQQGSFFNDGTSDRHN
FT                   RFHSNKVRQLNSAAKHVMDQMGLEFWHVGDFVRAIPENQYMFDDLHPGPIGAAMLWGNS
FT                   ILEYLARTPRIE"
FT   gene            <416379..>418016
FT                   /locus_tag="YALI0_E03718g"
FT                   /old_locus_tag="YALI-IPF4195"
FT                   /old_locus_tag="YALI-CDS1987.1"
FT   CDS_pept        416379..418016
FT                   /locus_tag="YALI0_E03718g"
FT                   /old_locus_tag="YALI-IPF4195"
FT                   /old_locus_tag="YALI-CDS1987.1"
FT                   /product="YALI0E03718p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79089"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C752"
FT                   /protein_id="CAG79089.1"
FT                   /translation="MIITPKTHNKSALKLKLAEPERHYRQGDIVAGTVVIHPTKHELSF
FT                   DAISLQLKGYIQTRSEDGTHCHQACFLSIDKNLDANLTNLPSQGKSKAFHANQVYRYPF
FT                   EFELPIDVPKEGITARCDAQYLKLPPSFEIATSNVVGTYASIHYVVEAAILSVNDREQT
FT                   SYFQGTSGASYGIAGGLRSNPGSLPGSANNSAPSSPGTPSTMMHTSPIRKVSVPILVVP
FT                   NYHPHTQANLFKPGLLQQAEAAGDSAKAHAKFKAGDVQLMGITSMNKIPIIKTYKTSSS
FT                   STITVPLNIRFTPEDPTGTTPEVVSISAKLQAYTVISHEIPQYLWSSQHYDPASGKPVP
FT                   RQSVAESSRNLLHVSQKIRPAFALTDKADKYTVNFALCIPDKMKKSLVPSFNFASISHG
FT                   YRLKFYVTFANRVIATVAYPVIVSGYAAESISAFPSSASLMSLNNAGGNDAVSIPVDVN
FT                   AQSTKFVIGSGLPEYEHDDPDSAPMSRNTSGTNLASLATQNSAAQSGHQNSAHHILNLN
FT                   HENSRSTSSLVGTLKRAMSATSLHKKKD"
FT   gene            <419579..>419852
FT                   /locus_tag="YALI0_E03740g"
FT                   /old_locus_tag="YALI-IPF40083"
FT   CDS_pept        join(419579..419602,419676..419852)
FT                   /locus_tag="YALI0_E03740g"
FT                   /old_locus_tag="YALI-IPF40083"
FT                   /product="YALI0E03740p"
FT                   /note="weakly similar to uniprot|Q12489 Saccharomyces
FT                   cerevisiae YDL012c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C751"
FT                   /protein_id="CAG79090.1"
FT                   /translation="MSNQDYYGEKGPQQPPQSYQQGPPQHGGGYPQQQQQPYYVQQGPQ
FT                   QGGGGGACAGCPSAGGFFGNW"
FT   gene            <420926..>422962
FT                   /locus_tag="YALI0_E03762g"
FT                   /old_locus_tag="YALI-IPF4197"
FT                   /old_locus_tag="YALI-CDS1240.1"
FT   CDS_pept        420926..422962
FT                   /locus_tag="YALI0_E03762g"
FT                   /old_locus_tag="YALI-IPF4197"
FT                   /old_locus_tag="YALI-CDS1240.1"
FT                   /product="YALI0E03762p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79091"
FT                   /db_xref="InterPro:IPR013633"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C750"
FT                   /protein_id="CAG79091.1"
FT                   /translation="MFPSFSSFKQSAQEQGEEDENDRRKRSRQDRDDKPRKRHERGSDR
FT                   RRHRHREGLRDSERRSRRTDHEHDKPAFTTDVINERIGHASHLFFLDETGDDALLKFSQ
FT                   PYRKELPTYRRASNLVVGDHLRIIPSKEDFEKFLVTLCRVNPSEVPSSSHDSGTDSAYY
FT                   LKYHQCPKKSVPYYMVAEEGSSTVTTDSFISIEETPSTTDDILKGLLQQRMQIQRDLNM
FT                   HPTVSQWEQMAAIQEAIAILGSSKLKLSEDQKLQLNISVFTVALKGLPEEPDIVLRYMD
FT                   AFEGLLSLNNIDSDVNTKWKSFTAYDQNPPKSLVADVRIWERRVDALLLDRHSNFTTIY
FT                   LGLEKIFADIKEWKTKDESVDMDTIYHASLRRLFVIWDDLGYTTWTVNLIQALLEHAFF
FT                   FKYDESLEDFWSTRQPRLGDSRSKGWKYSPKDPVSLPEGTDDRTPFDEVLFEDISPFIQ
FT                   TSQDNLQLLWACLLHMGLIIPGKTLPRSLMFEISEDQIVNNPQVTSQAIHLCELIFREV
FT                   EDDPDYKAFTTWWGDSDYTADSSNELFEVGTRIRSMASRGLAFDPRIFSKLEQFLDTEP
FT                   GWQLFLTYGQLTGLDCSYILREAVSRIPMPFSWWKAYIESVGNAEKQELMHLALHKLPW
FT                   SRDLHVWLNQCDWVSPDHKEAIRTAMMRRQMNISLGVLDDDTS"
FT   gene            complement(<423075..>424022)
FT                   /locus_tag="YALI0_E03784g"
FT                   /old_locus_tag="YALI-IPF4198"
FT                   /old_locus_tag="YALI-CDS4204.1"
FT   CDS_pept        complement(423075..424022)
FT                   /locus_tag="YALI0_E03784g"
FT                   /old_locus_tag="YALI-IPF4198"
FT                   /old_locus_tag="YALI-CDS4204.1"
FT                   /product="YALI0E03784p"
FT                   /note="some similarities with DEHA0F19514g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79092"
FT                   /db_xref="GOA:Q6C749"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C749"
FT                   /protein_id="CAG79092.1"
FT                   /translation="MRLQLRSFSTSLRRANNVSQQLKDLPSVSGGGPFPLLPQFQPIGT
FT                   PPSLVSVSLPASSTLFARRGSIVSINGQLDTITSRLSSLSAFARTVQGMPFLYNRISAT
FT                   APATLLVSTNTSYQSSLAIVSLDGRTDWTVAQRDALFAWAGAALHVQPNTSLFGSARGG
FT                   TTRWGNTYLTGRGDVALVGRGQIFKIDLSEDEDILVHPANLLAYTTSQGSANPHGQFVK
FT                   LNHSAPLLQLPKLPFIERLLANNSLLKSYLDSDFHRAVQNTNKSIRKTWAKWFGTGNQL
FT                   LQIQGPRTILIQSQRTDLREIVSRNDLAKVGSSD"
FT   gene            complement(<424786..>425520)
FT                   /locus_tag="YALI0_E03806g"
FT                   /old_locus_tag="YALI-IPF4199"
FT                   /old_locus_tag="YALI-CDS4968.1"
FT   CDS_pept        complement(424786..425520)
FT                   /locus_tag="YALI0_E03806g"
FT                   /old_locus_tag="YALI-IPF4199"
FT                   /old_locus_tag="YALI-CDS4968.1"
FT                   /product="YALI0E03806p"
FT                   /note="weakly similar to uniprot|Q04066 Saccharomyces
FT                   cerevisiae YDR428c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79093"
FT                   /db_xref="GOA:Q6C748"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR027519"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C748"
FT                   /protein_id="CAG79093.1"
FT                   /translation="MTTITKLTYGPDPRQYSNVWIPKGSKAPSHWVIFMHGGAWVDYKQ
FT                   TEKDGDELMEAVVDGNVWGASIEYRLAPEVSGKTFAEDVYNAIKSIFDKYPAAPWTMIG
FT                   HSAGAFHSLKLDTDVKEKGGFASPTNIILSEGIYDLRTLVDDHPTYSYFTNPAWGEDKA
FT                   KWDEESPLLHHQACPKINYTIVHSDIDELVPFDGQPQLLAKKWKQQGVPFDFEVIRGLK
FT                   HNDVFISSEFAKIANEIIQKSS"
FT   gene            complement(<426909..>427793)
FT                   /locus_tag="YALI0_E03828g"
FT                   /old_locus_tag="YALI-IPF4202"
FT                   /old_locus_tag="YALI-CDS4433.1"
FT   CDS_pept        complement(426909..427793)
FT                   /locus_tag="YALI0_E03828g"
FT                   /old_locus_tag="YALI-IPF4202"
FT                   /old_locus_tag="YALI-CDS4433.1"
FT                   /product="YALI0E03828p"
FT                   /note="similar to uniprot|P78795 Schizosaccharomyces pombe
FT                   SPBC18H10.03 Probable eukaryotic translation initiation
FT                   factor 3 RNA-binding subunit (eIF-3 RNA-binding subunit)
FT                   (eIF3 p33) (Translation initiation factor eIF3 p33
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79094"
FT                   /db_xref="GOA:Q6C747"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017334"
FT                   /db_xref="InterPro:IPR024675"
FT                   /db_xref="InterPro:IPR034240"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C747"
FT                   /protein_id="CAG79094.1"
FT                   /translation="MQTFHHQDTGSEDFRQNTMDEKWADDDEFSTPQITQNADGTKTIV
FT                   THRMDDGKKYKRSVTIKNQSVTEKVLNCVAERSKWTKYGKELGAPPGPNRMTTTIGEDI
FT                   VFVLGLKSDQPEEEVEEEEAAAAAPRVGEDKGVKCRLCQGPHFTSKCPYKETLGGSTAA
FT                   GGMGRSLGGDEPAGAAKTGGYVPPHLRNKGPGGPGGPGGAAGGRSDDDDELTLRVTNLS
FT                   EEATDDDLRRMFGKYGMINRVYVAKDRDTGRPRGFAFVTYTLKSHAQAALEAMDGHGFD
FT                   NLIMKVDYSKKRN"
FT   gene            <429454..>432153
FT                   /locus_tag="YALI0_E03850g"
FT                   /old_locus_tag="YALI-IPF4203"
FT                   /old_locus_tag="YALI-CDS0616.1"
FT   CDS_pept        429454..432153
FT                   /locus_tag="YALI0_E03850g"
FT                   /old_locus_tag="YALI-IPF4203"
FT                   /old_locus_tag="YALI-CDS0616.1"
FT                   /product="YALI0E03850p"
FT                   /note="some similarities with uniprot|CAB16599
FT                   Schizosaccharomyces pombe SPAC3H5.08C WD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79095"
FT                   /db_xref="GOA:Q6C746"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C746"
FT                   /protein_id="CAG79095.1"
FT                   /translation="MAAIREYVGSLLNNATGGSANNSNSGINSAPDSAGTSPKKHSLAL
FT                   PHTPPTGTSRAASHSSAFNSASDEADDNVQFRDIHPAALVRTETEDVDRQLNHFHFEDR
FT                   GASSEPEQIPLRGRQGRKDDPYGSTFFSAKETFLDGRDRDIKLVIPETRDSRELSRPRR
FT                   SPVSATASSHSGGGFFSRILQKRKNSGRQSIEAEEQEDDEQDQDGEDKRAEGWCADVMG
FT                   YAPNYSMFSDLKYVKVRAHHRPSHQKKRNFDRLFLAQELRTHDPSDPLATDNSRLASQT
FT                   AQKVISSSPIGAIWAMKFSLDGRYLAAAGQDRVLRVWKVCTRPQNSPYEDYFGFKGTKM
FT                   YAPVFEESPEREFRGHEGDILDLSWSKNNFLISSSMDKTVRLWHPDRQEEIASFPHNDF
FT                   VTCVEFHPKDDRFFVSGSMDRQLRLWSILDNQVAFARQVPDIVTAVAFTPNGNTVIAGC
FT                   LRGQLYFYQTHQLVLQTQLQVRISTKVKHAYKSKITGIQVVTEPKKSRTHNNIYNPMHA
FT                   AVAAEDDYKMLITTNDSRIRLYNYRTKALIAKYRGLDNDHSQIKASFSDDYRFIISGSE
FT                   GERTYIWDTIRSDSGTGLNHVSSKTIKAYEYFHSHQSTVTVALFAPLQTRQLLDLAHDP
FT                   IYSIVNPPKVVLGQNDMTPEKALYPHHDGHIIVAADYSGKIKVFRQDSAYTKRKLAEDS
FT                   ASFIQSRRSLNSIGGASGRSSPRGRSSRSSSASAWNRFSRGVRSPAVSPGTSVHRKSFG
FT                   ASTSTGPAPFGVIANGLSSANHTIMDPSTFPRARKSSTSGLSQISRRTSESLFSPEKSV
FT                   PEIHVNDEDGREIEPTGSIRSNSVLMTDSDQELDEDTDQEEQDELTEQASLVCEKCGSQ
FT                   NFKVRVIEGMVILCCSACRTPISEAAST"
FT   gene            <433742..>435088
FT                   /locus_tag="YALI0_E03872g"
FT                   /old_locus_tag="YALI-IPF4204"
FT                   /old_locus_tag="YALI-CDS2812.1"
FT   CDS_pept        433742..435088
FT                   /locus_tag="YALI0_E03872g"
FT                   /old_locus_tag="YALI-IPF4204"
FT                   /old_locus_tag="YALI-CDS2812.1"
FT                   /product="YALI0E03872p"
FT                   /note="weakly similar to uniprot|P47159 Saccharomyces
FT                   cerevisiae YJR124c weak similarity to Staphylococcus
FT                   multidrug resistance protein singleton"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79096"
FT                   /db_xref="GOA:Q6C745"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C745"
FT                   /protein_id="CAG79096.1"
FT                   /translation="MVFKYIGDTLGLTPVLKSSWDVHALIIMRFFRLMAFGQISVILAQ
FT                   FFDAHGFSQDKTGLFMSLTLAGDVGLSLFLTTYGDRLGRKNVLLIGAGLMTLSGLVFFH
FT                   ESNYYLLLLAAICGVISPSGAEVGPFRAIEESTLAQLTTLEARADVFAWYTLLGSLGAA
FT                   LGALVGGWTVQIAQEKYHFTKLEAYKTVFLTYAAIGFIKFIASCFLSRKVEAPAEETEP
FT                   LLANDQENATEERAELRNNIKKRGGLRNLLPNISPESQKIITTLCLLFAIDSMGSSLAN
FT                   FSWISYYIQRKFDISTGYLGSVFFVTGIVGALATLVGSGISRRLGPLLTMVVTHLPSSA
FT                   LIILLPVPSTVQGVITILAIRACTAQMDVAPRQAFLSAVVLKNERTLVMGWVGTIKTLA
FT                   QLPGPYITGYLARHNKQWIAFVAAGSLKVIYDLSILSYFTRVKLDRDQN"
FT   gene            <435333..>436766
FT                   /locus_tag="YALI0_E03894g"
FT                   /old_locus_tag="YALI-IPF4205"
FT                   /old_locus_tag="YALI-CDS2528.1"
FT   CDS_pept        435333..436766
FT                   /locus_tag="YALI0_E03894g"
FT                   /old_locus_tag="YALI-IPF4205"
FT                   /old_locus_tag="YALI-CDS2528.1"
FT                   /product="YALI0E03894p"
FT                   /note="some similarities with uniprot|P16639 Saccharomyces
FT                   cerevisiae YGL017w ATE1 arginyl tRNA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79097"
FT                   /db_xref="GOA:Q6C744"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017137"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C744"
FT                   /protein_id="CAG79097.1"
FT                   /translation="MNIISNALFSTRNRCGYCKDREGAEPQGTLFSFNSVQMTAAQYQA
FT                   LIDRGFRRSGTYIYKPDLANSCCSQYTIRLNVEDFKASKSQRGVLNRWTNHVTDKGNGG
FT                   KNSGKNNQFDLVAKIQEGETDAFNSRLEPNSFTKEKYDLYARYQKHVHNEGPEDISESG
FT                   FRRFLCSDSFTDSTSDVCKGLDVPDRLSGGYHQLYYHNGKLVAMAVLDILPLCVSSVYF
FT                   LWDPDYAQWGLGKVAAMREIALAKALGVPYYYMGYYIPDCVKMKYKGEYHPSFVLDPES
FT                   LTISEQEIDDYPFPEGINVESRALAGVGVWVPLKEMSKNISTMDDSARYYSYVRRSAKT
FT                   VDRPKEVAARVRYEDLSGAGYLKLEEMMKGLPKFANKKQFVAPQNVLDVIPFEGQKIEY
FT                   FKYDDDMYSDSEDEEEVEVEEWDKKENEKQTVEGVLVSLASLVDKTNSAFANEMAMGLL
FT                   AVRATAGSGLGDKTAILMG"
FT   gene            <437151..>437618
FT                   /locus_tag="YALI0_E03916g"
FT                   /old_locus_tag="YALI-IPF20486"
FT   CDS_pept        437151..437618
FT                   /locus_tag="YALI0_E03916g"
FT                   /old_locus_tag="YALI-IPF20486"
FT                   /product="YALI0E03916p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79098"
FT                   /db_xref="GOA:Q6C743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C743"
FT                   /protein_id="CAG79098.1"
FT                   /translation="MYQLNVLQRQYISFTMYHDRPPLLLSFPFWLVIALPKYTLDTLER
FT                   VQRTWFNHFLASVVGIQYLMGLLASALWVRRIRELRYMIDNGTYYDHFPDPGEHADYEG
FT                   EDDFELDVLDETVPAMNGAVLVLAFHVMLGIVMVVILISQFIANLGTIKVT"
FT   gene            complement(<437872..>438360)
FT                   /locus_tag="YALI0_E03938g"
FT                   /old_locus_tag="YALI-IPF4206"
FT                   /old_locus_tag="YALI-CDS5802.1"
FT   CDS_pept        complement(437872..438360)
FT                   /locus_tag="YALI0_E03938g"
FT                   /old_locus_tag="YALI-IPF4206"
FT                   /old_locus_tag="YALI-CDS5802.1"
FT                   /product="YALI0E03938p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C742"
FT                   /protein_id="CAG79099.1"
FT                   /translation="MQFSIASVAFLTLAAAQSSSKPKRTVYETITSCTGECSLIAEPTF
FT                   GLLGKNHTGFGNATATGVANSTVPAVSSTPVVVNSTKSFVNTTVGPSSSVASTTKAVSN
FT                   VTITSASGSASEASATVASASEAVPTTAGSATAEKANMGALNTVGAVVVGAAVMAALL"
FT   gene            complement(<440268..>440939)
FT                   /locus_tag="YALI0_E03960g"
FT                   /old_locus_tag="YALI-IPF4207"
FT                   /old_locus_tag="YALI-CDS5212.1"
FT   CDS_pept        complement(440268..440939)
FT                   /locus_tag="YALI0_E03960g"
FT                   /old_locus_tag="YALI-IPF4207"
FT                   /old_locus_tag="YALI-CDS5212.1"
FT                   /product="YALI0E03960p"
FT                   /note="weakly similar to uniprot|Q06636 Saccharomyces
FT                   cerevisiae YDR302w GPI11 GPI11 - protein involved in
FT                   glycosylphosphatidylinositol (GPI) biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79100"
FT                   /db_xref="GOA:Q6C741"
FT                   /db_xref="InterPro:IPR009580"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C741"
FT                   /protein_id="CAG79100.1"
FT                   /translation="MATRKAAKTKANGPAHVPSGPSQVLAVVYGTLLLVYLRFIFSAGI
FT                   THDPAKVMTQALPGLLLLHMGYCVVVLGNKPGRKIGTDVSTAMIAAALSVFFSVIIFGL
FT                   LVLFGAPAISLVHNTFVCAMHMSILAVLPLFFTYHLDSKVWADIIAMRRPLDHVYAASV
FT                   CTLIGAWLGAIPIPYDWDRPWQQWPITILAGAYLGYFVGTLGGIALELTKSLCSKTKKT
FT                   E"
FT   gene            complement(<441705..>445514)
FT                   /locus_tag="YALI0_E03982g"
FT                   /old_locus_tag="YALI-IPF4208"
FT                   /old_locus_tag="YALI-CDS0196.1"
FT   CDS_pept        complement(441705..445514)
FT                   /locus_tag="YALI0_E03982g"
FT                   /old_locus_tag="YALI-IPF4208"
FT                   /old_locus_tag="YALI-CDS0196.1"
FT                   /product="YALI0E03982p"
FT                   /note="weakly similar to uniprot|Q06632 Saccharomyces
FT                   cerevisiae YDR301w CFT1 pre-mRNA 3 -end processing factor
FT                   CF II"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79101"
FT                   /db_xref="GOA:Q6C740"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C740"
FT                   /protein_id="CAG79101.1"
FT                   /translation="MHIFKNLTEPTAVTHSLSCNFTGERNLVLVKGSQLLQIFRYKDDI
FT                   PTKDEAPRLELITEYYLDGTVTGVTRIKTIDNYDLDSLYISVKHAKAVIVAWNASSFTI
FT                   DTKSLHYYEKGLVESNFFEPECSSVAVSDEANSFYTCLLFQNDRMAFLPIIEKGLDDDE
FT                   MPESGQVFDPSFIVKASRLDKRIENVMDICFLHEYRETTMGILFQPKRAWVGMKNILKD
FT                   TVSYAIVSVDVHQKNSTVIGTLNGLPVDAQKVIPLPAPLGGSLIICANTILYIDSSASY
FT                   TGVMVNNTHRQNSDLIVSRDQSTLDLRLEGAEVCFIQELGNTALLVTEDGQFFSLLFNK
FT                   DGRRVASLELRPIEPDNFILSQPSSVAAGPDGTIFLGSRAGDSLLVKWYHGEPESQPEE
FT                   TLDDGNESDDDLYGGDTAQTEDTTNRPLKLRLADRMLGMGPMQSLALGKNRGSQGVEFV
FT                   TTTGVGANSALAILTSALMPYKRKSLYKDMPGGQFWSVPVRFEEEGEVAKSRTYVVSSD
FT                   SENSYLYYVDAAGVIEDVSLSTKKKKTKKHFVSNVTTIFSSSMLDSALLQVCLETVNIY
FT                   DAKIGQPHKYSLPQGTTAVEARVLGNYVLVLLSDGQVKILEAVSINKRPFLKAAQVSIE
FT                   PASESKAIGIYATDSSLTFGAPSKKRTRQGSPAQDSRPVVVVCYADGSLLLQGLNSDDR
FT                   LILDASDLSGFIKEKDGQLYDAPLELVDIALSPLGDDHILRDYLVLLTPQQLVVYEPYH
FT                   YNDKLRFRKIFLERTPTINSDRRLTQVPLINGKHTLGVTGETAYILVKTLHTSPRLIEF
FT                   GETKGAVAFTSWDGKFAYLTQAGEVAECRFDPSFSLETNWPVKHVQLCGETISKVTYHE
FT                   TMDVYVIATHKTVPHVVRDEDDEVIESLTPDIMPATTYQGAIRIVNPYSWTVIDSYEFE
FT                   MPAEAALCCESVKLSISDRKSQKREVVAVGTSILRGEDLAARGALYLFDVIEIVPEKER
FT                   PETNRRLKKLVQDRVRGAFTAVCEVSGRLLAVQGQKLLVQALQDDLTLVPVAFLDMQTY
FT                   VAVAKSLNSMLLLGDATRSVQFVGFSMDPYQMIPFARDLQRVLVTTCDFAIEGENLTFV
FT                   VADLQKRLHILEYDPDDPQSYSGARLLRRSVFYSGKVIDSSAMVPINEDRFMVIGVCSD
FT                   GSVTDVVPCPEDAYRRLYAIQTQITDKEAHVCGLHPRAYRYDPILPGTGNSPHRPILDG
FT                   HTLIRFANLPRNKQNVYANRLGQRYQQLIWKDLELISDLFKKCI"
FT   gene            <446005..>446721
FT                   /locus_tag="YALI0_E04004g"
FT                   /old_locus_tag="YALI-IPF4209"
FT                   /old_locus_tag="YALI-CDS5027.1"
FT   CDS_pept        446005..446721
FT                   /locus_tag="YALI0_E04004g"
FT                   /old_locus_tag="YALI-IPF4209"
FT                   /old_locus_tag="YALI-CDS5027.1"
FT                   /product="YALI0E04004p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79102"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C739"
FT                   /protein_id="CAG79102.1"
FT                   /translation="MQLPPELITLVATFLDFKDLSRLTCVNKHLYELLATDIWKDVYYS
FT                   AGYVPPLLTCAPLIQHVHFDSAVTTMFFNRKNFPAIKQFSVSYYEDITPWIGLPVGTVF
FT                   RNWRRDLYQQFYPQLAEYLKAHEVTLASLLLYDQSFLYYFIEADSCHKIERLRFDTNFT
FT                   DTVLYHDKVYPPILRLAIVEKFIRAVEAAGCRPPFDRDQGSLSFWNQIEDIERGPDGPI
FT                   MPPLPADFGDLSGERT"
FT   gene            complement(<446785..>447234)
FT                   /locus_tag="YALI0_E04026g"
FT                   /old_locus_tag="YALI-IPF20477"
FT   CDS_pept        complement(446785..447234)
FT                   /locus_tag="YALI0_E04026g"
FT                   /old_locus_tag="YALI-IPF20477"
FT                   /product="YALI0E04026p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79103"
FT                   /db_xref="GOA:Q6C738"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C738"
FT                   /protein_id="CAG79103.1"
FT                   /translation="MSFILNHLNETTLNVQGDEGVQFSIVGGLGTLASAYASYLMCTRV
FT                   PTSNKTWLAATVASLFISIGNQYQCQFTPGSPANSSYIGRLPWTVLRVAFLAVVYGQLN
FT                   LGGTKFTWAAGNPLHIPVLFLASYVLNEVGNVLRKPIPKPVVKDE"
FT   gene            <448846..>449799
FT                   /locus_tag="YALI0_E04048g"
FT                   /old_locus_tag="YALI-IPF4211"
FT                   /old_locus_tag="YALI-CDS4185.1"
FT   CDS_pept        448846..449799
FT                   /locus_tag="YALI0_E04048g"
FT                   /old_locus_tag="YALI-IPF4211"
FT                   /old_locus_tag="YALI-CDS4185.1"
FT                   /product="YALI0E04048p"
FT                   /note="similar to uniprot|P32332 Saccharomyces cerevisiae
FT                   YKL120w Mitochondrial oxaloacetate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79104"
FT                   /db_xref="GOA:Q6C737"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C737"
FT                   /protein_id="CAG79104.1"
FT                   /translation="MAVILDKQKKQPPKQISTLGGFVAGAIAACGAVTVTNPIELVKTR
FT                   MQLQGELAARGEAKKVYTSPLQALVKIYKSEGIKGLQSGLFSAYVYQIGLNGCRLGLYE
FT                   PTRKVIANVCNIDLNKENPVGLNVASGAISGIMGAVAGSPFYLIKTRQQSYSPAFKVGA
FT                   QTYYKSIGDGFRQIYGAEGFKGLYRGVDAAILRTGAGSSVQLPIYNWAKELLLKHHITD
FT                   PGASTHLVASAMSGLGVAVVMNPWDVLMTRMYNQKGNMYKNPFDCLMKTVSIEGPFALY
FT                   KGFGAHLLRIAPHTILTLMFMEQTMKWVKWFEGVPF"
FT   gene            complement(<450025..>451005)
FT                   /locus_tag="YALI0_E04070g"
FT                   /old_locus_tag="YALI-IPF4212"
FT                   /old_locus_tag="YALI-CDS4071.1"
FT   CDS_pept        complement(450025..451005)
FT                   /locus_tag="YALI0_E04070g"
FT                   /old_locus_tag="YALI-IPF4212"
FT                   /old_locus_tag="YALI-CDS4071.1"
FT                   /product="YALI0E04070p"
FT                   /note="similar to DEHA0G18535g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79105"
FT                   /db_xref="GOA:Q6C736"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C736"
FT                   /protein_id="CAG79105.1"
FT                   /translation="MSVKTVDISTINQTTADELLECASRDGFLFVEGSGFTQKEVDDMF
FT                   NMSKGFFALPLEEKNKFPIGAENRGYNAINVETLDPATQKKGDPKEGFNFGKYINEKPI
FT                   QPMPEFFQKPENADIIANMQTKLYNLSQRILKLLAMGLKIDESSGGSNWFADRHRRDYP
FT                   SGSIFRLLYYPGQKKADPEDEIRAGAHTDYGSLTLLFQREGEEGLEILSPVSKKWEPVP
FT                   YVGPKEPGMAPPVVVNIGDLLSYWTAGILKSTIHRVKFPAKLQAEGTDRYSCVFFCHPE
FT                   EEVRLEPVPSAKIASVTGRGANEGKVITAEEHLQSRLSATYGWKK"
FT   gene            <452411..>454537
FT                   /locus_tag="YALI0_E04092g"
FT                   /old_locus_tag="YALI-IPF4214"
FT                   /old_locus_tag="YALI-CDS1129.1"
FT   CDS_pept        452411..454537
FT                   /locus_tag="YALI0_E04092g"
FT                   /old_locus_tag="YALI-IPF4214"
FT                   /old_locus_tag="YALI-CDS1129.1"
FT                   /product="YALI0E04092p"
FT                   /note="weakly similar to uniprot|P40850 Saccharomyces
FT                   cerevisiae YNL085w MKT1 required for propagation of M2
FT                   dsRNA satellite of L-A virus"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79106"
FT                   /db_xref="GOA:Q6C735"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR022039"
FT                   /db_xref="InterPro:IPR022040"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C735"
FT                   /protein_id="CAG79106.1"
FT                   /translation="MPIKSLDAFATERRLFKPQALSGLNGSILGIDADHYLSVISALAA
FT                   TYPQVVTGGSSLPPKVRDVLLRDLTTLKSHKITPYFVFRGLPAASANPHLFKQYDLQHA
FT                   EMRSQRRQAAWNQYEAASTEAEHATLAAFHDSGLNPVTTSAAVFRNITGLLAENNVEYS
FT                   VAPYYAWAQLAYLVSTERIDAVLGPSELLLAPHVDKILVTMDDKNASVLHKKALLQELG
FT                   GLTNELFVEVALAAGCDLTGNYTFPPFEHPINVMGQPTTPIRTAADSLAQYPSIYTAVA
FT                   TYGADQGVFAARFRRAFAAFKFCPVLHADGHVGPLPNTGDVPNDSHDFLGQRLPDELIY
FT                   YQNAGLIGPDLLTVIVSGFAAEEAGLDGDADIEYRTLVKKLPDTYSKCLNLITQSLHRY
FT                   YHYKKYNIVYFWQPETEHSLNSQFQPALYVGLNWKTDKLDGLSSKPVSAVNVSSVLDLI
FT                   SNSSADWKKASLTTDHKVLLSTNTQILANTILRLLQLEGYIDPKTHSLTKWGEVLQAFG
FT                   NEPMALPILSLLRNKLLDNKPLTPQSVTAFAPSASPLLLKVAGFVNSTSGTYRGRFSRL
FT                   ALAMSGIAATQTRATRWLLEATLFSLLSYAADKGRDASVYELGRALPFNTLPSSITVNV
FT                   IDQLLRGAALEDVAKVCYHGDSAAKIVSEQLAQFKAVWQALFAAAEKAHMLDLISADVY
FT                   KQFVEANDVCKNKL"
FT   gene            complement(<455192..>457441)
FT                   /locus_tag="YALI0_E04114g"
FT                   /old_locus_tag="YALI-IPF4216"
FT                   /old_locus_tag="YALI-CDS0983.1"
FT   CDS_pept        complement(455192..457441)
FT                   /locus_tag="YALI0_E04114g"
FT                   /old_locus_tag="YALI-IPF4216"
FT                   /old_locus_tag="YALI-CDS0983.1"
FT                   /product="YALI0E04114p"
FT                   /note="weakly similar to uniprot|Q03162 Saccharomyces
FT                   cerevisiae YMR100w MUB1 involved in budding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79107"
FT                   /db_xref="GOA:Q6C734"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C734"
FT                   /protein_id="CAG79107.1"
FT                   /translation="MRESNFRSVPSNRASVTITTTLYDRRALDCTSDKPLINSLNHLTY
FT                   LTSSSARVRETLCTDGGLERLVAIMKTCQESKHDDKHSDKNLLVAWKWALAFQCLVFVG
FT                   TRGTEAIRKRIVEAGLLPVLATVLDNYLLMMEDAKAEQELQRRRAEVEQEMQRRQADDK
FT                   DRSDAVTASNPFGISLCGSTREVSADKERENTPGQSQSQGQAARRDCRLHSAISSAVSS
FT                   VSRLCRTQSAVPDEPQAGSSRESSLQSSFSSSMIDSASSTSSTTTTIMNSSTTITTPSL
FT                   RQLLSESAILRSGASVESFDTATQNSSQSQNDDAQMVDTDTGLALFAERDADGDVEMGS
FT                   DDFQPRRLQASQPQQQQQQQQQQPAQPGQPTVTGQTATPRPGPGVAPVTAQGAISSIQS
FT                   SIASMPRIFENGILMPRDDDVLWALEILAYVSKYSSTKECIQTCHFVPDLSLRDKNLPP
FT                   LRRAAVPQPLMRSKFGSHEGDPVVKIVDVDDEDDYKGKSICVDETADVDGVVDDQFLDD
FT                   HRTQKQREITAFHKRVTRKSHRKKTDWEKAYDTYDFESEEDICAEFLGETINVFPIVEK
FT                   FTIREYSNEIQYWAGVIMRNSCRKNEARGGIRQCAHFDCGKWEEFPRQFAKCRRCKRTK
FT                   YCSRECQLKAWNYHKHWCSTNPPNVASSRSGSSAVTSSAASVSSVSTASTVATASTVAT
FT                   VNTMASGGTVASGTEGFPNSPNNAASASSASTATVAGGSQSTLSNSRQSMFRSTR"
FT   gene            complement(<460440..>463319)
FT                   /locus_tag="YALI0_E04136g"
FT                   /old_locus_tag="YALI-IPF4218"
FT                   /old_locus_tag="YALI-CDS0509.1"
FT   CDS_pept        complement(460440..463319)
FT                   /locus_tag="YALI0_E04136g"
FT                   /old_locus_tag="YALI-IPF4218"
FT                   /old_locus_tag="YALI-CDS0509.1"
FT                   /product="YALI0E04136p"
FT                   /note="some similarities with uniprot|P31244 Saccharomyces
FT                   cerevisiae YBR114w RAD16 nucleotide excision repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79108"
FT                   /db_xref="GOA:Q6C733"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C733"
FT                   /protein_id="CAG79108.1"
FT                   /translation="MARLSAKMDAHPPSTRSRRQIMSDSDETESCSDDSDHSDASSAAA
FT                   PRTTKPWQTKSYQENLSRGGDSGDDSEEGDSDDSDDSDDSDDSDNSDDSEDGLNGILNK
FT                   SDSPKAIAPDFQRHTSPVKRMPQPDRPVATPVRRNRLSMSPKNSVFDSANPLLSASKKA
FT                   TAGTKKNIFDDEPMAPMKIPDLHAAPKPKPKSDLSAAGLRRPSKPISTPIKTPSNSMES
FT                   ANRAAYEEYKQSMKPRVPSRSAFSISSPIKQNIEHQQRFQQASVGLSESELAIMSGAGK
FT                   QQSGYDRYNQPNNTPRVNYGVRGPPGLVKDAALTGVNAHSSAPAPEFNYTPASTAGDVE
FT                   ALLPYILSNNDEDEESSDEEEEEPEDKTKKGASSKKATSRRSEERAAQEKEMGDRGHLV
FT                   RKHWDSEFLKNMRFKGIVPGLSVTLMQHQRKGVRWLLGREVPTNKHKGGMLCDDMGLGK
FT                   TVQSISLILSNPRGLHAKTASKDGEPRECKATLVIAPLSLATQWEQEIKDKSPGLRVLK
FT                   HHGPGRTSDSHVFRDYDVIVTTYQTLSSEIKKDNSPLLGVKFWRVILDEAHTIKNKRSQ
FT                   MYQAACRVFADRRWCLTGTPVQNNIDELQALLQFIRVPPYDDPVVWKEQISGPLSKEGA
FT                   ARTAMAKLHLVLSGLMLRRTKAVLKDSKMNMKARRVHQVDIEFQPDERAFYDAVNERIG
FT                   SQIDTISNGSMMQALTLLLRLRQICDHRYLVSKEAATGGHLDEFEGYSAEADDGKDLDD
FT                   LADMFADMGMDGAGSSSTSSGDNKVSINGKDVHASAKVVKLLELLKADPRKTIVFSQFT
FT                   KFFDVLEPFLIRENIRYVKYDGSMPIRKRDAALATLRADPDTTVLLCSLKCGALGLNLT
FT                   CANRVVLLDPWWNPMVSEQAIDRVHRIGQTVDVDVYEFSVVDSVEKKIMQLQDKKRKLA
FT                   GSVINGDRELMKEVSTLSRAELLFVFGRA"
FT   gene            <466913..>469097
FT                   /locus_tag="YALI0_E04158g"
FT                   /old_locus_tag="YALI-IPF3157"
FT                   /old_locus_tag="YALI-CDS1950.1"
FT   CDS_pept        join(466913..467336,467389..469097)
FT                   /locus_tag="YALI0_E04158g"
FT                   /old_locus_tag="YALI-IPF3157"
FT                   /old_locus_tag="YALI-CDS1950.1"
FT                   /product="YALI0E04158p"
FT                   /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
FT                   YMR162c Potential aminophospholipid translocase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79109"
FT                   /db_xref="GOA:W0TYM0"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYM0"
FT                   /protein_id="CAG79109.4"
FT                   /translation="MTRKDGGRGSLDFTTEGLNEAPPRVSQDDSNSQRPRERPHITFSP
FT                   STNDVPHSQRSPPPPQQQPHSPRRPRGNSLRTQLFERHRQQQQQQAPDTTNDTSMDISG
FT                   DYSWATDPSEDDLKEGPYQREDSFEEVTPQDIDKSIDDSEPLARTSSVGSKRLSRMATQ
FT                   FSTTPGNISERLPNYALENSKPNSFKENLLSWGPQKQVVKYFGKVHDFVLNIQHLPPSR
FT                   DGRQLPLEVPTGKRELLDERRNKKFIDNEIKSSIYTPWSFLPRQLYAQFSKLANLYFLA
FT                   VSIMQMIPSWSTTGTYTTIAPLMFFICVSMAREGYDDWRRHRQDKAENYRLAKVAIKRD
FT                   KGGTISETSSSRNMELDSFSSGDSISGASPIEFKEVYWKDIMAGDIVKLKQDDWIPADM
FT                   IVLWADGMGDQAYIETMALDGETNLKPREALPQIQTQCSTDAGLAKLNGHLNTEDPNID
FT                   LYNFEGRLEYEGDTYSLGPQNVVYRGSILRNTPNMLGVVIFTGEESKIRMNAIKNPRTK
FT                   APRLQSMVNRIVMVMVAFVLILSAFCTGASSIYYHSDGRHMWYLRGLEVGVVPNLMGFI
FT                   IMYNTLIPLSLYVALEIVKVFQIYFIQSDIDMYYIPSNTPCEAHTATINEELGQVSYIF
FT                   TDKTGTLTENLMVFRKMSVGGRAWIHELDCMLEAAKAANAVKEARNSTEMSKLAGKAGV
FT                   GDLLIHKPRRSRKSLR"
FT   gene            <469446..>472460
FT                   /locus_tag="YALI0_E04169g"
FT   CDS_pept        469446..472460
FT                   /locus_tag="YALI0_E04169g"
FT                   /product="YALI0E04169p"
FT                   /note="highly similar to uniprot|Q12674 Saccharomyces
FT                   cerevisiae YMR162c DNF3 Potential aminophospholipid
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04169g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64325"
FT                   /db_xref="GOA:B5FVH1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH1"
FT                   /protein_id="CAR64325.1"
FT                   /translation="MALPRKSMTIEPTQTQSSEAEPRLSRALSTRSLWKASAAPMKDQE
FT                   NPTTLDLLNYLQTNPNSEYSIRAKFFLLNMALCHMCLPEGNLEEGIEYTSASPDEVALV
FT                   AAARDLGYIMSNRYNSTVTVRTFPDGLDDDPVDETYEILDVIEFTSGRKRMSVVVRMPN
FT                   NELFIFCKGADNVIVDRLRNSAIAHEKIDRISNQAADRKRAEAEVVLESRKSMGAATSP
FT                   RKSGVDTDARTSFGIPRPSINLGRSRDPLDSIDDWLYKKTREEEDVHEVASTARKSVQL
FT                   ARKRMYNEPQPRRSMDVRQTAHRVSMGRVSTGRVSFAYGEERLPRNMDDILTRTTPKKN
FT                   SGGGFDHEDAAGDLSVEFGIDDELVKNDAYIMEKTLNHIEEFSTEGLRTLMYAHKKLGQ
FT                   EEYKQWKKLYDDARTSLENRAMKCEKVGEMIERDFELSGATAIEDKLQKGVPETIEKLR
FT                   RANIKLWMLTGDKRETAINIGYSCRLIKDYSTVVILKHDEDIVGALAQSLLKLDTGNVA
FT                   HCVVVVDGQTLSIIEEDLTLMSLFIDLGIKADSVICCRASPSQKALMVTNVRSKVKSAI
FT                   TLAIGDGANDIAMIQSADVGIGITGKEGLQAARSSDFAIAQFSYLLKLLLVHGHWNYDR
FT                   TCKYVLATFYKEMLFYTTQAIFQYNSMFTGTSMYEQWSLAMFNTLFTSLPVIVLGIFEQ
FT                   DLSAATLIAVPELYAKGQKNEAFNYLVYLVWMTIAISQSLIISFMAFYIWGFSSLPDID
FT                   NTLYPLGMITFTAVVLLITLKLQMMDIQSRTVIALGVTIISIGGWFAWNLFLSAVYHNG
FT                   RVKIYYIPDGMVSRWGKDLSWWAALLVVTIAAALVDILWKVFRVWFFPTDTDLFQELEQ
FT                   DDSIKKRLEEEAYEELQQGWRHGNWVADLEAQGADAPGTPRSSRTRSTRYSNSVRSPAS
FT                   PRYYDEYTPYTSSSGRESSSNDHQSRTDKLRQKLRFPRKKTSGEYEREVEEILKRRAED
FT                   ERSQALRDIEMRRMA"
FT   gene            <473964..>475154
FT                   /locus_tag="YALI0_E04202g"
FT                   /old_locus_tag="YALI-IPF3153"
FT                   /old_locus_tag="YALI-CDS3283.1"
FT   CDS_pept        473964..475154
FT                   /locus_tag="YALI0_E04202g"
FT                   /old_locus_tag="YALI-IPF3153"
FT                   /old_locus_tag="YALI-CDS3283.1"
FT                   /product="YALI0E04202p"
FT                   /note="similar to uniprot|Q96U86 Neurospora crassa B13A5.
FT                   050 putative arginase family member"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79111"
FT                   /db_xref="GOA:Q6C732"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C732"
FT                   /protein_id="CAG79111.1"
FT                   /translation="MDSEYGDLSVEQKPIKDHSHSHHHHDHGHGHGNGHVEVEYLNLPG
FT                   NNFYEDLDAELNGPLYAGIQTFAHLGHVSCFDPTNFASEQFDIALVGAPFDTAVTFRSG
FT                   ARFGPAGIRKGSRRMSPGQVSPYREGFMLYDDWAKFVDCGDVAMHPLDNRYALNQLYRG
FT                   MRAIHNHTTSTLNATHIPRAILMGGDHTTTLSALQAIYEKIGPVSVIHFDSHIDTWDPM
FT                   VLGGNVSSYMQVNHGTFLHYAAERGYLNHGHNLHVGSRAPYVRKHGDIEHDKHCGFAIV
FT                   NAREIDEVGIAGVVQKIKDRVGNTNVYISVDIDVLDPVYAPGTGTAEPGGYTTREFMQI
FT                   LDGLEGINIVGADVVEVAPAYDGPGDVTLLAAAQVIDSLASLMVMNGPLSTRQSTK"
FT   gene            complement(<475243..>476784)
FT                   /locus_tag="YALI0_E04224g"
FT                   /old_locus_tag="YALI-IPF3152"
FT                   /old_locus_tag="YALI-CDS2249.1"
FT   CDS_pept        complement(475243..476784)
FT                   /locus_tag="YALI0_E04224g"
FT                   /old_locus_tag="YALI-IPF3152"
FT                   /old_locus_tag="YALI-CDS2249.1"
FT                   /product="YALI0E04224p"
FT                   /note="similar to uniprot|Q08224 Saccharomyces cerevisiae
FT                   YOL055c THI20 hydroxymethylpyrimidine phosphate (HMP-P)
FT                   kinase or uniprot|Q08975 Saccharomyces cerevisiae YPL258c
FT                   THI21"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79112"
FT                   /db_xref="GOA:Q6C731"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C731"
FT                   /protein_id="CAG79112.1"
FT                   /translation="MTDTRPPSVLTIAGSDSSGGAGIEADLKTITVHGCYGMTTITGLT
FT                   AQNTTGVEKIHPIEDQGFITACLDAVFSDVGVDVVKTGMLSSQETITTVTNYLKKHHAN
FT                   KASVIDPVLCSTSGSTLFPAEYVSVYLELFGLATIVTPNIPEAVELASVLEKKKFETPK
FT                   TVQDMKDLAVSIHKTGAKWVLIKGGHLSFTKDKEPAKENDTDKVVIDVLYDGKDFTELV
FT                   MPYITTKSTHGTGCTLASAIASNLAKGKDIPQAVLEGTQYIQNAIFEAHPIGKGHGPVN
FT                   HTYNMRVLPFQKGHFLDYLLSHPKVAPAWKQYVEHPFVMQLAKGDLKPECYYYFLQQDY
FT                   LYLRHYARAAALSGYKAKNIAQTAAAGVIIDTIQSELGLHIDHCKENGMSLEELENSEE
FT                   GLQCYAYTRYLIDVGAAEDWLALQFATSPCLFGYGIAARNGKNHPEYKPGNRYSSWIDK
FT                   YVDPKFGCATETGRALLEEEAPKVSPERLEELIEIFATATKMEVTFWNKALTLGE"
FT   gene            <478434..>479681
FT                   /locus_tag="YALI0_E04246g"
FT                   /old_locus_tag="YALI-IPF3150"
FT                   /old_locus_tag="YALI-CDS3081.1"
FT   CDS_pept        478434..479681
FT                   /locus_tag="YALI0_E04246g"
FT                   /old_locus_tag="YALI-IPF3150"
FT                   /old_locus_tag="YALI-CDS3081.1"
FT                   /product="YALI0E04246p"
FT                   /note="similar to uniprot|P53960 Saccharomyces cerevisiae
FT                   YNL040w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79113"
FT                   /db_xref="GOA:Q6C730"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C730"
FT                   /protein_id="CAG79113.1"
FT                   /translation="MSRHTSTIVGLLTCQNEPYLKALTTRVIGCEEVPKTKKTPAKYEV
FT                   ELEDTILFPEGGGQPADLGTLSYEETSVPVNYVKRDGLIAKHETDSPIEVGTTVNVDLE
FT                   WARRFDHMQQHTGQHLLSAIFDTRKLETLAWSLGDKFCYVELPKRVTREEMDAVQAEVN
FT                   RVIQQDLKITTTIITNEEEKAAADPSVVEKIPDDYDVNNGVIRVVNIGDIDHNPCCGTH
FT                   LNSTREIGSVALLHTQAMRGSNCRVFFVCGDRVHKYASEAHRTIKMVNSHLSCLTEDIE
FT                   NKILALNQNLKDASNREKMWMAEVATFTAHNAKQDLETKNVVFVYKPEASLDFLNVIAK
FT                   EIGDLAEGKTAILACGQGTAGGAIMIIGDKLDEVSAKVKDIVVNVKGGGKGRWQGKVTK
FT                   WDMGAAEALETYALSI"
FT   gene            complement(<479785..>480963)
FT                   /locus_tag="YALI0_E04268g"
FT                   /old_locus_tag="YALI-IPF3149"
FT                   /old_locus_tag="YALI-CDS3331.1"
FT   CDS_pept        complement(479785..480963)
FT                   /locus_tag="YALI0_E04268g"
FT                   /old_locus_tag="YALI-IPF3149"
FT                   /old_locus_tag="YALI-CDS3331.1"
FT                   /product="YALI0E04268p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79114"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C729"
FT                   /protein_id="CAG79114.1"
FT                   /translation="MTESRPKISFGHQHPSAKLASGVSLIARLSKSPRSTPKQAMRDSP
FT                   RLTPTKSPWPAKTITPTQPQTQMDEEKENTDDYDYSPGVITRASCEPLSASASPSPLPK
FT                   ISVAKRQRQDYLMGTSPPTFHIRRDSEVQTSTPVGNSTLKAFENLDISCDIVTPKKSTE
FT                   LSIDSPTKQRTSFDSITRTVSITLSSVYDEINETPRKKRPIESRAPSTLPRRKRSGFLR
FT                   HRPSKLDLIDHKELTFFPLHAQASDCGNNEPLVFVEDYFVSDYERSLKNPEASIKKCTT
FT                   CFAPLYEFSSFLESMDKRDACKYSEFVCTKCTHKAFPDRSTGFGRSVRKAQSSYELRSR
FT                   QPMAQSSVGTSPSRPMWWDSLSRKLRWRWRTKGLIPKDVLDLINPPAPTSHY"
FT   gene            <482335..>484182
FT                   /locus_tag="YALI0_E04290g"
FT                   /old_locus_tag="YALI-IPF3148"
FT                   /old_locus_tag="YALI-CDS1517.1"
FT   CDS_pept        482335..484182
FT                   /locus_tag="YALI0_E04290g"
FT                   /old_locus_tag="YALI-IPF3148"
FT                   /old_locus_tag="YALI-CDS1517.1"
FT                   /product="YALI0E04290p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79115"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C728"
FT                   /protein_id="CAG79115.1"
FT                   /translation="MHPKTVPREMPPDEQSLALLQAAWAKLDPLNKGTIAATQMLAAVD
FT                   AIEASFGMVPGKFISRRGRKVIADFADENPRKRVTLEKMVRLFEAFDKSVEMEGEQSVS
FT                   GWMSQNEDYSDYYGDAQRVSEIQTPGPEVDVGASPPVSPKASSLHTEGFGMDREQHGFP
FT                   DILGELPDILPELDHPSPTRTTQYAPFQTTSASSHVKYVPTNEGRSTSATTNYKPSTIS
FT                   PMTQRGSLTSPQRASRRGSTASSRPTTLNSTQTLGNESSRDGFSMSDRSFNRSTPLRPN
FT                   RRSWAKSNDEAFFERMRKDDDDGDDDGDFSISMADGDTDSLMRINHKHMNELHQLRNYA
FT                   AFCETQMEDSELRHVDLEASILAKTKECREHVSRTKAHQEGLEQVSQMITELTEILGRK
FT                   HKRNSRTGSISSTPDSDVLEAYKNRLEVQLEALGKSGELQEAEIKRLTTEKIEQQQKVE
FT                   ALEAQIKSLTDSLTKVTDNVTTMKANKEREDFLDFEARLNNQDPSDFSSINEILEQQNL
FT                   IINDLKEKLLEKEQKEEPKDIKTETVAHVEQSTISTGLKNAFTIIIMVIAFHLISEIFF
FT                   PSNLPEGVLWWMNAPAPIERVFGALDAWVARHDDFRMPM"
FT   gene            complement(<484469..>490895)
FT                   /locus_tag="YALI0_E04312g"
FT                   /old_locus_tag="YALI-IPF3147"
FT                   /old_locus_tag="YALI-CDS0101.1"
FT   CDS_pept        complement(join(484469..488925,488972..490895))
FT                   /locus_tag="YALI0_E04312g"
FT                   /old_locus_tag="YALI-IPF3147"
FT                   /old_locus_tag="YALI-CDS0101.1"
FT                   /product="YALI0E04312p"
FT                   /note="weakly similar to uniprot|O74390 Schizosaccharomyces
FT                   pombe SPBC28E12.06C Putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79116"
FT                   /db_xref="InterPro:IPR000409"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR023362"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036372"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C727"
FT                   /protein_id="CAG79116.1"
FT                   /translation="MSDDISSLLQQLRLDEIPLSAEKLTSSLALGGASQAVFCSSYGFE
FT                   LIMEKLFVAESGLKEYLQILCSALRSNDANCTYFRQGTGIDMLKQCLDTHSSTEGFIDT
FT                   LLECLIEEDGRIDNTISAEILTLYLLETEPPQLPPLVNAVHNSLAKYPYSVALFNHVGL
FT                   ARHVHDLSVKALDKDLSGPEKLLVPLAKHFDQYGVDPTVVARLLKKADKPEHADKLSQW
FT                   TSELAVEPSHFYFGPESYFEFRKLHKRFPPASGEYSISVWVKIDRNTSSTIIDIYDFQQ
FT                   SLIKASVKSDDKHSSLHIQWGNYTHSVKGDIPLGRWTLVTLVYEKSKIYCYLDSVIQDT
FT                   VSVVARSIQKNTVSVRLGGDRQDQSNGSIRIGSLLITDTAITDQTVSFLHYLGPGYYGS
FT                   YQDNLSKFLTYEGASLLELERNETDSSGSVTSHSLPGPPALSIPQHAIVLTCNPHYSTD
FT                   LNCSLKTLVVNTVDDKQSDETKSKEYMGIMEGGAYVVSTSPVDKAIYPYGGLHVLLQLV
FT                   ENASTPEQLRTALRIFCSTLQSSWKMSDEAEHKEGYSILAMILKTKEEIIGVRHLSILL
FT                   DFVGFVSESTDDSIIINPMAYLALILEFDIWKGSSTQTLKLLLHQFVVFCTSREHDFNV
FT                   TRLVKMRVMKTFLQAVKAEVFPNDIYPDLCKTLTAIICANYSSEVMRSITLFITFALSD
FT                   SISVKQALPYNRLGQPLSGHMAITNSRREQGMLVLEAFVRAACQVDVTQFARKLSRTVT
FT                   IKWFLSLLDDQNPEVVVNGLHLLSLVLSSRGPAFKKKFIRATRGITLMTAQLGRWWQVS
FT                   EVWILGLSLLFGLPFTPETLKCSLPEYFHQLYHASAIINVPEAILVLNEMMVFACEAYR
FT                   QLEPGSEDSKNVEEYIFDIMSSYDELRHTNGDFCKLTTFRVYLEGSCRMTYALFKDDDK
FT                   FGDKSGRLHDLMKTHLRNILLDLVWSRRDFGEFWDSVGPEGNHVINTLCGEDILAAIVN
FT                   CESSILFEPRCFTNAGQFLSQYSKYHIETGAATEKMELLFTSIGSILARLSNVHGFSKL
FT                   SKALYQTKSSLVRIYVALTFRCLVTASTARAGNSILRQIIKYQNFLLADLRDTRVLGDL
FT                   ITQVYRLLTIPNIDQRYLFDFLRAVFVVKTDDVPAACHQFSRNHGGEICSFLSELAVMT
FT                   NDEAIGWVAEVRPDFDSFILPTVYERGKELLASEESASELKLDTLGTHHAMESMVYQTY
FT                   RNNIVNWQLSILDSEKVKFHRNIQDKHEHYQMLLDQHARVDAEAGRLNGSSNVSSWRLD
FT                   LSEGRIRMHKKVVPDESEWIQGYMDRHLIDGGDAELDEVEGDESKDVAGSNSIVPTGSA
FT                   GTAIGDESTSLNSSLDEESFEVIDDFNHIDDSPVEDKNRKVIRMLEPGDTIVDFWNVGR
FT                   IVGVEATEGLLILGAFNLYVVDKYFHRSDGEVVNASEAPIAERDPFLRIISGEKSGVAE
FT                   PATSNSGGAASLALKFPLESILQVTKRRFLLRDVAIEIFFTNGCSLLLTAATPRVRDAI
FT                   SNKLLNNRSTRAMGDAMRTKLKNDDILYAISHACDLDSSSKSFSQKLGFSKSSSAVHIP
FT                   TKKWMAGELSNFSYLMILNTLAGRTFNDITQYPIFPWVLADYDSEELNFSKPETFRDLS
FT                   KPMGAQSSHRANEFKNRYEALLELDDTRSPPFHYGTHYSSAMIVTSYLIRLQPFVHSYL
FT                   LLQGGRFDHADRLFYSIKKAWLSASRDNTTDVRELIPEFFFLPEFLLNSNNFSFGQRQN
FT                   DGDAKVGDVELPPWAKGDPKLFVQRNREALESQYVRDNLHLWIDLIFGSRQQGPEAIDS
FT                   LNVFHHLSYRGAINLEVIEDEMERLATIGIIHNFGQTPSQILTKPHPKSGDVGAVAWDL
FT                   ATEPDFTVNTNEPEVIEDLFVHNSQLKVTYRQRAVVTVEGFPPTVLRADSRNHGLQVWN
FT                   DNRLVTVFEGLHLSPIELVVALENMLVLTADRAGLVSVHRLVITKNGKSLQYELSHLDT
FT                   LRGHEACISHIRVSECFNYIITLDDVGKVIQWDLSTFKFIRTFTTEGVRNVQVNEISGD
FT                   IALLTSDSIVVTTINDDHLVTRQLNTTGRPANYCAAFISDPTYKWHGDYFVVVGDDRGE
FT                   IIVSIFRTPPTILTTF"
FT   gene            complement(<491654..>492565)
FT                   /locus_tag="YALI0_E04334g"
FT                   /old_locus_tag="YALI-IPF3145"
FT                   /old_locus_tag="YALI-CDS4345.1"
FT   CDS_pept        complement(491654..492565)
FT                   /locus_tag="YALI0_E04334g"
FT                   /old_locus_tag="YALI-IPF3145"
FT                   /old_locus_tag="YALI-CDS4345.1"
FT                   /product="YALI0E04334p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C726"
FT                   /protein_id="CAG79117.1"
FT                   /translation="MSVERRILPIRSRRRGQRAASRSIFSLPLLLSTPSAANEEEDIRL
FT                   SGDHAGNWTEYINRKIRSSDKSKSFPKPEEKQFVSVGIQHDGPQLPPSRRSARVGYGKT
FT                   DSPLSHVADLFEGHGFYSFDFHSQESGIGQVTTPLKPTYTHAETQTPIDNLPQTQVPQW
FT                   TYSKRRVRFVNRSRRKYMKEKRKVNRVHKNTENEEKEKEKEKETWICPFCDYEDIFKEP
FT                   PYALISRYEMKEKEDWRRSTLQKSNRGNSAETHLFQRSYRVFPDSYYEWESRPPDGEGH
FT                   HAADHSQDGASGYSHDCYDYGG"
FT   gene            complement(<492853..>495006)
FT                   /locus_tag="YALI0_E04356g"
FT                   /old_locus_tag="YALI-IPF3144"
FT                   /old_locus_tag="YALI-CDS1091.1"
FT   CDS_pept        complement(492853..495006)
FT                   /locus_tag="YALI0_E04356g"
FT                   /old_locus_tag="YALI-IPF3144"
FT                   /old_locus_tag="YALI-CDS1091.1"
FT                   /product="YALI0E04356p"
FT                   /note="some similarities with uniprot|P38285 Saccharomyces
FT                   cerevisiae YBR158w CST13"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79118"
FT                   /db_xref="GOA:Q6C725"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C725"
FT                   /protein_id="CAG79118.1"
FT                   /translation="MQPSTPKRSKGDWSTTQQRRSYSTPSALIFGSPEDTPASSSSFAS
FT                   SSSTGTTPNTSPQRPSQLPKSPSSPTPSRRGLRGKLASLTLGAAERVRSISGRIDDREP
FT                   PVYAPPAQPLANPQESLMGWMVERNNGGTRPQQRHPPPRLDTSNYGVSAISNNGLLTPE
FT                   QTPESSPIQPIHRAKGRTTSYYQTQPFKYTSSLREDPFIDRNRNRIKEVQELDFEEFNN
FT                   SEDDFCLSETDVHSEFSSSADSTSSQCHKALRIPEILYNILSHVEADVQVPHEPPPQRR
FT                   RPLSLRHAFLIYGDREKAHQAWERALKEEQTPTQQMFKGDGALHGCLLVNKFWFEVSRK
FT                   LLYNKLHFCDSQKWRQFVHMSSDTGSPEDLITWSRSSHHRSLSRSTGQPNLHQLANGEA
FT                   EMNDYFDTPTKLFVLHKISNAQQSEIDLLQHKIGGALEWLEFYTCAAIVPPLGLLAGGS
FT                   LQKIVLPGCTKVDDAFLKLVAENCPRLQIADLRACEKVSNEGLVALAGKCPQLKLLNVG
FT                   RTQMGHLISYRGISAIARKTQVNTLGAAGCFVCDKSMWELAWYRGHSLDRLSLNGCTLL
FT                   TNDSIPRILPYTSNLAVLELRGCTQITDFKSIIKFKRYQERHKREPLIEGCEIFESRMR
FT                   EAEFQLEMDISREILRDCVQWIYAPDHDQESVRVKRKKVVPNFASTSRLSFIPHGSDAA
FT                   RKLAATSTRVESSSRHHSSRPSH"
FT   gene            <497508..>498191
FT                   /locus_tag="YALI0_E04378g"
FT                   /old_locus_tag="YALI-IPF3143"
FT                   /old_locus_tag="YALI-CDS5156.1"
FT   CDS_pept        497508..498191
FT                   /locus_tag="YALI0_E04378g"
FT                   /old_locus_tag="YALI-IPF3143"
FT                   /old_locus_tag="YALI-CDS5156.1"
FT                   /product="YALI0E04378p"
FT                   /note="similar to DEHA0D10263g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79119"
FT                   /db_xref="GOA:Q6C724"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C724"
FT                   /protein_id="CAG79119.1"
FT                   /translation="MSRRRAPVKSDRIEELGDEEVITRVETNVSYSTTIPTKKTASSNT
FT                   TDNGFSLFDIIRSLGFLLFLGATLSYYITGTWAWGYETQLTNPAYLRHSFKHNILGAPY
FT                   LNLTDDQLSVYDGTRAGEPIYVGVGGKVYDVSANPLTYGPGGPYHFFAGRDAARAFSTG
FT                   CFQTDLTWDVRGLDPDTVAKDIRGWQRFFEKNKKYFYVGQVVHPEPSGEPPKFCQGQKM
FT                   PGGRH"
FT   gene            <499399..>501432
FT                   /locus_tag="YALI0_E04400g"
FT                   /old_locus_tag="YALI-IPF3142"
FT                   /old_locus_tag="YALI-CDS1243.1"
FT   CDS_pept        499399..501432
FT                   /locus_tag="YALI0_E04400g"
FT                   /old_locus_tag="YALI-IPF3142"
FT                   /old_locus_tag="YALI-CDS1243.1"
FT                   /product="YALI0E04400p"
FT                   /note="uniprot|Q8WZL2 Yarrowia lipolytica Ssy5 protein part
FT                   of an extracellular amino acid sensor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79120"
FT                   /db_xref="GOA:F2Z675"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR012985"
FT                   /db_xref="UniProtKB/TrEMBL:F2Z675"
FT                   /protein_id="CAG79120.1"
FT                   /translation="MSYRKIFGKKKDKEPEEGAPRPRPEDAQSVSTAGTAGSSYMSSIF
FT                   SRNTRNTSGTASTSASAGSTGSARSYHKEGAAAGRVNVLETISDVADTVGVDVPQQVKR
FT                   GQFGTSDRNHGISASQPSLSSPNAYLGAGSPTNLFSGAPSSGGASSPVFPFAVNEVHMR
FT                   EVHESLAQLNAESSALLQHIFNGVFTPVMASTALQRLMRDFINFTEMASDVTVQQLAPT
FT                   IKVVLHLSDNLLGPEDIQSRKLLLRTLHELGRRIGVLPRLSGTVSEPRNFAIGEMASEL
FT                   EALPQVLRIMDQICTAQSEVADQDGAFIAPVLRGLTPQFSVLTLSFGYPQPEQSHYDMV
FT                   SQLSTSSPQSVHLYCHKNQIAACANFKPPYRIPTDPQSPPMSLSIASNDGTASGTLGGF
FT                   IYPKISANDPALAAYARSTFAMTCGHVCLSEKTGQNPPVSAPSPVLINMYRAALKKEQV
FT                   KYAPNTAAYTQFQNAIDETKGPNTLGSVVWGERAVVNGAISDVAIIKCDTGLTCRNTLG
FT                   DDVVFTEYDPALVFGNLEVRSVAQKLVPGMNVFKYGSTSRYTRGVYNGPKIVYWAEGRI
FT                   QSSEFVVTTDSTPMFALGGDSGAWLLHKVESENPSLSVMGMLHSHDGEVKQFGLFSPMN
FT                   VILDRLEQVTHVKWGVVGTTDDEGEDLAGGSDSDASEHNHSD"
FT   gene            complement(<501774..>502310)
FT                   /locus_tag="YALI0_E04422g"
FT                   /old_locus_tag="YALI-IPF3140"
FT                   /old_locus_tag="YALI-CDS5693.1"
FT   CDS_pept        complement(501774..502310)
FT                   /locus_tag="YALI0_E04422g"
FT                   /old_locus_tag="YALI-IPF3140"
FT                   /old_locus_tag="YALI-CDS5693.1"
FT                   /product="YALI0E04422p"
FT                   /note="similar to uniprot|Q6C5F8 Yarrowia lipolytica
FT                   YALI0E18458g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79121"
FT                   /db_xref="GOA:Q6C722"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C722"
FT                   /protein_id="CAG79121.1"
FT                   /translation="MTRFCDTVKTLIKEPSFYQFTGTVAGYTLFAAAFPVVAAIHTARG
FT                   VALLKNKSLESCECENKLAKKFDISNITLNEWYSPITLLFPLFKRVVEPLGPLAVMWAR
FT                   YTGLVGEMTDKEVNCVFNCWAKISLGYIYVTGAICFTGLSVWSYRRQTQRHIKKQSIVG
FT                   VPEVTLALFTGLLFV"
FT   gene            complement(<503189..>505405)
FT                   /locus_tag="YALI0_E04444g"
FT                   /old_locus_tag="YALI-IPF3139"
FT                   /old_locus_tag="YALI-CDS1016.1"
FT   CDS_pept        complement(503189..505405)
FT                   /locus_tag="YALI0_E04444g"
FT                   /old_locus_tag="YALI-IPF3139"
FT                   /old_locus_tag="YALI-CDS1016.1"
FT                   /product="YALI0E04444p"
FT                   /note="similar to uniprot|Q12149 Saccharomyces cerevisiae
FT                   YOR001w RRP6"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79122"
FT                   /db_xref="GOA:Q6C721"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C721"
FT                   /protein_id="CAG79122.1"
FT                   /translation="MEIDSVVRLAQQTAKAARGLASHDIKFYSSIDDKVADSVKENASQ
FT                   LIGVVNQLAQKIAPNEVGSFPPELDTVNRHWNEFSSVVDDLYEKTDIQLGKLNKKGDKV
FT                   EIAESKKTGPQTLGEKIRVGNAIQSSSEIKGPQWKPQEMWEVDNSRDTPFKPKLTSKPN
FT                   ALEPLEDAFELVTEDDRRDHYPQPYAKEIMEQPYPDEVYEETEVIPNRPWEAEGEDEYI
FT                   YVDTEEKLRDMVDHLKTQEEIAIDVEHHSMRTYYGITCLVQVSSREQDYIIDTIALRNL
FT                   EIFNEVLTDPKIVKVLHGATMDIQWLQRDFGLYIVSLFDTFHAAQALGLKGHSLAFLLQ
FT                   HYANFVTSKKYQLSDWRIRPMSPEQLLYARADTHFLLNIYDQLKNALVQKDKIEGVLEK
FT                   SRQTASQRYEYTGYDPRYYLKSFDYEGGINRLISQFHITGPSVSVAKALFLWRDSMARK
FT                   EDESTGYVMPNYLLVSLANRMPQTPEAVFSVSKSLPLLVRKNVEEILDVIKDSKDEHVE
FT                   VEQVEEEPVLAAESIEGAEFSEIAEVIFLAAQDGQSDITGKFDSSKSSIVHVKETALGP
FT                   LGVSKIDKHMMVLAVPVAPLSVDSTESDSEVQNAEEEVKVEQDAAADDESDYSEDEHEH
FT                   ANDIIIAKSNKKYTADKEAKKGVAKEKSEEFTPFDYSAGASILKSDDQKAAEKKAAMTA
FT                   RKQKAKEKKQFNPYEIKEDAKGASKRRGPKDGGARSVQYKKRRT"
FT   gene            complement(<505794..>506753)
FT                   /locus_tag="YALI0_E04466g"
FT                   /old_locus_tag="YALI-IPF3138"
FT                   /old_locus_tag="YALI-CDS4157.1"
FT   CDS_pept        complement(505794..506753)
FT                   /locus_tag="YALI0_E04466g"
FT                   /old_locus_tag="YALI-IPF3138"
FT                   /old_locus_tag="YALI-CDS4157.1"
FT                   /product="YALI0E04466p"
FT                   /note="some similarities with DEHA0E21846g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79123"
FT                   /db_xref="GOA:Q6C720"
FT                   /db_xref="InterPro:IPR013911"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C720"
FT                   /protein_id="CAG79123.1"
FT                   /translation="MANDKDQDGFFPKYQQPSFVLRMWGKLVPAADNKYALTIVCAAQM
FT                   GVGVLLLAYPRRSTFRAKYGKWPYRAVKATGILTGSALIGCTAIFDLARTRNLTYDPWA
FT                   QRARADRVKALKEGKKVTWWWGAHDHKPVGMNEYMSELRVLLEIKKMQYNKKKLADVAE
FT                   SGFKPTEPLLSSDLYMDDILWKYVLPRVFPDEVPISPISRKLTEAMFQSLGLTYEELVA
FT                   ANRKFREGVLEQVENPLFLAHRPWLFGSSSSMDAAIKEVLGEGSNDPDILEGLYNDIAE
FT                   QWDGSIMWGIIAGETDVTIRLIPGTDIVELVEEAEDEE"
FT   gene            <508130..>509113
FT                   /locus_tag="YALI0_E04488g"
FT                   /old_locus_tag="YALI-IPF3137"
FT                   /old_locus_tag="YALI-CDS4056.1"
FT   CDS_pept        508130..509113
FT                   /locus_tag="YALI0_E04488g"
FT                   /old_locus_tag="YALI-IPF3137"
FT                   /old_locus_tag="YALI-CDS4056.1"
FT                   /product="YALI0E04488p"
FT                   /note="weakly similar to uniprot|Q96U38 Neurospora crassa
FT                   B2J23.080"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79124"
FT                   /db_xref="GOA:Q6C719"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C719"
FT                   /protein_id="CAG79124.1"
FT                   /translation="MARTPVYFIPHGGPTFMYENHPGGDKGAFDYLRHLGRDLIQKHKE
FT                   NPDSVKGVIVMSAHWESANQQDENPKGTGNNEFPKVNGKGIPVGIVTDKNDNYPNLEYD
FT                   FFNFPAHMYEEKFWAKGNHASAEKIAKLIDNTPGYYAQLRSDKKWDHGVWVASRVMFEE
FT                   AGEEKGALKFPIINISEPAGDDVDHLSPRQLSERFYNLGKALAPLRDEGYWIIGSGMSV
FT                   HNLRERRKFADGGEPEYSQPFEDAVKDVVENVTSVPVSDEQNLENLSELWKNPHRPAAH
FT                   PTAEHLFPFYFSAGAADGDKGVQEYTKISGSTAWGLFKWGGSTGDY"
FT   gene            <511102..>512919
FT                   /locus_tag="YALI0_E04510g"
FT                   /old_locus_tag="YALI-IPF3136"
FT                   /old_locus_tag="YALI-CDS1577.1"
FT   CDS_pept        511102..512919
FT                   /locus_tag="YALI0_E04510g"
FT                   /old_locus_tag="YALI-IPF3136"
FT                   /old_locus_tag="YALI-CDS1577.1"
FT                   /product="YALI0E04510p"
FT                   /note="similar to uniprot|Q9URL7 Candida albicans PTR2
FT                   Peptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79125"
FT                   /db_xref="GOA:Q6C718"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C718"
FT                   /protein_id="CAG79125.1"
FT                   /translation="MTSHLGDHLEDHLEPSRDDNLYYHEEEEAPGYQAYTSQADYPAKP
FT                   TYSGSGSSQRRFDDYNTSLEKKEGDIEFTEVVDESEHYSQKWSTYTDEYNPDGLRVATD
FT                   EECMTLRKIAAPISAMTYMLSLVEFAERGSYYGLTNVISNFVQFPLPPGGNGWGATPKD
FT                   SQSTAGALNQGLQVATALTLVLQFLSYLTPLLGAYLADSKYGRFPTIWAGTIVCGVGHV
FT                   IIVISGIPGVLEHQKASLGVFIAGLIIFAFGTGLFKPNLLPLLLEQYREDDNWVKKLKS
FT                   GEEVVIDKESTLQRMTLVYYWSINVGGFLGLGTAYAEKRIGYWLAFLVPTILYFFLPFF
FT                   LFIIRNRVYKAPSSEDSIIAGFVGVMWQWLFRKPSTYSEKFVADVWTTLKATRFFLFFP
FT                   IYFINDNGIGALSNSQGSSMITNGVPNDLLNNFNPITIIVAVPIVNYILYPLLRRYRIN
FT                   FRASFRIFLGFMLAAFSPMIGAILQWRIYETSPCGYYATDCDKGVAPITIWWQVFPYFC
FT                   TALSEIFAVTTSYELAYSLAPAHLRSIVLALLLFMSAFSTAIQTGITPALVDPHLIWPF
FT                   VGISVAGAAFAIAFLCCYWRLGKGQEVSV"
FT   gene            complement(<514190..>515383)
FT                   /locus_tag="YALI0_E04532g"
FT                   /old_locus_tag="YALI-IPF3135"
FT                   /old_locus_tag="YALI-CDS3267.1"
FT   CDS_pept        complement(514190..515383)
FT                   /locus_tag="YALI0_E04532g"
FT                   /old_locus_tag="YALI-IPF3135"
FT                   /old_locus_tag="YALI-CDS3267.1"
FT                   /product="YALI0E04532p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79126"
FT                   /db_xref="GOA:Q6C717"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C717"
FT                   /protein_id="CAG79126.1"
FT                   /translation="MALRHDDTRHVSKLSLSQTLSRWKNRSRESLNFDEPAINDTATST
FT                   ERERNLGRRKSSISSFTSFMSSNSSNSERSLKTMGRAKTVNEEVTRPKSRSKDQPQKTA
FT                   DNTRRIFSGNASYSSLIDISEEKKPKETKNTKNTKNTKSPSPLSTTPTGPATTQTMISS
FT                   TNTNNNINTKTNTNTNANTNINTSTTTNKAEIIAANPPTTPSPLSKPPPSKRFSLAVVS
FT                   SSPSFSSARTTRPASMSLSPILPERSAKRASVLQVAPFFQRPTAIKEPEEEESSASSGS
FT                   DDLFSDTEDPYVDPTINLDEYDEDDAEIFCKAPLKHKVVCITCGHKFDTIDECFSHREK
FT                   HQQQAIRRPLTQGTTKMKRPASIAVDVQKERAALVQTKSKRFTSSRHSWSVREMGRV"
FT   gene            complement(<519030..>520280)
FT                   /locus_tag="YALI0_E04554g"
FT                   /old_locus_tag="YALI-IPF3134"
FT                   /old_locus_tag="YALI-CDS3072.1"
FT   CDS_pept        complement(519030..520280)
FT                   /locus_tag="YALI0_E04554g"
FT                   /old_locus_tag="YALI-IPF3134"
FT                   /old_locus_tag="YALI-CDS3072.1"
FT                   /product="YALI0E04554p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79127"
FT                   /db_xref="GOA:Q6C716"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C716"
FT                   /protein_id="CAG79127.1"
FT                   /translation="MQLFYATFDVKLGHSILKGFGEGLGGVEYKAIPSSFQQDDVVYLS
FT                   HNGQPGVAVVVDRNIGNNEGERRNTVFALGVLVDEPWNYLNILDTTMKALEKGDEVKVL
FT                   NGLWSLLTKGPKPMAPERHPIYALVPLLTMIGPEFFEIHRQTLLRNRLLIVLDHDTGIT
FT                   LEQATSLVYILGLLGASSDTLPELNLQYNVTVQDSERLAKMNNYLAITSDTIMLHRKSD
FT                   HDVAVQLSNDGVQITNYGFPSQRDSRRYHVLTHFIKAVREEGRGPAFQQLLSQAHHSQP
FT                   CPTSAKKPLWRQFYEVLANNMLWLASAGEISTIEDEQYLEGLEFDDEDDDSLTLEVLLV
FT                   GYFQQITNRLNATVQSLVTRDLYRENHHTLTLAHADVLQTGLEMYNSHDEKFLHDYVER
FT                   WWNTDINVSYLGLFKCC"
FT   gene            complement(<520894..>523971)
FT                   /locus_tag="YALI0_E04576g"
FT                   /old_locus_tag="YALI-IPF3133"
FT                   /old_locus_tag="YALI-CDS0409.1"
FT   CDS_pept        complement(520894..523971)
FT                   /locus_tag="YALI0_E04576g"
FT                   /old_locus_tag="YALI-IPF3133"
FT                   /old_locus_tag="YALI-CDS0409.1"
FT                   /product="YALI0E04576p"
FT                   /note="weakly similar to uniprot|P33418 Saccharomyces
FT                   cerevisiae YKL205w LOS1 pre-tRNA splicing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79128"
FT                   /db_xref="GOA:Q6C715"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040017"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C715"
FT                   /protein_id="CAG79128.1"
FT                   /translation="MEDQIEQAVDIAIQGVGDPAVRQQALDFCNQVKASDEGWQMCLAM
FT                   FAGDRKRSDAARYFSLQVIDEALGRLNREQLVYVRDHLFAYVRMGSGLSQGQANVNVGQ
FT                   AVSFADDPVHMKNKLGETLAYLFIMTYTEIWDTFFYDFERLLESPENQFGNPRAADLYL
FT                   RVLNDIHREIGDTLIIRDPAVQSRNNDLKDLIRNRDMARLADSWKKILMYYKDQQLEPL
FT                   ATEIVNNALRVIGGWVSWAELTLIAEPEALEAIFNLLSSPKSRIHACDCLSEIVAKKMY
FT                   PNAKFQLIQSLNLTSIIHTLSQSADIEFDERVAKLANSIGSELIHIVETESQEFSANCE
FT                   ALLLDMFPLLLRYLGNEYDDTSSQVLPSVGSYLQLVRRDSKREKAKINPNRLTKNTADQ
FT                   YENFPADRTFISDQRHAVVRSILEAVMKKCRYLDDQEWEEDEDGEFCELRQRLKNLQDM
FT                   CASIDNQLFLDDVCPVISQALSLPPTADWRDIELGMFELQTLSEAMRSGALSTVKTGQN
FT                   ESPATQAFNNLFFQMVASDAVAQCPQPAVHLLFMEIVVKHSSLFSQHNTNLLNRVLEFF
FT                   VSPLGIQNSESTKVQMRSWILFHKFCKSVKPQIGQVAQLLVDSIRPLLVIQTEDDTDSD
FT                   DESAGSAFNAQLNLFELSGILVSILDEASATNGVEQTLQPIFTAVEKAIGVSPPNAESI
FT                   TLVHHNLVAIGTFAHGLDGSSNKLPDGILQLFKNSAEVVNVALDRIPDTKVREAARTVF
FT                   TRLVPILGSSILSEISTLIQILLQRCSHAELADFLGFLGHLLHSFRNDEGVYNMLKSLL
FT                   SPLCQRVFASLEELSASADAGNTDDKVLKVEIQRAYLMFIMQILRDRMGGAIVEDKQLA
FT                   DSIIKSVIHYASDPTDIYTCRSAASCLTKMIQLWGNGELEAASAEESVFDQGQKIDGFE
FT                   QIVLEFSGLCWQVPASSGFNLQDAQSKILVTELGNIQKHIYLKKGDQFLSYLVEQYFPQ
FT                   IGVPDNAAKDYVEKLKTLENKDFKKYFSAFVNELVK"
FT   gene            <524863..>525615
FT                   /locus_tag="YALI0_E04598g"
FT                   /old_locus_tag="YALI-IPF3131"
FT                   /old_locus_tag="YALI-CDS4902.1"
FT   CDS_pept        524863..525615
FT                   /locus_tag="YALI0_E04598g"
FT                   /old_locus_tag="YALI-IPF3131"
FT                   /old_locus_tag="YALI-CDS4902.1"
FT                   /product="YALI0E04598p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79129"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C714"
FT                   /protein_id="CAG79129.1"
FT                   /translation="MYRPTTATRLSVAPCRLIIRHKSSKSPSPASNVAPQPVKKGEEDE
FT                   VKADAKPEAANKAPQPKTASTTATSTSTTSTAASSPAPSAPAPPYENNPYMFSRSHFTP
FT                   NFSRHQSGNTSSPTRILGIQPHPFTVKEHTGESMNEIFLHKALASHMQPLLLSLDDRKR
FT                   EIPSKVYKFRNQRQVPKAENSLWLKSVLRQQTHSDMDLIPQEMLQQMVPFRPLSDVTRK
FT                   FWDVKMKVDFKRQQQRKQEPEEEEDDSY"
FT   gene            complement(<525755..>526216)
FT                   /locus_tag="YALI0_E04620g"
FT                   /old_locus_tag="YALI-IPF3130"
FT                   /old_locus_tag="YALI-CDS5307.1"
FT   CDS_pept        complement(525755..526216)
FT                   /locus_tag="YALI0_E04620g"
FT                   /old_locus_tag="YALI-IPF3130"
FT                   /old_locus_tag="YALI-CDS5307.1"
FT                   /product="YALI0E04620p"
FT                   /note="weakly similar to uniprot|P29340 Saccharomyces
FT                   cerevisiae YGR133w PAS2 E2 ubiquitin-conjugating enzyme -
FT                   peroxin and uniprot|P15731 Saccharomyces cerevisiae YBR082c
FT                   UBC4 E2 ubiquitin-conjugating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79130"
FT                   /db_xref="GOA:Q6C713"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C713"
FT                   /protein_id="CAG79130.1"
FT                   /translation="MASQKRLIKELAAYKKDPNPCLASLTADGDSLYKWTAVMRGTEGT
FT                   AYENGLWQVEINIPENYPLQPPTMFFRTKICHPNIHFETGEVCIDVLKTQWSPAWTISS
FT                   ACTAVSAMLSLPEPDSPLNIDAANLVRCGDESAMEGLVRYYVNKYASGN"
FT   gene            <526637..>527773
FT                   /locus_tag="YALI0_E04642g"
FT                   /old_locus_tag="YALI-IPF3129"
FT                   /old_locus_tag="YALI-CDS3482.1"
FT   CDS_pept        526637..527773
FT                   /locus_tag="YALI0_E04642g"
FT                   /old_locus_tag="YALI-IPF3129"
FT                   /old_locus_tag="YALI-CDS3482.1"
FT                   /product="YALI0E04642p"
FT                   /note="similar to uniprot|Q12461 Saccharomyces cerevisiae
FT                   YPL152w RRD2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79131"
FT                   /db_xref="GOA:Q6C712"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C712"
FT                   /protein_id="CAG79131.1"
FT                   /translation="MSHSHPVRRILSPKDLEIFGASDTKKQVFGFVKVLNYYVVGKGNS
FT                   YETLKHPIIGKLVAILDKVIDLVAKYPPEDATSSRFGKPEFRDFHQALEENAKDWISDL
FT                   GELEDWQLVELCTYFAASFGDRTRIDFGSGHELNFICFLFCLRQLGLLDVPEYNPEVHD
FT                   PTGEAKNAKCVEDETDSSAAVLTVFVQYLKTMRAVQASYWLEPAGSHGVWGLDDYHFLP
FT                   FMFGSAQLACHKYLRPLSIHDMEMLDMWKHEYLYMGCIHFINSVKTTASLRWHSPMLDD
FT                   ISGVKTWAKVNQGMVKMYDAEVLSKLPILQHFMFGQLIKAPEGVSPPPDPNAEVQHIHN
FT                   HWADCCGIKVPSAIAASEMSQKPGDLRKLRGSGVLPFD"
FT   gene            complement(<527903..>529468)
FT                   /locus_tag="YALI0_E04664g"
FT                   /old_locus_tag="YALI-IPF3128"
FT                   /old_locus_tag="YALI-CDS2185.1"
FT   CDS_pept        complement(527903..529468)
FT                   /locus_tag="YALI0_E04664g"
FT                   /old_locus_tag="YALI-IPF3128"
FT                   /old_locus_tag="YALI-CDS2185.1"
FT                   /product="YALI0E04664p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79132"
FT                   /db_xref="GOA:Q6C711"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C711"
FT                   /protein_id="CAG79132.1"
FT                   /translation="MSCNHLNIYIIGITMYVFYSSGHPYAMAIHHSFKISKKKALPPAK
FT                   SKATLRPKSTEPVPVAANPLITAFEVDFSNDGPVADFQWDIETIEKSRVVFPLAPEAWE
FT                   TTFAAVHESDTTQTTQPPSEDDTTLEITEEKVATKIVPQKFIPGWMMVGDTGDSTDVDQ
FT                   SVDPPQCFDWVDLFFEPKSATEYDPRNFSSHFQETLKVSQELYTPGSVVNPITEGYVIS
FT                   GKSTHAFFNPITGAMTPWIHQPAPRASKDKSTNTTLRTIPNTDCLNVGDPSYWWNVRIC
FT                   SNYFHLGEASSNRVVAALFSTSYKASLSGPTEICIIRCFQPYVKEASYASQFYTFLPQK
FT                   NEKYALALAGSPTSNLFLVESYKEDVHYIYLLTSSLNSPLPHYKLVLSVSHISRTQKNG
FT                   NLRGKQWWHHRILTFGDNLVIFKEGRLASWRIIYDCSTDSVKAYLIPEKYGFVADVHPV
FT                   QFGKHLVFSRGVLDMSTFQFCTVPVGQNDRKKIVWHKRNGVLVGSTVNSLSFQCFYLGD
FT                   PSEV"
FT   gene            complement(<529576..>530985)
FT                   /locus_tag="YALI0_E04675g"
FT                   /old_locus_tag="YALI-IPF3127"
FT                   /old_locus_tag="YALI-CDS2603.1"
FT   CDS_pept        complement(529576..530985)
FT                   /locus_tag="YALI0_E04675g"
FT                   /old_locus_tag="YALI-IPF3127"
FT                   /old_locus_tag="YALI-CDS2603.1"
FT                   /product="YALI0E04675p"
FT                   /note="similar to uniprot|Q08649 Saccharomyces cerevisiae
FT                   YOR244w ESA1 histone acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04675g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79133"
FT                   /db_xref="GOA:Q6C710"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C710"
FT                   /protein_id="CAG79133.1"
FT                   /translation="MALAEADLPNGKTNGKASGSEETPAPVQKVDMNVAINELRVGCKV
FT                   HVEKDGEDRVAEILSVQMRRGNLEFYVHYVEFNKRLDERIAATRVDLSQGVIWPEPEKP
FT                   KKPLSGAAKESSKEKKKNPSKKQKLTDSAATTPGANSEDVMDLDNLQVNGTTQDPDNFN
FT                   RDEEIEKLRTGGSMTQSSHEVARVRNLQRIVLGNHVIEPWYFSPYPIELTEEDEIYICD
FT                   FTLCYFGSKKQFERFRSKSTLRHPPGNEIYRDEAVSFFEIDGRKQRTWCRNLCLLSKLF
FT                   LDHKTLYYDVDPFLFYCMTRRDEKGHHLVGYFSKEKESAEGYNVACILTLPQYQRHGYG
FT                   RLLIDFSYALSKAEGKTGSPEKPLSDLGLLSYRAYWADTIIELLMEKGKQEMTIEDIAS
FT                   VTAMTTTDVLHTLQTYNMLKYYKGQHIICLTDSVCEKYEKMLKKRRRKVNSELLKWKPP
FT                   VFTAAQLRFAW"
FT   gene            complement(<531524..>532849)
FT                   /locus_tag="YALI0_E04697g"
FT                   /old_locus_tag="YALI-IPF40288"
FT   CDS_pept        complement(531524..532849)
FT                   /locus_tag="YALI0_E04697g"
FT                   /old_locus_tag="YALI-IPF40288"
FT                   /product="YALI0E04697p"
FT                   /note="similar to uniprot|Q12417 Saccharomyces cerevisiae
FT                   YPL151c Pre-mRNA splicing factor PRP46"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04697g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79134"
FT                   /db_xref="GOA:Q6C709"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C709"
FT                   /protein_id="CAG79134.2"
FT                   /translation="MPVAKDLFPEYGTLATGENEPSRNIRRAQKLREFQNLELPPYLAK
FT                   QVAAKMAEKGLAVEATGGVAVQRIAGGSQSGQKALMGASSSALTKHTPSASQPTTHDSL
FT                   TNLGANLTQSKPAWHAPWEIYRVITGHQGWVRSVCVEPENQWFATGSADKTIKIWDLAT
FT                   GKLRLTLTGHIMGVRALGVSPRHPYMFSGGEDKMVKCWDLETNKVVRHYHGHLSAVYSL
FT                   DIHPTLDVLVSAGRDAVARVWDIRTRDPVVVLSGHKSTINRVKFQASEPQVITASADET
FT                   VRLWNLQAGKTMTTLTHHKKSVRGLTLHPEEFTFSTASANSSKQWKCPEGDLVLNYDDQ
FT                   NAIINTLSVNQDNVMFSGGDNGSIGFYDWKTGHMFQSTQSIPIPGSIESENGIFDSSFD
FT                   KTGLRLITCEADKSIKMWREKPNATAESDPGLEWKPKIYQTY"
FT   gene            <533164..>534177
FT                   /locus_tag="YALI0_E04719g"
FT                   /old_locus_tag="YALI-IPF40287"
FT   CDS_pept        join(533164..533194,533360..534177)
FT                   /locus_tag="YALI0_E04719g"
FT                   /old_locus_tag="YALI-IPF40287"
FT                   /product="YALI0E04719p"
FT                   /note="similar to uniprot|P40961 Saccharomyces cerevisiae
FT                   YGR132c PHB1 prohibitin antiproliferative protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04719g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79135"
FT                   /db_xref="GOA:Q6C708"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C708"
FT                   /protein_id="CAG79135.1"
FT                   /translation="MSNRLLGVLTTIAIPVGVGITLMQSAMYDVRGGYRAVIFDRLAGV
FT                   KQNVIGEGTHFLVPWLQKDIIFDVRTKPRNIATTTGSKDLQMVSLTLRVLHRPVISQLP
FT                   HIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREVVSARIREDLVKRAGEFNI
FT                   ALEDVSITHMTFGKEFTKAVEQKQIAQQDAERARFIVEKAEQERQAAVIRAEGEAESAE
FT                   AISKALEKAGDGLLLIRRIEASKEIATTLAQSNNVTYLPKGGNGSNGASSGNSLLLNVG
FT                   R"
FT   gene            <534587..>535564
FT                   /locus_tag="YALI0_E04741g"
FT                   /old_locus_tag="YALI-IPF3123"
FT                   /old_locus_tag="YALI-CDS4076.1"
FT   CDS_pept        534587..535564
FT                   /locus_tag="YALI0_E04741g"
FT                   /old_locus_tag="YALI-IPF3123"
FT                   /old_locus_tag="YALI-CDS4076.1"
FT                   /product="YALI0E04741p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04741g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79136"
FT                   /db_xref="GOA:Q6C707"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C707"
FT                   /protein_id="CAG79136.1"
FT                   /translation="MLSVYADQHREAPFPKKAYKAELQKTTENAGLGLQVSEFLSEAEI
FT                   IHSLYYRYRNAHHCAEWFRPFSMLHRRVSQVANWIVDLHKATKKRAPRLITAIKISIQK
FT                   IQTRYLQPAFWSFYSVLALGQYVTVGFALLGTVARIASLLAQVHPIPRTVGKVLDAAVK
FT                   KGAEVMSDDIGEVLVRVTSEKPAKSDKIKKMTKSTVTKTTTGGKKLLKNMDIDDIFSTK
FT                   KKTKKNIEKPRVVEENVEESIITNDDIEDNSMLTEPAPKAKKVKVAKVENFFEESKDKK
FT                   KKNPASLDDSLEPPKKKKKILDSTDGMKKKKKKSKKNAIDDIFG"
FT   gene            complement(<535756..>536818)
FT                   /locus_tag="YALI0_E04763g"
FT                   /old_locus_tag="YALI-IPF40286"
FT   CDS_pept        complement(join(535756..536621,536782..536818))
FT                   /locus_tag="YALI0_E04763g"
FT                   /old_locus_tag="YALI-IPF40286"
FT                   /product="YALI0E04763p"
FT                   /note="similar to uniprot|Q12074 Saccharomyces cerevisiae
FT                   YPR069c SPE3 putrescine aminopropyltransferase (spermidine
FT                   synthase) or uniprot|Q12455 Saccharomyces cerevisiae
FT                   YLR146c SPE4 spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04763g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79137"
FT                   /db_xref="GOA:Q6C706"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR030668"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C706"
FT                   /protein_id="CAG79137.1"
FT                   /translation="MTVKQLEHASIKNSWFTEVSDSFPGQGLMLKVEEILHVSQSEFQD
FT                   VLVFRSTEYGNVLVLDGVVQVSERDEFAYQEMICHVAMMSHECPKRVLVIGGGDGGVLR
FT                   EIVKHESVEAAHLCEIDESVIELSKKYLPNMAVGFDNTKVTVHIRDGFEFIREVARSDE
FT                   KYDVIITDSSDPDGPAEKFFQREYFQLLHTALNDDGIVITQSSENVWLNFKFVKQLRDI
FT                   CKGVFASVEYCAALLPTYTSGQLGLMVCSKKPTNLKIPKRQWTQEEESSLVRYYNKEIH
FT                   EASFVLPNWAKHFLEGTSL"
FT   gene            <537405..>538556
FT                   /locus_tag="YALI0_E04785g"
FT                   /old_locus_tag="YALI-IPF3120"
FT                   /old_locus_tag="YALI-CDS3424.1"
FT   CDS_pept        537405..538556
FT                   /locus_tag="YALI0_E04785g"
FT                   /old_locus_tag="YALI-IPF3120"
FT                   /old_locus_tag="YALI-CDS3424.1"
FT                   /product="YALI0E04785p"
FT                   /note="similar to DEHA0E18414g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04785g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79138"
FT                   /db_xref="GOA:Q6C705"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR028884"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C705"
FT                   /protein_id="CAG79138.1"
FT                   /translation="MKHPYHIVSLSPDGKTMYAAAARQVDRICLETGECKSTVVEESAT
FT                   RTTTKTGDKPAAAKRTKYLPTSVSHVRSLQLSKGGKYLLATTDETKSLVLLDPTTLEVI
FT                   KKVQYPKRPSAVATDKEDLNIVLGDKFGDVYGESVEDLLKVEGELKDEPVLGHVSMLTA
FT                   LELGYDSKDRPYVISADRDEHIRISRFPASHVIEQFCFGHQQFVSSLLINDLDASILFS
FT                   AGGDDEIFVWDWLNGKQLQKLSLREHVESYLNEAHIYVDKKGVATTHKEITVSSLQQIK
FT                   DTPYLLVNVESTNAIIVLKIVDNKLEVASVFATEAHVISFSVAGNLLVTSEVGSEGVKA
FT                   YTITDGVVTKSDKEIPFGSCEYEDDSELISLFSTKSLRKRGEF"
FT   gene            <539630..>542629
FT                   /locus_tag="YALI0_E04807g"
FT                   /old_locus_tag="YALI-IPF3118"
FT                   /old_locus_tag="YALI-CDS0445.1"
FT   CDS_pept        539630..542629
FT                   /locus_tag="YALI0_E04807g"
FT                   /old_locus_tag="YALI-IPF3118"
FT                   /old_locus_tag="YALI-CDS0445.1"
FT                   /product="YALI0E04807p"
FT                   /note="similar to uniprot|P12683 Saccharomyces cerevisiae
FT                   YML075c HMG1 3-hydroxy-3-methylglutaryl-coenzyme A
FT                   reductase 1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04807g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79139"
FT                   /db_xref="GOA:Q6C704"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C704"
FT                   /protein_id="CAG79139.1"
FT                   /translation="MLQAAIGKIVGFAVNRPIHTVVLTSIVASTAYLAILDIAIPGFEG
FT                   TQPISYYHPAAKSYDNPADWTHIAEADIPSDAYRLAFAQIRVSDVQGGEAPTIPGAVAV
FT                   SDLDHRIVMDYKQWAPWTASNEQIASENHIWKHSFKDHVAFSWIKWFRWAYLRLSTLIQ
FT                   GADNFDIAVVALGYLAMHYTFFSLFRSMRKVGSHFWLASMALVSSTFAFLLAVVASSSL
FT                   GYRPSMITMSEGLPFLVVAIGFDRKVNLASEVLTSKSSQLAPMVQVITKIASKALFEYS
FT                   LEVAALFAGAYTGVPRLSQFCFLSAWILIFDYMFLLTFYSAVLAIKFEINHIKRNRMIQ
FT                   DALKEDGVSAAVAEKVADSSPDAKLDRKSDVSLFGASGAIAVFKIFMVLGFLGLNLINL
FT                   TAIPHLGKAAAAAQSVTPITLSPELLHAIPASVPVVVTFVPSVVYEHSQLILQLEDALT
FT                   TFLAACSKTIGDPVISKYIFLCLMVSTALNVYLFGATREVVRTQSVKVVEKHVPIVIEK
FT                   PSEKEEDTSSEDSIELTVGKQPKPVTETRSLDDLEAIMKAGKTKLLEDHEVVKLSLEGK
FT                   LPLYALEKQLGDNTRAVGIRRSIISQQSNTKTLETSKLPYLHYDYDRVFGACCENVIGY
FT                   MPLPVGVAGPMNIDGKNYHIPMATTEGCLVASTMRGCKAINAGGGVTTVLTQDGMTRGP
FT                   CVSFPSLKRAGAAKIWLDSEEGLKSMRKAFNSTSRFARLQSLHSTLAGNLLFIRFRTTT
FT                   GDAMGMNMISKGVEHSLAVMVKEYGFPDMDIVSVSGNYCTDKKPAAINWIEGRGKSVVA
FT                   EATIPAHIVKSVLKSEVDALVELNISKNLIGSAMAGSVGGFNAHAANLVTAIYLATGQD
FT                   PAQNVESSNCITLMSNVDGNLLISVSMPSIEVGTIGGGTILEPQGAMLEMLGVRGPHIE
FT                   TPGANAQQLARIIASGVLAAELSLCSALAAGHLVQSHMTHNRSQAPTPAKQSQADLQRL
FT                   QNGSNICIRS"
FT   gene            <543160..>544224
FT                   /locus_tag="YALI0_E04829g"
FT                   /old_locus_tag="YALI-IPF3113"
FT                   /old_locus_tag="YALI-CDS3746.1"
FT   CDS_pept        543160..544224
FT                   /locus_tag="YALI0_E04829g"
FT                   /old_locus_tag="YALI-IPF3113"
FT                   /old_locus_tag="YALI-CDS3746.1"
FT                   /product="YALI0E04829p"
FT                   /note="similar to uniprot|AAH46753 Mus musculus COP9
FT                   (Constitutive photomorphogenic) subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04829g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79140"
FT                   /db_xref="GOA:Q6C703"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="InterPro:IPR040961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C703"
FT                   /protein_id="CAG79140.1"
FT                   /translation="MASLATFQVENDIVDVDSTPQQGFDRDDLYKYDDVEQKAILAAHP
FT                   WRTDPSYFRNVLVSSIALVKMAMHARSGGAIEVMGMMTGKILPNTFVVMDCYPLPVEGT
FT                   ETRVNAQQEGIEFMVEYLQGLKDVGRRENIVGWYHSHPGYGCWLSGIDVDTQFQNQQFQ
FT                   EPFLAVVVDPNRTISAGKVEIGAFRTYPKDYKPPKKATKQNQDQSVPLSKAKDYGAHSE
FT                   RYYELDVSFFKSSLDENLLQLLWNKNWAATLSQSTIQLNHDYTSKLMLDLSEKNAQLAI
FT                   GLGEKTPQSQGRGFREAMSKADNEPHTNLLNYSTKGQWEAVNRSVKDGVQIGSDELQGL
FT                   MSLEIQRRLFGRAK"
FT   gene            complement(<544606..>545592)
FT                   /locus_tag="YALI0_E04851g"
FT                   /old_locus_tag="YALI-IPF3111"
FT                   /old_locus_tag="YALI-CDS4047.1"
FT   CDS_pept        complement(544606..545592)
FT                   /locus_tag="YALI0_E04851g"
FT                   /old_locus_tag="YALI-IPF3111"
FT                   /old_locus_tag="YALI-CDS4047.1"
FT                   /product="YALI0E04851p"
FT                   /note="similar to uniprot|Q6C6S0 Yarrowia lipolytica
FT                   YALI0E06787g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04851g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C702"
FT                   /protein_id="CAG79141.1"
FT                   /translation="MKFSTSALALVASLALAEQGEQYTDNGRYSLAGIDQSLYQWPQSD
FT                   YVYHMAAQRDNRNIAMRTDGRNLYFGDARDINGSPLREVNVFIDIAGDLNIAGPDASAR
FT                   YVGVDNGRLALSTRRNNNINIQRFGDNRVSWRYNDQQQFQACPVDQYGNAYDISDNQRS
FT                   SDHLHQVYAGRAPCSKPVTVSLNGARQNGLARYQDSQLRIANNQQFRDSRIVQNDGRLM
FT                   LVDNRSHGNLNQFQGQLSYRGQLVDNQGRFIQLGNQASMRFTDRNQVRNGLTGFSYRDN
FT                   RLTYQNQGFIACQVQNGMWELRPTAVEAAAASCVNPQYVEISMEPLN"
FT   gene            complement(<546359..>547603)
FT                   /locus_tag="YALI0_E04873g"
FT                   /old_locus_tag="YALI-IPF3110"
FT                   /old_locus_tag="YALI-CDS3092.1"
FT   CDS_pept        complement(546359..547603)
FT                   /locus_tag="YALI0_E04873g"
FT                   /old_locus_tag="YALI-IPF3110"
FT                   /old_locus_tag="YALI-CDS3092.1"
FT                   /product="YALI0E04873p"
FT                   /note="weakly similar to uniprot|O59762 Schizosaccharomyces
FT                   pombe possible guanine nucleotide- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04873g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79142"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C701"
FT                   /protein_id="CAG79142.1"
FT                   /translation="MLLAQLQALAPTRLSKMIPSLEIPNLVADTGSTYTHSISESLVNE
FT                   DIQLANMFQGMELETRVAGSANRAKTWTGKRSADVFKQTVWTPDGSSLITNNEDHALRL
FT                   FVVPPDLLSNKEKQPHNLYPYTRTFFSSPIVSFSVFPGFQLADYSSCFAVVSQRGMPIQ
FT                   ITNVLGGSQSVGCYKWTDMSNEQFLTPSSVAFRPGSDYLFAGSERRLALFNVNNVGSEP
FT                   EYQWDMPSFGLVSHISHASKQVAVSSFSGSLALYDFDTMGEVAKTSSAPTAQGICQTLW
FT                   SPNENYLHLICRGAIEIPVLDVRMGLRHVATLGGWDGKTSQRLWADKTITGRGLVAGTV
FT                   DGHVNTWEDIDMGIDRLCESSWKAHSSPVSAVASNPLTGIGVVATSSGERAGEEDRPVD
FT                   CSLKLWEFPNEEESQ"
FT   gene            complement(<547660..>547748)
FT                   /locus_tag="YALI0_E04895r"
FT   tRNA            complement(join(547660..547696,547712..547748))
FT                   /locus_tag="YALI0_E04895r"
FT                   /product="transfer RNA Arg (TCG) cove"
FT   gene            complement(<548325..>549746)
FT                   /locus_tag="YALI0_E04939g"
FT                   /old_locus_tag="YALI-IPF3108"
FT                   /old_locus_tag="YALI-CDS2563.1"
FT   CDS_pept        complement(548325..549746)
FT                   /locus_tag="YALI0_E04939g"
FT                   /old_locus_tag="YALI-IPF3108"
FT                   /old_locus_tag="YALI-CDS2563.1"
FT                   /product="YALI0E04939p"
FT                   /note="similar to uniprot|P25345 Saccharomyces cerevisiae
FT                   YCR024c asn-tRNA synthetase mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04939g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79143"
FT                   /db_xref="GOA:Q6C700"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C700"
FT                   /protein_id="CAG79143.1"
FT                   /translation="MTQRVFESSTVRSITTLPQTINQIKTENKHILGTQDASPVTINGW
FT                   IKSVQKLKNVAFLNISDGNCAQGVMAVLQPDQVTSDLTTGACVSVKGNLVSSQGKKQGL
FT                   ELQAESVKVTGTVDEYPIQKKFHKQEFLRTLPALRWRTSVNSSTLRYRSFCMAQMTNFF
FT                   AENDFVQTNPPLLTSSDCEGAGEVFKVAGGGKGDKFFGDKPAYLTVSTQLHLEVLAAAV
FT                   GRVWTFTPAFRAENSDTNRHLSEFWMAEAEISFIDDLEPLMDLAEGMVKSCLAPLMEEG
FT                   NKARNDLLDARRSAEQKEELLDRWDMANCDFPRLTYKQAIKILNLQHLKEPFAHRPDYE
FT                   VGLRSEHEKWLATEYFISPVFVTDYPKEQKPFYMKQSPHDSQTVACFDLLMPHIGEVIG
FT                   GSVREDNYDTLLKNIETTGMDKSALEWYLELRKQGSTPHGGFGMGFERLISYATGIENI
FT                   RDVTAFPRWVDNCSC"
FT   gene            <551854..>552552
FT                   /locus_tag="YALI0_E04961g"
FT                   /old_locus_tag="YALI-IPF3107"
FT                   /old_locus_tag="YALI-CDS5089.1"
FT   CDS_pept        551854..552552
FT                   /locus_tag="YALI0_E04961g"
FT                   /old_locus_tag="YALI-IPF3107"
FT                   /old_locus_tag="YALI-CDS5089.1"
FT                   /product="YALI0E04961p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04961g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79144"
FT                   /db_xref="GOA:Q6C6Z9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z9"
FT                   /protein_id="CAG79144.1"
FT                   /translation="MSLEESWIDVDQKVTVKPPARYSARMPNVEALETESSALFYHAPS
FT                   VYIIESDAEEDDEYNCDSRDETTDDRTLLFSRDSRNSPSSRDSTTTTTSIAALQDSLST
FT                   IVSRDMKQARACGSSRSKPPSSVCLDSLRIVPESQLPKMRARGSGTVAPAMSSTDSDSD
FT                   TKMAVKKRRVKRVRTGVSSPSMEVSGAGSPGGTGGFSPAALAAGITIIGLSFSAGYAIG
FT                   RQSLRTASVN"
FT   gene            <553036..>555174
FT                   /locus_tag="YALI0_E04983g"
FT                   /old_locus_tag="YALI-IPF3106"
FT                   /old_locus_tag="YALI-CDS1112.1"
FT   CDS_pept        553036..555174
FT                   /locus_tag="YALI0_E04983g"
FT                   /old_locus_tag="YALI-IPF3106"
FT                   /old_locus_tag="YALI-CDS1112.1"
FT                   /product="YALI0E04983p"
FT                   /note="some similarities with uniprot|CAD62574
FT                   Schizosaccharomyces pombe Anaphase-promoting complex (APC )
FT                   required for cyclin degradation possibly required for
FT                   metaphase-anaphase transition cullin family"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E04983g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79145"
FT                   /db_xref="GOA:Q6C6Z8"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z8"
FT                   /protein_id="CAG79145.1"
FT                   /translation="MQIQAFDSIFGDAFDDSLRIPAETDVQDLNMASLDTIREWMSPDN
FT                   SNADVSDIQASIALIPLIESDLLNWYHEVVRVHFLENVATQLDFSNLDSLEKLESIALR
FT                   LEAARFHYHRPLESLSLSRHLVENFQHYLFALFEITFGGTPYLTALRNYMVSCSLPPTD
FT                   RTINLCKTLYNLGLGPKLEPILSSSLVAGIERHILNVYGDEWTLSCLPTMTVWLKSCLP
FT                   RIEQMFLHPPTLDSLVCVGHRYVARLRTSQLFDITVDYPDSIAAIQDLRQCLESPHQRA
FT                   QVVATFQNACQTRLLHAGANTVDVLSAYIHTTHTFLLLDSKGVLLEKVTRPIKRYLKER
FT                   SDTVTSIVSGLLGNEKSDIKSLAEYLSKPPSTVLEDDLADPHWVPDPPDAPSDFRKGFA
FT                   DIVDDLIMLFDNREVFVREFVGIFADQMLQLRDYNVGEIQLRAELLKRRFGERTLQNLD
FT                   VMVRDIQESKRVDTGVHAESIQGKAVYGTFHASILSKLCWPQLKSEEFLLPSAIESQLS
FT                   LYGTGFSKLKQRRKLKWLRSLGNVDVELELEDRTVALTVAPEMASFIHAFHDTTENSLE
FT                   YVQEKLKMSPEMARRCAAFWVKEGVLQEKSEGVFRVLERKSEAQNVVVADAFEASEAGQ
FT                   SAEDKAIESIRQYWSYIHAMLTNRGSLPVIQMHSFLKMLVPKETPYTATQDELKQFLQA
FT                   MVDEEKLDVVGAKFKLKK"
FT   gene            complement(<555413..>557170)
FT                   /locus_tag="YALI0_E05005g"
FT                   /old_locus_tag="YALI-IPF3104"
FT                   /old_locus_tag="YALI-CDS1687.1"
FT   CDS_pept        complement(555413..557170)
FT                   /locus_tag="YALI0_E05005g"
FT                   /old_locus_tag="YALI-IPF3104"
FT                   /old_locus_tag="YALI-CDS1687.1"
FT                   /product="YALI0E05005p"
FT                   /note="similar to uniprot|P38707 Saccharomyces cerevisiae
FT                   YHR019c DED81 asparaginyl-tRNA-synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05005g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79146"
FT                   /db_xref="GOA:Q6C6Z7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z7"
FT                   /protein_id="CAG79146.1"
FT                   /translation="MSQSSSENFESDSALATITMADLEKKVEQLSVSGPAIYVNDTKGV
FT                   DESSASGAQDSPYKTPAFALYSHPDAQIKVFKAGAEGAEGAYEDISPSALKKAKKGVDG
FT                   LVKKAEKAKQLEASKADREAAEAARLEAAKKITITEDKSLDKPKLIKIRDTTENRGPRV
FT                   KLFGWVHRLRTQKGVAFLVLRDGTGYLQCVLQGDLANAFQTQNLTLESSVAIYGTLKEV
FT                   PEGARAPGGHELVVDFYEIIGLAPSGDDAITNKVQEGADPSYLLDYRYLTVRGETLSAV
FT                   MKVRASFLRSIRRVYDELGMTEITPPCMVQTQVEGGSTLFALDYYGEKAYLTQSSQLYL
FT                   ETVIPSVGDAYCIAESFRAERSHTRRHLSEYTHIEAELGFLDFETFLEHIEEVLCRTVD
FT                   YVLADPVAGPLVQELNPGFKAPERPFMRMPYVDALEWLNEHNIPNEEGNKFTFGDDIAE
FT                   AAERKMTDEIGKPIFLTRFPLEIKSFYMKKCVDDPRVTESVDVLMPNVGEITGGSMRID
FT                   DLDELMAGFKREGIDTAPYDFFIDLRKYGTFPHGGYGLGTERILAWLCDRFTVRECSLY
FT                   PRFTGRCKP"
FT   gene            <559352..>560985
FT                   /locus_tag="YALI0_E05027g"
FT                   /old_locus_tag="YALI-IPF40285"
FT   CDS_pept        join(559352,559433..560985)
FT                   /locus_tag="YALI0_E05027g"
FT                   /old_locus_tag="YALI-IPF40285"
FT                   /product="YALI0E05027p"
FT                   /note="similar to uniprot|P38708 Saccharomyces cerevisiae
FT                   Putative prolyl-tRNA synthetase YHR020W"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05027g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79147"
FT                   /db_xref="GOA:Q6C6Z6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z6"
FT                   /protein_id="CAG79147.1"
FT                   /translation="MPPKAAKAKNDNMLIGITVNKEDDFSGWYQQIVTKGEMLDYYDVS
FT                   GCYIMRPPSYFVWEQIQEWFNIKIKKLGVKNAYFPMFVSSRVLEKEKDHVEGFAPEVAW
FT                   VTKAGSSDLEEPVAIRPTSETVMYPYYAKWVRSHRDLPLKLNQWNSVVRWEFKHPQPFL
FT                   RTREFLWQEGHTAHLTAKEAEDEVMAILDNYEKIYSELLAVPVIKGKKSEKEKFAGALF
FT                   TTTVEGFIPSTGRGIQGATSHCLGQNFSKMFDISVEDPNGGADKLFAWQNSWGLSTRVI
FT                   GVMTMTHSDNKGLVLPPRVAHTQAIIIPCGLTAKLAAEKRAAVMDASAAIEKALSEADV
FT                   RVASDTRDTYSPGWKFSDAELRGIPLRIEVGPRDVEQGKIVAVRRDNGEKIVMDIADLA
FT                   TSVPELLETIQKDLFSKAKETFDKHVIKATTWDDFVKALNAGNLVLAPWSASIETEEWI
FT                   KDNSARTVDPNNEADDKAPSMGAKTLCIPFEQPELAADAVCVTGSGKKADNWCLFGRSY
FT                   "
FT   gene            complement(<561818..>562762)
FT                   /locus_tag="YALI0_E05049g"
FT                   /old_locus_tag="YALI-IPF3101"
FT                   /old_locus_tag="YALI-CDS4211.1"
FT   CDS_pept        complement(561818..562762)
FT                   /locus_tag="YALI0_E05049g"
FT                   /old_locus_tag="YALI-IPF3101"
FT                   /old_locus_tag="YALI-CDS4211.1"
FT                   /product="YALI0E05049p"
FT                   /note="weakly similar to uniprot|P38635 Saccharomyces
FT                   cerevisiae YFR025c HIS2 histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05049g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79148"
FT                   /db_xref="GOA:Q6C6Z5"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z5"
FT                   /protein_id="CAG79148.1"
FT                   /translation="MHSHHSHSGQYVQHAKDSLEECVQAAKDKKFDVFCLTEHMPRSRE
FT                   TDLYPEEIESKTTPVDLAKVFDDYVKHARQLQKDNTSNTEILVGFECESIRAECWDRAV
FT                   ELKKHYGLDLCVGSVHHVNGIPIDFSQGQWCDASDSVSDMIDDQTTPEHALYKKYYEIQ
FT                   WNMLQKLKPEVVAHFDLIRLYSTIREGFGATENYVRENWPDVWDQIIKNIDFIISYGGF
FT                   IEVSSAPLRKGWNTPYPRPDICKAVINRGGRLCLSDDSHGVAQVGLNYKKTLEYLEGLG
FT                   VKDLWFLTKKSGKVEAQKIEIVRAKEAGFWVSC"
FT   gene            complement(<563309..>563668)
FT                   /locus_tag="YALI0_E05071g"
FT                   /old_locus_tag="YALI-IPF11449"
FT                   /old_locus_tag="YALI-CDS5990.1"
FT   CDS_pept        complement(563309..563668)
FT                   /locus_tag="YALI0_E05071g"
FT                   /old_locus_tag="YALI-IPF11449"
FT                   /old_locus_tag="YALI-CDS5990.1"
FT                   /product="YALI0E05071p"
FT                   /note="weakly similar to uniprot|P38877 Saccharomyces
FT                   cerevisiae YHR191c CFT8"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05071g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79149"
FT                   /db_xref="GOA:Q6C6Z4"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z4"
FT                   /protein_id="CAG79149.1"
FT                   /translation="MNVTNIFLDHLRQNDHVESVPQMIQTPSGMAIVEIQGEVVSKAHL
FT                   QEGSRRVGSIEFEEKKATLVIDGKQRMRGSIKKLDKPLGLLKMDPENRHQVDLIEIVTH
FT                   KVSFTDIPEPVGAEE"
FT   gene            <564026..>565414
FT                   /locus_tag="YALI0_E05093g"
FT                   /old_locus_tag="YALI-IPF3100"
FT                   /old_locus_tag="YALI-CDS2678.1"
FT   CDS_pept        564026..565414
FT                   /locus_tag="YALI0_E05093g"
FT                   /old_locus_tag="YALI-IPF3100"
FT                   /old_locus_tag="YALI-CDS2678.1"
FT                   /product="YALI0E05093p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05093g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79150"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z3"
FT                   /protein_id="CAG79150.1"
FT                   /translation="MTSLANLIYAQTLYKYAIDNSVKSVVVLPDIPQPIAEYMATQVPK
FT                   HPLIQPDILSMTGGPSSLTAAHCQKWWRQMISSTKIAEKELALSSLAKLVDGFRHVLYN
FT                   ETVAGLKADEVKFKHLKEMERDKKIKAETERLEKERLEKERLQKEQQEKEQQARREALE
FT                   ASKEQEEASKAQQSMTKSDDEDVEMTDAVEELKENENSSKKEQAEVETTEADVESVKVK
FT                   EEEKDTEVETEKKTVEAEAEAEAEAEAEAEAEEQNYKDEEEQADGAEADVESDAREAEE
FT                   SGSDKETTADVETDRGETEEPDESELDRVTETPEAGATPGSEERTRKRARSTTEDSDSR
FT                   KRSRRNTSAAPSANRKFQNVAGNLLSNISSNKSASFFTHPVNPNSAPNYYELIFSPTDI
FT                   RTIKAQVKDGRISSTSELEREVAKMFANAIMYNPWDSDVNLWAREMQQETDALLTLFRG
FT                   AGGE"
FT   gene            complement(<565649..>565983)
FT                   /locus_tag="YALI0_E05115g"
FT                   /old_locus_tag="YALI-IPF11445"
FT                   /old_locus_tag="YALI-CDS6230.1"
FT   CDS_pept        complement(join(565649..565828,565906..565983))
FT                   /locus_tag="YALI0_E05115g"
FT                   /old_locus_tag="YALI-IPF11445"
FT                   /old_locus_tag="YALI-CDS6230.1"
FT                   /product="YALI0E05115p"
FT                   /note="similar to uniprot|O74700 Saccharomyces cerevisiae
FT                   YEL020wa TIM9 essential subunit of the TIM22-complex for
FT                   mitochondrial protein import"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05115g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79151"
FT                   /db_xref="GOA:Q6C6Z2"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6Z2"
FT                   /protein_id="CAG79151.1"
FT                   /translation="MDQLNNREQQEFQQLVEQKQMKDFMRLYSSLVQRCFTDCVNDFTS
FT                   KALSSREESCLEKCSEKFLKHSERVGQRFQEQNAALMQKR"
FT   gene            complement(<566943..>568560)
FT                   /locus_tag="YALI0_E05137g"
FT                   /old_locus_tag="YALI-IPF40284"
FT   CDS_pept        complement(join(566943..568016,568534..568560))
FT                   /locus_tag="YALI0_E05137g"
FT                   /old_locus_tag="YALI-IPF40284"
FT                   /product="YALI0E05137p"
FT                   /note="similar to uniprot|P28834 Saccharomyces cerevisiae
FT                   YNL037c IDH1 isocitrate dehydrogenase (NAD+) subunit 1
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05137g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79152"
FT                   /db_xref="GOA:Q6C6Z1"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z1"
FT                   /protein_id="CAG79152.2"
FT                   /translation="MLRTAYLAKAASALPKRTLATNARTMFQPKEYGSKYTVTLIPGDG
FT                   IGNEITDAVKTIFKTISVPIDWEVVNVTGVGENHLDGYEEAIRSINRNKVAIKGILHTP
FT                   VEKHGHTSFNVALRRELDIFASLVLIKNIPGVQTRLDGIDMALIRENTEGEYSGLEHSP
FT                   VPGVVESIKVITKRKSERIARFAFDFALKNNRHKVTAIHKANIMKLADGLFRNTCKEVS
FT                   AEYPEIQYGDMIVDNASMQAVSWPQQFDVLVTPNLYGTILSNIGAGLVGGPGLVPGVNL
FT                   GTEHAVFEPGCRHVGLDIKGRGTANPTAMILSSAMLLRHLNLDDFADVISKATYDVLAE
FT                   GQVRTPDLGGNSTTDEFTMAVINKLQ"
FT   gene            complement(<568706..>569257)
FT                   /locus_tag="YALI0_E05159g"
FT                   /old_locus_tag="YALI-IPF3097"
FT                   /old_locus_tag="YALI-CDS5643.1"
FT   CDS_pept        complement(568706..569257)
FT                   /locus_tag="YALI0_E05159g"
FT                   /old_locus_tag="YALI-IPF3097"
FT                   /old_locus_tag="YALI-CDS5643.1"
FT                   /product="YALI0E05159p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05159g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79153"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Z0"
FT                   /protein_id="CAG79153.1"
FT                   /translation="MGTAHTQTSKSKKKSKLDGSKERSQGCKYDETKERGYWSNREYET
FT                   PLDVSIGIVSQFERSGRPPPIISTPLKPPFISPLLGAKRIKASMVGYPDGCCFSDLHGD
FT                   MWEKRVHVNECNNVNFLAEYGAADRVQMEPQEKVFQVVYGLGISNGSPRAQCDVPDTLF
FT                   NAPGAALFFKLVSFEIEVSL"
FT   gene            <569578..>569991
FT                   /locus_tag="YALI0_E05181g"
FT                   /old_locus_tag="YALI-IPF11443"
FT                   /old_locus_tag="YALI-CDS5909.1"
FT   CDS_pept        569578..569991
FT                   /locus_tag="YALI0_E05181g"
FT                   /old_locus_tag="YALI-IPF11443"
FT                   /old_locus_tag="YALI-CDS5909.1"
FT                   /product="YALI0E05181p"
FT                   /note="weakly similar to uniprot|P40491 Saccharomyces
FT                   cerevisiae YIL098c FMC1 Formation of Mitochondrial
FT                   Cytochromes"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05181g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79154"
FT                   /db_xref="GOA:Q6C6Y9"
FT                   /db_xref="InterPro:IPR039196"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y9"
FT                   /protein_id="CAG79154.1"
FT                   /translation="MSKSLNLYRSLYRELSKQYVAAMTVHINGENQRNEAKAKYEAIQK
FT                   KTTPKAIEKLPTPRTSHYNSTALREYFTNGTGEAEQIQHAEDMLLFLENQRVYKDLLAR
FT                   YNPGVDMADQERVRLSARRVGLEVPVGKKDFED"
FT   gene            complement(<570275..>572083)
FT                   /locus_tag="YALI0_E05203g"
FT                   /old_locus_tag="YALI-IPF3096"
FT                   /old_locus_tag="YALI-CDS1601.1"
FT   CDS_pept        complement(570275..572083)
FT                   /locus_tag="YALI0_E05203g"
FT                   /old_locus_tag="YALI-IPF3096"
FT                   /old_locus_tag="YALI-CDS1601.1"
FT                   /product="YALI0E05203p"
FT                   /note="some similarities with uniprot|P08019 Saccharomyces
FT                   cerevisiae YIL099w SGA1 sporulation specific glucan 1 4-
FT                   alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05203g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79155"
FT                   /db_xref="GOA:Q6C6Y8"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y8"
FT                   /protein_id="CAG79155.1"
FT                   /translation="MRKDGHTARGKSQCRTVSAKKYYHNKTRARTHGAEVTVLLFSDKH
FT                   DFLLVQVPTPSLFCYKWLDCAILILTHTHTHTHTHTHTHIPTMLLQAFVSVLALPGSLA
FT                   LPLFDQKPLLLAPYARPNVTLIDAQKFELWLAQQTHHAFESVLDNVGHQGSNNGLPVGV
FT                   VIASPSKTAPDYYYQWTRDAAITMDSVVRRFYDQASQGILNDTLSNIIMGYIETQGMLQ
FT                   HVSNPSGYFDWNRRVVSGLGEPKFETDGSAFTGHWGRPQNDGPALRIKTISHYIQTQVE
FT                   WNETASLDDYVYIYKSMILPDVEYILQYWDQPTFDLWEELEGYHLFTSQVQFNALINVV
FT                   ELARHYSDRETESRCTFTAGSIRQFIKTHFEAGSRLNAQFEPRSFGRSGLDSSIFLAAL
FT                   DSVRWESSIAAGTSLKPYDDLLIATIMPYVHSFDYPINHQRLAEFEESFQDENPGYVAV
FT                   GVGRYAEDVYDGVGTSHGNPWFICTATIAETIFFIAHHLAQQSSDFVLEINSLTKEFYG
FT                   TFVSSDRIARDSEEYQHLLDRLVDLGDSFLDVIREHQANNGDMSEQFNRYDGFMQGAEK
FT                   LTWSYGSFWSAVRARQEVIKGTSGRK"
FT   gene            <573270..>574502
FT                   /locus_tag="YALI0_E05225g"
FT                   /old_locus_tag="YALI-IPF3095"
FT                   /old_locus_tag="YALI-CDS3133.1"
FT   CDS_pept        573270..574502
FT                   /locus_tag="YALI0_E05225g"
FT                   /old_locus_tag="YALI-IPF3095"
FT                   /old_locus_tag="YALI-CDS3133.1"
FT                   /product="YALI0E05225p"
FT                   /note="weakly similar to uniprot|Q01080 Saccharomyces
FT                   cerevisiae YNL248c RPA49 DNA-directed RNA polymerase A (I)
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05225g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79156"
FT                   /db_xref="GOA:Q6C6Y7"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y7"
FT                   /protein_id="CAG79156.1"
FT                   /translation="MASDKKRKASSKRLTKIKVAKVQDDGKVFLSDCGHLSIPKDAKFS
FT                   SVSDNGETSIKGKSSRMRYTSVPVDHEKYCVAVISSKGLADLVPAESIELKAMSKQLAK
FT                   RVAENTEQKSYREQRVNLGNEFGTLKAKKTLASLARNNIDSNELVDFEDDVVEAVATAT
FT                   ANLPTQEQVSMAMDDARPIPKHNLETLDVNEIYPVEGYLTDEEAGYIRSEAILDEQDIG
FT                   KRVDMLPYRTSQMVRDSLYKITDKTDETMYKTSLLYYLSLLIGFYRDRHVKKREDIKTR
FT                   LNNPPEYLIDQMLYRYTTPLSGGHKSQRYHTYMVNSRNEAMLLCTIIILVLRLNNNVVD
FT                   IPILSQEVGIKPSKLADVCRQVGCAIKNASLTHMDDIGRPRTEASHWKIASLKAPLKLP
FT                   ELAQRRRRAKK"
FT   gene            complement(<574944..>577415)
FT                   /locus_tag="YALI0_E05247g"
FT                   /old_locus_tag="YALI-IPF3094"
FT                   /old_locus_tag="YALI-CDS0779.1"
FT   CDS_pept        complement(574944..577415)
FT                   /locus_tag="YALI0_E05247g"
FT                   /old_locus_tag="YALI-IPF3094"
FT                   /old_locus_tag="YALI-CDS0779.1"
FT                   /product="YALI0E05247p"
FT                   /note="similar to uniprot|P32319 Saccharomyces cerevisiae
FT                   YBL017c PEP1 vacuolar protein sorting/targeting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05247g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79157"
FT                   /db_xref="GOA:Q6C6Y6"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y6"
FT                   /protein_id="CAG79157.1"
FT                   /translation="MRLLTRLLVLVASLALFAQADDDLSTKISSTINEFSGLIVEHYYL
FT                   TNDMTNASPDDAEVVLLRTSKNDLYVTYNQGKTFKQVLKGEDIIAIYPNPHFKNRVYFL
FT                   TPDEKVFFTIDKGESFKSFRTPAPPNQRGLQLMTFDRNNKDAFIWTGSEGCEDELSPRC
FT                   KVVTHYTNNNGGRWTEVGNGAIMCQYVNGLKDQKRNNLMYCLFEYNEGGVKKSRLAYST
FT                   DNFRNQRVTHENVLDFALAEEFLVVAVINDEDETLECQTSVDGESFSVARFPPDFKVPK
FT                   QLAYTVLQSTTHAIFLHVTVNGKANSEYGAILKSNSYGTSFMLSLNEVNRNRVGFVDFE
FT                   KMANLEGVAVSNIVINARQASRGSRKQLKSMITHNDGGQWAYLNPPPADTEGKAYSCSG
FT                   QSLEKCSLNLHGFTERKDYRDTYTSASAVGMMIGVGNVGEYLEGYLDGNTYLTVDGGIT
FT                   WREIKKGAYMWEYGDQGSILVIVDGEEPTNEVFFSLDEGVTWNPYRFSEDLVKVDDIST
FT                   VPNDNSRRFLLTGKSPRSKGEQSTTVHIDFSGLSDRQCKLDESNPDRDDYELWSPRNPT
FT                   QQSNCLFGHETQYYRKLVDSKCYIGRQLIQPHKVVQDCECTREDFECDFNYVRDRDGTC
FT                   KLVKGASPPDHALQCKENPNLVEYYESTGYRRIPLSTCKGGQELDKADAIPCPGKKGEF
FT                   SKKHGGGLGVIGTFFVIIVPIAMACVIGFMIFQHYQSKFGVIRLGDEDSFSSSSSNPVV
FT                   QQALKGLAYVVAGITMIPEALKGVGEFARGIFGHSGSSNRPWSRDYAPVDINEDDELLG
FT                   DDIESDAEEVI"
FT   gene            <578406..>579282
FT                   /locus_tag="YALI0_E05269g"
FT                   /old_locus_tag="YALI-IPF40082"
FT   CDS_pept        join(578406..578537,579133..579282)
FT                   /locus_tag="YALI0_E05269g"
FT                   /old_locus_tag="YALI-IPF40082"
FT                   /product="YALI0E05269p"
FT                   /note="similar to uniprot|P43682 Saccharomyces cerevisiae
FT                   YKL006ca SFT1 SNARE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05269g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79158"
FT                   /db_xref="GOA:Q6C6Y5"
FT                   /db_xref="InterPro:IPR039897"
FT                   /db_xref="InterPro:IPR039899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y5"
FT                   /protein_id="CAG79158.1"
FT                   /translation="MSAYQREEQNNTRLEELASKISSLRSVTNDIHAQASDYSLIDSTT
FT                   DTVGNMMTSVRGSASKLGRSLKAGHPIWRTVGIALAIILLLWFLFKFF"
FT   gene            complement(<579440..>580443)
FT                   /locus_tag="YALI0_E05291g"
FT                   /old_locus_tag="YALI-IPF40283"
FT   CDS_pept        complement(join(579440..580168,580384..580443))
FT                   /locus_tag="YALI0_E05291g"
FT                   /old_locus_tag="YALI-IPF40283"
FT                   /product="YALI0E05291p"
FT                   /note="similar to uniprot|Q9P5K9 Neurospora crassa B23L21.
FT                   200 Probable F-actin capping protein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05291g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79159"
FT                   /db_xref="GOA:Q6C6Y4"
FT                   /db_xref="InterPro:IPR002189"
FT                   /db_xref="InterPro:IPR017865"
FT                   /db_xref="InterPro:IPR037282"
FT                   /db_xref="InterPro:IPR042276"
FT                   /db_xref="InterPro:IPR042489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6Y4"
FT                   /protein_id="CAG79159.2"
FT                   /translation="MSRSNQEALADFVADAPPGELNQVVEAISTVVDGNSSILSKLETD
FT                   VHNKILDQCMVVSLGKSKSLVSKYNQLSKDTFYDSQSGQKFEFDFDTKKATPSGSHGSD
FT                   SPIQGALDKYFSAHFPSEGAAGVFPQDDGSIALVLVDGKYNPANYWNGKWRSVYIFESG
FT                   SLSGTIDVDVHYYEDGNVRLKSSEKVDLGSVSESDIVDAISKAEQQFQEKLNKSFNGLN
FT                   EDSFKALRRQLPVTRSKINWGKSISNYRLGKDINVGGGRE"
FT   gene            complement(<580981..>582282)
FT                   /locus_tag="YALI0_E05313g"
FT                   /old_locus_tag="YALI-IPF3089"
FT                   /old_locus_tag="YALI-CDS2936.1"
FT   CDS_pept        complement(580981..582282)
FT                   /locus_tag="YALI0_E05313g"
FT                   /old_locus_tag="YALI-IPF3089"
FT                   /old_locus_tag="YALI-CDS2936.1"
FT                   /product="YALI0E05313p"
FT                   /note="similar to uniprot|Q08777 Saccharomyces cerevisiae
FT                   YOR306c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05313g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79160"
FT                   /db_xref="GOA:Q6C6Y3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y3"
FT                   /protein_id="CAG79160.1"
FT                   /translation="MSCKSVESQLVVASGSISEKEEPLVQKLPEPDRGRAWIAMVGGAL
FT                   GLYSSFGYINVVGLFEAYYLHHQLDGYSASTVSWITSLQFFILLVGGVFFGRLAEMYGP
FT                   RPVAIVGMLFTVGGIMATSECKTYYQFLLAQGICTSIGNSCVYYASMVACNTWFVKRRA
FT                   TALGVVVGGSSIGGVTLPFVFSQLQPKIGFNDTVRVIGYIMLGVGVICCVCISSRLPPN
FT                   KKLRKNFFNFRQEVIEPYKNKSFAMMTAALFVSYWGLVTTMGYMSTHAISHGMSETVSF
FT                   YLVAIYNGASFLGRILPGIMADKVGTYNMHSVCCVLCGIILLAFWIPSNSNAAFFTFSG
FT                   VFGFISGPYIGLFAALVAEVSEPHEIGRRLGVVTFFCSWAALTAMPIAGATLDEGHTSF
FT                   VGLQVFAGVTMMVGGFMVFAAKMLVPGQTWLSKF"
FT   gene            <584267..>585451
FT                   /locus_tag="YALI0_E05335g"
FT                   /old_locus_tag="YALI-IPF3088"
FT                   /old_locus_tag="YALI-CDS3310.1"
FT   CDS_pept        584267..585451
FT                   /locus_tag="YALI0_E05335g"
FT                   /old_locus_tag="YALI-IPF3088"
FT                   /old_locus_tag="YALI-CDS3310.1"
FT                   /product="YALI0E05335p"
FT                   /note="highly similar to uniprot|P42023 Pneumocystis
FT                   carinii Actin II (Centractin-like protein)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05335g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79161"
FT                   /db_xref="GOA:Q6C6Y2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y2"
FT                   /protein_id="CAG79161.1"
FT                   /translation="MSSFEKVLLNQPVVFDNGSGTIKAGYAGEELPKTFFPACVGRTKH
FT                   TRVMAGSMEGDTFVGNKIQEVRGLLKLKYPMEHGIVTDWDDMERIWHHVYNNELNILSE
FT                   DHPLLLTEAPLNPRSNRDRAAQIFFETFNVPALYVSIQAVLALYASGKTTGLVVDSGDG
FT                   VTHAVPVYEGFSINSAIQRIDIAGRDVTEYLQLLLRKSGTVLQTSAEKEVVRTIKEKLC
FT                   YVAADPKREEKDWVASGGIRDIEQQRPGSAGGSISTVFKLPDGKDIYIGPERFRAPEIM
FT                   FNPEIIGSEYNSLPQIVADAIARTDLDLRAGLYGSMLLSGGNTLMRGMGDRLLTELKGL
FT                   APKDTKIKIYAPPERKYSTWIGGSILAGLSTFKKMWFTVDEWHENPDIIHTKCL"
FT   gene            complement(<585540..>587723)
FT                   /locus_tag="YALI0_E05357g"
FT                   /old_locus_tag="YALI-IPF3087"
FT                   /old_locus_tag="YALI-CDS1053.1"
FT   CDS_pept        complement(585540..587723)
FT                   /locus_tag="YALI0_E05357g"
FT                   /old_locus_tag="YALI-IPF3087"
FT                   /old_locus_tag="YALI-CDS1053.1"
FT                   /product="YALI0E05357p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05357g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y1"
FT                   /protein_id="CAG79162.1"
FT                   /translation="MKTYGRRSRKKNALNVAPVNHLHRKNKFVEDLPDHGEEDSQAVEP
FT                   WDERETPYDDSQPHSDLNDSQIQGESSDHEANDPDGVENLDPESDHESEAETQPADDHF
FT                   LFNTRMPPSTQPRNWTRKRAAMESPLQDRGKKARLVGNLGAPAAPTAPSKTVRFEGPMS
FT                   SSPLVLSSELSRPSPSQAPITPITPADVTHPPSTPDKYIVGVVPSTTPNYSPLTMKFDD
FT                   SVDGGVARRLFETESGNKDKERGVFDDNMGLQYHEKEVTKDAQETHTTRGLNDEPENGS
FT                   QHSNNTGQIVADSQWQDEVLCSDEEEESEDVQVVPSSSQDQEILGGPLFSITSPSSGIA
FT                   FSSMPAPSSASSLHHSLDPEETVDETPSGFRDVSFAKSTQEESQYVPGETQYGPGESLY
FT                   EPEGDSDDFSETQRAGYTQTKDDSCEDDSENEESQKELIPHESSQHGPTSATSTDHIIS
FT                   DSQYCPNDELLEDVDETNEVETNDELHRDGQGYDWCQSQSTTRSQSQRNRPIELSDDEP
FT                   AASMDIYHDAHESLSDTRDEEDLEAQSISDDDEQHELANKMPHGTQQPGNRGVQIIPDS
FT                   DDDESPGYSPFKQPTQPRPQFTLPSASLKRVRLTESQEPQPITESQLLMSGLFMDSAHP
FT                   HHNDDDEDDVVIPVRRQNDSLDEDDYVSDSQDEGDVFPRPSLKREAFAHLPPLPAKPSI
FT                   TSSDMETQAYIGHSITDTLLEPLSDPDSLTQDE"
FT   gene            <588488..>589759
FT                   /locus_tag="YALI0_E05379g"
FT                   /old_locus_tag="YALI-IPF3086"
FT                   /old_locus_tag="YALI-CDS3012.1"
FT   CDS_pept        588488..589759
FT                   /locus_tag="YALI0_E05379g"
FT                   /old_locus_tag="YALI-IPF3086"
FT                   /old_locus_tag="YALI-CDS3012.1"
FT                   /product="YALI0E05379p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05379g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Y0"
FT                   /protein_id="CAG79163.1"
FT                   /translation="MLFPLEIWDIIITYADIDALVRLSGVSSYFLKSCEPYLETASRAC
FT                   FPWAQKSLLGEPDGSEGTWRLSALRIIAMRHLRPDFINPTGTQKNCKDTPLRRFPDFNS
FT                   NDHTSRPFFYDATHTVIKGVPLDDVAKADAPPQANPAPAPSNSALIYPVGGDTLRGNRR
FT                   SLWTSASEPTETEGHFYQVYSDLNGYYLKVYLEVIDKTTFKSRLFQVPIDDDTERPLDA
FT                   VSAHNDRLFVTVAKRRSFLVFYFNPNTAKFYLVLRATGHYGMFTQNRVLADLNTIRVLS
FT                   HEGYFFNYELHGLYTAPDFEPKTIIGFTSNSPKWSHFCYLSHPRSKLKSTRYVAWFADA
FT                   NDFDLRKNRQSLMCVVADLKEYRMWRVPMHCALLVVGLYHNTIGCWLLDKDMLVTPTRG
FT                   RRKLLLEKTVAKWRSDPEEFWVIK"
FT   gene            complement(<589862..>594465)
FT                   /locus_tag="YALI0_E05401g"
FT                   /old_locus_tag="YALI-IPF40282"
FT   CDS_pept        complement(join(589862..594354,594465))
FT                   /locus_tag="YALI0_E05401g"
FT                   /old_locus_tag="YALI-IPF40282"
FT                   /product="YALI0E05401p"
FT                   /note="weakly similar to uniprot|P33202 Saccharomyces
FT                   cerevisiae YKL010c SOS1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05401g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79164"
FT                   /db_xref="GOA:Q6C6X9"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X9"
FT                   /protein_id="CAG79164.1"
FT                   /translation="MPRRDRYCADDMAVDTDDDNRDTEMGDSVILSRNRDTRELEDEIR
FT                   DEDEVLEDDHDGLDDLDDEDDSRPGVSGSGGASGLLRSLAGEMGGMSWHMNFQADRVRE
FT                   LLDNVRQAEDATVMLILLQEISEVLLMSNQDILLYSFPVDNLCSEMAAIMTNPLFEESQ
FT                   DCAIMACRTLYNLWEVSPTVSSNICSAGIAKILADKLTNLTDVDFAEQAMQLLEKLSSD
FT                   HPESPGHAEHLLRQGCLRAALIHLDFFATHVQRSAVNIAANCCKYLSAAMFDQIQEVMP
FT                   ILANTLTSSDQKVVERGSQAVARTIERLGKSCDEEDVSFEAIVSSELVTQLTALLVHGD
FT                   SAAQRTVLQTLAIIARHSDNLAAEIVKADITGVLLRILGNSGSEKLLTALVKAPPQLIE
FT                   ECVKLIFSLLPDAVTVEGFPDGPFRTSRASPTRAAVLKQLPNYNSFCSSTLHLLFELFA
FT                   ATMTVRVKRKIVYSVIRLLAASPSETVVALPEVAVFISSVLNQSEDDSLILGAVDMSIF
FT                   LIENHSAEFGPLFASEGILDQISAIPPPPKSTNKFVALSADSDDDEEDDIVYDFSCNLK
FT                   PLIALYIQRFEGLVESNSVTSNNNGDLVQIASLLDGPNFKQGLDMLQSRLPTLSTFQLT
FT                   HSDVVVSLLQSLTVENGHGDLVERRRQFLETFCSNKGSLESFAVLVDKLLEGLARTERF
FT                   EVLTSGLPDSGNLETTLGKQVRLNLVAERGTDLPKQYRNMFVSIHAIATFKAVDDFFRS
FT                   KVQTSLAFEQRMSSFMRRRFRGSGGAGGGTLEQALSAIAAATGMPLPSGSIVGEESDSG
FT                   EDDEDEDNGGNEDDEDGEEDGNGEVDDNEDDDESLGFSEEEEVGGDDDEEIVEDEVGVV
FT                   NDDSDIEIDETGEAEDGEEEGERANGAGEADDDEGEGASQSYADAAASSGPKWHLTFSI
FT                   NGQEVTHETTVFGALLKACGSPSEIWNTNFTINIEKTKGAPPVVDEPKFESEDIVPYLQ
FT                   SPESFSDSPRAATIMQLLSALYNVNLWSGEIAGSVYNLNPSHFLSSKLTAKFNKQLEEP
FT                   LIVASLCLPAWTVDATRLYPFLFPFDVRHRYLESTSFGYSRSIQKWEEHYRERRSHNGN
FT                   DSSSSSRDRNDRPPIGKLIRQKVRISRKHMFQSAIKVMELYGSSPSVLEVEYFDEVGTG
FT                   LGPTLEFYATVSHQFAHKSLEMWRDDTPTSGAGGSEAFAFSQQGLFPIPLITCSNNEKV
FT                   LHRFKVLGTFVARSMIDSRLIDIHFSTTFFRLACLQLSFSPTSETLLAIDEQLGKSLRQ
FT                   LQRMSPGEIEHLGLDFTLPGFPQAELKPNGSQIPVNGDNVQEYVDLIVDQTVGSGVSQQ
FT                   IEAFKTGFSEVFPFSAVCAFSPAELVLMCGPSVEDWSLDTLSEAVHADHGFDQRSKTFM
FT                   NLLEVMSEFDESQRRQFLSFVTGSPKLPIGGFKALKPGLTVVRKASENGLGPDDYLPSV
FT                   MTCVNYLKCPDFSTKELLRSRLLQAISEGGGAFHLS"
FT   gene            complement(<595511..>598129)
FT                   /locus_tag="YALI0_E05423g"
FT                   /old_locus_tag="YALI-IPF3082"
FT                   /old_locus_tag="YALI-CDS0664.1"
FT   CDS_pept        complement(595511..598129)
FT                   /locus_tag="YALI0_E05423g"
FT                   /old_locus_tag="YALI-IPF3082"
FT                   /old_locus_tag="YALI-CDS0664.1"
FT                   /product="YALI0E05423p"
FT                   /note="some similarities with uniprot|Q8X014 Neurospora
FT                   crassa B23D6.090"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05423g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79165"
FT                   /db_xref="GOA:Q6C6X8"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034028"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X8"
FT                   /protein_id="CAG79165.1"
FT                   /translation="MKLLNIFTIATVASAMSLRRQEPISHVEPADTIFHIDPDLLQPHS
FT                   SFSLSVKVPIPEGGAHYNRLQQRWYVHADPNARRDAESFFKKRSIGHIGEDIAAHGGLE
FT                   GWTRDPTDVFKYLMRNDSSPIEAPSGFEEYKLVLTPSDVDMLDKALSSTPSLLYKGTAY
FT                   RKLNVYDQQTGDVAASYRKVGWARIMVKKVPDEEPQVEGAWMVDDPTGLGVPGTVYHIS
FT                   DQESFRAMANADPDQSKAEMKLMKRALVDKPTSMLVWRESDAYTKDLESPTDYSFVTKE
FT                   MTILSKRQSDIGGGGSSSGLALSSTIGDTSGCPNHKQIALIGAAADCNYMKDFNSTESV
FT                   RANILANMNTISQLYEQSFNISLGLKALVLANSTDCPTTAVDSAPWNYECTATQPNAIS
FT                   DRLSAFSQWRGDRSSDGIAAWTLFTDCAQGSTVGLSWLGVLCGARASQQGNTWVAGTNV
FT                   VAKTSLEWKVWAHELGHIFGAVHDCTSQTCSDGTVDKNDCCPMSTSACNANGQWIMNPA
FT                   SGQQETTFSECTKGNICAGIGRNSLNTSCLIDNTGGIKLLTENECGNGIVEEGEDCDCG
FT                   GEEGCRGNTCCDPKTCKFRTGAVCDDANQACCNQCQFAPSTQECRSSKGPCDPAEFCTG
FT                   NSSSCPPDLTTENGKSCEDPSRPGFGGLQCIAGLCTSRDLQCFTLMQNRTTLVGNTPAN
FT                   VTQACDQGRCSISCRDPNLPNVCFGSQYNFLDGTPCGRGGKCLRGQCSGNTNDYFRSWF
FT                   DDAGGWISRNTGAFVGIIVGVVGGIIVLILIGCFRRWRHRKRAMPVYPVKNNYARRAPP
FT                   PPPPMGGNRGPIGGAGGANMYPPPPPAQYPFKYESRQSQQYPSQDVYPPAAPPPSYSRQ
FT                   W"
FT   gene            complement(<599826..>600176)
FT                   /locus_tag="YALI0_E05445g"
FT                   /old_locus_tag="YALI-IPF20363"
FT   CDS_pept        complement(599826..600176)
FT                   /locus_tag="YALI0_E05445g"
FT                   /old_locus_tag="YALI-IPF20363"
FT                   /product="YALI0E05445p"
FT                   /note="weakly similar to DEHA0E02409g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05445g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79166"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X7"
FT                   /protein_id="CAG79166.1"
FT                   /translation="MNAYPRVAIHFCTGCKWNLRAAWYLQELLSTFGNQLGEVALLPAS
FT                   SGTFVIELVTEEGAKPILLWDRKTNGGFPGEWCQYGDRMARETLVNMYHVVCCSSSWYY
FT                   ATTVQPSQLKCH"
FT   gene            <601988..>602629
FT                   /locus_tag="YALI0_E05467g"
FT                   /old_locus_tag="YALI-IPF3081"
FT                   /old_locus_tag="YALI-CDS5332.1"
FT   CDS_pept        601988..602629
FT                   /locus_tag="YALI0_E05467g"
FT                   /old_locus_tag="YALI-IPF3081"
FT                   /old_locus_tag="YALI-CDS5332.1"
FT                   /product="YALI0E05467p"
FT                   /note="similar to uniprot|Q88LQ9 Pseudomonas putida PP1870
FT                   Thiopurine s-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05467g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79167"
FT                   /db_xref="GOA:Q6C6X6"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6X6"
FT                   /protein_id="CAG79167.1"
FT                   /translation="MKPEFWQDRWNKDQIGWHQKSANPHLVKYWPTLNISQGSTVIVPL
FT                   CGKSLDMRWLEGLGYNVLGVELSEKACKQYFDQMELEPKVSKNASGKFTIYEAGNTQIW
FT                   CGDLFDLDADDVKYVSALYDRASVIALPPDMRERYAAHLGALIPDPQGLIITLDYDQSK
FT                   MNGPPHAVSDAEVQRLFGTNWKLTLLEEVDKKDMFKEEGIEPVERVYKLN"
FT   gene            <603272..>605824
FT                   /locus_tag="YALI0_E05489g"
FT                   /old_locus_tag="YALI-IPF3080"
FT                   /old_locus_tag="YALI-CDS0711.1"
FT   CDS_pept        603272..605824
FT                   /locus_tag="YALI0_E05489g"
FT                   /old_locus_tag="YALI-IPF3080"
FT                   /old_locus_tag="YALI-CDS0711.1"
FT                   /product="YALI0E05489p"
FT                   /note="weakly similar to uniprot|P43556 Saccharomyces
FT                   cerevisiae YFL047w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05489g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79168"
FT                   /db_xref="GOA:Q6C6X5"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X5"
FT                   /protein_id="CAG79168.1"
FT                   /translation="MPSFADSFWSSDYAAGLGVVFDQLDKGCNENDEVLALVNARMEAE
FT                   EAYGNRLKEIPTQFGETKKTGGFFASKNGALDEGASLKKAYEGVLHEMGEEGKAHLTIA
FT                   SNMRDMVHLPFSKWADEHRQRVQYSYKVLRSKVKSYDKEYVEVQRAQKRYFNKCRLYEE
FT                   LKESSGETVTPATSASPASIDRQRSASTASDATTIVSKPSINHHSRAESITVSDPSREL
FT                   SDIGGQVFSSAELGNLMKKALQDIKRADLKVAILGTYENVSSGDQIVSWIQQNVPIPSD
FT                   SSAVAFAERFGQDLVTQGYLRLVGQVGSKFANSSAFSYQWRKKAFIVAGLQDDDDSLEA
FT                   TVDKVRPFVGEYLGETLSSYVSSRGAPTDESPIQRALREVSELDSRYKIQVAKLDDVRC
FT                   TLEESVIDHLKFMERCESDRLKAVKAVFLDFLAAASNSLPALQSSVERLLLFQEAIHPA
FT                   ADLRFLVESFRTGPFTPKVTVYDNYYNSSDSQTTFGLDLELRCRGDRRKVPSIVSTVLN
FT                   HMDDQYPLLDNDEVRLNVWTVSVSLKTTHALRKELNTGKPVDKAILKKYELPVAASILK
FT                   LYLLELPDSLVPHQYYDVVKRLYSAGPGGQPPSPEERIQSLQNTFAQLLVSNIATLDAI
FT                   TTHLARLIRLTNAGDEYILQLSQELSHCFLRPRVESPVTFGDRHAYRLVNDLLVYRDQI
FT                   FPELKRKNSAFRSSNSISKKSTKSESRDSSRGGAVPTFSDSPVRRQSLKNRLEAITKSE
FT                   QDAKESAANAESSSGTESPGKDIPPPLPDKRPLKGKDNEGGAPPVPEKDVKDGKGPKGK
FT                   VGKMYDQENNTGSFSSVSSSAMFNVQLEDGKESIVIDD"
FT   gene            complement(<606470..>607123)
FT                   /locus_tag="YALI0_E05511g"
FT                   /old_locus_tag="YALI-IPF3077"
FT                   /old_locus_tag="YALI-CDS5279.1"
FT   CDS_pept        complement(606470..607123)
FT                   /locus_tag="YALI0_E05511g"
FT                   /old_locus_tag="YALI-IPF3077"
FT                   /old_locus_tag="YALI-CDS5279.1"
FT                   /product="YALI0E05511p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05511g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79169"
FT                   /db_xref="InterPro:IPR020915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X4"
FT                   /protein_id="CAG79169.1"
FT                   /translation="MNTITVASDEYREYASITTRHPYNLILNLILRYLTPNPNPCYYLY
FT                   NQPRPTYNASPLQITQITMPVLKVVAKISDQFPCLTDVLYVQNITGTISSQDPKYPFEA
FT                   VITSGHDVIRTTKSGQTAILDAVLVGHLKDSDKKFLMKYSGHLNFSPELVEVLTGKKTE
FT                   HGPPGNVKSFGTIELDEEAKDDKESWVVGQTMVGNGRFFRDGEDLFVEYLTEFM"
FT   gene            <610610..>611788
FT                   /locus_tag="YALI0_E05533g"
FT                   /old_locus_tag="YALI-IPF3076"
FT                   /old_locus_tag="YALI-CDS3330.1"
FT   CDS_pept        610610..611788
FT                   /locus_tag="YALI0_E05533g"
FT                   /old_locus_tag="YALI-IPF3076"
FT                   /old_locus_tag="YALI-CDS3330.1"
FT                   /product="YALI0E05533p"
FT                   /note="uniprot|P41929 Lysine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05533g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79170"
FT                   /db_xref="GOA:P41929"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41929"
FT                   /protein_id="CAG79170.1"
FT                   /translation="MSLREITSPDEIRDTRSFSHLEWGAFLSIDDYNHREEIVLGHTPM
FT                   CKNRLKSWGLYIEDGTRVAACETLERPALVQCKDGKIKSTSTFSIGAVFTPKEHRGKGY
FT                   ASVMMKQMASGIPFKPTLTDADIIKATGVSDVDQTLRVTPLWSDVGTFYEKFGWIGTTD
FT                   LQYVFEVDGSASQNGVNGTPNGTNGTNGVNGHTNGTNGHSSAVKYLSEEDVYRLADVEA
FT                   SSFASDFEKFPFKGSYKCGIVPDRTVYEWHLARAKFLAKFAKVPEPKVFGAQIGDSWMA
FT                   WHHMYNARELVILRAKLAKAEDLVELIAAAKNHLCKDGFSDQINKIILWEQEREWNHIV
FT                   DGLSYDAIDQAIEKSQGKREHRGSSIPAVMFVEYKLQKDAMEFVDHGKLTWC"
FT   gene            <614925..>617342
FT                   /locus_tag="YALI0_E05555g"
FT                   /old_locus_tag="YALI-IPF3075"
FT                   /old_locus_tag="YALI-CDS0824.1"
FT   CDS_pept        614925..617342
FT                   /locus_tag="YALI0_E05555g"
FT                   /old_locus_tag="YALI-IPF3075"
FT                   /old_locus_tag="YALI-CDS0824.1"
FT                   /product="YALI0E05555p"
FT                   /note="some similarities with uniprot|O74262 Neurospora
FT                   crassa SRE Siderophore regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05555g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79171"
FT                   /db_xref="GOA:Q6C6X2"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X2"
FT                   /protein_id="CAG79171.1"
FT                   /translation="MSSSFAAINRADETARSNESTPSDSTKAPAQAKAPSTQPQPQSQT
FT                   QTPTQTPGSQTPVPHMPPQPHEDTRPAAPTQMAPTTTPMSDVPAHQQVPSQTPSQIPSA
FT                   QVIPPVHPAQPPSEIQTQAHSGRATEDVSQPPQQMEGVATQQTQGDQKHPESFAPAPVA
FT                   AQQAPPAAPVVDAPTSVKKESTSPKGKEIAGPSLSPVASPATSPTATTNAPKRKKKASV
FT                   ITAQVCSNCGTTRTPLWRRAPNGATICNACGLYLKARNISRPTHLEKPPATATIYLPGS
FT                   QSTSPALSAAEVEKRDSCETRDGGCCGGACKPSNMPDDKDMQAACGDVTLGSCPGDGHC
FT                   NGTGGSAACSGCLAYNNRINKAVQLANQRKDDDGTKTEPETPGTPVSGSRSVVVIACQN
FT                   CGTTITPLWRRDDSGSTICNACGLYYRLHGVHRPVRMKKNMIKRRKRVLEKDGGGAAGS
FT                   ASSPGSAASPVPTAAATPTLVAAPPPTQAAVTPSSMGLGVTGAPVAASVSPSAVAASPA
FT                   GTPASLSGTPIGTPVAAAATPAASTPTHPMQQQQQQQQQQQQQQQPQHLQHLQQQQQQQ
FT                   QHPQHMHGAVVPPPGAPGAEHLPPMHYPFPHPPPPPHPHAHPYYYPYYPYPYPYPMQGM
FT                   PPPPMQFPTGPDGKPVSPYGYPAPGSAPMPLAMPPAAGASPIPQAMYAPPAIDFTHSFR
FT                   GNPGTSNPGTSNPGASNAPATPVPRSEANSPASGEKRSASPSYQDSLRKKQSLDLSIHS
FT                   LLNTNSGEESTRQKLKDFLDIQIPDNLTSPAEIREYLKEKQREISERLKDLN"
FT   gene            <620024..>621208
FT                   /locus_tag="YALI0_E05577g"
FT                   /old_locus_tag="YALI-IPF3074"
FT                   /old_locus_tag="YALI-CDS3309.1"
FT   CDS_pept        620024..621208
FT                   /locus_tag="YALI0_E05577g"
FT                   /old_locus_tag="YALI-IPF3074"
FT                   /old_locus_tag="YALI-CDS3309.1"
FT                   /product="YALI0E05577p"
FT                   /note="highly similar to uniprot|Q6C1S5 Yarrowia lipolytica
FT                   YALI0F13761g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05577g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79172"
FT                   /db_xref="GOA:Q6C6X1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X1"
FT                   /protein_id="CAG79172.1"
FT                   /translation="MTKTAVPRKRFLWHPADIDTYYSDDYFSDEERDFKYGRPRPTPMA
FT                   SLLNLNLNEYELIRFYNNESTPLLVAATGKNEDAQGLWMANVTKLASSNNALKEICMAF
FT                   ATMHMGHNRKKSIYILKDGREHPKTAGPLTDLTRVAGYTRLEEEVLEQMFIRLTNAVKA
FT                   HQLQIVNMTLESYESVLLSSVLIYLHAMSMGPFVPLFSFDGGVDLFSLGRTIHDLTFIY
FT                   SDKIEPSNPFNYSFGEDSENDREKLPREEDMWAIIDFVDTDVELSVAEKRRIKRSLTAE
FT                   LNNLIMLFHMDREALSVSHISAWCTFWTPSFFRLLREEHNTYALLFVCYWCGYAHMWHI
FT                   LFWWGDRIQEDLLNLKDHLPERVHHFLEWPLQSCTRFDINYVDLLNGKMRQLYI"
FT   gene            complement(<621769..>623769)
FT                   /locus_tag="YALI0_E05599g"
FT                   /old_locus_tag="YALI-IPF3072"
FT                   /old_locus_tag="YALI-CDS1280.1"
FT   CDS_pept        complement(621769..623769)
FT                   /locus_tag="YALI0_E05599g"
FT                   /old_locus_tag="YALI-IPF3072"
FT                   /old_locus_tag="YALI-CDS1280.1"
FT                   /product="YALI0E05599p"
FT                   /note="similar to uniprot|Q9Y7G7 Neurospora crassa NDH64 64
FT                   kDa mitochondrial NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05599g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79173"
FT                   /db_xref="GOA:Q6C6X0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6X0"
FT                   /protein_id="CAG79173.1"
FT                   /translation="MLRPLTRAGALSSLTRPAAVRTAFRSLHCSRPALQTHTPLSRGKK
FT                   FLKFSLATFGAIGLGATALVVSFLVYDISSYKEIDDCGDIDVHALALSPRRGGPKNLPI
FT                   FDSWLDDTDTPEKAESSSKPRLVVLGSGWGSVALLNALKPGDYNVTLISPSNYFLFTPM
FT                   LPSATVGTLELRSITEPVRRICAAAAAHFVNASANNIDFKERLIECSQRDPVTGDTVNF
FT                   YVPYDKVVVGVGCTTNTHGVKGLQYCHFLKTVDDSKSIRNQLVANLEKAALPSTSIDER
FT                   KRLLSFVVCGGGPTGVEMAAEVYDLMNEDLAKHYPKALRNLVSVHVIQSRSAILNTFDH
FT                   SVSEYAMERFKHDNIDLLINSRVVEVKEDRVLFSQADPKDPSKKIIKEVPFGLCLWSTG
FT                   VDQSPLTKSIVKDIGAPNQTNRRAIETDPQLRILGTPEGQAYAIGDCSTVRTHVLDTAL
FT                   DILKSHVLASRPFSANTQETPEALEKRVHEIKLTVGEVKRLTAVLQKTLPDSSEHFVRI
FT                   DELFQEYDADHSGTLSYSELTKMLKDVDQKITSLPATAQRANQQGVYLGKKLRKIASIG
FT                   AAAYDTPVPYGDIDAAYYKPFKYKHLGNLAYLGNAAVFDFGKHGTFTGGLLGMYIWRSA
FT                   YFSQCVSFRTRALMFQDWLKRGLFGRDFIAP"
FT   gene            <624772..>626286
FT                   /locus_tag="YALI0_E05621g"
FT                   /old_locus_tag="YALI-IPF3070"
FT                   /old_locus_tag="YALI-CDS2321.1"
FT   CDS_pept        624772..626286
FT                   /locus_tag="YALI0_E05621g"
FT                   /old_locus_tag="YALI-IPF3070"
FT                   /old_locus_tag="YALI-CDS2321.1"
FT                   /product="YALI0E05621p"
FT                   /note="similar to uniprot|Q9URW6 Schizosaccharomyces pombe
FT                   SPAPJ696.02 SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05621g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79174"
FT                   /db_xref="GOA:Q6C6W9"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="InterPro:IPR033643"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W9"
FT                   /protein_id="CAG79174.1"
FT                   /translation="MGINNPVPRSLRSECRKAAKILASFVKPNQIFGQDMVIPPHVLQN
FT                   AEGLVILTVLKAGFLFSGRAGSGVIVSRLPDGGWSAPSALVTAGAGVGGQIGAELTDFV
FT                   FILNSRKAVDSFSQTGNITLGGNMSLAAGPLGRNAEAAGSASATNVATIFAYSKTKGLF
FT                   AGVSLEGSVLVERREANRKFYGNNNATAKKILSGYVEPPPDCDALFRVLESRAFRNPND
FT                   FADDDSYFRHDGDSFYDDIPSQFSDGSSVRRGGDSDDEYGGRGGGAAAGRFSSRNRDDD
FT                   RRGGSRRDSSYSFRSGRDRDDDREVESITDRFRKTHFKSSYSDDPSGRRGSTRGNNDDR
FT                   YDRDRDWRDKGSSRGDRGDRGDRGDRGSHYSSRSRDHENGSSRSNRDREYDRDDRYDRD
FT                   DRDRDRGDRYDRYDRDEKVDRYERQKSPREKPFKPAPPPPHAPVAAAEEKAVALYTFDG
FT                   EQPGDLSFRKGDVIAVVKRGVSKDDWWTGRNGATEGIFPANYVELM"
FT   gene            <628082..>628957
FT                   /locus_tag="YALI0_E05643g"
FT                   /old_locus_tag="YALI-IPF3066"
FT                   /old_locus_tag="YALI-CDS4473.1"
FT   CDS_pept        628082..628957
FT                   /locus_tag="YALI0_E05643g"
FT                   /old_locus_tag="YALI-IPF3066"
FT                   /old_locus_tag="YALI-CDS4473.1"
FT                   /product="YALI0E05643p"
FT                   /note="similar to uniprot|Q9WYD3 Thermotoga maritima TM0297
FT                   Oxidoreductase short chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05643g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79175"
FT                   /db_xref="GOA:Q6C6W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W8"
FT                   /protein_id="CAG79175.1"
FT                   /translation="MSNSAKAAVVPPAPTAEDIARANAGSKEEPVFQAKNFLSKFRLDG
FT                   KVAIVTGGARGLGFSMAEGLCSVGLKGIAILDVQQDLGLDAIEKLHKAYGVQAQFYKAD
FT                   VRDEESVNEIIDRVVHDLGSVDVVVNSAGVADLVHAAEYPADKFRRVIDINLNGSFLVT
FT                   QAAARHMIKQGTGGTVVFIASMSGSIVNWPQPQSAYNASKAAVKHLSKSLAAEWAVHNI
FT                   RCNSISPGYMDTALNRAYNTLFEEWKDRTPLGRLGDPDELTGACIYLASDASSYVTGSD
FT                   IIIDGGYTII"
FT   gene            <632880..>634037
FT                   /locus_tag="YALI0_E05665g"
FT                   /old_locus_tag="YALI-IPF3064"
FT                   /old_locus_tag="YALI-CDS3401.1"
FT   CDS_pept        632880..634037
FT                   /locus_tag="YALI0_E05665g"
FT                   /old_locus_tag="YALI-IPF3064"
FT                   /old_locus_tag="YALI-CDS3401.1"
FT                   /product="YALI0E05665p"
FT                   /note="some similarities with uniprot|P43549 Saccharomyces
FT                   cerevisiae YFL054c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05665g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79176"
FT                   /db_xref="GOA:Q6C6W7"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W7"
FT                   /protein_id="CAG79176.1"
FT                   /translation="MLNQPKKPLWPKVRHFLREPFAEFWGCVILIVLGDGSVAQVTLSN
FT                   GEKGDYQSISWGWGLGVMFGVYVSGGISGGHLNPAVTLASCVYRGFPWRKFPGYMLAQT
FT                   LGCMVGAAIIYGNYRSAIDTFEGCKGCRTVSGPKSTAGVFCTYPAPFMTRTGQFFSEIV
FT                   ASAVLQFIIFAINDTKNIPAGPLAPLVLFFLIFAIGACLGWETGYAINFARDFGPRLVT
FT                   AMIGYGSEVWSAGGYYFWVPIVAPFIGCLLGGFLYDFFMYTGDESPINWPWMGFDRFLN
FT                   PHKRIEHDMGTVQQNVEAPMLVEAHPNMGSVQENPLSTGTDEPKVDMDPGFSSDSQTVH
FT                   LGRNMRAADHEHVEQAHTPESATPPQPTGAAQFLEFENLDDSDSS"
FT   gene            complement(<635125..>636192)
FT                   /locus_tag="YALI0_E05687g"
FT                   /old_locus_tag="YALI-IPF3061"
FT                   /old_locus_tag="YALI-CDS3740.1"
FT   CDS_pept        complement(635125..636192)
FT                   /locus_tag="YALI0_E05687g"
FT                   /old_locus_tag="YALI-IPF3061"
FT                   /old_locus_tag="YALI-CDS3740.1"
FT                   /product="YALI0E05687p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05687g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79177"
FT                   /db_xref="GOA:Q6C6W6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W6"
FT                   /protein_id="CAG79177.1"
FT                   /translation="MAKDNQIAIEDESPRSSDELVVEGRGAGKDTNTSAYTDTNDTTTN
FT                   TTSSSNNNNDSALGGLQSSIQAAVDDIQNEDTSAGYGGVNRYEAALIYDRLRKALLPAI
FT                   GINLAMCWIKDFSLSHSMVLFRLHDGRLPDEDMEDGNVTISGFFFLLLLIATSIAPFWT
FT                   TPKISSAKLNAMGVPPQKFVAIILCLACGLNWLEKVFAYHWVIILFFRLFISLLLNEIK
FT                   WSQVYFISGWFPQTEYLRVFIYTQWAAFVITWGYEFFWSFILALGVWPTPVFLLEPCGY
FT                   VAVAWYLYHKVPEFPNQSEFLPADLNDKYVRMIESDPTFQPLDWNHPDSYDFYKIDLKS
FT                   HSKLHYYIYFWLQFL"
FT   gene            <637673..>638791
FT                   /locus_tag="YALI0_E05709g"
FT                   /old_locus_tag="YALI-IPF3059"
FT                   /old_locus_tag="YALI-CDS3549.1"
FT   CDS_pept        637673..638791
FT                   /locus_tag="YALI0_E05709g"
FT                   /old_locus_tag="YALI-IPF3059"
FT                   /old_locus_tag="YALI-CDS3549.1"
FT                   /product="YALI0E05709p"
FT                   /note="weakly similar to DEHA0B16577g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05709g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79178"
FT                   /db_xref="GOA:Q6C6W5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W5"
FT                   /protein_id="CAG79178.1"
FT                   /translation="MKYTALALAATAAALPLNLQQLTLSPTNMIDQVVGLLPNSIKQSV
FT                   SGKKIGDTFDQSGMPPKEEAARVARTLVHRESLTTLVTVNKDNVPEGYVEYYADCGKDG
FT                   NPVMLNVHIGTGFRNIAAGSEATLSVRVGDHPVTENTNPWYPGGIVKSTAGSPRVSLRG
FT                   KFEDIDKDEIEAVESCFLKRHPDAKWWLPGNNVHSTHWVKFNVDSLHMVGGFGDRAFIG
FT                   EIPGDVYREAKLLGHGEGVTLSEEELFAAHHGGMSKEEFVKVHGDVKHHDMKGKHHKGE
FT                   HKGKHHKGQHKGKHHGDMKLTQEQLVKVHAALSDDPEAFIKAHSGDVSISDEKVHKVDA
FT                   NHGKDLTEEQLMKIHAALSDDPEAFKVHHNLL"
FT   gene            <640162..>640851
FT                   /locus_tag="YALI0_E05731g"
FT                   /old_locus_tag="YALI-IPF4524"
FT                   /old_locus_tag="YALI-CDS5122.1"
FT   CDS_pept        640162..640851
FT                   /locus_tag="YALI0_E05731g"
FT                   /old_locus_tag="YALI-IPF4524"
FT                   /old_locus_tag="YALI-CDS5122.1"
FT                   /product="YALI0E05731p"
FT                   /note="weakly similar to DEHA-IPF3451.1 Debaryomyces
FT                   hansenii DEHA0C16368g putative oxydo-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05731g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79179"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W4"
FT                   /protein_id="CAG79179.1"
FT                   /translation="MPSLSEIKQFNSTHTPSVNKAVGVFFGGTSGIGKETAYMFAQKFD
FT                   RPTVFIVGRSEEAGSQIVADLNRLNARATFIKSDLSQMKEVLRVSEIVKNDTSKINLLF
FT                   LSQGILSTAGRTETAEGIDLRMALNYYGRWLAVKELAPLVQKAYNDGDKDNARVVSVLA
FT                   PGNEGPYQENDISYETSSLWPIRTGTSRNSLLRQCCDSPEFTLICPSSMPIQAMLLPES
FT                   PENCPGT"
FT   gene            complement(<641303..>642337)
FT                   /locus_tag="YALI0_E05753g"
FT                   /old_locus_tag="YALI-IPF4523"
FT                   /old_locus_tag="YALI-CDS3850.1"
FT   CDS_pept        complement(641303..642337)
FT                   /locus_tag="YALI0_E05753g"
FT                   /old_locus_tag="YALI-IPF4523"
FT                   /old_locus_tag="YALI-CDS3850.1"
FT                   /product="YALI0E05753p"
FT                   /note="similar to uniprot|P08524 Saccharomyces cerevisiae
FT                   YJL167w ERG20 farnesyl-pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05753g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79180"
FT                   /db_xref="GOA:Q6C6W3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="InterPro:IPR039702"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W3"
FT                   /protein_id="CAG79180.1"
FT                   /translation="MSKAKFESVFPRISEELVQLLRDEGLPQDAVQWFSDSLQYNCVGG
FT                   KLNRGLSVVDTYQLLTGKKELDDEEYYRLALLGWLIELLQAFFLVSDDIMDESKTRRGQ
FT                   PCWYLKPKVGMIAINDAFMLESGIYILLKKHFRQEKYYIDLVELFHDISFKTELGQLVD
FT                   LLTAPEDEVDLNRFSLDKHSFIVRYKTAYYSFYLPVVLAMYVAGITNPKDLQQAMDVLI
FT                   PLGEYFQVQDDYLDNFGDPEFIGKIGTDIQDNKCSWLVNKALQKATPEQRQILEDNYGV
FT                   KDKSKELVIKKLYDDMKIEQDYLDYEEEVVGDIKKKIEQVDESRGFKKEVLNAFLAKIY
FT                   KRQK"
FT   gene            complement(<648096..>650819)
FT                   /locus_tag="YALI0_E05775g"
FT                   /old_locus_tag="YALI-IPF4522"
FT                   /old_locus_tag="YALI-CDS0597.1"
FT   CDS_pept        complement(648096..650819)
FT                   /locus_tag="YALI0_E05775g"
FT                   /old_locus_tag="YALI-IPF4522"
FT                   /old_locus_tag="YALI-CDS0597.1"
FT                   /product="YALI0E05775p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05775g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79181"
FT                   /db_xref="GOA:Q6C6W2"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W2"
FT                   /protein_id="CAG79181.1"
FT                   /translation="MSGFTTFHAMIRLRPLTIPIRIFIRNVSLSSGFRHQKYKRLDYPK
FT                   APTLLRDPPPEVRAVPQTPPETFSVKRQGRNKAGRKQTTEMYTFVSQKDALEFELAPSA
FT                   VLRQTIEKRLASLSQEQRELKAEMETQIARAGGVFAVRKGLVPGIYLHWDKVVRETGKM
FT                   SQSEWKKLETVQEAQEWMGMYHVSPEDVCYDPFASRISFLEHLLSDEAKLEPEKKRWFA
FT                   VKKGRQPGVYSNWEEAADQVIGYSGAVYASFSTDKQACKFLGMSKKEYFEQLKQDPTET
FT                   DKEMIRQKRLADEQLQAYKRERDRIKFSQYAEAKMYIAPPDGGSPNRVKQLLTKCLQIQ
FT                   AEINKMVSLDKMRKFHMQDIFDELDQMTEEEKQECLESLDNSHLVDAYNVFNNPEYWDF
FT                   YREYLLTKENYLGYESTTCSKGRGDTLFKSEFRECGTTKSTTEELAATEVSQWRQKNET
FT                   SVENDTVKLDTSSEGFFSSTQELSERTEDTVDKKLTQRQKRDSKRATLKALDKSISENI
FT                   AAPDDVAIGIKENGTVRNQAKKTTFENWLDGFSEAEKHKPASKITLTGHFKNATPQMRR
FT                   EMLKARHETKMELVARTADPSTTVTLDMLAGLTCNCGEPVFVRNRDSSAAAPLIPRRQL
FT                   YLSTNRYKNLHGDSGWTNHTFKHKQADFDINTTSFRDHHDHKLLRAFETNWRIMFNSLS
FT                   KQLGPIAANHAGRYDDVEANVVYTDGSHNALPSPLLYNAGAAGWGVHFEKGLMPDACGR
FT                   VPGEQTPGRAEILAMVMAIRIISRHMTYRSQKWEIRTDSLWTLRLLEHGWEGLEPTERM
FT                   RSHPNYYLIKRLRALLYENQNISLRFIRSQHMHSGARIADKLAKKGARKKYSETAEQYG
FT                   TDDEDIFIHDPALSAFFPSATVPSNLRSSMWTDNKE"
FT   gene            <654712..>655878
FT                   /locus_tag="YALI0_E05797g"
FT                   /old_locus_tag="YALI-IPF2419"
FT                   /old_locus_tag="YALI-CDS3366.1"
FT   CDS_pept        654712..655878
FT                   /locus_tag="YALI0_E05797g"
FT                   /old_locus_tag="YALI-IPF2419"
FT                   /old_locus_tag="YALI-CDS3366.1"
FT                   /product="YALI0E05797p"
FT                   /note="similar to uniprot|P36049 Saccharomyces cerevisiae
FT                   YKL172w EBP2 required for pre-rRNA processing and ribosomal
FT                   subunit assembly"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05797g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79182"
FT                   /db_xref="GOA:Q6C6W1"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W1"
FT                   /protein_id="CAG79182.1"
FT                   /translation="MGAPKLKDSLKAAKANDKAAKLTAKKGVLPKPKDLAVVAKQQIAH
FT                   EDDGDDEEDEDDEEEDEEDEEDEEDEDKTPVLSRKEARKMKKLAAAAAAAEEDDDEEDD
FT                   DEVPQLYDTTRLDLSESESEIENVENEVEDIPLSDVELDSDNDAIPYQKVTKNNKPALM
FT                   QAKARISLPYAKMTFVDTLVHTSGAIELKDIYDDMEKELAFYKQGLDAAKVARKELLKA
FT                   KVPFTRPLDYFAEMVKSDEHMEKLKQKLIEEATSKKASEEARRQRDLKKFGKKVQHNKL
FT                   QERAKDKKETLEKIKSLKRKRAGQEMTSEEFDIAVEEAAADNHNIEGKNHKRQAKDAKF
FT                   GFGGKKRFRKANTSESSGDLSGFNQKRNNAPVKKRQQSRPGKSRRNRG"
FT   gene            <661034..>666206
FT                   /locus_tag="YALI0_E05819g"
FT                   /old_locus_tag="YALI-IPF40262"
FT   CDS_pept        join(661034..661198,661449..663954,664702..666206)
FT                   /locus_tag="YALI0_E05819g"
FT                   /old_locus_tag="YALI-IPF40262"
FT                   /product="YALI0E05819p"
FT                   /note="weakly similar to uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1 extracellular alpha-1 4-glucan
FT                   glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05819g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79183"
FT                   /db_xref="GOA:Q6C6W0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6W0"
FT                   /protein_id="CAG79183.1"
FT                   /translation="MKFSIVLPLAGALLAAAGPIQQHPMEGCVPRSVFDLDGCLDTCND
FT                   FLVSDSDPEQCLQCLTVYELDNKNTVLSTLEEQGLPMQPEVPVCGVSAPMITPGPAIPV
FT                   LAKRAPISTVTSCSAPPSDQQTCFNQCAAVIRDIALCLGIQSCICDRISKTLDNINNCL
FT                   DCVTHFTALNNILDIPNQIVKFLAGCSQPTTAEPVCVTSVIDPDVTCEPPQVSTTCTAP
FT                   PKPNLSFLQCTQTCTSIITNVGLCLGVKDCVCSRLIGLTSSIATCLSCITIFDLSAIPN
FT                   LATGLLNWLGNCGLDAGQTLQCDTSTTPGACQTIAPPSSSTVEATTTSAESSSSEAPSS
FT                   SAAPSSSASSEGPSSTEASSSTEAPSSSSEAPSSSSEVPSSSEAPSSSAAESSTEAASS
FT                   TDAASSTEAPASSSEAPSSSAAESSTEASSAPSSSDAVSSTEAPSSSDNSAASSTTDGS
FT                   GASSTDTGASSTDTGASSTDAGASSTDAGASSTDAGASSTDAGASSTDAGASSTDAGAS
FT                   STDAGASSTDAGASSTETGASTTDNSGASSTTDNSGASSTTDNSGASSTASNTDGSGSS
FT                   TDGSGSSTTDNSGQSSVPSSVTAPPSSATGPVATTITSCSSITYPKETCIQKCSDVISQ
FT                   IALCVGVKQCICDRLLTLNDNVNACLSCVTYIDFTGIFDIPGQLLQFLGQCDVATTPTE
FT                   VCTTQTIDPNVSCEPDVTSSTCSVVNPFDLTLSQCMTTCTGVISSVGLCVGLQSCICDR
FT                   LANSAKDVGDCIQCLSLFDLGNIPYLAANFLNWLGKCNVQSTASSNCVYQTITGECVTK
FT                   TPATSEAITTSAEPSSSAGPSPSSSVTDTTPSSTGSGSGESSSAPSSTGGAGESSTTGG
FT                   AGESSTTGGAGESSTTGGAATQTGGNGNNSGSNTATQTGSNTATQTGGNGNNSGSNTAT
FT                   QTGGNGNNSGSNTATQTGGNGNNSGSNTATQTGGNGNNSGSNTATQTGGNGNNSGSNTA
FT                   TQTGGNGNNSGSNTATQTGGNGNSSGSNTATQTGGNGNNSGSNTATQTGGNGNNSGSNT
FT                   ATNSDDNTASPTSSAATTSTTGGNGGNGGDNGGNNGGNGGDNGGNNGGNNGGNGGSDGG
FT                   NNGGNNGGSNGGNNGGNGGSDGGNNGGNNGGSNGGNGGSDGGNNGGNNGGSNGGNGGSA
FT                   GDNGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSEGSGSGSGSGSGSGSEGSGSGSGSGS
FT                   GSGSGSGSGSEGSGSGSGSGSEGSGSGSGSGSEGSGSGSGSGSEGSGSGSGSGSEGSGS
FT                   GSGSGSEGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSEGSGSGSG
FT                   SGSGSGSGSGSEGSGSGSGSEGPSQANSASTFGVSAAMMTIMVMAVLF"
FT   gene            <668333..>669431
FT                   /locus_tag="YALI0_E05841g"
FT                   /old_locus_tag="YALI-IPF40261"
FT   CDS_pept        join(668333..668349,668420..669431)
FT                   /locus_tag="YALI0_E05841g"
FT                   /old_locus_tag="YALI-IPF40261"
FT                   /product="YALI0E05841p"
FT                   /note="weakly similar to uniprot|O93846 Magnaporthe grisea
FT                   PATH531 Pathogenicity protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05841g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79184"
FT                   /db_xref="GOA:Q6C6V9"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V9"
FT                   /protein_id="CAG79184.1"
FT                   /translation="MFHALGSIASVVFPIFASYRAIKSHDMTYATPWLKYWVVMGIEQA
FT                   LENTFGVVLSVLPLYSLARLVFFAWLVLPQSQGAVRLYDEKVEPFLDRYNTQIEDFFAN
FT                   GHTYVRDYGLQYLSVLVKWLTGKGFDTEAAKSTSANPAPATPVVPQSYMDSVMGYIKSN
FT                   SPATGGKITRLFDMYRAAGAVGGAVGSREVTETVEIPSSLPHSEQLGLIDKERSRLLAA
FT                   LSSLDARGSLLKSDTKSKSNASLASGVNITASDYSPLLASSSDTEFDVVKSEDVLGLDG
FT                   NVKDERPNSRGWFWQRHYSKVGEANKAGYEKLVDPPSEPPVSGASMARESEEEEPLIPS
FT                   NL"
FT   gene            complement(<669614..>670483)
FT                   /locus_tag="YALI0_E05863g"
FT                   /old_locus_tag="YALI-IPF2405"
FT                   /old_locus_tag="YALI-CDS4495.1"
FT   CDS_pept        complement(669614..670483)
FT                   /locus_tag="YALI0_E05863g"
FT                   /old_locus_tag="YALI-IPF2405"
FT                   /old_locus_tag="YALI-CDS4495.1"
FT                   /product="YALI0E05863p"
FT                   /note="similar to uniprot|P32787 Saccharomyces cerevisiae
FT                   YJR144w MGM101 mitochondrial genome maintenance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05863g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79185"
FT                   /db_xref="GOA:Q6C6V8"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6V8"
FT                   /protein_id="CAG79185.1"
FT                   /translation="MRPTVALVVARGVRAMGYRTAAAATKPAAASATSAPATPAKKPAA
FT                   SSYWRKAASAASTASVSNATKKTPVAASSPAAEPIEADDMPQVDTSTVDQAPTFQYPEG
FT                   AQSNVFQHMNQREIDWEQSFQGLGSQAFSKEAAQVLQAPLTVEDIEITPDGLLYLPEIK
FT                   YRRVLNAAFGPGGWGLAPRSDTVVTDKIVTREYGLICEGRLVSVARGEQTYFNEDGVPT
FT                   ASEGCKSNAMMRCCKDLGVASELWEPKFIRKFKAQHCEEVWGTHVVNKRKKKLWKLKGE
FT                   TLAYPYQE"
FT   gene            <673001..>673192
FT                   /locus_tag="YALI0_E05885g"
FT                   /old_locus_tag="YALI-IPF20306"
FT   CDS_pept        673001..673192
FT                   /locus_tag="YALI0_E05885g"
FT                   /old_locus_tag="YALI-IPF20306"
FT                   /product="YALI0E05885p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05885g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79186"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V7"
FT                   /protein_id="CAG79186.1"
FT                   /translation="MVYTAIRSPPSAVKKVGAMEGNTKFKIQAAEKGVGLKFFVNHKAD
FT                   FIAQVFPTPSVHMKELEF"
FT   gene            <676394..>677533
FT                   /locus_tag="YALI0_E05907g"
FT                   /old_locus_tag="YALI-IPF2404"
FT                   /old_locus_tag="YALI-CDS3465.1"
FT   CDS_pept        676394..677533
FT                   /locus_tag="YALI0_E05907g"
FT                   /old_locus_tag="YALI-IPF2404"
FT                   /old_locus_tag="YALI-CDS3465.1"
FT                   /product="YALI0E05907p"
FT                   /note="weakly similar to uniprot|Q9P5J4 Neurospora crassa
FT                   B23L21.350"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05907g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79187"
FT                   /db_xref="GOA:Q6C6V6"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V6"
FT                   /protein_id="CAG79187.1"
FT                   /translation="MAEEVIFKKTYVNCPAAYPRNHPTSTMHPDDRLIVQAAIYEPKEL
FT                   TKPLKGSPTLIFHAANGMPREALIPFFEDLYSLLKDNSIQLNGIIAFEAVNQCNSNIIN
FT                   EKFLGDTYEWNDGPRDLLSGLSYLRFGKHPLMMSGPLIGMGHSVGGNIVFSLAEQNPHY
FT                   FCMVLGLEAMLLPDEARIDMRDSYAAQSYKRRDIWPDLETVKNKFAKNPAFKNWDPRAF
FT                   GLYLKYGFRELPTHLYPNERGVTLSTDKHAETHLFVQRSKNPNAEVPFEREEPHEVFND
FT                   LLKIAVPKMFLCAQDSFIGIFEEYYPRIMKPGDEFLMVPGSHLVPYEQPKAIAEAFVPF
FT                   IKKNYFQWVEDREKNIKTVRKRMIDQEFADLITNRDSKL"
FT   gene            <678546..>680771
FT                   /locus_tag="YALI0_E05929g"
FT                   /old_locus_tag="YALI-IPF2403"
FT                   /old_locus_tag="YALI-CDS1004.1"
FT   CDS_pept        678546..680771
FT                   /locus_tag="YALI0_E05929g"
FT                   /old_locus_tag="YALI-IPF2403"
FT                   /old_locus_tag="YALI-CDS1004.1"
FT                   /product="YALI0E05929p"
FT                   /note="similar to uniprot|P46971 Saccharomyces cerevisiae
FT                   YJR143c PMT4 dolichyl-phosphate-mannose--protein O-
FT                   mannosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05929g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79188"
FT                   /db_xref="GOA:Q6C6V5"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V5"
FT                   /protein_id="CAG79188.1"
FT                   /translation="MAELRNRKGGVAAEPAAADSTPKVMVKPKKKSNAKYFQANLVLTL
FT                   LAFLTRFIMLSHPDEVVFDEVHFGKFASYYLQRTYFFDLHPPFAKLLIAAVGWLIGYDG
FT                   SFKFENIGENYITNNVPYVAYRALSASLGSLTVPIIFKTLQYSGYSVAACTIGAAIVCL
FT                   DNAHINDSRLILLDATLNISVALSLFCYVRFSNQRKSPFSLAWWTWLFSTGIALSCTIS
FT                   TKYVGVFTFMAVGGAVVYDLWLLLDYEKSGLSMKDFLWHFGARAYALILVPFVIYLAWF
FT                   QVHFVVLNRSGPGDAFMSPDFQETLGDNFLAQQARDVEFYDIVRFKHKSTGALLHSHDA
FT                   RYPLRYEDGRISSQGQQVTGYSTADPNNAWQILPEKDFPEDQRVGHPVYGSNKVRFRHL
FT                   ATNTYLLTHDVASPYFPTNQEFTTVSPEVAAERYNETIFEVRLNTGKSNNVRTKAAEFK
FT                   LIHDKTKVAMWSHSKLLPEWGFGQFEINGNKNTQDPTNTWTFDEIVGLSPERAAFTPKK
FT                   TRQIPFLQKYLELQGTMFRENNALTASHPYASEPITWPFLIRGVSFWTNAPNRAQIYFH
FT                   GNFVGWYIEDIVIALFVGAIAADQFMRKRQITTFGRRASSKLYHSMGFFFLAWSTHFFP
FT                   FFLMGRQKFLHHYLPAHLCAALLAGAGFDFIFGEFDRLDEEANASKKDLEYTQRKNKPL
FT                   HLATITVLILLTACFLFFCPLTYGLANQSVQAIQWRQWMKFELHFSK"
FT   gene            <681799..>683616
FT                   /locus_tag="YALI0_E05951g"
FT                   /old_locus_tag="YALI-IPF2400"
FT                   /old_locus_tag="YALI-CDS1575.1"
FT   CDS_pept        681799..683616
FT                   /locus_tag="YALI0_E05951g"
FT                   /old_locus_tag="YALI-IPF2400"
FT                   /old_locus_tag="YALI-CDS1575.1"
FT                   /product="YALI0E05951p"
FT                   /note="weakly similar to uniprot|Q9K3W1 Streptomyces
FT                   coelicolor SCO4383 4-coumarate:CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05951g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79189"
FT                   /db_xref="GOA:Q6C6V4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V4"
FT                   /protein_id="CAG79189.1"
FT                   /translation="MSVAPSSNPNPIHHLSRVEDVPLSQTFRGNITDFVRSGGFADDDS
FT                   KPCCIDAKTGQQLTQKQVWDYADKFRALLHHDNNLCPFNANTTDPALGDVMITLVPNHL
FT                   FITSLHFAALDLGATVSPGSAGYTVAELVNQINLTGASLIVYTRPVFKVVREALAQIVV
FT                   PVKIVEFEGLIERAEFVQSHKIQSTKKVTLSPEESYSRIAYLGMSSGTSGGLPKAVRLS
FT                   HFNMASSAELSKRAAPSIAGSEQIAGAIIPVNHVYGLAKFLIAMPKSGATTVFHSKFDL
FT                   IEILEAQQKYKVNMYALVPPIIVVLAKHPAVEKYIPSLREHLRYVSSGAAPLGANVIEA
FT                   CNKRLAGTASGENEFGGLKIVQGYGLTETSPVVSTFDPNDPERHARSCGKLVPNTQARI
FT                   VSEDGVDQPAYELKDLSQLEAELKKGNLPTGELWLRGPQIMDGYHKNDEANAESFVDAT
FT                   DYTSNMPFYMKRWFRTGDVALVDTLGRYMIVDRTKEMIKSMSKQVAPAELEDILLGHPQ
FT                   VADAAVIGVQQVEKGTEAPRAFVVLRDPKFDAVEIKKWMDAQVPKYKQLHGGVVVLDAV
FT                   PKNASGKILRRLLRQRENDVVLGLDKAKL"
FT   gene            <684290..>688129
FT                   /locus_tag="YALI0_E05973g"
FT                   /old_locus_tag="YALI-IPF2399"
FT                   /old_locus_tag="YALI-CDS0191.1"
FT   CDS_pept        684290..688129
FT                   /locus_tag="YALI0_E05973g"
FT                   /old_locus_tag="YALI-IPF2399"
FT                   /old_locus_tag="YALI-CDS0191.1"
FT                   /product="YALI0E05973p"
FT                   /note="similar to uniprot|P12866 Saccharomyces cerevisiae
FT                   YKL209c STE6 ATP-binding cassette transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05973g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79190"
FT                   /db_xref="GOA:Q6C6V3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030246"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V3"
FT                   /protein_id="CAG79190.1"
FT                   /translation="MKNDYKNSIEMESIAGSVSEESIPESSLPPYTEFDKPAEPCSVFK
FT                   FTIKSDLPYIFVGIVCCALEAGVGPLQTVLMGKIFDTLAKHMKGTLENKFMAEIGKYCG
FT                   MSLGLVFLGFCTDFFSNIAFIYYGDRQLLRLSRKIKDTFVKYKSMAWYDHNQGVQGSLN
FT                   VAFRNIEDIQGACCSAIAFAIKDVLTIAISMGVAMYHSWSLTLVIMAGLPIIVLVAMGV
FT                   APRLQRHFRDYKGVITDASVMIDWSMSGLQHVKLSNGEKKQMSILQYQMHLATICYMKF
FT                   TTWSAAQQAFMQVLALIMFVQGFWFGAKQVQIGNLTAGAVMTCFFSAMAVTSHIASITG
FT                   QMMSIMKAMVSAGLVNQLINSAKPSKVDVRQYPEKCDGNIIFNGVTFAYPTRPGVPVLK
FT                   NVKLEFKQGQTTFVVGQSGSGKSTISNLLLQVYDSYDGEIRVDGFETRGVSTRWLYESI
FT                   NVVRQSTALFETSIRENIQLGRGAEWKSATEHDIDKACQFALLSSTICDLPLGLDTKTT
FT                   NLSGGQRQRVALARAYVRNSPVLIMDESLSALDIVFRELMVEAIRKWRKNKTTIVVTHE
FT                   LSQIQSGDYVYLMRDGEVVQSGLRKDIENVGYFKELREQGQTKEADKEAPPVNEIGDFD
FT                   QNMIRNTYIPMKTTRGVRKWVDVKPPPQRDVLDRKRKPVGYFEFSKLVLKTIPNKPLFY
FT                   SGLLLSFLLGAANPAFGWTISQVISQIMPNGESDSSLNKTLVKWSLIVIGIALLQGALA
FT                   FLHTYTLERAANGWAVFLRKSSFKTVVTREMSWFSRAVDSDHDTPDIGPFHFDRNSSGI
FT                   TELIINETEELRSAVTTFFSAVISIFTICVVGFIWSLVQGWKLTLVSFSIFPGFLLTSQ
FT                   LYAYVSSVWEMGLRERIVRVQSLIHECVTGVSEVRILNLENYFEHKYIKLEDAVLKYAK
FT                   MRAFLVSITYASHQMFTPLLQVIILWVGMKLINDGEYTMEKLMGVMVILIQAMTTAAGA
FT                   LETIPQMSKGMNVTKTLFALMDEGRAETSEDGGTECPDLHGEIVFRGVDFSYQSRKEAP
FT                   VLNNFSMKVASQEAVVIVGPSGSGKSTITNLLTKLYPYRRGIVSIGRHDIRDIDTAYLR
FT                   QRLAVVTQSAAFYNGSITSNLTYGCAADPEEIERVCKLVGIHDFIMSLSDGYNTVIGNE
FT                   TGSGTALLSGGQSQRLSIARALLRKPQILILDECTSALDNASAKVVHELILKLKKMRKV
FT                   TMIVITHSHELMKLGDRVLVLGAHGEGVVEQGPYKELISHRGPLYTLVNGGICH"
FT   gene            complement(<688464..>689894)
FT                   /locus_tag="YALI0_E05995g"
FT                   /old_locus_tag="YALI-IPF2396"
FT                   /old_locus_tag="YALI-CDS2534.1"
FT   CDS_pept        complement(688464..689894)
FT                   /locus_tag="YALI0_E05995g"
FT                   /old_locus_tag="YALI-IPF2396"
FT                   /old_locus_tag="YALI-CDS2534.1"
FT                   /product="YALI0E05995p"
FT                   /note="weakly similar to uniprot|Q99156 Yarrowia lipolytica
FT                   LIP1 Lipase 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E05995g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79191"
FT                   /db_xref="GOA:Q6C6V2"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V2"
FT                   /protein_id="CAG79191.1"
FT                   /translation="MTTINSKALNGSFEGVPIGETIQWKNVLYADVKHRFAPPILKTDF
FT                   EGKTIDCTEDGYDCPQLPNKHDMHDGEYKSDELLCTNLRIVKPKGDFKHPLPVYLYIHG
FT                   GANLVGNIYSKRTDPTPFVEHSAAIGKPVIMVVIEYRLGMLGYSTSKDGKGNWGLRDQW
FT                   TSVQWVNKFIGEFGGDSQRVTVGGESSGSIGVHALVLKDGLEHHGVISRAFMSSGSLGC
FT                   FLPLPVAYLDTYRAKAAKELGVEEADLDDPTKVPPYALVTAGFKIEYPFGFYAYDDFLP
FT                   DNLLQAIPKLRTALVSDNDYEGSLFVKRVVPPAEIEPLLNSSETGKKVKDIYSILTGAE
FT                   VCKFRGDSFFVVSNAELLGQLEKGGVDVYRQFFDQVDPFDPSLRARHAVDLVFMWKCLP
FT                   NLPEWAIELANKYQTNLIKFVYDESPWPSDEVALVGNKTIKYGHYNPRKLAEKLLDLDL
FT                   KEIRKLGENLTPAGEWAM"
FT   gene            complement(<693643..>696690)
FT                   /locus_tag="YALI0_E06017g"
FT                   /old_locus_tag="YALI-IPF2394"
FT                   /old_locus_tag="YALI-CDS0417.1"
FT   CDS_pept        complement(693643..696690)
FT                   /locus_tag="YALI0_E06017g"
FT                   /old_locus_tag="YALI-IPF2394"
FT                   /old_locus_tag="YALI-CDS0417.1"
FT                   /product="YALI0E06017p"
FT                   /note="similar to uniprot|P22515 Saccharomyces cerevisiae
FT                   YKL210w UBA1 E1-like (ubiquitin-activating) enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06017g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79192"
FT                   /db_xref="GOA:Q6C6V1"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR032420"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="InterPro:IPR042063"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="InterPro:IPR042449"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V1"
FT                   /protein_id="CAG79192.1"
FT                   /translation="MSDKSDKMQIDNAGEIDESLYSRQLYVLGHEAMKKMANSNVLIVG
FT                   LQGLGIEIAKNIVLAGVKSLTLYDPGKTEVADLSAQFFLREDDVGKRRDQVSQPRLAEL
FT                   NSYVPVHVLEAKDLSEEEVARFQVVVLTNASLEEQIRVNEITHKQNIGFVSTDTRGLFG
FT                   NIFVDFGSSFALIDANGEEPHSGIIAGIDEEGNVAALDETRHNLEDGDYVKFTEVEGLD
FT                   INGDTPRKIKVTGPYSFNIGSVDGLGTYKKGGLFTQVKMPQEISFGSLKEQLAKPELLI
FT                   SDFAKMERPAQLHVGFMAVQAFQQKHGRAPRPQNTEDANEVLHLAKSVTAEYPDVLSGG
FT                   EIDEKLLTQLSFQAAGELPAMTALFGGMAAQEVLKGCSGKFGPIRQWVYFDSLESLPKD
FT                   VALTEQSVAPTGSRYDRQVAVFGKEFTEKIFAVKTFLVGSGAIGCEMLKNWALMGLGKD
FT                   GEIHVTDNDVIEKSNLNRQFLFRPKDVGKHKSVTATEAVAEMNPDLKGHFDAKLDKVGP
FT                   DTENIFDDSFWKSLDFVTNALDNVDARTYVDRRCVFFQKPLLESGTLGTKGNVQVVYPN
FT                   LTESYSSSQDPPEKGIPLCTLRSFPNKVDHTIAWAKSIFQGYFTDNVESVNLFLSQPNF
FT                   VESTLKQTGDQKSILENIKSYLVDERPTTFKECVQWARLEFEKKFNGDISQLLYNFPKD
FT                   ATTSTGAPFWSGPKRAPDALEFDFNNQDHLDFLIAGANLRAFNYGIRGDDLDVSEYKEV
FT                   VDNMTVPKFEPKSGIKIQANENESVDPVDADSEELTQLANSLPPPSSLAGFRLTPVEFE
FT                   KDDDTNFHIQFITAASNCRAQNYAIDGADRHKTKFIAGRIIPAIATTTALVTGLVCLEL
FT                   YKVVDKREVIEDYKNGFVNLALPFLGFSEPIASQKMEIAGVELDKIWGRYDIHENLTLK
FT                   QFLEFFEKNYNLTVTMLSQNVSLLYASFFPPAKLNEKYDLTLTELVEAVTKKKLEPHVK
FT                   TLIFEVCAEDQDGEDVDDIPYVCLHL"
FT   gene            <697089..>697877
FT                   /locus_tag="YALI0_E06039g"
FT                   /old_locus_tag="YALI-IPF2393"
FT                   /old_locus_tag="YALI-CDS4764.1"
FT   CDS_pept        697089..697877
FT                   /locus_tag="YALI0_E06039g"
FT                   /old_locus_tag="YALI-IPF2393"
FT                   /old_locus_tag="YALI-CDS4764.1"
FT                   /product="YALI0E06039p"
FT                   /note="similar to uniprot|P48240 Saccharomyces cerevisiae
FT                   YGR158c MTR3 involved in mRNA transport and DEHA0A13343g
FT                   Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06039g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79193"
FT                   /db_xref="GOA:Q6C6V0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6V0"
FT                   /protein_id="CAG79193.1"
FT                   /translation="MTDRRRVLGPADAVPFTLDNIKPTEVEQKSLDIGSIFVKTGVVEN
FT                   ANGSAYLELDDIKIVAIVHGPRPMRGLFTTSAILNVDTKFLPVSLCDIESKSAVVSSTQ
FT                   LTQYIRSASTTQSSSLQKNVSSYVHTSLLPSILVEKYPKSTIDVSISVLSSSNNTKTTV
FT                   AAAVSCAGAALADSGLECTDIVTAGSVLLDENKATVSPSRAPTSEIDGVVSYMAASKKI
FT                   VGMWIEGGNVSEKQMEEIFDKTEEMAREIRGVMHGVLLEQ"
FT   gene            complement(<698346..>701174)
FT                   /locus_tag="YALI0_E06061g"
FT                   /old_locus_tag="YALI-IPF2392"
FT                   /old_locus_tag="YALI-CDS0536.1"
FT   CDS_pept        complement(698346..701174)
FT                   /locus_tag="YALI0_E06061g"
FT                   /old_locus_tag="YALI-IPF2392"
FT                   /old_locus_tag="YALI-CDS0536.1"
FT                   /product="YALI0E06061p"
FT                   /note="similar to uniprot|O74787 Schizosaccharomyces pombe
FT                   SPBC26H8.03 Phosphatidylethanolamine N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06061g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79194"
FT                   /db_xref="GOA:Q6C6U9"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6U9"
FT                   /protein_id="CAG79194.1"
FT                   /translation="MAVPSAAIKASGVDMGDLKKRHDTKLDVEESVIDEKINENESDEK
FT                   LTEKLTEKLTEKLTEKTSTEPIAYVGKCPDGTTFIVPETEDMLTNLFDPRITKSLTDVI
FT                   IVSILVTFMGLFFVVPKSWRVPLYLFLFAAWRLAYNGGIGWLLHNQSNYHKLTKWALKY
FT                   KVFDKDNKTWWHQLIKREFETRFQNQPNYSFYEVPVEFNTWILFRHVVDLILMSDFTCY
FT                   FMLAWSCALSVRTNQPWWLVIGRWLAGALMLAFNLWAKTDAHRVVKDYAWYWGDFFFLK
FT                   DMELTFDGVFEMAPHPMYSIGYAGFYAASLMACSYTLFLASLAGHAAQFVFLSIVENPH
FT                   IEKTYNPHQPKQRRKASHVRDRSSIQLGLDQKQKDELSAIVEGDESVSIASTPISTTFD
FT                   EPETVQKHSLPPLVVFSNFQITRVTDIMTVGAAVYTMLLYFLPANRLWYTVTFFMALSA
FT                   RLFHTLGLGVILRRQSERRSFTKTFLKFGIYPFEAYEQWQVWYNVSTVLSYTTFGLFCL
FT                   RQWRAPSTDPLWPLKYILGALLIALHGWTSKSIHDSLGHFGWFYGDFFLDRKQNLTYSG
FT                   IYRYLNNPERFFGIAGIWGLALMTNSPGVGILAFLWTLEGMAFIKFVEQPHMQRIYGTS
FT                   IRHDAGVTKTIKNSLKLPSPFEKRVRQFQGSVDKVINDTLTVVEEFIGLAKPTLNEVVN
FT                   DSKILLRQYPAKLTLTRMLDVPENIDTADYSVKLVGGEKCADSNRISYAFGTPIHVKWQ
FT                   ASPNRSAKDWIGLYRVHDNTSPEVTSLPSKGRWSGIDETGHESHLDGIVSSSKTNGEVV
FT                   FRGDTLFWECGVYEFRYHHAGKHTVLSTSEPFEIVAPKIDLSGEVDAKTLALEILPIVQ
FT                   RCFSLSMEFPPEEVDDYWALEEPKVINRVQAAVQAYFNVELAQEVLQSDESVENLAERL
FT                   LRIRDALKGLTV"
FT   gene            <702550..>703767
FT                   /locus_tag="YALI0_E06083g"
FT                   /old_locus_tag="YALI-IPF2389"
FT                   /old_locus_tag="YALI-CDS3183.1"
FT   CDS_pept        702550..703767
FT                   /locus_tag="YALI0_E06083g"
FT                   /old_locus_tag="YALI-IPF2389"
FT                   /old_locus_tag="YALI-CDS3183.1"
FT                   /product="YALI0E06083p"
FT                   /note="similar to uniprot|P53285 Saccharomyces cerevisiae
FT                   YGR141w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06083g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79195"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U8"
FT                   /protein_id="CAG79195.1"
FT                   /translation="MKIAWLLFTAATFVEGVSRHKRDPVWTVNPGQVPDYVLRHCPGVH
FT                   LYSEEKYLPGDPADYVTNFKIDTASGKTVLNGSESDPVTLARLGQYSFEKHSSRTFMTS
FT                   LTDFNADPDWITGEGNIPHLVSGKIDHAKSVLIVVDKGDGLVDAFWFYFYPFNLGPFVM
FT                   GGGPYGNHVGDWEHSLVRFQDGVPQILWMSAHGGGNAYYYNAAEKMDNDPERRVLFSAR
FT                   GTHANYGSVGQHSHDLPFYMLSDFTDRGALWDPVQNYYGYTLTHRERGRTGADRIWFDG
FT                   RVLTSDGQSPHPSWLNYLGRWGDRQLPNSDPRQKWHPFNWRYIDGPRGPMAKNLLRHTV
FT                   CERNKWWNLFRTCRIRRRVETAEGIEAEGYGCVGLMDWLPWWIGWIPWTVTWRGYGCWA
FT                   IDRLWG"
FT   gene            <707313..>708188
FT                   /locus_tag="YALI0_E06105g"
FT                   /old_locus_tag="YALI-IPF2388"
FT                   /old_locus_tag="YALI-CDS4472.1"
FT   CDS_pept        707313..708188
FT                   /locus_tag="YALI0_E06105g"
FT                   /old_locus_tag="YALI-IPF2388"
FT                   /old_locus_tag="YALI-CDS4472.1"
FT                   /product="YALI0E06105p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06105g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79196"
FT                   /db_xref="GOA:Q6C6U7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U7"
FT                   /protein_id="CAG79196.1"
FT                   /translation="MNNNSRIMVPMHSLPSPGQPQGPTSHHMGYQYVETPPSPKSRKSS
FT                   SFNPKYMPPLDSSYRLGYKPLFKRENEDPFKYDISSPTPAQSPYDERKTSAPSVVTSST
FT                   TGYPNYTTEPLPRKRGYSAPQNKAMVSMVHHMQPQQTYHSSSSSSNSSRATIKKARRAY
FT                   RSKFTQEQDRLIISMKNENKTWQEIKEMVKGETPHNIQRRYEVLMAQMNGNLIWEQDDL
FT                   DALVDLLEAAERHKWKHISSELSRKLDKKVTPLACQKKFKEMFGVAENSSLLGSSLCYA
FT                   YYDNGWNCVE"
FT   gene            complement(<709623..>710423)
FT                   /locus_tag="YALI0_E06127g"
FT                   /old_locus_tag="YALI-IPF2387"
FT                   /old_locus_tag="YALI-CDS4721.1"
FT   CDS_pept        complement(709623..710423)
FT                   /locus_tag="YALI0_E06127g"
FT                   /old_locus_tag="YALI-IPF2387"
FT                   /old_locus_tag="YALI-CDS4721.1"
FT                   /product="YALI0E06127p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06127g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U6"
FT                   /protein_id="CAG79197.1"
FT                   /translation="MMHIADSCPDPLQEPLVTSGSPPPHDSPHTTALALDQALKQLRDH
FT                   KEEGGNLKHNQWLHTKDRQRLRMLQQDCVSLQTLLATLSNKLGQKLWARRTANQTSCTA
FT                   PHESPNLQCDSRADKSHNTASHAMQVSADIMKQMRGLNTAKQPSGCKSLPRKRHKSYLH
FT                   DSGDSDLSDDPMELWIDSDSDACFSHSHPHNPKLASVEAAVSDTLSPIRADVPSRRHGS
FT                   PRLGHSSDVYSAPQKSLWNELEQPEWNENVEKPVGLPDSSPVPS"
FT   gene            complement(<711236..>713602)
FT                   /locus_tag="YALI0_E06149g"
FT                   /old_locus_tag="YALI-IPF2386"
FT                   /old_locus_tag="YALI-CDS0867.1"
FT   CDS_pept        complement(711236..713602)
FT                   /locus_tag="YALI0_E06149g"
FT                   /old_locus_tag="YALI-IPF2386"
FT                   /old_locus_tag="YALI-CDS0867.1"
FT                   /product="YALI0E06149p"
FT                   /note="similar to uniprot|P40566 Saccharomyces cerevisiae
FT                   YIR007w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06149g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79198"
FT                   /db_xref="GOA:Q6C6U5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR041036"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U5"
FT                   /protein_id="CAG79198.1"
FT                   /translation="MSLQLLIDETGNFTDPSGKAVILRGINVAADAKLPAKPFTPSQQK
FT                   AGDDFYDTTVSFVGSPFPLEEADEHFARIKAWGFNTIRYIYTWEALEHEGPGVYDEEFI
FT                   DYTIAVLRKIGEHGMFAFMDPHQDVWSRFTGGSGAPLWTLYAAGLDPRHCMTTHSALVQ
FT                   NLWDNPSKFPKMIWSTNYQKLACQVMFTLFFAGNHFAPKCIINGVNVQDYLQGSFLAAK
FT                   RHLAERIAVDQHLVENVVIGWESVNEPNHGLIGYENIHAIPDSQKLRLGPTPTAFECMR
FT                   MGMGETVEVDNYEFGPFGATKNGTVVIEPKGTLAWLKDFSECDKIYGWTRGPEWLPGMC
FT                   IWAQHGVWEPKTGKLLKPTYFNDGHSFHGIGSKIDEEVWVNKYFLGYWLAFLATIRQVN
FT                   KDWLVLMQAPVMQVPPDLVNHPEFNDKRIVYSPHYYDGLTLMNKKWNRLYNVDVVGILR
FT                   GKYPSIVLGLRVGESAIRNCLRDQLRFLRKEGLAKIGNFPCLISEIGIPYDMDDKYAYR
FT                   TGDYSQQIRALDANQYALEGSKLHYTLWVYTASNNHKWGDNWNGEDLSLYSKDDAAKQL
FT                   QKYGGATQTLTNGSADGSQSSEETPPPTYTSYASYYLDSSYLGKTSIGKSIKGRVSSIK
FT                   GAIRRRNKTAAVPLSSHGDAFKPPPEYVLGARAGEAFIRPCPQVISGKLDSYGFDLQKS
FT                   VFTLKIKGAACGENDKCEGKLLPTTIYLPHYHFLQWATGVSTSSGKWEYDENTQILTWW
FT                   HYEGPQQLQVKGNIRFITDYIDTANNLSSSQCRSQ"
FT   gene            <714342..>715124
FT                   /locus_tag="YALI0_E06171g"
FT                   /old_locus_tag="YALI-IPF2385"
FT                   /old_locus_tag="YALI-CDS4791.1"
FT   CDS_pept        714342..715124
FT                   /locus_tag="YALI0_E06171g"
FT                   /old_locus_tag="YALI-IPF2385"
FT                   /old_locus_tag="YALI-CDS4791.1"
FT                   /product="YALI0E06171p"
FT                   /note="some similarities with uniprot|P09880 Saccharomyces
FT                   cerevisiae YJL087c TRL1 tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06171g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79199"
FT                   /db_xref="GOA:Q6C6U4"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U4"
FT                   /protein_id="CAG79199.1"
FT                   /translation="MPKYVIVPVASVGCGKSTVGKTLASVCGFGQVQNDDITGTNRRPK
FT                   FLQAILEQLESHQVVYADRNNSSVKERKELVDGLRKELGNEVDMVGLQFVHNQQTIPAL
FT                   KKITQERVFARKDHQTVSTATLAPQKIYMIMGGFIKRLEPFTDAEKKEYKLIVDLPVEK
FT                   DNTADNVLRLLEKIKDNSATAPMLEDPKYTDQEVRDTVQNLIVSETKSEEVLQKEKEER
FT                   EKNRKRKPADKSKGPRKKQPKLTFNKGAKKDLDKSSGA"
FT   gene            complement(<715763..>717019)
FT                   /locus_tag="YALI0_E06193g"
FT                   /old_locus_tag="YALI-IPF2383"
FT                   /old_locus_tag="YALI-CDS3057.1"
FT   CDS_pept        complement(715763..717019)
FT                   /locus_tag="YALI0_E06193g"
FT                   /old_locus_tag="YALI-IPF2383"
FT                   /old_locus_tag="YALI-CDS3057.1"
FT                   /product="YALI0E06193p"
FT                   /note="similar to uniprot|P24521 Saccharomyces cerevisiae
FT                   YMR220w ERG8 phosphomevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06193g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79200"
FT                   /db_xref="GOA:Q6C6U3"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR016005"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U3"
FT                   /protein_id="CAG79200.1"
FT                   /translation="MTTYSAPGKALLCGGYLVIDPAYSAYVVGLSARIYATVSASEAST
FT                   TSVHVVSPQFDKGEWTYNYTNGQLTAIGHNPFAHAAVNTVLHYVPPRNLHINISIKSDN
FT                   AYHSQIDSTQRGQFAYHKKAIHEVPKTGLGSSAALTTVLVAALLKSYGIDPLHNTHLVH
FT                   NLSQVAHCSAQKKIGSGFDVASAVCGSLVYRRFPAESVNMVIAAEGTSEYGALLRTTVN
FT                   QKWKVTLEPSFLPPGISLLMGDVQGGSETPGMVAKVMAWRKAKPREAEMVWRDLNAANM
FT                   LMVKLFNDLRKLSLTNNEAYEQLLAEAAPLNALKMIMLQNPLGELARCIITIRKHLKKM
FT                   TRETGAAIEPDEQSALLNKCNTYSGVIGGVVPGAGGYDAISLLVISSTVNNVKRESQGV
FT                   QWMELKEENEGLRLEKGFK"
FT   gene            <717233..>718033
FT                   /locus_tag="YALI0_E06215g"
FT                   /old_locus_tag="YALI-IPF2382"
FT                   /old_locus_tag="YALI-CDS4720.1"
FT   CDS_pept        717233..718033
FT                   /locus_tag="YALI0_E06215g"
FT                   /old_locus_tag="YALI-IPF2382"
FT                   /old_locus_tag="YALI-CDS4720.1"
FT                   /product="YALI0E06215p"
FT                   /note="similar to DEHA0G19305g Debaryomyces hansenii and
FT                   uniprot|Q00873 Saccharomyces cerevisiae YKL087c CYT2
FT                   holocytochrome-c1 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06215g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79201"
FT                   /db_xref="GOA:Q6C6U2"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U2"
FT                   /protein_id="CAG79201.1"
FT                   /translation="MSEEKCPVDHESRKVWARKLESSTENAASGTAQPKECPVDHTKMK
FT                   KPEVAQTETKAAAEACPVDHETRDVWVKRQNVASHGLAASVDVEPYGNAALSEPNTGLD
FT                   QQREISTIPRAGSDSNWVYPSQQQFFNAMKRKQWDPQAEDMQSIVPIHNAVNERAWYEI
FT                   QRWEGQMADKCGGPKLVSFQGDSKKLTPKARFNNWFLGYQKPFDRHDWTVDRCGTKIDY
FT                   VIDFYEGKQLPGMIGMPSFYLDVRPKVNSLEGIRMRIANIFGFK"
FT   gene            complement(<718217..>718639)
FT                   /locus_tag="YALI0_E06237g"
FT                   /old_locus_tag="YALI-IPF11432"
FT                   /old_locus_tag="YALI-CDS5896.1"
FT   CDS_pept        complement(718217..718639)
FT                   /locus_tag="YALI0_E06237g"
FT                   /old_locus_tag="YALI-IPF11432"
FT                   /old_locus_tag="YALI-CDS5896.1"
FT                   /product="YALI0E06237p"
FT                   /note="similar to uniprot|P87108 Saccharomyces cerevisiae
FT                   YHR005ca TIM10 subunit of the TIM22-complex"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06237g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79202"
FT                   /db_xref="GOA:Q6C6U1"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR027100"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6U1"
FT                   /protein_id="CAG79202.1"
FT                   /translation="MSFLGLGGQNPNGPSNPQKLLAAEAELDMVTDMFNRLVESCHEKC
FT                   IKADYSSGDLNANEGLCLDRCVAKYFDVNTKVGEVSMRGADGNYGLEDTANTVHAEAWK
FT                   QRILHGPTLNVKYVHRIKVHEIVRLTMVYLAPWHFN"
FT   gene            <718892..>718977
FT                   /locus_tag="YALI0_E06259r"
FT   tRNA            join(718892..718928,718941..718977)
FT                   /locus_tag="YALI0_E06259r"
FT                   /product="transfer RNA Pro (AGG) cove"
FT   gene            <718993..>719082
FT                   /locus_tag="YALI0_E06303r"
FT   tRNA            join(718993..719032,719046..719082)
FT                   /locus_tag="YALI0_E06303r"
FT                   /product="transfer RNA Tyr (GTA) cove"
FT   gene            <719983..>721296
FT                   /locus_tag="YALI0_E06347g"
FT                   /old_locus_tag="YALI-IPF2381"
FT                   /old_locus_tag="YALI-CDS2897.1"
FT   CDS_pept        719983..721296
FT                   /locus_tag="YALI0_E06347g"
FT                   /old_locus_tag="YALI-IPF2381"
FT                   /old_locus_tag="YALI-CDS2897.1"
FT                   /product="YALI0E06347p"
FT                   /note="weakly similar to uniprot|Q7RXP6 Neurospora crassa
FT                   NCU00162.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06347g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79203"
FT                   /db_xref="GOA:Q6C6U0"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6U0"
FT                   /protein_id="CAG79203.1"
FT                   /translation="MKLPSLATIACLVLPVLADYGLSEMYELSLPNSMASDDRFKTHFY
FT                   ASGSAVLTSSGPGGRSQIALTELGRPNQRGAVSGNQPIPSKDFITEVSLAVYGPVLPGG
FT                   GFGIFFTPQPYQSGPVYGMKDKWNGLALILDSVIGNDGEGHLHVHDNTGGDYAAMDASQ
FT                   VEKDALALCKLKYRNTGAPVKITTYYINGKLKVEINGHKCFDERPVALPDSPYFSISAA
FT                   STEGPDTFEVYSLKTYRVDPNGVGGAPTENTPVEQKQEAPQAQQQQQQQQQQQQQQQTQ
FT                   QQPPQQQLQDVATSEHITELAKKLISVEEKLESFTDLKKLSTLSNDLAVLTNRIGVMDQ
FT                   KLREMEVEGKEHVRERTQDTKNYITNHLQEIKSQLHSLTQTFDSQVKNELRSQFTDFSS
FT                   DKKNQIPSLWIPLVVIVGAQSALFFVYLKSRGKYEKLL"
FT   gene            complement(<721618..>723522)
FT                   /locus_tag="YALI0_E06369g"
FT                   /old_locus_tag="YALI-IPF2379"
FT                   /old_locus_tag="YALI-CDS1419.1"
FT   CDS_pept        complement(721618..723522)
FT                   /locus_tag="YALI0_E06369g"
FT                   /old_locus_tag="YALI-IPF2379"
FT                   /old_locus_tag="YALI-CDS1419.1"
FT                   /product="YALI0E06369p"
FT                   /note="some similarities with uniprot|O94522
FT                   Schizosaccharomyces pombe SPCC1281.05 Possible involvement
FT                   in nuclear protein localisation"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06369g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79204"
FT                   /db_xref="GOA:Q6C6T9"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T9"
FT                   /protein_id="CAG79204.1"
FT                   /translation="MALEKTLQLPAMMVLSELTPEGDEFVVSEFDPEGEKKIDLDGRPQ
FT                   GGREFRMNTFKLPGRGSKLFMMATECAKELNFRDSYLLFNKNKSLYKMIASQKDKEALI
FT                   ALGLLPYSFRSRVIGIITARSIYRQFGARAIVDGKRVTDDYWEAAAIEQGFTESDPVIM
FT                   DRRGQITHVYNQEVYGTPNPPNLPKAQKRKEKPPAGPTPVPTQPATRPSLSSTMPRISS
FT                   GGMPGAPNTANTLHPMAGQPPPGASAAASAANSLQTPAHVHPHVYAQLQQSQQMMGGAG
FT                   PVVPAAPAILATDSSNQPINNAAAAAAQVETANLKNLLLSTYMPGTSIRGSLDYQQGNI
FT                   SLASKYNIASIDFFHDYKAPEIEASYSALEYNRYLGGQRKFRKDMWTNFWQIKSAGELP
FT                   SKPNLGVLDANEVYATSQTQMMKRKQESVEQEAVIVNTKKRRGRGGILSTSTAATSLDT
FT                   HSGSSSVAPDEAEPTFQDVSEELTQSQPPPQIRKLPMGVSKDEYLEQMYAQEQRAQAAA
FT                   QGQVTAGGPGQPGVPGMPLGAMQDKSPKSRFKRAMPGPGGMPMVPGQGIPDHLMQQLPL
FT                   DHQLNQQRQIAATGMGGAPMVPQQLRHMAQPGGMPMPPQQFQGQPQVNGGGWRGQNFM"
FT   gene            <724210..>725619
FT                   /locus_tag="YALI0_E06391g"
FT                   /old_locus_tag="YALI-IPF2378"
FT                   /old_locus_tag="YALI-CDS2602.1"
FT   CDS_pept        724210..725619
FT                   /locus_tag="YALI0_E06391g"
FT                   /old_locus_tag="YALI-IPF2378"
FT                   /old_locus_tag="YALI-CDS2602.1"
FT                   /product="YALI0E06391p"
FT                   /note="similar to uniprot|Q12226 Saccharomyces cerevisiae
FT                   YLL063c AYT1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06391g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79205"
FT                   /db_xref="GOA:Q6C6T8"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T8"
FT                   /protein_id="CAG79205.1"
FT                   /translation="MMGRISRFSTDREGFLCSISQPSIFNMPDTVLEIFGQPPLNIYTQ
FT                   ICLCYSMDKARRSEIVHILQSGLVRLTESFPWIAGQVVRDDTSGLFKITTLGKTPRLVV
FT                   KDVTDTALPMEQLKNVQFPFRMMHETDLAPRSTIPGLFSESEHNPVFLLQATYIDGGLL
FT                   LTFLGHHQAIDGTGLAQIVSLLSKACNGEPFTEEEKIMGNMERDNIVPLFSEIERLRYG
FT                   DLYEKLKHQIVPKYTPTTSENPPSCSWRYFIFSGDSLSKLKQLASQNLTTGIPFVSTDD
FT                   SLTAFVWQAVSRARLQRLEKNTKTTIGRAINVRPCLGIRNTYPGMITNMAYSNNTLSEL
FT                   VDAPLGHVASNLRSKLDSEELKQNTRALATLINDNLGTPITSPTATMDMSSDIALSSWA
FT                   QQNFYALDFGLGLGLPESVRRPEFTPVESLMYFLPKTKKGDVALAICLREEDMEALRKD
FT                   GEMMKYATFIE"
FT   gene            <726520..>727767
FT                   /locus_tag="YALI0_E06413g"
FT                   /old_locus_tag="YALI-IPF2377"
FT                   /old_locus_tag="YALI-CDS3079.1"
FT   CDS_pept        726520..727767
FT                   /locus_tag="YALI0_E06413g"
FT                   /old_locus_tag="YALI-IPF2377"
FT                   /old_locus_tag="YALI-CDS3079.1"
FT                   /product="YALI0E06413p"
FT                   /note="weakly similar to uniprot|P36024 Saccharomyces
FT                   cerevisiae YKR072c SIS2 involved in cell cycle-specific
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06413g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79206"
FT                   /db_xref="GOA:Q6C6T7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T7"
FT                   /protein_id="CAG79206.1"
FT                   /translation="MHTFFSQTSNLYQEHLHFSLKRLQAPVTSSITTVTSTTPNQNTPS
FT                   TPPATTQFTNTVTAVSNTTMASTPRDNSASPQSSPKPVLVSRKSIVSFTEPVHPNDRHR
FT                   NSVVSLHHIDHSKVLETNRRVSPTSSNGASGCTTPTIVKGRLETQSLDEILGSLGDTHA
FT                   VASPNFNLHSVTSNPNLPTASPTLGPKTVSSAPVIKPAVSTPATASPTLTDSIFPPKTD
FT                   SSKIHILIAASGSVATIKMPLIVQKLKTVYGDKVEVQAILTTAAQHFFSAEQQNEMIDL
FT                   GVRIWKDKDEWTCWKKSSEKILNAELKKWADVLLIAPLSANTLCKIANGICDNLLTSII
FT                   RAWNPAAPIIVAPAMNTMMYNHPLTQKHLNVINAEMPWIQVLLPVEKKLVCGDTGIGAM
FT                   LEWSQVVDCLVGRLSE"
FT   gene            complement(<730229..>732109)
FT                   /locus_tag="YALI0_E06435g"
FT                   /old_locus_tag="YALI-IPF2374"
FT                   /old_locus_tag="YALI-CDS1465.1"
FT   CDS_pept        complement(730229..732109)
FT                   /locus_tag="YALI0_E06435g"
FT                   /old_locus_tag="YALI-IPF2374"
FT                   /old_locus_tag="YALI-CDS1465.1"
FT                   /product="YALI0E06435p"
FT                   /note="weakly similar to uniprot|P06102 Saccharomyces
FT                   cerevisiae YIL038c NOT3 general negative regulator of
FT                   transcription subunit 3 and DEHA0F04422g Debaryomyces
FT                   hansenii and KLLA0B09196g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06435g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79207"
FT                   /db_xref="GOA:Q6C6T6"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T6"
FT                   /protein_id="CAG79207.1"
FT                   /translation="MAARKLQQEMDRVFKRVAEGVATFDSIYDKVQQSTNQSQKEKLEQ
FT                   DLKREIKKLQRLRDQIKTWMGSNDIKDKKTLTDQRKLIETEMERFKACEREMKTKAFSK
FT                   EGLSPGAGKQLDPREQQRQEACAFVQNTIDELSEQLETLEAEEEQLHGTVRKGRKDNSV
FT                   KSERLSEIADASDRHKWHIGRLEVIARLLENGSLAPQQVMDLQEDIQYYVESNQDVDFA
FT                   EDVEIYDELNLDQEEDEFTIDEQYLRDEPTSTLEDLAVESAKEREREAAKEKEEAAKAA
FT                   QAQKEAAAQAAADAQNSSRRPAATNTPPPIGSNMKPAPLPTRNESLKYASAAAAAAGSS
FT                   VGSSPSALPQGLAPLPAPKEEIRAAAPVPVAVSATPAPWAEGGGPAPGGANVSIPTGPA
FT                   AASTPIAASSTPVAAPAIPTGPAASATIASTSSAGNTTSTAPSPPPLSTSTTLSDDSII
FT                   YTLPPGLQDLVSSLDVAKKRVGTPPPIGSIAKLLETSYFSCPDSGDAEKPQMYHPESPF
FT                   PTLPFYPQDPLAVFEDGGIFAKMDIDTLFYIFYYRQGTYHQYLAAKELKSRSWRFHKRF
FT                   LTWFQRHEEPKMINNEFEQGTYRYFDFEGVWLQRRKSNFQFEYHFLEDEI"
FT   gene            <734132..>738373
FT                   /locus_tag="YALI0_E06457g"
FT                   /old_locus_tag="YALI-IPF2373"
FT                   /old_locus_tag="YALI-CDS0125.1"
FT   CDS_pept        734132..738373
FT                   /locus_tag="YALI0_E06457g"
FT                   /old_locus_tag="YALI-IPF2373"
FT                   /old_locus_tag="YALI-CDS0125.1"
FT                   /product="YALI0E06457p"
FT                   /note="similar to uniprot|P07702 Saccharomyces cerevisiae
FT                   YBR115c LYS2 L-aminoadipate-semialdehyde dehydrogenase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06457g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79208"
FT                   /db_xref="GOA:Q6C6T5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T5"
FT                   /protein_id="CAG79208.1"
FT                   /translation="MYRTNTVTQWATALTNPTLSVLPFDFVRPAEGSVVEAQLTEALSS
FT                   KTVAELDQIAKNSGVAGATDFSAALALYAILVYRLSGDEDVCLGSDDAEGNVFVFRSNL
FT                   NGTSTSLGDLIKSVVEFETWQKDSGVKFADILAEIQTSQKLESEPVLFRTSFQHLQSDT
FT                   ESQSVLGPAAGRLTDVSVYLGKESLSIHYNSLLYKEDRMKLFASQIVELIAQAAVLGPS
FT                   AEVGKLSLLSPQQRDGSLLPLPTSDLDWSGFRGPIHEIFAENAKNHPDRPCCVETASAL
FT                   CPESKERSFTYKQIDEASNVLAHHLVASGIKPGHVVMIYAYRGVDLVVSVMGTLKAGAT
FT                   FSVIDPAYPPARQTIYLRVAQPRALVVIGKAGKIDQLVTDYCDKELQLLTLVPELALTD
FT                   DGALVGGEVEGSDILASSQAKKGEQTGVLVGPDSNPTLSFTSGSEGIPKGVLGRHYSLT
FT                   YYFPWMAETFGLSDKDKFTMLSGIAHDPIQRDIFTPLFLGAQLIIPTSDDIGTPGRLAE
FT                   WMATYETTVTHLTPAMGQLLSAQATAQIPSLHHAFFVGDILTKRDCTRLQKLAQNVFIV
FT                   NMYGTTETQRSVSYFQVASYASDSSFLAQQKDIMPAGKGMKNVQLLVVNRHDRTQTCGV
FT                   GEVGEIYVRAAGLAEGYLLNDALNAEKFVTNWFVTPEHWIQEDEKVNKGEAWREFYKGP
FT                   RDRLYRTGDLGRYLPDGNVECSGRADDQVKIRGFRIELGEIDTHLSRHPLVRENVTLVR
FT                   RDKDEEPVLTSYIVVQNTDAVNEFLDAQEDEEETDQVVQGLFKYRKLIKNIKEFLKTKL
FT                   PSYAIPTVVVPLAKMPLNPNGKVDKPALPFPDTAQLAIVAQKAAAASGDANAAPIEFTE
FT                   TQAAIRDIWLDVLPQQPATISPDDSFFDLGGHSILATRMIFELRKKLMVEIPLGLIFKS
FT                   PSIAGFALEVDKLKKGGEVEFHGENESDEQEQAAVDYYNDAKTLIADAKLVASSYPSHS
FT                   GKLDASAPVKVFLTGGTGFLGSFLLRDLLERSQNIHVFAHVRAKTVEAGLDRLRNSSEA
FT                   YGIWKDEWASRITPIIGDLEKADFGLSKEQFSQLTDEVDVIIHNGALVHWVYPYSTLRG
FT                   PNVLGSINVMNLALTGKAKIFNFVSSTSAVDTEHFNKLSADLVEEGKAGVPESDDLMGS
FT                   SVGLGNGYGQSKWVAEHVIREAGARGLTGTIIRPGYVVGDSKTGATNTDDFLVRMIKGC
FT                   IQLGEIPNIHNSVNMVPVDHVARVVTAASFWPKQPSGVVVAHVTSQPRTRFNEFLQTLQ
FT                   KYGYKVSVEDYVTWRLALEKFVVEDSQDSALYPLLHFVLDDLPQSTKAPELDDSNARSA
FT                   LSRDAEWTGVDLSAGKGVDEAQMGIYLAYLVAVGFLDAPQSKVELALPKVELSEQTLDK
FT                   LKSVGGRGGNK"
FT   gene            complement(<738789..>741216)
FT                   /locus_tag="YALI0_E06479g"
FT                   /old_locus_tag="YALI-IPF40260"
FT   CDS_pept        complement(join(738789..740813,741157..741216))
FT                   /locus_tag="YALI0_E06479g"
FT                   /old_locus_tag="YALI-IPF40260"
FT                   /product="YALI0E06479p"
FT                   /note="similar to uniprot|P23254 Saccharomyces cerevisiae
FT                   YPR074c TKL1 transketolase 1 or uniprot|P33315
FT                   Saccharomyces cerevisiae YBR117c TKL2 transketolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06479g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79209"
FT                   /db_xref="GOA:Q6C6T4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T4"
FT                   /protein_id="CAG79209.1"
FT                   /translation="MAPQFSKTDETAINTIRTLAIDAVAKANSGHPGAPMGLAPVAHVL
FT                   WNYYMNFTSSNPEWINRDRFILSNGHACMLHYSLLHLFGYDITIDDLKNFRQLNSKTPG
FT                   HPEAETPGIEVTTGPLGQGVSNAVGFAIAQAHLGATYNKPGYDIINNYTYCIFGDGCMM
FT                   EGVASEAMSLAGHLQLGNLITFYDDNHISIDGDTNVAFTEDVSQRLEAYGWEVIWVKDG
FT                   NNDLAGMAAAIEQAKKSKDKPTCIRLTTIIGYGSLQQGTHGVHGSPLKPDDIKQFKEKV
FT                   GFNPEETFAVPKETTDLYAKTIDRGANAEKEWNELFAKYGKEYPKEHSEIIRRFKRELP
FT                   EGWEKALPTYTPADNAVASRKLSEIVLTKIHEVLPELVGGSADLTGSNLTRWKDAVDFQ
FT                   PPVTHLGDYSGRYIRYGVREHGMGAIMNGMNAYGGIIPYGGTFLNFVSYAAGAVRLSAL
FT                   SGHHVIWVATHDSIGLGEDGPTHQPIETVAWLRATPNLSVWRPADGNETSAAYYKAITN
FT                   YHTPSVLSLTRQNLPQLEGSSIEKASKGGYQLISEDKGDIYLVSTGSEVAICVAAAKLL
FT                   KEKKGITAGVISLPDWFTFEQQSLEYRKSVFPDGIPMLSVEVYSDFGWSRYSHQQFGLD
FT                   RFGASAPFQQVYDAFEFNAEGVAKRAEATINYYKGQTVKSPIQRAFDPIDVNTRPGHGV
FT                   "
FT   gene            complement(<743613..>746037)
FT                   /locus_tag="YALI0_E06501g"
FT                   /old_locus_tag="YALI-IPF40259"
FT   CDS_pept        complement(join(743613..745486,746022..746037))
FT                   /locus_tag="YALI0_E06501g"
FT                   /old_locus_tag="YALI-IPF40259"
FT                   /product="YALI0E06501p"
FT                   /note="similar to uniprot|P12688 Saccharomyces cerevisiae
FT                   YKL126w YPK1 ser/thr-specific protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06501g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79210"
FT                   /db_xref="GOA:Q6C6T3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T3"
FT                   /protein_id="CAG79210.1"
FT                   /translation="MSTWKKIKEGHLSAFSSRPSSNSTATIKESPTNTKRDTLSLPSVS
FT                   TNAPGGYEKLTPTSSTSSKAPSGEWSRESTHSYTPRDSRDSRDTASSATSTSCATPAAP
FT                   PAPHLSHSFKPGLLTVNIVETKGLSLPPSYAKYASLFAPEKQLVKDSNTMSSARRMTPP
FT                   PVYLVLEFDKTQLVLEATGGTLENPIWKAQSSFDVSRPEPLSINLYAKLSAGLVKPSEM
FT                   EGLGLSSSIGGNGSMSSVNSSSKRSSATPKYIDIFLGSVKLTPNFTPASSFDGYQALSS
FT                   GTGKIHLKLDYKPTRNEPLSMKDFELLKVIGKGSFGKVMQVRKKDTQQIYAIKTIRKAR
FT                   IVSRSEVTHTLAERTVLAQIDNPFIVPLKFSFQNPDKLYLVLAFVNGGELFHHLQNEKV
FT                   FDLNRSRFYTAELLCALECLHEYNVIYRDLKPENILLDYVGHIALCDFGLCKLNMEGQE
FT                   KTNTFCGTPEYLSPEILLGHGYTKTVDWWTLGVLLYEMLTGLPPFYSENTNEMYQRILN
FT                   DPLRFPDDMDREARSILTGLLNRDPKKRLGVNGAAEIKAHPFFNEIDWKRLMAKKYTAP
FT                   FKPSVRSATDTSNFDREFTSEVPSDSVANDYLSESVQKQFGGWTFTEKNEHMH"
FT   gene            <748250..>752784
FT                   /locus_tag="YALI0_E06519g"
FT                   /old_locus_tag="YALI-IPF11431"
FT                   /old_locus_tag="YALI-CDS5775.1"
FT   CDS_pept        join(748250..748752,749619..752784)
FT                   /locus_tag="YALI0_E06519g"
FT                   /old_locus_tag="YALI-IPF11431"
FT                   /old_locus_tag="YALI-CDS5775.1"
FT                   /product="YALI0E06519p"
FT                   /note="weakly similar to uniprot|P34244 Saccharomyces
FT                   cerevisiae YKL101w HSL1 ser/thr protein kinase coupling
FT                   septin ring assembly to cell cycle progression"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06519g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79211"
FT                   /db_xref="GOA:W0TYM1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR031850"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYM1"
FT                   /protein_id="CAG79211.4"
FT                   /translation="MHNPAAVAAASRAYPTDPMVQQIQQQYEAQQNYNYNAQAQNTQNT
FT                   QNTQTQTPGQTTTDPTTKRLSQTSTSSNKKTKTHIGPWRLGRTLGRGSSGRVRLARHSH
FT                   TGQLAAVKIVPKAVVADAVNAANGEEHGATGLPYGIEREVIIMKLIEHANVMALYDVWE
FT                   NKGELYLVLEYIEGGELFDYLIKKGRLEEYEAASYFLQIINGVDYCHRFNICHRDLKPE
FT                   NLLLDKNRNIKIADFGMAALETDRMLETSCGSPHYASPEIVAGKTYHGAPSDIWSCGII
FT                   LFALLTGHLPFDDDNIRRLLLKVQTGKFNMPSELSPYAKDLIWRMLRTDPTTRITMDEI
FT                   FQHPFVRKYSGGVTPTHIHAPSYEHVARPVASVQDIDIEILKNLQILWHGEDAEIIMQK
FT                   LLSPDANPEKTFYCLLMKYRHDHAAAVAATAPPTLQQQQSQEMQPAMHKSHSHSSRKQH
FT                   KRKTSHNSHRLGSRGSLVSVSSAHKRGVSFTHVKKRSQQSIRSMRGSASNSVVASPRKQ
FT                   TASAPVSAGTAPIPFNVNVPYTEAPATAPAAPTTAAATSTATRAPAQPLAPTQAVQSPP
FT                   RQSQPVHQQPPTSRRAPISSAPSWLTRSPPASKDADFEAFLDSAFNKPVKTKKSYGSLL
FT                   GSPVDARRHVTDPANTSIASRTAAGATAANTSKRAVTMAYNDEFEFERPMSLFDPREVG
FT                   GDTGRAQQPSVSRAQTISHTHTHSRERVANAHSDTPNYLPMIFEEGDRFADAIEEEFHL
FT                   NISDNTLSAPSTNHTTPMLGGDRKSSEWENLFDFTERGDQVVVGEDSLLDISFHRDNAN
FT                   EATPVAPAATHVGRESTELYKDLQFPEIPVVDRDETAVESMPRTQSKMKISGQMQTDNF
FT                   MKRPSSINLNGHLSQSNLSRQTTSASQRRPLVSRDMNTHAASPREAAKPVRQLQAAAEL
FT                   HERRPVEVLQKQQPQQQQQHHHQQQQQTQHQLQPAPVFREKPVVSAPRRPAPAPPVQSV
FT                   ADTMVLPMHQQQQNNSQFTIPAPVQTQPPQSKSSRTKSFIRRFGFAPKREAPVAPTSKV
FT                   TMIQSSDYGAAPGVNANAHMNAQKDPAAPAAHAAAHAAHTSGTAPATGDPWNVTQSWFM
FT                   KMFSRPNVAPRQPPQTLYSTLTSQQLEDEIVALLASWRKYGISNLSVSHSSIKCQISSR
FT                   NALKIKSAKLHIDIGPLKHTNSFAHFFHDRGSQGSFTQLYDQIKAHLVSQGLLINN"
FT   gene            complement(<753407..>753898)
FT                   /locus_tag="YALI0_E06545g"
FT                   /old_locus_tag="YALI-IPF20233"
FT   CDS_pept        complement(753407..753898)
FT                   /locus_tag="YALI0_E06545g"
FT                   /old_locus_tag="YALI-IPF20233"
FT                   /product="YALI0E06545p"
FT                   /note="similar to CAGL0C04565g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06545g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79213"
FT                   /db_xref="GOA:Q6C6T1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR036671"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6T1"
FT                   /protein_id="CAG79213.1"
FT                   /translation="MNHYTILGLSEPPHVPELTSADLKTAYKQALLKNHPDKLQEREAY
FT                   TGSVQITAITTAYACLSNSKLKKEYDLSLKNGANGVKSGPGSDVFDLTELEEREDADGM
FT                   FSWYKPCRCGEAGGYVLTEEHLENNEKYYEGVDVQFHEIVVQCGTCSLWITVQYGVEEE
FT                   "
FT   gene            complement(<754245..>756314)
FT                   /locus_tag="YALI0_E06567g"
FT                   /old_locus_tag="YALI-IPF2358"
FT                   /old_locus_tag="YALI-CDS1197.1"
FT   CDS_pept        complement(754245..756314)
FT                   /locus_tag="YALI0_E06567g"
FT                   /old_locus_tag="YALI-IPF2358"
FT                   /old_locus_tag="YALI-CDS1197.1"
FT                   /product="YALI0E06567p"
FT                   /note="similar to uniprot|O74935 Yarrowia lipolytica YlPOX2
FT                   - YALI0F10857g Acyl-CoA oxidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06567g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79214"
FT                   /db_xref="GOA:Q6C6T0"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR029320"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6T0"
FT                   /protein_id="CAG79214.1"
FT                   /translation="MLSQQSLNTFTEPPVEMARERNQTSFNPRLLTYFLDGGEKNTLLM
FT                   DRLMQEYERDPVFRNEGDYDITDVAQSRELAFKRIAKLIEYVHTDDEETYLYRCMLLGQ
FT                   IDMGAFARYAIHHGVWGGAIRGAGTPEQYEFWVKKGSLSVKKFYGSFSMTELGHGSNLV
FT                   GLETTATLDKNADEFVINTPNVAATKWWIGGAADTATHTAVFARLIVDGEDHGVKTFVV
FT                   QLRDVETHNLMPGIAIGDCGKKMGRQGTDNGWIQFTHVRIPRQNMLMRYCHVDSDGNVT
FT                   EPMMAQMAYGALLAGRVGMAMDSYFTSRKFLTIALRYATIRRAFAAGGGQETKLIDYPY
FT                   HQRRLLPLMAQTYAIKCTADKVRDQFVKVTDMLLNLDVSDQEAVPKAIAEAKELFSVSA
FT                   GVKATTTWACAHTIDQCRQACGGHGYSAYNGFGRAYSDWVIQCTWEGDNNILCLSAGRA
FT                   LVQSNRAVRAGKPIGGPTAYLAAPAGSPKLAGRNLYDPKVMIGAWETVSRALINRTTDE
FT                   FEVLAKKGLSTAQAYEELSQQRFLCTRIHTRLYMVKNFYERIAEEGTEFTKEPLTRLAN
FT                   LYAFWSVEEEAGIFLREGYITPQELKYISAEIRKQLLEVRKDVIGYTDAFNVPDFFLNS
FT                   AIGRADGDVYKNYFKVVNTQNPPQDPRPPYYESVIRPFLFRKDEDEEICSLEDE"
FT   gene            complement(<758017..>758493)
FT                   /locus_tag="YALI0_E06589g"
FT                   /old_locus_tag="YALI-IPF11430"
FT                   /old_locus_tag="YALI-CDS5821.1"
FT   CDS_pept        complement(758017..758493)
FT                   /locus_tag="YALI0_E06589g"
FT                   /old_locus_tag="YALI-IPF11430"
FT                   /old_locus_tag="YALI-CDS5821.1"
FT                   /product="YALI0E06589p"
FT                   /note="similar to uniprot|Q6C1D8 Yarrowia lipolytica
FT                   YALI0F17182g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06589g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79215"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S9"
FT                   /protein_id="CAG79215.1"
FT                   /translation="MTRVYTELSINASADTISKILYQFQNYPKWNTFIKEIESELNDYS
FT                   ANPERLVGHDMEVVYTRYNGKKHAPIEVHVLHADKSKLQWEGHFYSNVVMKGIHTMEIE
FT                   VVNDQKCIFKNYEDYSGVAAYGLEWTTFYDDKVHDYARMNMELKKVAESGGAKL"
FT   gene            complement(<759873..>761501)
FT                   /locus_tag="YALI0_E06611g"
FT                   /old_locus_tag="YALI-IPF2356"
FT                   /old_locus_tag="YALI-CDS2012.1"
FT   CDS_pept        complement(759873..761501)
FT                   /locus_tag="YALI0_E06611g"
FT                   /old_locus_tag="YALI-IPF2356"
FT                   /old_locus_tag="YALI-CDS2012.1"
FT                   /product="YALI0E06611p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06611g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79216"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S8"
FT                   /protein_id="CAG79216.1"
FT                   /translation="MNIKTAALPTLALQKTSISCCCGSSTCTNFCHAQKHISQLEATLR
FT                   TSAEVGQALLAQVSVMKDQIDRLNGQVTTLHVENDSMLAHNKGLIADIATLSAKLAVSD
FT                   SQIDSLNHELEESRKYQAKMTRVKLQTESLENQLELLEQVRESMQNELHTSESDKKAAQ
FT                   VRWRKTDMLLERLARDYEQLEQQAADAMASKSMASLRSNKTRYSVDSGNTLVDEYRLNH
FT                   KKSETDVLRDELLATRSEVRDLKKQLDKHDVVLKKQSRELLREEDDEYDMDISPRDHAN
FT                   RVFQINSNMDRFVTPRKSINNLQSYNLPTHNLHTFNYPTPESLKATPTLYTPSRPGKRD
FT                   PTNATNESKHTRSSSLPPTPVIDDVATFDDSFASNSDFDESPTRHASHLQKELRHFVSH
FT                   ETTLRNRFSDLYDEKLPSSCSRIPELSTELGAQAKLVRSTSFESIFSMAEGAECGPETE
FT                   FIQGHDAHFGQFQRTTLASTSAAATFTTATPDSGLRNFDSRLLLSQVNSSNTPRVAKKE
FT                   SSGWGFGGMWSRIKSKEATTEVTEA"
FT   gene            <764804..>765859
FT                   /locus_tag="YALI0_E06633g"
FT                   /old_locus_tag="YALI-IPF2355"
FT                   /old_locus_tag="YALI-CDS3775.1"
FT   CDS_pept        764804..765859
FT                   /locus_tag="YALI0_E06633g"
FT                   /old_locus_tag="YALI-IPF2355"
FT                   /old_locus_tag="YALI-CDS3775.1"
FT                   /product="YALI0E06633p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06633g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79217"
FT                   /db_xref="GOA:Q6C6S7"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037626"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S7"
FT                   /protein_id="CAG79217.1"
FT                   /translation="MSELLNNTPKKMNESIISGVSSDPSRLEFSLQSPALCLAWNEDSL
FT                   VYGYNQGVTVLTRKPVVLGNAFASEWSFLSVEYHMGLACELIATCGAFVAVGHDDNTIS
FT                   LINTAEEDAIERTDVKRGHYDFVNGIDVNLDGMVASVGDDRQLLIYSDKLEVVHKIKLD
FT                   GAGRAVKFQEDGGPHLVVLEGSNRLNVYDWEKGQFLYTVFSNDVVGGSKKIGCCGPPAA
FT                   VKAVALNVGQNHADQLTVLGSGWWRKYSSANLQGGGGHTVPNKQGELYGSRQLSGAVFC
FT                   VSNDTAVVVSDKKTLFYSLGTEKSIEVACDFVSGVEAAAVRAKGDLVAVAGGRALVLLN
FT                   SAENESNIVRR"
FT   gene            complement(<766124..>768448)
FT                   /locus_tag="YALI0_E06655g"
FT                   /old_locus_tag="YALI-IPF2354"
FT                   /old_locus_tag="YALI-CDS0905.1"
FT   CDS_pept        complement(766124..768448)
FT                   /locus_tag="YALI0_E06655g"
FT                   /old_locus_tag="YALI-IPF2354"
FT                   /old_locus_tag="YALI-CDS0905.1"
FT                   /product="YALI0E06655p"
FT                   /note="similar to uniprot|P32794 Saccharomyces cerevisiae
FT                   YLR397c AFG2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06655g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79218"
FT                   /db_xref="GOA:Q6C6S6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S6"
FT                   /protein_id="CAG79218.1"
FT                   /translation="MAPKSSSTSKKKSSSTKDDGEVKEKPVKIPDLFIVRPQGETQAAV
FT                   THNKNIYKVGLHPKILEALGLNNNEFVSVYREGDRGVGGTVCAIPEAVEDPDLVDINVV
FT                   TVSAGLKDAGALLFGDRVKVERYKTKMDMASLVSVRINTPNSPEQAVIDATTTDLKKLA
FT                   MVSPGLSMEVKIESGEYVNVTVTDVGDTDLGSLSLEQSELKNHVSYWSPLFLLEDTQVV
FT                   VSTRNCWELPKTTTYKSIGGLDQHIVELKSTIELPLHHPSLFSRFGISPPRGVLLHGPP
FT                   GTGKTMLLRAVAQESNAHVLTINGPSIVSKYLGETESSLRAIFEEARKYQPAIVFIDEI
FT                   DALVPRRDGDESGQAESRVVATLLTLMDGMSQSASAKIVVVGSTNRPNAIDPALRRAGR
FT                   FDREVEIGIPNAEARLSILSIQMADMPHNMSEEDIQYISSITHGYVGADLSALCREGVM
FT                   NAINRGLEEHGSALNAVNSGLEVTMPDLERALLDVRPSAMREIFLEKPSTTWSDIGGQS
FT                   GVKEKLKQMVEWPLTKADTMKNLGITPPRGVLLYGPPGCSKTLIAKALANESGLNFLSV
FT                   KGPELFNKYVGESERAVREIFRKARAAAPSIIFFDEIDALSTARGHSEAGAGGERVLTS
FT                   LLTEMDGIESLNGVMVLAATNRPDVIDSALMRPGRLSRLLYVGPPDEHARQQILKIRTK
FT                   NMCLGSEVDLEEIAKTTEGMTGAEIVALCEEAGLYAMSQDEDAKEVTKKDFDHVLKGAR
FT                   RGVTEEMLKYFVDWAEGNSPA"
FT   gene            complement(<769186..>769968)
FT                   /locus_tag="YALI0_E06677g"
FT                   /old_locus_tag="YALI-IPF2350"
FT                   /old_locus_tag="YALI-CDS4790.1"
FT   CDS_pept        complement(769186..769968)
FT                   /locus_tag="YALI0_E06677g"
FT                   /old_locus_tag="YALI-IPF2350"
FT                   /old_locus_tag="YALI-CDS4790.1"
FT                   /product="YALI0E06677p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06677g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79219"
FT                   /db_xref="GOA:Q6C6S5"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S5"
FT                   /protein_id="CAG79219.1"
FT                   /translation="MQSLKGLRPQISRANPLIHHSFSRWTRSSHYLTSDTQPSYRTRLS
FT                   PLSPIKEILYSDVHSLLELKMVTIDIESVRYVQDFIGPKYELPEAVIRELLCISHTLTP
FT                   SAQRKGTPFQTQKTHIEDTLGYGAINSRVLLGQHAYKFAVFSYLTKVPSWSRKKANLMN
FT                   FDICRSGLADRLTRDETLVLAFVKNTKLIKSLYVPLPEENANKRQAFRKMHDTHYATKM
FT                   LFALIASIHIEHGGVKAEEFVHEVILEGYMTSGLMTLV"
FT   gene            <770708..>771589
FT                   /locus_tag="YALI0_E06699g"
FT                   /old_locus_tag="YALI-IPF2349"
FT                   /old_locus_tag="YALI-CDS4444.1"
FT   CDS_pept        770708..771589
FT                   /locus_tag="YALI0_E06699g"
FT                   /old_locus_tag="YALI-IPF2349"
FT                   /old_locus_tag="YALI-CDS4444.1"
FT                   /product="YALI0E06699p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06699g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79220"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S4"
FT                   /protein_id="CAG79220.1"
FT                   /translation="MTPATPPHHHMDLDTPPTPRYGPMEDSPMRKKDAKPASRPHDPNR
FT                   QKTQRHTSMNNTKTPNRQRNTKGEAPASVSRMMLTPADTPVSSKRTPVDVLESNKKTGR
FT                   VLFPPANIVQAGSGRARHHAHTPVTPRTSRVRKSTHKHLLKTKPISQPQFTIFSDSAAA
FT                   KAEANGDDPFVCPDAPKAASPRAVSSLAHPHQEKPDPSVPGMWYNFRGKKHYRPFKQGE
FT                   GLDVKPKVLFKEELSKVTIQETDDPFGGGPIGGPTIASEIADAAESGDSEAETDEDADP
FT                   LSSFSEEIASLS"
FT   gene            <773558..>775579
FT                   /locus_tag="YALI0_E06721g"
FT                   /old_locus_tag="YALI-IPF2348"
FT                   /old_locus_tag="YALI-CDS1260.1"
FT   CDS_pept        773558..775579
FT                   /locus_tag="YALI0_E06721g"
FT                   /old_locus_tag="YALI-IPF2348"
FT                   /old_locus_tag="YALI-CDS1260.1"
FT                   /product="YALI0E06721p"
FT                   /note="some similarities with uniprot|P38206 Saccharomyces
FT                   cerevisiae YBL020w RFT1 nuclear division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06721g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79221"
FT                   /db_xref="GOA:Q6C6S3"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6S3"
FT                   /protein_id="CAG79221.1"
FT                   /translation="MDELPSHEPKNRYSRSSSIGSPADARYAPPSPLHEPSDASQIAIA
FT                   MGGVRQRSASIRKHRRQQPSQVFIPPMHENVTAPRDEHEPKMSSPVPETDEKPLLQTSA
FT                   AGATLLIGIQILSKLASFGLNQMLLLVATPALFGANAQLEFVLNTVLFFSREAVRLALQ
FT                   RLTLAGKKPDVYVFGGGVVQDTVSGTSQAVINMGYISVLLGVFFSSVAAASHSLFSVAY
FT                   ASWAVQLVCIAAMVDLASEPYYVLAMQQLRFRSRAAAEAVAILVRCVVTFSFTLLAKDT
FT                   DGGLNGGVLAFAFGQLAYSLISSAVYIYTVRQDNRDRQFSFRPQKIQPFESQMEMSDNN
FT                   RDVITHNASPYYLDKPTVRLAGSIWIQTVFKHCLTEGDRILVSYFLPLYDQGVYAIVLN
FT                   YGSLVARIVFFPIEEGLRTFFSNLLGEKPSETALKLSRQVLCSVVRIYTYVALFAAGFG
FT                   PTTLPFIFGTLLGARGGQWSEGAPSRSAPAVMGAFALYIPFMALNGALESFVQSVATPA
FT                   DLRRQAVALGVFSVVFATVGGLLMKTMDLGARGLVFANIVNMTLRIGWSVVFIYHYYVS
FT                   HKAENVNPTHLLPGKLVIATGVTTILASLFGVGRVSSFRDVGINIGLALALAAAIAVEE
FT                   RQALVQLVQLVRKKEDKVKVDDKEEKEKESDKSEGESE"
FT   gene            complement(<775865..>776884)
FT                   /locus_tag="YALI0_E06743g"
FT                   /old_locus_tag="YALI-IPF2347"
FT                   /old_locus_tag="YALI-CDS3901.1"
FT   CDS_pept        complement(775865..776884)
FT                   /locus_tag="YALI0_E06743g"
FT                   /old_locus_tag="YALI-IPF2347"
FT                   /old_locus_tag="YALI-CDS3901.1"
FT                   /product="YALI0E06743p"
FT                   /note="some similarities with uniprot|Q8NJ06 Neurospora
FT                   crassa NCU04633.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06743g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79222"
FT                   /db_xref="GOA:Q6C6S2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S2"
FT                   /protein_id="CAG79222.1"
FT                   /translation="MSSHPGESLTHLYEMAPTPLTKLGLLSFCVALIFVVFIFGRSLQR
FT                   IFFGSLHPREVVHLQERAVYTISEFAMQLFVFRAQLNRRFVGMFATLLFIKGLHWMCTV
FT                   RTRYVYLEYPNSGIVMRYPRLILALVILHVTDILWIRYCLRKLRVSQSMVVSVFLFEIT
FT                   ILFCSLLGSTGIMLFDLVEKALLYMCLSKGQLVKSKRYWLFLLGFAVTTAKLISYLIFS
FT                   ATLMGDYCIPLHIFREFYKTLRITISGTRELIKSRKTPNFHGLYWNLQDASEKQINESN
FT                   DICVVCRDSMKAGGLSGVQAPDKNIPKVLTCGHIVHFGCIACWSEYSNRCPTCRRLVE"
FT   gene            <777880..>780138
FT                   /locus_tag="YALI0_E06765g"
FT                   /old_locus_tag="YALI-IPF2345"
FT                   /old_locus_tag="YALI-CDS0964.1"
FT   CDS_pept        777880..780138
FT                   /locus_tag="YALI0_E06765g"
FT                   /old_locus_tag="YALI-IPF2345"
FT                   /old_locus_tag="YALI-CDS0964.1"
FT                   /product="YALI0E06765p"
FT                   /note="similar to uniprot|P38205 Saccharomyces cerevisiae
FT                   YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06765g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79223"
FT                   /db_xref="GOA:Q6C6S1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S1"
FT                   /protein_id="CAG79223.1"
FT                   /translation="MGKYPRKKNNQNNRDKNDDGRRKSGWEDVVKENEKWEKYYKAQGI
FT                   VPEAEWDAFKTACQSPLPVSFRVTGSTELTDEIQAAIVDDYVPHLSGLVFEGEEVVPPQ
FT                   NIKFYPNNHGWQFNVRKTVVRKQKLFSRFHRFLVLETTAGNISRQEAVSMIPPILLDVQ
FT                   PSDAVLDMCAAPGSKTAQLIEAVHAGGDLNPSGFVIANDSDYKRSHMLIHQVQRLNSPN
FT                   LIVTNHDAQMYPKVAIAAKGVDGAKSNEYLKFDRILCDVPCSGDATMRKNVNVWPDWTP
FT                   GNALGLHQLQLNILMRGIQLLKPGGRLVYSTCSLNPIENEAVVAEALRLSKGSVHLIES
FT                   RGDIPNLINSKGMTDWKVQAKGNKDGWNNKGDEGCTDSWFPPTDESIKEQLTKCIRVYP
FT                   HTQDTGGFFIVAFEKAKDVEEEDDKKRVAEDETRDAKRVKVDASDIIDAAKETASDAKE
FT                   AVVDAAETVKEAVTDAAETVKEKFEGVVAEVKEDAKDEEPKKSKKMPYDANEEPFVFVD
FT                   PNHEELQKCWDFYKFNDQFPRDSMMVRNHTGEPTRTIYYTSPSIKPILELNANRLKFVH
FT                   AGTRFFTLQKNEDTCKWRIQSESVNRAFPYIGARVVKGNLDIIKFLATTEFPKFEILEK
FT                   EYPEFAKEVSAHTEGCLILTAQYNDREICLPMWRGKMSANLMINKQDKEEFLHRVFKIE
FT                   GIKTRGQQQQQKPVAAESAERAQGQAEAAKAVEEAKQENEQAEIADEIVEENVVEKAE"
FT   gene            complement(<781125..>782153)
FT                   /locus_tag="YALI0_E06787g"
FT                   /old_locus_tag="YALI-IPF2342"
FT                   /old_locus_tag="YALI-CDS3871.1"
FT   CDS_pept        complement(781125..782153)
FT                   /locus_tag="YALI0_E06787g"
FT                   /old_locus_tag="YALI-IPF2342"
FT                   /old_locus_tag="YALI-CDS3871.1"
FT                   /product="YALI0E06787p"
FT                   /note="similar to uniprot|Q6C702 Yarrowia lipolytica
FT                   YALI0E04851g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06787g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79224"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6S0"
FT                   /protein_id="CAG79224.1"
FT                   /translation="MKFSIAALALVASALAQDYSGYNHYDGDNSDDLYSTQYVDESNYQ
FT                   WPDSDYVYQMNAQRDSDHRNLAMQTDGRHLYFGNSNRDINGTPLKTVNVFVDIQGDINI
FT                   VHNHNSTGRRQNYVGVDDGRLALSDRRSNAIGYQRFNNNNRVAWQHDNGKQQFLACPVD
FT                   SYGNAYDISYDQRSSDHTYQVFTGASPCANPISVSLNGDRLNGRAQYQNSRLRVHGDQW
FT                   NNQRVVNNNGRLMISNDQRNDPFLAQLSYRGQMVDPNTGRFVQLGNQASMQWTDRNQVG
FT                   HGLTGFNVNHQSDNRLTYENQGFLACQLDDGHWELRPVAVEAAAAACSNARYVQISMDP
FT                   VN"
FT   gene            <784047..>784583
FT                   /locus_tag="YALI0_E06809g"
FT                   /old_locus_tag="YALI-IPF2341"
FT                   /old_locus_tag="YALI-CDS5692.1"
FT   CDS_pept        784047..784583
FT                   /locus_tag="YALI0_E06809g"
FT                   /old_locus_tag="YALI-IPF2341"
FT                   /old_locus_tag="YALI-CDS5692.1"
FT                   /product="YALI0E06809p"
FT                   /note="some similarities with uniprot|Q12057 Saccharomyces
FT                   cerevisiae YOR104w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06809g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79225"
FT                   /db_xref="GOA:Q6C6R9"
FT                   /db_xref="InterPro:IPR037504"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R9"
FT                   /protein_id="CAG79225.1"
FT                   /translation="MAPMIQLCPQAMAQPLISFSKRGLAESAKSTGEAFKSWDTCMDNT
FT                   FCKIVAIVGIVLGGMLVLWVLTAFFRCCFFGVSAFSACCALCSCCACCCNDKINREANQ
FT                   GNYAAANNPAMYPASNPYQAYNYQPQPVYGNQSNNNFAPDYYVNRSVDDTDYEMEKYPK
FT                   INTYEVPAEQERTRF"
FT   gene            complement(<785006..>786259)
FT                   /locus_tag="YALI0_E06831g"
FT                   /old_locus_tag="YALI-IPF2340"
FT                   /old_locus_tag="YALI-CDS3064.1"
FT   CDS_pept        complement(785006..786259)
FT                   /locus_tag="YALI0_E06831g"
FT                   /old_locus_tag="YALI-IPF2340"
FT                   /old_locus_tag="YALI-CDS3064.1"
FT                   /product="YALI0E06831p"
FT                   /note="uniprot|O74211 Yarrowia lipolytica Peroxin
FT                   Peroxisome biogenesis factor 20"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06831g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79226"
FT                   /db_xref="GOA:Q6C6R8"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R8"
FT                   /protein_id="CAG79226.1"
FT                   /translation="MASCGPSNALQNLSKHASADRSLQHDRMAPGGAPGAQRQQFRSQT
FT                   QGGQLNNEFQQFAQAGPAHNSFEQSQMGPHFGQQHFGQPHQPQMGQHAPMAHGQQSDWA
FT                   QSFSQLNLGPQTGPQHTQQSNWGQDFMRQSPQSHQVQPQMANGVMGSMSGMSSFGPMYS
FT                   NSQLMNSTYGLQTEHQQTHKTETKSSQDAAFEAAFGAVEESITKTSDKGKEVEKDPMEQ
FT                   TYRYDQADALNRQAEHISDNISREEVDIKTDENGEFASIARQIASSLEEADKSKFEKST
FT                   FMNLMRRIGNHEVTLDGDKLVNKEGEDIREEVRDELLREGASQENGFQSEAQQTAPLPV
FT                   HHEAPPPEQIHPHTETGDKQLEDPMVYIEQEAARRAAESGRTVEEEKLNFYSPFEYAQK
FT                   LGPQGVAKQSNWEEDYDF"
FT   gene            <787575..>788397
FT                   /locus_tag="YALI0_E06853g"
FT                   /old_locus_tag="YALI-IPF40258"
FT   CDS_pept        join(787575..787598,787645..788397)
FT                   /locus_tag="YALI0_E06853g"
FT                   /old_locus_tag="YALI-IPF40258"
FT                   /product="YALI0E06853p"
FT                   /note="weakly similar to DEHA0E08393g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06853g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79227"
FT                   /db_xref="GOA:Q6C6R7"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R7"
FT                   /protein_id="CAG79227.1"
FT                   /translation="MASRLFFKTATPLSFAAIAVASAPVAFAESPRRSIYDNDKKEEEI
FT                   APVPGTVETGKAREGDIEKFEKEHGVSVENVGGVTIKSPKALESNIKVAREWFADKVQQ
FT                   GNQYIDEAFNKYLAVENSVTKTVADLKSPQEDILPAGIYITVAALSGSILTRNRNILFR
FT                   SAIPLAFGVAAFSYFLPQTAHNTGALVWKYEQKVPEVAKAHVDAKESVDSFAKNVRKAL
FT                   DDGKTSLESGVHSTRKFIADSTGLQLPDVDENDKKK"
FT   gene            <789249..>790349
FT                   /locus_tag="YALI0_E06875g"
FT                   /old_locus_tag="YALI-IPF2337"
FT                   /old_locus_tag="YALI-CDS3625.1"
FT   CDS_pept        789249..790349
FT                   /locus_tag="YALI0_E06875g"
FT                   /old_locus_tag="YALI-IPF2337"
FT                   /old_locus_tag="YALI-CDS3625.1"
FT                   /product="YALI0E06875p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06875g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79228"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R6"
FT                   /protein_id="CAG79228.1"
FT                   /translation="MSSPKRFSLFRSRENSVSRLCKDVESSIKEFDRHLTMQKAITNRI
FT                   EFWASTLDDEEISKDAEKLAMALREYWVEEEKLKLALKHFSDIFRTLGCEEDALIQSKA
FT                   KLDAAEKQVEAVKLKARNKDPSKVIHDHDMIAKSSILHSQVRAATKTTFIRFNAAAQRV
FT                   LRRAFTELFSQFREVGCSQQDVVVRGWTIGNGIACPDDDEPRDTIRTMNIGRSKSVQDF
FT                   KSESVKESRARRRPVPASTGSILHRRGSAGVMEPSAFSAPIAKTPMGRYDDGYHFRGGM
FT                   LGGMGSASYNSHARSTVPASVTSTPQSSRTPLSNQTSPFLYAPAMHPVDRNLSDEAMQW
FT                   NEVAEGWHHDERDREHERVGDGTPLV"
FT   gene            complement(<790502..>791716)
FT                   /locus_tag="YALI0_E06897g"
FT                   /old_locus_tag="YALI-IPF2336"
FT                   /old_locus_tag="YALI-CDS3191.1"
FT   CDS_pept        complement(790502..791716)
FT                   /locus_tag="YALI0_E06897g"
FT                   /old_locus_tag="YALI-IPF2336"
FT                   /old_locus_tag="YALI-CDS3191.1"
FT                   /product="YALI0E06897p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06897g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79229"
FT                   /db_xref="GOA:Q6C6R5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R5"
FT                   /protein_id="CAG79229.1"
FT                   /translation="MPPLVHKIHQHRPDEAFVPPTSPLTPPVPSVTVGQKILSACTGSI
FT                   ITSLIVTPFDVVRVRLQQQSALSAAESAAQAPNMLPPHSKIEAPSPKTNLSALKAHKLH
FT                   PINVATLPKGLGVTACCKEVFWFPTSVDYCVASEVDRCAVEHAKQMRFSGTWQGMRTIY
FT                   KYEGIQALWRGLSLTLMMAAPSTVLYFIGYEYLRDWSPIRSEVINPLVCGALARTLSAT
FT                   VISPMELFRTRLQSYPFESSSQLAFQKTLTGMKTMIAQDGYRSLWRGLVLTLWRDVPFS
FT                   GVYWSAYETFKAKLLRTQYFHGSVDAFTPSFIAGSAAGALASIITQPFDVGKTRRQIAS
FT                   CESAGQMSMIPLLTKMVREEGLGSLYVGSVPRILKVAPSCAIMISSYEVGKQLFDKMNG
FT                   NNVLT"
FT   gene            <793596..>797525
FT                   /locus_tag="YALI0_E06919g"
FT                   /old_locus_tag="YALI-IPF2335"
FT                   /old_locus_tag="YALI-CDS0170.1"
FT   CDS_pept        793596..797525
FT                   /locus_tag="YALI0_E06919g"
FT                   /old_locus_tag="YALI-IPF2335"
FT                   /old_locus_tag="YALI-CDS0170.1"
FT                   /product="YALI0E06919p"
FT                   /note="similar to uniprot|P87141 Schizosaccharomyces pombe
FT                   SPAC57A7.11 WD-repeat protein mip1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06919g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79230"
FT                   /db_xref="GOA:Q6C6R4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R4"
FT                   /protein_id="CAG79230.1"
FT                   /translation="MNGSVTSVQSVHSPQRRMEEDETVKSTASKTYVRHGFDDDYASDA
FT                   YMSMLAEIFYIYLDDKRHDTAGNPKRSSADGPPEWRMKDRQRTVSAAIVVCLNLGVDPP
FT                   DVIKTDPCSRLEAWVDPQTISDSKKATEQIGKQLQMQYEVLSMRTRYKQSLDPNVEDIK
FT                   RFCIGLRRGAKEERILFHYNGHGVPRPTASGEIWVFNRGYTQYIPVSLYDLQSWLGSPC
FT                   IYVWDCHSAGNIVSNFKRFVQQRIKEDADAQAPNGVTSAASGNGNAYLDCIQLAACRAD
FT                   ETLPMHPDLPADLFTSCLTSPIEIAVRWFVMKSPLAYGKKIKDLQIPGRITDRRTPLGE
FT                   LNWIFTAITDTIAWTLLPRDLFKKLFRQDLMVAALFRNFLLADRIMRVNSCHPVSDPPL
FT                   PPTHSHPMWDAWDLAVDQCLTQLPALAAGQEYRHSQFFEEQLTAFEVWLRYNARSDNPP
FT                   VQLPVVLQVLLSQVHRLRALILLSKFLDLGPWAVYSALSIGIFPYVLKLLQSPAKELKP
FT                   VLVFIWARIMSVDHQSIQHELLKDNGYAYFIQILLPFEGFAVNNVNVHDHRAMCSFIIA
FT                   LFCHGFKQGQRVSMGADLLRVLVVYAAEPDSPLLRQWSCLCISQLWFDYLEGKWLGMKE
FT                   RVPQSLIVLLEDPVPEVRTACTVALTAFLGNGDADHISQDFKDVECELANAVLKLTDDA
FT                   SGIVRREAVVFFSRFVVQYQGQILVAAFATLEQEAAAVSQMNLNTSSNPATGTVFAAVW
FT                   EAVLTFAEDPFTEVRDFARDVVDHVLFEMGQSPLGPRMEQLKRTMLQGAESKKQLPSVS
FT                   NLIPSSESHHHAAGSPAPQSPAMAPLTPTASSTIQNAIAADRAASSPLNSLKRSVSKYL
FT                   FGDNEPSGTAAQKTDSSVTTVPFGTGTIPVTPRYTSRAAGSRAQLPLKSGFFAWSTEFF
FT                   QEPQMVPAEADCTGSQRYTERLWRKTRNERIISESVLQRDEAVKGKWDHSLGVLSNKTQ
FT                   PQKLVFAQFEPHLAVADDRDGVSIWNWAENKRLSRFCNANPAGTRITDVKYLNEDDVPM
FT                   LLTASSEGCVRIYRHYESRQDVQLVSAWRALSGVGLQASSPVAVDWQQSRGTLLVGGPT
FT                   RVVKVWDAPREMCMASIPARSSAPVTALTSDQVAGHMFVAGFADGALRLFDRRVDSRDA
FT                   MVKIWKLSRGIRHSDKVLNVCMQRGGHRELVSGSADGVISTWDIRTDTPLRSWIAHTNG
FT                   MKAMDVHEHAPVLVTGSQLVRTWDFDGHMTSVNKNHPGYMTLPNRVTSVNALSFHPHRL
FT                   VMASNNVNDGTVMLRSCSGFLKSDF"
FT   gene            complement(<797779..>799845)
FT                   /locus_tag="YALI0_E06941g"
FT                   /old_locus_tag="YALI-IPF2333"
FT                   /old_locus_tag="YALI-CDS1200.1"
FT   CDS_pept        complement(797779..799845)
FT                   /locus_tag="YALI0_E06941g"
FT                   /old_locus_tag="YALI-IPF2333"
FT                   /old_locus_tag="YALI-CDS1200.1"
FT                   /product="YALI0E06941p"
FT                   /note="similar to uniprot|P53070 Saccharomyces cerevisiae
FT                   YGL236c MTO1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E06941g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79231"
FT                   /db_xref="GOA:Q6C6R3"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R3"
FT                   /protein_id="CAG79231.1"
FT                   /translation="MLRAQVRAVFRGNNRLPQLRRIHTTPDIVETLKTAPKYDVVVVGG
FT                   GHAGCEASAAAARSGARTLLVTPKFDNIGTCSCNPSIGGIGKGTLVTEVDAMDGLMGRV
FT                   ADKAGIHFKMLNRSRGFAVWGLRAQIDRKIYKKEMQQLIRDYPNLEVLEGTVEDLLTTP
FT                   EATPDAVKSYGSIAGLTLESGETINTEKVVITTGTFLGGEIHIGLEAYPSGRMGEKATF
FT                   GISNTLREVGFMLGRLKTGTPPRIDSTTIDYSTMLPELQDEDPFPFSYLNDDVPAAKTD
FT                   GSVNEETPAELRGPNNHSVVCYKAKTVKATHDLIRDNLDKSIHIREDVKGPRYCPSIES
FT                   KIIRFADKDSHVIWVEPEGLDTTTIYPNGISTTLPAETQLQVLKTIPGFENVTMTQPGY
FT                   GVEYDYVDPRELKNTLETKLVHGLYLAGQINGTTGYEEAAAQGIIAGFNAGLQAQNKEP
FT                   FTMRRSDGYIGVLIDDLITKGVSEPYRMFTSRSEFRFSVRADNADERLTVKAFERGLVD
FT                   SRRVSRLEQRNEAIADIKKIFESKRLTPTEWNEQLGYKVFPRLVEGKMTAAHMLLVKGI
FT                   DDDLLFATMPELSKYPPRLILRVTTEYRYKMYLDKERQQIASVERDESLKLPENLDYMS
FT                   MAGLKIEYRTVLDKVRPATLGQAKRIEGISNSVCFYLLKYVHKNKHLGGKNDA"
FT   gene            <800521..>800613
FT                   /locus_tag="YALI0_E06963r"
FT   tRNA            join(800521..800559,800577..800613)
FT                   /locus_tag="YALI0_E06963r"
FT                   /product="transfer RNA Ile (AAT) cove"
FT   gene            <800624..>800708
FT                   /locus_tag="YALI0_E07007r"
FT   tRNA            join(800624..800661,800673..800708)
FT                   /locus_tag="YALI0_E07007r"
FT                   /product="transfer RNA Gln (CTG) cove"
FT   gene            <801509..>802873
FT                   /locus_tag="YALI0_E07051g"
FT                   /old_locus_tag="YALI-IPF2332"
FT                   /old_locus_tag="YALI-CDS2757.1"
FT   CDS_pept        801509..802873
FT                   /locus_tag="YALI0_E07051g"
FT                   /old_locus_tag="YALI-IPF2332"
FT                   /old_locus_tag="YALI-CDS2757.1"
FT                   /product="YALI0E07051p"
FT                   /note="similar to DEHA0E05104g Debaryomyces hansenii
FT                   similarity to kynurenine aminotransferase and glutamine-
FT                   phenylpyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07051g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79232"
FT                   /db_xref="GOA:Q6C6R2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R2"
FT                   /protein_id="CAG79232.1"
FT                   /translation="MAEFEEDVVLEKYWPEEAAHEGKSAGSTVPLSHHFEGPKHNFPGL
FT                   EMKMGATGVIWTTDRAAEKGFSHENPEWANLGQGAPEVGPIPGCFKRPDVIDASEESRE
FT                   YASTAGVKELREAVANLYNHDYREGKESKYTYENVCIVPGGRAGLIRIAAILSDVYLSF
FT                   FFPDYTAYAEMLALFKNFSPIPVPLRADDDYQVHLDIIRAELDRGVSALLTSNPRNPTG
FT                   QAMRDQDLKDLQDMCRKRCLLIMDEFYTRYNYEDGCNGSSVSSAANIINVNEDPVLIVD
FT                   GLTKSFRLPGWRICWIVGPKSYIKALASAGSFLDGGSNAPFQKAAVPFLEPSLVKKEMT
FT                   ALQVHFKAKRDYCIDRLEKMGFKFHQVPTTTFYIWLDLSPLPKEINSSLHFFEACLEEK
FT                   VIMVPGIFFDLNPLARREIHHSPYYHFMRLSYGPPMENLVKGMDAIERVINKYKK"
FT   gene            <804608..>805486
FT                   /locus_tag="YALI0_E07073g"
FT                   /old_locus_tag="YALI-IPF2331"
FT                   /old_locus_tag="YALI-CDS4455.1"
FT   CDS_pept        804608..805486
FT                   /locus_tag="YALI0_E07073g"
FT                   /old_locus_tag="YALI-IPF2331"
FT                   /old_locus_tag="YALI-CDS4455.1"
FT                   /product="YALI0E07073p"
FT                   /note="highly similar to uniprot|P43619 Saccharomyces
FT                   cerevisiae YFR047c putative nicotinate-nucleotide
FT                   pyrophosphorylase [carboxylating]"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07073g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79233"
FT                   /db_xref="GOA:Q6C6R1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R1"
FT                   /protein_id="CAG79233.1"
FT                   /translation="MSFAHLLPIDGDWKTDVTRWMSEDVPSFDVGGYVVGDDIHHATLY
FT                   CKSPGVVAGVPFAQEVFDRNQLKVKWSVREGDYVDPKGGKVAVAKVSGPVRQVLLAERT
FT                   ALNLLARASGVATKSRHIVELAKKAGYTGIIAGTRKTTPGLRRLEKYAMIVGGADPHRY
FT                   DLSSMVMLKDNHVWATGSITDSVKKARSVCGFAMKIEVECQSEEEANEAIAAGADIIML
FT                   DNFDGKGLQVAAQSIKDKWNGTKHFMLECSGGLTEENIGSYLTNQIDIYSTSSIHQGTG
FT                   IVDFSLKIDHN"
FT   gene            complement(<805876..>810432)
FT                   /locus_tag="YALI0_E07095g"
FT                   /old_locus_tag="YALI-IPF2330"
FT                   /old_locus_tag="YALI-CDS0089.1"
FT   CDS_pept        complement(805876..810432)
FT                   /locus_tag="YALI0_E07095g"
FT                   /old_locus_tag="YALI-IPF2330"
FT                   /old_locus_tag="YALI-CDS0089.1"
FT                   /product="YALI0E07095p"
FT                   /note="similar to DEHA0C07986g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07095g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79234"
FT                   /db_xref="GOA:Q6C6R0"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6R0"
FT                   /protein_id="CAG79234.1"
FT                   /translation="MDRRHSLPITPSNPVTQKSGLGSVFKSLTKGFKSSSSGAPQTRPT
FT                   VVGGAADQEELMRVLATGTPDKKVEAAMALEHAVQTYSVSSIPEIWYAARDLTKTDQPT
FT                   ECRRSGLKLMIACIKQDESATGSRLAYFQSLIENSNLQDFDLQLEVLRVLTDNGKNVFD
FT                   LYQSGYPFTHILSSWLKRLAAEAQDVRIGRIDDVTAASTGGKVTMNDNLQTLMKLLTSM
FT                   LQHNFQMFNDDEVGAILGEVVTMCRRTSSKSDIEAALEMFNTVIQSGYVPIKSIPVVLD
FT                   ILCSTYVTIPDLEEAVGQSLTMLCSSHVGHATVEIMFRYLQDAGKNTSGQNAPNGNTLR
FT                   GTVRFLRVLAENTPPELKLDITMGAVLGAYEDSLRLGSANHDLEVCQNVTELVRNQETC
FT                   RKITYEDWDSDHSPYVIIARCAEQEMDDSATGNQSSMHRTGSITKTAGTGQGSTSLFDK
FT                   KSAHFETRSRLSKRAGSIFSADSTKDGKENKEDSAAPAPEPSKLMLCIRDFVELVSSLE
FT                   RKADFTAPKEQTIQFYLEMAPFLNESSAARIVRHFEDSYLCSPFSSNWEANTELVLDFL
FT                   EPYWPDGVRMLVLDFMDRLYTVSSEVNDRDMLNKLISMLSNTYRSSHLTTKVRSRLLTL
FT                   LTDMSKSASFDVFNTMLRDITATGEAPAVELVYSLGRMFGQFMLIQPQKAQLVYTTLVK
FT                   MLPTLRQQNSVDAYLEACRLFVRLRSTDDEYVYITNPVDMDGLSASFGRNYTGREEECD
FT                   KPWHFPEDVKFLDGVERNKPCRKLMVGPPGQEPRNGVYSIDTSLWFSEILQVISKAQCD
FT                   WEIYSFVLAHLGPQLSNLALFKWSHQDIKALRVALSEGISDRLPAALKIPKDISKPDIG
FT                   VAIIRNISSFIGYGDLLSRTDEEYILQALVAGLSSWEKTAIPCIHALVLCCYEFPVSIR
FT                   RFLPQIFTKFQTKITTLSSSPHILEFLLALSRMPSLTRSFTQDEYKRIFGMAFKYIQHA
FT                   NDLAKMSDGSKHQVNYDPTGPDTKSSTDATQFNGTVMSQYLLALAYNVIIAWFLKLDIS
FT                   KRHFLAKFIVRNLILADGNPADIDPQSLALLDLIQRFAFTDFDLQMPSMMGINAHLKDK
FT                   KTSTKQWLYGTSVISIQTVLTTGETQYIVRRPTGTAIINVNPSDKMVPRQTQTEQSSEE
FT                   LFSPNYFLLQTLPTDVTADIPKPIALGTDPATTRAVSAIDRIPVVDFHKVGVMYMGPNQ
FT                   KEETEILANQTGSLHYRQFMSSLGTLTRLKDNKSIYTGGLDTEQNVDGEFAYCWRDKIS
FT                   QLVFHATTLMPPPLNPQDTAYASKKRHIGNDYVNVFFDESGLTFDFNTIKSQFNFINIV
FT                   ITPHSANFDKSHIFADTKDEPKTPADQPTRYYKVRAYRKAGVPAIFAACHLKIISEGSL
FT                   PDFIRNLVLIASKFATIWYSDGQYVSNWRYRLQQIQQLKEKTVAQVEAAAAEKKNAATD
FT                   SKDMAASFLEQLQGGGAPDDNDDDDDDNPSGPVFTEDEDTGNDLPLLKSLDFTSFLN"
FT   gene            <811633..>812187
FT                   /locus_tag="YALI0_E07117g"
FT                   /old_locus_tag="YALI-IPF11429"
FT                   /old_locus_tag="YALI-CDS5634.1"
FT   CDS_pept        811633..812187
FT                   /locus_tag="YALI0_E07117g"
FT                   /old_locus_tag="YALI-IPF11429"
FT                   /old_locus_tag="YALI-CDS5634.1"
FT                   /product="YALI0E07117p"
FT                   /note="similar to uniprot|Q9XHV6 Oryza sativa 10A19I.10
FT                   protein and uniprot|P53068 Saccharomyces cerevisiae YGL240w
FT                   DOC1 component of the anaphase promoting complex"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07117g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79235"
FT                   /db_xref="GOA:Q6C6Q9"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016901"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q9"
FT                   /protein_id="CAG79235.1"
FT                   /translation="MSEKPTFTEGLEEVEELGLTDLGSLAHWSVSSHKTGCGVEALRSD
FT                   DHQLFWQSDGPQPHHLDIHFSKRVSIERVSIYTDYELDESYTPSKIKILAGSGYHDLLE
FT                   VTEVDLDEPQGWTHLVLDGLREDGVLKTYLLRLLIPANHQHGKDTHLRAVKVYGPRKHM
FT                   VMDDSIFTFTTPQMFSEQVIR"
FT   gene            <813703..>816561
FT                   /locus_tag="YALI0_E07139g"
FT                   /old_locus_tag="YALI-IPF2329"
FT                   /old_locus_tag="YALI-CDS0522.1"
FT   CDS_pept        813703..816561
FT                   /locus_tag="YALI0_E07139g"
FT                   /old_locus_tag="YALI-IPF2329"
FT                   /old_locus_tag="YALI-CDS0522.1"
FT                   /product="YALI0E07139p"
FT                   /note="similar to uniprot|P33307 Saccharomyces cerevisiae
FT                   YGL238w CSE1 importin-beta-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07139g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79236"
FT                   /db_xref="GOA:Q6C6Q8"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q8"
FT                   /protein_id="CAG79236.1"
FT                   /translation="MTEFETVVALLKQSQLPQSARSAEQQLKELEDQADFPIVMLHVVA
FT                   AQNLEESTRLAAALFFKNFLKRKWVNSDGQHLLQPSTVKTVKDEVVGLMISLPERLQIQ
FT                   LGESVSIIADSDFPHNWEDLVSSLVARLSPTDMVTNNGILTVAHSIFKKWRPLFSSDDL
FT                   NREILLVLNQFTEPYKQLCEEVDRQIEANSNNKAQLDILFRVQFNIFKIFFDLNCQDIP
FT                   AFFEDNLDYFMNLLKKYLCYTNPLLEDPDEDDEAGILEKVKASICDAIQLYSLRYEEFF
FT                   GTYLNGFVETVWNLLTNTSTQPKYDILVSRALTFLTSVAKVPRHTNMFSSPEVLKQLIE
FT                   KIVVPNMSLRESDEELFEDDPLEYIRRDLEGSDSDTRRRAATDFLRELNDKAESSVTKV
FT                   ALEYVEQFLNLYKQDPASNWKAKDTAIHLYSSIAAKGAVTSSGVTSINLTVDILSFFSE
FT                   NIAPDLMNDSANPILKVDAIKYIYTFRNQLSRDHLIQVFPVLMNHLLSTNYVVCTYSAV
FT                   TVERLLAKNVFDKTEVAEIAQQLLPKLFELIAAGGTPEKISENEYLMKCIMRILLVAGS
FT                   DVATGDAGKQLLQQLIGILQEICKNPSNPRFNHYTFESIGVLLKYTVPVVGFAAVQDIV
FT                   SPTFLTILEQDIAEFSPYVFQLLALILELSPSIDSLPPAFQQLARTLVVAQLWESRGNV
FT                   PALARLLKAIISKNGSIYEENLLALLGVFQKLISSRVNDEFGFDLLQAIMLHISPQVLQ
FT                   PHLKDIAVILLMRLQGSRTEKFVNRFAYFVVFLAATAPTPSFPITFIDQAEKGVFGTIW
FT                   GQFLVNAVPNVQGPLQRKTAAIGCTKLLTGTPEFLGGEYSSLWPTTLEKLVQLLNSEIS
FT                   KSTEEVSPEVDLDSLSFGSSFNKLSTCTPKPTDPLPDIRDAKQFFVQQLQAANNQTNGQ
FT                   VNQLIGNSSEAVKTALRDFGYA"
FT   gene            complement(<818614..>819492)
FT                   /locus_tag="YALI0_E07161g"
FT                   /old_locus_tag="YALI-IPF2327"
FT                   /old_locus_tag="YALI-CDS4454.1"
FT   CDS_pept        complement(818614..819492)
FT                   /locus_tag="YALI0_E07161g"
FT                   /old_locus_tag="YALI-IPF2327"
FT                   /old_locus_tag="YALI-CDS4454.1"
FT                   /product="YALI0E07161p"
FT                   /note="weakly similar to uniprot|Q06667 Saccharomyces
FT                   cerevisiae YDR315c IPK1 inositol 1 3 4 5 6-
FT                   pentakisphosphate 2-kinase (IP5 2-kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07161g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79237"
FT                   /db_xref="GOA:Q6C6Q7"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6Q7"
FT                   /protein_id="CAG79237.1"
FT                   /translation="MSSLPTPLPPYKWTLLTAGNANVVYKSDETDLLLRLRRNRNAPST
FT                   AEVDEYLTGTIRPAIGPFLFHYTVVNLPLGFLESLPEAENLDLGEPLGLLMENLGPKPN
FT                   ETNVLKSHAVKINYSDNWESYTVELKPKWLLQSPTAPKDSINCRTCALQLKREKPRICP
FT                   LKLFNEDEQTSLQALEDVFPGTQKQFEPLAKFFSNSELFAEIRHMQHGDELGILGYANY
FT                   VQVPPQFVTAMTMRDVSLFVHVQGDSVNGKIVDADLKSVSEKRDYWASLETDLIEGGWY
FT                   EKPGTNCLLRN"
FT   gene            <821030..>822187
FT                   /locus_tag="YALI0_E07183g"
FT                   /old_locus_tag="YALI-IPF2326"
FT                   /old_locus_tag="YALI-CDS3400.1"
FT   CDS_pept        821030..822187
FT                   /locus_tag="YALI0_E07183g"
FT                   /old_locus_tag="YALI-IPF2326"
FT                   /old_locus_tag="YALI-CDS3400.1"
FT                   /product="YALI0E07183p"
FT                   /note="similar to uniprot|Q04062 Saccharomyces cerevisiae
FT                   YDR427w RPN9 subunit of the regulatory particle of the
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07183g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79238"
FT                   /db_xref="GOA:Q6C6Q6"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035298"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q6"
FT                   /protein_id="CAG79238.1"
FT                   /translation="MEIDNDVPTILATLRMEADPELAATFYSLEDLWERKLWHQLTDAL
FT                   AELYADPRSKPLRLRIFTQFIQVFERNLNQLKLVIFGVLAAAQCNNDEETLGFLTSLAD
FT                   KVSHKPDTQDAYVYAQIEIARVKLRLKDMDGAREVLNSVTGTIDSLNSVDPIITAAYYG
FT                   VNADYYLSKGDFNTYYRNALLYLACIDLSTLSVEAVQKRAHELSVAALLGEKIHNFGEL
FT                   LLHPVLDSLKNTEYAWLRDLLFALNQGDISEFEKLTSQHVSKLPPLEAAMPLLRQKICL
FT                   TALTEAAFKRPTNDRTLTFAAVAKETQLPADEIEHLVMKALSLELIKGHIDQVAQTITI
FT                   TWLQPRVLNKQQIADMKQRLDQWDANVKQLGGWIHDRGEGVWLEA"
FT   gene            complement(<822368..>823969)
FT                   /locus_tag="YALI0_E07205g"
FT                   /old_locus_tag="YALI-IPF2324"
FT                   /old_locus_tag="YALI-CDS2073.1"
FT   CDS_pept        complement(822368..823969)
FT                   /locus_tag="YALI0_E07205g"
FT                   /old_locus_tag="YALI-IPF2324"
FT                   /old_locus_tag="YALI-CDS2073.1"
FT                   /product="YALI0E07205p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210w UGA4 GABA-specific high-affinity permease"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07205g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79239"
FT                   /db_xref="GOA:Q6C6Q5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q5"
FT                   /protein_id="CAG79239.1"
FT                   /translation="MDDKIEEGYGQNPPSGDANVLATMGYKPELKRNYSMIQVFGIAFS
FT                   IMGLFPSISSALVYSMPSGPAGMVWGWFVASFCIMMVGLSMAELGSSLPTSGGLYWWTY
FT                   HFATPKLKRPLCFLVGYSNTLGLTAGIVSIDYGFAQLVLAVAGVATDGEYVATKYTVYG
FT                   VFAACIISHAIVASLASDGMSKLQTGCIVLNIAIIIIAIIALPIGARHNLHDGAYIFGK
FT                   LENLTTWPTGWTFFLGWLAPIWTIGSFDSCVHMAEEASNATKAVPFGIISSIGMCWVLG
FT                   FVINIVLACVMAPDTERILSTPFQQPMAQLIYDCLGKKWTLALMVIIFVLQWTMGLSIV
FT                   VAASRQSWAFARDGALPFSNFFKVVNHKVSIPVRAVWGNCTLGLVIGCLCMIDAAAAAA
FT                   LFSLAAASNDLAWMTPIACRLIWGYKNFVPGPFYLGRVISKCVSTFAVLYLCFAICLLM
FT                   FPLEGPNPNKDNMNYTCVINVAVWAGSLIYYFGWAHKWFEGPQSNLELEGMEVEGVPQL
FT                   TKMNQTDPAQSDKSVE"
FT   gene            complement(<825389..>825475)
FT                   /locus_tag="YALI0_E07227r"
FT   tRNA            complement(join(825389..825424,825438..825475))
FT                   /locus_tag="YALI0_E07227r"
FT                   /product="transfer RNA Gln (CTG) cove"
FT   gene            <828503..>834223
FT                   /locus_tag="YALI0_E07271g"
FT                   /old_locus_tag="YALI-IPF40257"
FT   CDS_pept        join(828503..828709,828968..834223)
FT                   /locus_tag="YALI0_E07271g"
FT                   /old_locus_tag="YALI-IPF40257"
FT                   /product="YALI0E07271p"
FT                   /note="similar to uniprot|P32528 Saccharomyces cerevisiae
FT                   YBR208c DUR1_2 urea amidolyase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07271g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79240"
FT                   /db_xref="GOA:Q6C6Q4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q4"
FT                   /protein_id="CAG79240.1"
FT                   /translation="MCKSIGWTIAEWKEAQTNSSYEEARHRLLDLVATFKDYKHGDPAW
FT                   ITVASTEHINKQWKELQLMKKNPESLPLYGVPFAVKDNIDVIDFPTTAACPAYLYIPKE
FT                   DATMVRLIKEAGGIVVGKTNLDQFATGLVGTRSPYGKTPNTFSDKHVSGGSSAGSASVV
FT                   ARGLVPFSLGTDTAGSGRVPASLNNLVGLKPTVGAFSAKGVVPACKSLDCVSIFSLVLS
FT                   DAQLVFNIAAHFDKDDCYSRRFPQRPLKSFGPTPVFAVPETPLWFGDELNPALFDDAVE
FT                   RLRQQGVKVVKIDFTPLFDLAKCLYEGPWVAERYAAIKDFVQNRKEDMDETVYGIVKQA
FT                   ENFTAADAFAYEYKRRAIVRKIEEIFSSIDGLIVPTCPLFPTMESVAKEPVTVNAHQGT
FT                   YTNFVNLADLSALAIPVGFRKDGFPFGITLISQKFNDYALLDMAQKFLPASRPLGALPK
FT                   DKFTAKKGDLLASSIVDNMPRTIPLAVVGAHLTGMPLNWQLQKVEATLARRTKTADYYR
FT                   LYALANTVPTKPGLRRVLPSDTTLRGEAIEVEIWDVPYRNFGEFVSMVPHPLGIGTIEL
FT                   ADGKWVKGFICEQLGYDDAEDITKFGGWRAYKAETTQNLESKPFETVLVANRGEIAVRL
FT                   IKTLRKMDIRAVAVFSEPDRFAQHVLDADDSVSLEGTTAAETYLSIPKIIAACKKTGAQ
FT                   AILPGYGFLSENADFSDACAEAGIVFIGPTGDSIRKLGLKHSAREIALASDVPLVPGTG
FT                   LIETVSEASEAAEKLEYPLMIKSTAGGGGIGLQKVDKPEDLKRAFETVKHQGKSFFGDD
FT                   GVFMERFVENARHVEVQILGDGKGNALAIGERDCSLQRRNQKVVEETPAPNFPAETRTR
FT                   MMKASEMLAKNLNYRGAGTVEFIFDEKRNEFYFLEVNARLQVEHPITESVTGLDLVEWM
FT                   ILIGAGKAPDFEAQRAKTPQGASIEARLYAENPVKDFVPSPGQLTDVQFPSDARVDTWV
FT                   SRGTKISAEYDPTLAKIIVHGSDRADALRKLQRALDETVVAGVTTNLDYLKSIVGSQMF
FT                   AEAKVSTRVLDSYNYTPNAIEITSPGSYTTIQDYPGRTKLWHIGVPPSGPMDAYAFRVA
FT                   NQIVGNHPKAPAIEATLVGPSIMFHSDTVIAITGGSAEATLNGEPIEFWKPVTVKAGQT
FT                   LATGRLTSGCRLYIAIRNGLSIPEYLGSRSTFALGNLGGFNGRTLKFGDVIFMGEPELP
FT                   SCSIPAPISEHAPASDDMIPKYGNAWTVGVTCGPHGSPDFFAHGWMDTFFDAKWKIHYN
FT                   SNRFGVRLIGPKPEWARKDGGEAGLHPSNQHDYVYSLGAINFTGDEPVILTCDGPSLGG
FT                   FVCAAVVVEAELWKIGQVKPGDTVQFVPMTIDSARQLKKAQDRTITNLCGSPYESVDAL
FT                   LALEDYENPIIYTVPASTSTPRVVYRQAGDRYILVEYGDNNMDINLSYRIHRLIEEAQQ
FT                   SIKGIVEMSRGVRSVLIEFHPSASRSTLMQALVDFEKRLQFVETWQVPSRIIRLPMCFE
FT                   DSKTLDAVKRYQETIRSKAPWLPNNVDFIRDVNKFSDRSQVRDIVYTARFLVLGLGDVF
FT                   LGAPCAVPLDPRHRLLGTKYNPSRTYTPNGTVGIGGMYMCIYTMESPGGYQLVGRTIPI
FT                   WDKLSLGQDRPWLLSPFDQIEYYPVDEEELNHITTEVENGRYAVEMEQSVFDYGKYSAW
FT                   LKDNSKSIEAHIASQAEGLDDFANLIKVANEDLASGKTGATKEETPLSASAVQVFSEVT
FT                   GRFWKGLVAVGDTVDKGQGIVVVEAMKTEMVVNAPVAGKVVKLYNTNGDMVDTGDCVAV
FT                   IEPIV"
FT   gene            complement(<834390..>835394)
FT                   /locus_tag="YALI0_E07293g"
FT                   /old_locus_tag="YALI-IPF2318"
FT                   /old_locus_tag="YALI-CDS3963.1"
FT   CDS_pept        complement(834390..835394)
FT                   /locus_tag="YALI0_E07293g"
FT                   /old_locus_tag="YALI-IPF2318"
FT                   /old_locus_tag="YALI-CDS3963.1"
FT                   /product="YALI0E07293p"
FT                   /note="similar to uniprot|Q6CDB7 Yarrowia lipolytica
FT                   YALI0C01925g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07293g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79241"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q3"
FT                   /protein_id="CAG79241.1"
FT                   /translation="MNYQYKRIRRIGGAQLGCTKVDFDKEVKERHITSCTLDKVGTFHF
FT                   IFGQELGDGFRKPYLVYYNEKEGVKHISCPLNYKVKHGAHPACVALDQNTFLFRNDSEN
FT                   GYELNHYLVSLDDCWQMSTYHRFEVGSKSKLLNLLNADHKPSFTEVHRTGLARIRYASE
FT                   GDITMISNEGNAVKIHSSVLIGISSYFETLLKWKKMEAVPNEVRVDIPTSTLEVLVRYI
FT                   YGEELDMTFVDACELVVFAQMCCLPELVHLASQWFKPNPPEDFDQAVSLWKKSFEARNS
FT                   VMRAFAAGCLVEFLSPDEDGIDDSWDMDADELSHLWKDVAIATKRRYAGMRYQ"
FT   gene            complement(<835710..>837398)
FT                   /locus_tag="YALI0_E07315g"
FT                   /old_locus_tag="YALI-IPF2316"
FT                   /old_locus_tag="YALI-CDS1869.1"
FT   CDS_pept        complement(835710..837398)
FT                   /locus_tag="YALI0_E07315g"
FT                   /old_locus_tag="YALI-IPF2316"
FT                   /old_locus_tag="YALI-CDS1869.1"
FT                   /product="YALI0E07315p"
FT                   /note="similar to uniprot|P39994 Saccharomyces cerevisiae
FT                   YEL020c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07315g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79242"
FT                   /db_xref="GOA:Q6C6Q2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q2"
FT                   /protein_id="CAG79242.1"
FT                   /translation="MNGSQVIAESLVQLGVEHIFGIVGIPVIEVADACIARGIKFIGFR
FT                   NEQSASYAASIYGYLSGKPGVCLTVGGPGVLHALAGVGNAQSNCFPLLLLAGSVDVHNT
FT                   HKGGFQELDQVAAVTEYTKFAARPSSTDALPFLLEKAYRTAYFGRPGATYVDLPANIIQ
FT                   SKDNDQVSFGVLQRLRNVPAPRSAGDPAKIAEAAALIRASKFPLLVIGKGAAYAKAEPT
FT                   IRRFQESTNIQFLPTPMGKGVISDSNPGNMSACRSQALKNADVVILVGTRLNWILHYGD
FT                   APKYSENTKFIHIDVCAEELGNNAGQAELGILGDASLVIGQLEDVLKGWKSPALAPEIA
FT                   AKREKNVQNATKKEADHSVPLKYFGVFASIQKTIAEIAKDRKLVIVSEGANTMDNSRSV
FT                   FGHVEPRTRLDAGTNATMGVGLGYAIAAKAYDPKSLVVAVEGDSAFGFSAIEVETAVRD
FT                   NLPMVIYVMNNSGIYHGVDPARYTDGQPLPSTALSLDTRYDVLAESLGAKGYFVKNIEE
FT                   LEVATKSAVQSNRVCVINVIIESGKDQKLEFGWMASEKKKEKSKL"
FT   gene            <838956..>839510
FT                   /locus_tag="YALI0_E07337g"
FT                   /old_locus_tag="YALI-IPF2314"
FT                   /old_locus_tag="YALI-CDS5636.1"
FT   CDS_pept        838956..839510
FT                   /locus_tag="YALI0_E07337g"
FT                   /old_locus_tag="YALI-IPF2314"
FT                   /old_locus_tag="YALI-CDS5636.1"
FT                   /product="YALI0E07337p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07337g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79243"
FT                   /db_xref="GOA:Q6C6Q1"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q1"
FT                   /protein_id="CAG79243.1"
FT                   /translation="MKHQIRPLLALLLALTLYTTLALANTAQVRFVPELSRSPFSDAYS
FT                   KALSPNENTLTVITTPDFESQTQTFQLNGLSTDGTMYEVRVCWPANYPLEFDLKFDSKT
FT                   NSVKVAYFSDYYSSDDDLNYLPLDAEFQVVLNKVVLGALPEDIFGAVILAVVGGGLAYF
FT                   LGGVVYKVVFDSHVTTEKKNR"
FT   gene            complement(<843297..>843415)
FT                   /locus_tag="YALI0_E07348r"
FT                   /old_locus_tag="YALI0E07357r"
FT   rRNA            complement(843297..843415)
FT                   /locus_tag="YALI0_E07348r"
FT                   /old_locus_tag="YALI0E07357r"
FT                   /note="5S RNA"
FT   gene            complement(<843421..>843491)
FT                   /locus_tag="YALI0_E07359r"
FT   tRNA            complement(843421..843491)
FT                   /locus_tag="YALI0_E07359r"
FT                   /product="transfer RNA Gly (GCC) cove score=64.77"
FT   gene            complement(<843609..>844658)
FT                   /locus_tag="YALI0_E07381g"
FT                   /old_locus_tag="YALI-IPF2313"
FT                   /old_locus_tag="YALI-CDS3797.1"
FT   CDS_pept        complement(843609..844658)
FT                   /locus_tag="YALI0_E07381g"
FT                   /old_locus_tag="YALI-IPF2313"
FT                   /old_locus_tag="YALI-CDS3797.1"
FT                   /product="YALI0E07381p"
FT                   /note="similar to uniprot|O74916 Schizosaccharomyces pombe
FT                   Putative acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07381g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79244"
FT                   /db_xref="GOA:Q6C6Q0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6Q0"
FT                   /protein_id="CAG79244.2"
FT                   /translation="MIRKIVVFLVCGALLILKSYIYAYHRFPKHDTLSVKEHGGTNSYS
FT                   PVMELHKSLVDIPSVSYNETHVSRFLQLYLSTRGYTIDLIGDHTRQNVYAYKGAREDAK
FT                   VLLTSNVDHVTSGTPYNVIDGAIYGSGALDAKSCIAAQVTALEELLRDRKVAYNEVALL
FT                   FVVGGEVFGSGGMTEVNKMVKPWKTIIFGKPSDLNLVSRHCGVVIIGLEGENQVLIDMM
FT                   QAFKTSIISGTVNVTFTNNQKATVEVRFLGDEENVASEVAGVLTRFRDVIFTYQSYPPQ
FT                   DFSCEVPGFESTVSSLSSDSPHLHGDFVRYLYGPGNMSLANAPDEHITVTDLLAAVEGY
FT                   KKLVLFAIA"
FT   gene            complement(<844968..>845041)
FT                   /locus_tag="YALI0_E07403r"
FT   tRNA            complement(844968..845041)
FT                   /locus_tag="YALI0_E07403r"
FT                   /product="transfer RNA Ala (AGC) cove score=66.06"
FT   gene            complement(<845502..>849053)
FT                   /locus_tag="YALI0_E07425g"
FT                   /old_locus_tag="YALI-IPF2312"
FT                   /old_locus_tag="YALI-CDS0261.1"
FT   CDS_pept        complement(845502..849053)
FT                   /locus_tag="YALI0_E07425g"
FT                   /old_locus_tag="YALI-IPF2312"
FT                   /old_locus_tag="YALI-CDS0261.1"
FT                   /product="YALI0E07425p"
FT                   /note="similar to uniprot|Q12754 Saccharomyces cerevisiae
FT                   YPL012w hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07425g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79245"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P9"
FT                   /protein_id="CAG79245.1"
FT                   /translation="MSELDHTEPLEDKLDRIRVHVNSKLANQKQLAIILGAVEENLEEE
FT                   KTEKTATSYFISFLALLEQSFSRQAPDQLENIDLAASALYFLDLVSPFASESLLRAKFS
FT                   QIFVKLAPVLGSSDSESALLRSAIGTLQHLLLAQDAASWQTPASELSPRRGVVGLMHLA
FT                   VNPRPKIRKRALDALAKILETRVSPVLVEHPAAATCADTALKAVKQYLENHKKEDTVDA
FT                   GFMHALALVKTICGVGMWPMSQFDELCQLLLSISKTTNQMLIQATFGIFEGVFRHFAKS
FT                   EEDENNKTRKLLVILDAVIDQAPATNDQHLAPAWFAVVAQGVGALGEVNPDKGLAKTPV
FT                   VFQKVCAYLDSEADSVRTSASQCLVALCSSINQKSLQNGDKWLSKLAEMATMLLSVQTR
FT                   ASLVDSTNVVAALLDTLRWKSDPFLVEAVTIIGGLRTEESFVNGIPALDNALGSAIRAM
FT                   GPAKVLELLPLNLSNPSSDSPGRAWMLPLLRDNIHNSEIAFFKSEFLPLIEYFDDKIST
FT                   TKGATAKVFEALLAQVWSVLPRFCALPMDLQQSFDQSFAELLSNKLYSNIEIRPVICQS
FT                   LRLLVESNVVYAEEPEAAESEDVNDDLLLLERFPRSEAESNVAYLGTVSSKILAVLFNV
FT                   YGQTIPESRGFILECINAYLGITPAGEIGDIFDNVCGMLHKALEDEAKESKPEKDALPA
FT                   MSLTMLDILIALVPYIPASSHNTLLTVFVQMIQNSDPNHQKKGYRLLTRLAEADNSFET
FT                   LEKHLDNICGVVLESAESVTAVSRGARVAALAKLVALLPENDLYFIPATVSEAVIATKD
FT                   VNEKTRTSAYNLLVLMGEKMARGGVIDNTRIPGLEDAGLGSVNANLTEFFKAVSAGLAG
FT                   TSPNLVSATITGLSRILFEFKDDVPMDMLSELSQTVELFLTSQNREIVKSTLGFVKITA
FT                   ISLPIDLVEPQLSELLPKLLHWSHEHKGHFKAKVKHIVERLIRRFGFDTIEKHFPEADK
FT                   KLLTNIRKSKERSKRKRTEEKEEDAPMSSTKPKKEFASEYERALYGDSDSEDEDDYEEE
FT                   ETTKRASKYIMKSDDPLDLLSQQALAHITSSKPRGKKEPLLKSSKFKTNESGKMIFKED
FT                   EEEDVIPQGSAIDHYVEAIKNGPVRGQKNKYKYKKSKGGDDDGGDDDDVVPKRPTKKFS
FT                   RGGVSKPKGKPQQRRKF"
FT   gene            <851564..>853471
FT                   /pseudo
FT                   /locus_tag="YALI0_E07447g"
FT                   /old_locus_tag="YALI-IPF2308"
FT                   /old_locus_tag="YALI-CDS5277.1"
FT                   /note="similar to uniprot|CAD70921 Neurospora crassa 7F4.
FT                   170 Related to acid sphingomyelinase pseudogene"
FT   gene            complement(<853656..>856022)
FT                   /locus_tag="YALI0_E07491g"
FT                   /old_locus_tag="YALI-IPF2305"
FT                   /old_locus_tag="YALI-CDS0651.1"
FT   CDS_pept        complement(853656..856022)
FT                   /locus_tag="YALI0_E07491g"
FT                   /old_locus_tag="YALI-IPF2305"
FT                   /old_locus_tag="YALI-CDS0651.1"
FT                   /product="YALI0E07491p"
FT                   /note="weakly similar to uniprot|P53086 Saccharomyces
FT                   cerevisiae YGL216w KIP3 kinesin-related protein required
FT                   for nuclear migration"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07491g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79248"
FT                   /db_xref="GOA:Q6C6P8"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P8"
FT                   /protein_id="CAG79248.1"
FT                   /translation="MESSISVAVRVRPFTQTEQTYLQHNPKQQLFLGDGSLASSSTNTA
FT                   TVNPFTSRKGGKSIRKIINVVDDKMLIFDPPESSPVAGMHKAAFPGNTHRIREHRFVFD
FT                   QLFDEDASQEQVYNQTTRPLLSNIFDGYNATVFAYGATGCGKTHTISGRPEAPGVVFLT
FT                   MKELFDRIEALRDEKVIDVSLSYLEIYNETIKDLLEPSDKVLTLREDADKKISVSNLSS
FT                   HKPESVEEVMEMILQGNTNRTQSPTEANATSSRSHAVLQINVIQKNRTAELSESHTFAT
FT                   LSIIDLAGSERASATKNRGERLLEGANINKSLLALGNCINALCDPKRKLHVPYRNSKLT
FT                   RLLKFSLGGNCKTVMIVCISPSSQHYDETLNTLKYADRAKMIKTKVVRNQHSLDRHVGS
FT                   YLKMITEQRTEIETLRKREAEAIEQAVAKYVAAEQTRRDAIKEAITSLETTYSRTTSET
FT                   EQRVMGLHRIKLLTLQQSQLTSWMQLLSGPDFGALTSAYPELLYFVDDAQDRLKRLCSD
FT                   IEAINAFLDSCTRDMAAQNTVDQCLRRLKELEGWCEADEELFLIWAEQTRDHYEREFHE
FT                   CVSSVSLTDTFFGPIVSQFMNACLHMIQRIEDQEHVRLLSEALVGCENVFKSVSTAPIP
FT                   TPSTPNFSLPSAYKRSVVVRSPVQPPPKDKPSKRVRWAPSPALSTPRRTSNVLSTPSRL
FT                   PGPAAAVESPIDHPMDSPDSAPPPLDFSDAVNHSNVSILADGDSRANRVVTPTSGKFGI
FT                   RGSLRKCVSNHELKSPVRGGNKENHGLGMPQRVTQ"
FT   gene            <857819..>858736
FT                   /locus_tag="YALI0_E07513g"
FT                   /old_locus_tag="YALI-IPF2303"
FT                   /old_locus_tag="YALI-CDS3987.1"
FT   CDS_pept        857819..858736
FT                   /locus_tag="YALI0_E07513g"
FT                   /old_locus_tag="YALI-IPF2303"
FT                   /old_locus_tag="YALI-CDS3987.1"
FT                   /product="YALI0E07513p"
FT                   /note="weakly similar to DEHA0D18975g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07513g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79249"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P7"
FT                   /protein_id="CAG79249.1"
FT                   /translation="MNSKYAGKAYTETTVHKYHRNLIGIEHPTRYGAPHTNTVVFIGGL
FT                   GDGITTVPYVKPLADALDKAGWGVVELLTTSSFGGWGTGSLERDAEEVEKAVEYLTTKL
FT                   EAGGLPNKQKVVLLGHSTGCQDIMYYLTRGKERAKIDGAILQAGVSDRDATVLNIGEKK
FT                   WKETVAAAQKLVDEGKGDTVLSGEFAEIMHNTPISASRFVALNAPRGDDDFFSIDLPDS
FT                   DLEKSFGQIKVPLLFLMSGSDAFVDPKQDKQKIVDRYESFVKGGNWSELSGVIDGASHN
FT                   VGRDSKEGAVDAVVEKIESFVKSI"
FT   gene            complement(<858959..>859891)
FT                   /locus_tag="YALI0_E07535g"
FT                   /old_locus_tag="YALI-IPF2301"
FT                   /old_locus_tag="YALI-CDS4255.1"
FT   CDS_pept        complement(858959..859891)
FT                   /locus_tag="YALI0_E07535g"
FT                   /old_locus_tag="YALI-IPF2301"
FT                   /old_locus_tag="YALI-CDS4255.1"
FT                   /product="YALI0E07535p"
FT                   /note="similar to uniprot|P00812 Saccharomyces cerevisiae
FT                   YPL111w CAR1 arginase singleton"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07535g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79250"
FT                   /db_xref="GOA:Q6C6P6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P6"
FT                   /protein_id="CAG79250.1"
FT                   /translation="MNFEYFPERKLSIVSAPFSGGQPKGGVDKGPEYLLGGGLEKHLQS
FT                   LDWDTKFDGHLEFPVPESDEDIGKMKRPRYVAEASRRVYKAVSEAAVSGRFVLTIGGDH
FT                   SIAVGTVAGVREKYPDACLIWVDAHCDLNTPAATDSGNLHGCPLSWVTGLAKPEKDDPF
FT                   GWVPECLDFKNLAYIALRDVDDFEKKMIKEHGITAYSMHHVDKYGIGKVVEMALQKVNP
FT                   DLSKPIHLSFDVDAMDPFFAPSTGTPVRGGLTWREACYICEELAATGKLVAMDLVECNP
FT                   ALGASQKDIDDTISAGISLAKSACGDTLL"
FT   gene            <865962..>868118
FT                   /locus_tag="YALI0_E07557g"
FT                   /old_locus_tag="YALI-IPF2300"
FT                   /old_locus_tag="YALI-CDS1087.1"
FT   CDS_pept        865962..868118
FT                   /locus_tag="YALI0_E07557g"
FT                   /old_locus_tag="YALI-IPF2300"
FT                   /old_locus_tag="YALI-CDS1087.1"
FT                   /product="YALI0E07557p"
FT                   /note="weakly similar to uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1 extracellular alpha-1 4-glucan
FT                   glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07557g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79251"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P5"
FT                   /protein_id="CAG79251.1"
FT                   /translation="MRDESVASSGVRGLNYTDTSSYSTTTNALRSNNGRSNNSTYASSM
FT                   YSTSSSHTSSALDTLHQTRRMALDRLKGWRKSTASPKPTPQSAAALGAGPQITLQPLQC
FT                   KANAREPLQQRDITDPRSLAYQANKYTVSDNASIIRRHRPDQRSRNQNDFNLASEDPFS
FT                   DSCSLRPSSTRPSTAAASNTSTNKRLSVASNFSLKPTPAPPSATAQSIPCDSPRLRQSS
FT                   FSERPATANIPHSPDLSTMTTLPRTYTTRSQRIRIPQNPVSCWDDDEDEEEPKKGLFNR
FT                   FKSTRSFSSRKASISSTTESIQSAPAQSPSIKSVSPKNSKTLKPTKSVKSVKSVKTAKA
FT                   APKTKSSKKGSLGNKFGIDDLGDFEWNMHAYMEGDEEGSDAEIEAALRRVREAEANEAK
FT                   ETTPTPTSHTTTTTNTTTSTRVSTSHSTPTPESVSIPISVASSKVSPVLPPISPSQSLD
FT                   LGLEPTATPTAVHNERIENENIKLNGSPNYAREHVANLLRRRANSGNQSPVPQTPVPQV
FT                   VAPEQCPWDTWKYTSNHHTYQITPPDSTRSSHVYASDAAYDTSHHSMVLPESPVQLQPT
FT                   SSTSSSSSDQTKWNDISANIALIQQQIQEMSPRSRELARGFAAKELTKPATLVTPTTIS
FT                   PATFATPPPRPSRDNVELPECFSKPFLTMTNSPSVRPLPRRLNKLGPALEESDASPDSS
FT                   QRSSVSTRLSTAPSSPEPDMRCFI"
FT   gene            <871014..>871676
FT                   /locus_tag="YALI0_E07579g"
FT                   /old_locus_tag="YALI-IPF2297"
FT                   /old_locus_tag="YALI-CDS5245.1"
FT   CDS_pept        871014..871676
FT                   /locus_tag="YALI0_E07579g"
FT                   /old_locus_tag="YALI-IPF2297"
FT                   /old_locus_tag="YALI-CDS5245.1"
FT                   /product="YALI0E07579p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07579g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79252"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P4"
FT                   /protein_id="CAG79252.1"
FT                   /translation="MDERDHVRDQSDVNERHNNSSPNHVDIPPQPRDSHLSPKVKHTIN
FT                   ELRDRTRLSRDNIRSREASRPHFPGNSPGSYEFPSRDRKHSSHDVPSLLTTISALEARL
FT                   TGKDAEIGHLKTELTKAHEIIETLRAQKSGTPVGHVTLEDHNSQLAASAKQLHEIYGQK
FT                   VMSKVQKYRSRKQSQVKSLKDRISSLESALRDSRRENSELVAAVDEYIDVSKTCDDG"
FT   gene            <874406..>877894
FT                   /locus_tag="YALI0_E07601g"
FT                   /old_locus_tag="YALI-IPF2296"
FT                   /old_locus_tag="YALI-CDS0279.1"
FT   CDS_pept        874406..877894
FT                   /locus_tag="YALI0_E07601g"
FT                   /old_locus_tag="YALI-IPF2296"
FT                   /old_locus_tag="YALI-CDS0279.1"
FT                   /product="YALI0E07601p"
FT                   /note="weakly similar to uniprot|P32873 Saccharomyces
FT                   cerevisiae YPL115c BEM3 GTPase-activating protein for
FT                   CDC42P and RHO1P"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07601g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79253"
FT                   /db_xref="GOA:Q6C6P3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P3"
FT                   /protein_id="CAG79253.1"
FT                   /translation="MGVSKTHPPMPTLKDSYTLWANQMAVSTPSSPPQQNSVFGQGSDS
FT                   SLRSTLGLRKRRDKRASVSSLSSPTRSMSVRRTASASMGPPSISNGTNGTLHPSPPKRN
FT                   ASLHIAKVKSASDDNTVNGTSLPGYLQNSASHARVPSNSSFNFSQHSRTPSDVFAPDHI
FT                   SLHQKTDSMSSNDLDTLEQLVQPDLSMPEKATASLDQLYNMLAERTVQLSHNSYQNTQL
FT                   WAMVNKQRQMILDLQRDLDSSLEVNARYKRRLLRATGERDSTNATASKDTSSTNATTNA
FT                   SPPPTATNTSTGNSIPGNASSTANGSVTTVVPTTAATSAVSSSLPPQSDDNNSTTATSA
FT                   KSAVSSTPSPNGSTSSVATSINNTSAGSNNGGATTAASKHIPQPIVPLPYPLPAVSSAR
FT                   EPKGFSFEEDRDNSKTHRKTKSDTLNDDSFLVPEKSPSRDPRLRSKKSMASVVSSDDNT
FT                   LGAVSMSKSASMGAAAAPTTPSLPPPALAPEPITLYVKPTELSTIRVDVASSLGVARKK
FT                   DTPVVVLSVSDRATSKVLWRCSKEYNAFVALDNAIAPQIPSFKTKIPDRSLFTSHAPAR
FT                   VDIRKDQLNGWFGSLLAIPRLPSSAAQTLCEFLSTNTIDPLDVPDGDARKEGFLTKRGK
FT                   SFGGWKLRYFVLDGPMLNYYESPNGPHLGAIRLYNARIGRQTQEEDSNSEDAYRHAFLV
FT                   MEPRKKDYVRHVLCAENDRERDDWIEALLEFVTLPEPESPIKSIHSPAITTVPTNTSTL
FT                   NAYGESIYDEYSEAPTPTLPTTEAIDSVMESQIGTGLGIDVGSSETVGSGNGSGTRINT
FT                   GSGVVTSSSNSRISAPIASEPIQNLQKWGYKYSPSSQSLNAQLQNDGIDDHVSLSPNHN
FT                   IHSTPIQAPVPEVKEKKKFFLFRKGNSDRQHQQQQQHTSTPEYLQSVLEAEGMIQREER
FT                   PTTPSLTTPTQSQFDGNDYHQGGVFGVPLLQAIESSSKDIDGHVVPSVVWRCIQYLDDQ
FT                   KAHFEEGIFRLSGSASAIRILKARFNDHYDIDLVSDSSTVFDVHAVAGLLKLFLREMPS
FT                   LILTQQLSPAFRRAMEIPDIVNRIYELKTLVKQLPAESRDLLFVLAQYLCKIIEHQDYN
FT                   KMNLRNVGIVFSPTVNVPAGIFVLFLTDFDCIFGDAQPRTDINRKLQDFPQALLG"
FT   gene            complement(<878323..>878853)
FT                   /locus_tag="YALI0_E07623g"
FT                   /old_locus_tag="YALI-IPF2294"
FT                   /old_locus_tag="YALI-CDS5710.1"
FT   CDS_pept        complement(878323..878853)
FT                   /locus_tag="YALI0_E07623g"
FT                   /old_locus_tag="YALI-IPF2294"
FT                   /old_locus_tag="YALI-CDS5710.1"
FT                   /product="YALI0E07623p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07623g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79254"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P2"
FT                   /protein_id="CAG79254.1"
FT                   /translation="MTRLFETEADTLNMDRVRLLRRHILYNSNRDRLPPYTAWLKSESK
FT                   ENPGTKLPELAKRYSAMSDSEKAEIARQYGPDASEEGNVYDKYDYKTIRYPKLSGLNVY
FT                   LAEALKDQTRVLEDNKLKSTIAEWSALPESKKQHYNDLAKKKNESNASRLLKIFGEVKD
FT                   LYEQDNLAIGGRK"
FT   gene            <883448..>885319
FT                   /pseudo
FT                   /locus_tag="YALI0_E07645g"
FT                   /old_locus_tag="YALI-IPF11405"
FT                   /note="similar to uniprot|P35207 Saccharomyces cerevisiae
FT                   YLR398c SKI2 antiviral protein and putative helicase in
FT                   frame stop codons and frameshifts"
FT   gene            complement(<886552..>889821)
FT                   /locus_tag="YALI0_E07744g"
FT                   /old_locus_tag="YALI-IPF2291"
FT                   /old_locus_tag="YALI-CDS0350.1"
FT   CDS_pept        complement(886552..889821)
FT                   /locus_tag="YALI0_E07744g"
FT                   /old_locus_tag="YALI-IPF2291"
FT                   /old_locus_tag="YALI-CDS0350.1"
FT                   /product="YALI0E07744p"
FT                   /note="weakly similar to uniprot|P48016 Saccharomyces
FT                   cerevisiae YPR026w ATH1 acid trehalase vacuolar"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79260"
FT                   /db_xref="GOA:Q6C6P1"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P1"
FT                   /protein_id="CAG79260.1"
FT                   /translation="MHFSFGLLLAASSVLAAPVNTTSANVTSVAPLANTSATAASRGPV
FT                   FLPVPGPVNVTKGTEYNETALEYNNKTNVLTSHKFDKNYQSEAYVANGFIGIRLPVQGQ
FT                   GFSQSGNATNYTSLIEDRRFTGAYVSGFTAHSAGNGSLATEGFLASIPNWSELSVSVGN
FT                   QSYNGSTSEKHISNYSQSLSLQNGVVSTNVTWSPTNDTQLQLNYTVLAHRARPNVGIVR
FT                   LDITSQNATTVNITDLLNSKGSVGTSYLASGSDTGSIWTAVSALGSNNTVFEYSTLGFS
FT                   NYSSVNISTEANSTQSISQSVPVELSPNTTFTVIKYVGIASSDASPATFATARKAALVA
FT                   RALGFDTLLYEHSNAWNNIWNDGDIVVPGDEELQIAVKASLFHLLSSVRSGDEPKGYNA
FT                   NGIAVGGLSSSNLQGLPAAIDSTVSPALLALYPQFAKNVVNYRVGLANKVSSKSKRSLV
FT                   EPYHTSIDSALNAWNYFVSTNNTEWLNSTGYDFIAAAANHYAQQFSLNSSVGAYSSNVT
FT                   YKGVTVLDSAYVNAGAVTLFKAASAASDIVGEDPNPTWSDISENVYIPQSSKNITLPSS
FT                   NLGNLTLGVNALTYPLVYDAESAAHSRALANFHHYSKQVEKKKLSPVDASLLAIDSAAL
FT                   SESGSGSYTYLLQASQPFLRKPYYQFSAQEKPQGAFPYLPGAGAFLQIFTHGFTGFRPT
FT                   QDTLFIDPALPPQLPEGYAVKGFKYQGEVYDINVTGTYTYITRRGIETLSTGNATFGNG
FT                   TFFANGTKFNATNTTLYDATAFANFTGLNVSTLPAFNWTALGANLTVSNFTVNNTSFGY
FT                   FNFSSLQNVTFGDLNVTVWGGLNVSNVTLGNAHTLNVTNLGFANATSFNGTFFNATSFG
FT                   SSNETSLPVFWELPSGLYNASNETLVSAQDSTDSTPVFIQIGGRNSAAGNYSIKVNQTL
FT                   IIPTYRGDIYFKNIPGNVAENAPVSSKEEWHPARFPVSINDGDNATYWQPINASRSEVV
FT                   IDLGRERPISEATIVWGPFTPKNYSIGVLPVANGTLNWANTTYSNFSVESRVLAQNSTI
FT                   GGDVSKVQLHNATARYVTLAIEGLSGKHGKHPGAVAELAFN"
FT   gene            <895765..>895883
FT                   /locus_tag="YALI0_E07755r"
FT                   /old_locus_tag="YALI0E07756r"
FT   rRNA            895765..895883
FT                   /locus_tag="YALI0_E07755r"
FT                   /old_locus_tag="YALI0E07756r"
FT                   /note="5S RNA"
FT   gene            complement(<897661..>898936)
FT                   /locus_tag="YALI0_E07766g"
FT                   /old_locus_tag="YALI-IPF2287"
FT   CDS_pept        complement(join(897661..898724,898936))
FT                   /locus_tag="YALI0_E07766g"
FT                   /old_locus_tag="YALI-IPF2287"
FT                   /product="YALI0E07766p"
FT                   /note="similar to uniprot|P07246 Saccharomyces cerevisiae
FT                   YMR083w ADH3 alcohol dehydrogenase III"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79261"
FT                   /db_xref="GOA:Q6C6P0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6P0"
FT                   /protein_id="CAG79261.2"
FT                   /translation="MSDVPKTQKAVVFEEVNGPLMYKDIPVPTPAKDELLVKVQYSGVC
FT                   HSDLSIWKGDWAQQLRFSPKMPLVGGHEGAGEVVGMGDQVTGWQVGDRTGVKFISGSCL
FT                   TCEHCSAGWDQHCVAPGVSGLLKDGSFQQYACVKAATAPRIPDSCDLAGVAPVLCAGIT
FT                   AYTALKNSGLKAGEWVVITGAGGGLGSYAVQYAKCMGFRVIAIDTGDDKETHTKELGAE
FT                   VFIDFAKSGAGMIAEIHKLTGGGAHAVVNFAVQDAAVEAATLYVRTRGTLVLCALPPNG
FT                   TVKSHILNHVGRGLTIKGSYVGNKLDTQEAIDFYARGLVKTKYRLGELSKLEEYYQQML
FT                   DGKIVGRVVVDNSK"
FT   gene            <901532..>902533
FT                   /locus_tag="YALI0_E07788g"
FT                   /old_locus_tag="YALI-IPF2285"
FT   CDS_pept        901532..902533
FT                   /locus_tag="YALI0_E07788g"
FT                   /old_locus_tag="YALI-IPF2285"
FT                   /product="YALI0E07788p"
FT                   /note="weakly similar to DEHA0B09856g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79262"
FT                   /db_xref="GOA:Q6C6N9"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N9"
FT                   /protein_id="CAG79262.1"
FT                   /translation="MLQLLAVTFFLSGIVTTLLGNVSPAIQKLSYYGKTLTQKTNSTLA
FT                   LPKPWFIHFYILAAFLGYYSLFIVYDSFSDNHILIDVLGLLDSPISANNMFANGWTDWM
FT                   DDLVSNINEWKLISTTHVQKPLTTLVLLLLGTIQGTRRLYECVYVMKYKVKTGASRVAE
FT                   EQRKKKEGQTAEIESRESQMLLTHYLVGMGFYVAVFCSLWATGVAGVRDMEEWDFDYNS
FT                   VGLSIAISLFLVASTLQYLCHVHLSSLIKYSLPTFWPFKITVCPHYTCEALIYMSYIGV
FT                   SLSTGSTPNYGLLLAPLFTLTVLTTSAKNSKDWYKQKFPEYNVRWLTIPGVL"
FT   gene            complement(<904297..>905337)
FT                   /locus_tag="YALI0_E07810g"
FT                   /old_locus_tag="YALI-IPF2284"
FT                   /old_locus_tag="YALI-CDS3824.1"
FT   CDS_pept        complement(904297..905337)
FT                   /locus_tag="YALI0_E07810g"
FT                   /old_locus_tag="YALI-IPF2284"
FT                   /old_locus_tag="YALI-CDS3824.1"
FT                   /product="YALI0E07810p"
FT                   /note="weakly similar to uniprot|Q890E1 Lactobacillus
FT                   plantarum LP_0082 zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79263"
FT                   /db_xref="GOA:Q6C6N8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N8"
FT                   /protein_id="CAG79263.1"
FT                   /translation="MQAAFTTAYGGPDKIEYSENFSLAQLKSNDHVLIQVANSALNPID
FT                   GLRNRGYLRLLQPDSHPHIFAYDVAGFVAEVGTAVTAFKKGDRVYARIGESEQGTTAGF
FT                   VSVRDAHVAIAPKNKPLLETAGIPLVGLTVLQSFEAGNLKRGQRIFISKGAGGVGTFAI
FT                   QLAKHVYGAYVITTASEKKIPLLKELGADEVIDYHKTNFWDVVKDVDFAYDVSDQPWAH
FT                   AMITKKGGVVVALRGVPTAQSAKNILSTEPGLILSYVLAAGNFLTSRFAWWYGTRYDAV
FT                   FCAASGKDLAQIAKYIEEGKIKPIVDSVYDLRNAKDAVEKLESGRATGKVIISVDDTLD
FT                   KGFKLP"
FT   gene            complement(<908935..>909591)
FT                   /locus_tag="YALI0_E07832g"
FT                   /old_locus_tag="YALI-IPF2281"
FT                   /old_locus_tag="YALI-CDS5265.1"
FT   CDS_pept        complement(908935..909591)
FT                   /locus_tag="YALI0_E07832g"
FT                   /old_locus_tag="YALI-IPF2281"
FT                   /old_locus_tag="YALI-CDS5265.1"
FT                   /product="YALI0E07832p"
FT                   /note="weakly similar to uniprot|Q01589 Saccharomyces
FT                   cerevisiae YDR077w SED1 abundant cell surface glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79264"
FT                   /db_xref="GOA:Q6C6N7"
FT                   /db_xref="InterPro:IPR038843"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N7"
FT                   /protein_id="CAG79264.1"
FT                   /translation="MKFSVATVAALAAAAYAQVSNSTLATTEAPVTSAAPIESAENNGT
FT                   ELTTGTVSIIKTETNVVTAYTTYCPYPTEIVEGNKTYTVTEATTLTITDCPCTRTTTVV
FT                   TETITTCPVSEFPTEPITEGPKPTESKPAPSPKPEESKPAPSPKPEESKPAPSPKPEES
FT                   KPAPKPTASKPEQPAASTPVQTQQPAISSGPEQASSANRVTVGAVAAIAAAAYLL"
FT   gene            <916365..>916464
FT                   /locus_tag="YALI0_E07854r"
FT   tRNA            join(916365..916403,916420..916464)
FT                   /locus_tag="YALI0_E07854r"
FT                   /product="transfer RNA Leu (AAG) cove"
FT   gene            complement(<918463..>919701)
FT                   /locus_tag="YALI0_E07898g"
FT                   /old_locus_tag="YALI-IPF2279"
FT                   /old_locus_tag="YALI-CDS2516.1"
FT   CDS_pept        complement(918463..919701)
FT                   /locus_tag="YALI0_E07898g"
FT                   /old_locus_tag="YALI-IPF2279"
FT                   /old_locus_tag="YALI-CDS2516.1"
FT                   /product="YALI0E07898p"
FT                   /note="weakly similar to uniprot|P35190 Saccharomyces
FT                   cerevisiae YGL215w CLG1 cyclin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79265"
FT                   /db_xref="GOA:Q6C6N6"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N6"
FT                   /protein_id="CAG79265.1"
FT                   /translation="MAFQYPYSHHHMAQAPPMDQGYFHQAPQAPMSSHYSAHYDYDMTR
FT                   DMGYDMTRGGYPTYHNMGYPPQVVPPPIQMPAPAPPAVTGGVSATLDYEIKDMAEFLTT
FT                   MALGIMKPNPEVGHDAFKAFASQVLSATRLPRATVVLSLVYLSKRWAMKDLELGHEKSS
FT                   GYIYRMSVVSLLLANKFHDDNTFTNRSWSQATGIAVGELTTLEADWLQKISWSLHLDQQ
FT                   DLKGWHRWNDCWNYWVANSPKSSAASSPLVSVSNSEVSTTNTSPHASSPVSPVSLSKPK
FT                   VGSVIMTSPTRPFYTVPSWYNQPASNMDSACAPQHHHQQHPPSAFTSYFQQSFASVGPP
FT                   VQAPMQAPSIPPPHHQMDHHHVAPQVMPMPPPHHSTHHYPECKEGPIASYYNPVCDCAH
FT                   CVFDPFPKHVVAC"
FT   gene            <922645..>924468
FT                   /locus_tag="YALI0_E07920g"
FT                   /old_locus_tag="YALI-IPF2277"
FT                   /old_locus_tag="YALI-CDS1564.1"
FT   CDS_pept        922645..924468
FT                   /locus_tag="YALI0_E07920g"
FT                   /old_locus_tag="YALI-IPF2277"
FT                   /old_locus_tag="YALI-CDS1564.1"
FT                   /product="YALI0E07920p"
FT                   /note="similar to DEHA0B03696g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79266"
FT                   /db_xref="GOA:Q6C6N5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N5"
FT                   /protein_id="CAG79266.1"
FT                   /translation="MTILGEDDNKVKELVKGGIDDIKSIDVKKSVQKCVSGASSGLKNA
FT                   YETVKFKTTTREGLIGDYDYKFLLTPKIPFMKKSKKGDKNRSTFFAVDSSLPLLLAILL
FT                   GFQHSLAMIAGIVTPPLLMASAANFDAQMTQYLVSAAMIGSGLLSLIHIIRFRIPGTHL
FT                   YVGTGLISVVGASFSTITVFTTGLPIMYKSGVCPVSETGAPLPCPEGYGMIIATASLCA
FT                   LIELLCSFLPSKFLMKLFPPVVTGPVVLVIGVSLIQSGFKDWAGGAGPCFGRPTSGDFM
FT                   LCPSNDAPMAAPWGSAQFIGLGFLVYVAILTCEKYGAPIMKSCAVVIGLLVGCIVAAAC
FT                   GYFDATPINEAPVATFLWTTTFPLKLYGPVVLPLLAVYLTIMMETIGDITATCDVSRVA
FT                   VSGPEYESRIKGGIRGDGIIGSIAGLLTLTPCSTFAQNNGVISLTKCANRQAGGWACFF
FT                   ILMMGIFSKFAAAFVSIPKPVIGGMTTFLFTSVAVSGLAIISRNPITRRDRIVLTASLV
FT                   LGLGATLVNNWFSFVFTYEGDNQSLQGFLDAIQLVMSSGFSVTGFVGVIANLIIDDDEE
FT                   EDEDDKEHTLEICSSSSSITQVDLEAGQKVE"
FT   gene            <927326..>929128
FT                   /locus_tag="YALI0_E07942g"
FT                   /old_locus_tag="YALI-IPF2274"
FT                   /old_locus_tag="YALI-CDS1746.1"
FT   CDS_pept        927326..929128
FT                   /locus_tag="YALI0_E07942g"
FT                   /old_locus_tag="YALI-IPF2274"
FT                   /old_locus_tag="YALI-CDS1746.1"
FT                   /product="YALI0E07942p"
FT                   /note="weakly similar to CA1593|CaMIG1 Candida albicans
FT                   CaMIG1 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79267"
FT                   /db_xref="GOA:Q6C6N4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N4"
FT                   /protein_id="CAG79267.1"
FT                   /translation="MEFTATNSDREMHPPPVAVPSHLQQSTTHRTVPKTNPKTGKSEMP
FT                   RPYKCPICDKAFHRLEHQTRHIRTHTGEKPHECTFPGCTKRFSRSDELTRHSRIHLNPN
FT                   TRRAKNMNSAAAAAHNAAAQQKGPPSNQQPKDDRTDRLVAISNLVDHHDAHPPIPGGSG
FT                   IKSEYSSAYSTPYSSVPSSPTMGQASLYRPYGAGPGGPPPPGGPGGLGGPAPPGPPGHH
FT                   GGPPTHIGLPPLHHPPPPGGPHSAAPSAPNSTPGSPMFVRVPHSTYPRSTFDMNMLATA
FT                   ASQQLERENAPPSGLSSGAPSAAPSGTSSPFNHSPSSSPLQSTQSSPALASYFSRPPAP
FT                   SSNPGTPGSSHGPPYGFSSGTSLSSHGNTHSNHFQHPQHLHPPHHHHGLQGHIFAGLQR
FT                   MTPMSGRDDSEPWHRSKKSRPNSPSSTAPSSPTFSNSESPTPDHTPLATPAHSPRIHPR
FT                   DLEGVQLPSIRSLSIGRHVPPTLPPMEIAPRSSGGTHTGTHTPYGGGSASHTPFGTSPN
FT                   SGVPPPHPNAAQGAASSLSMLAMAGLNHAAGGAAPGGSGAAATSSTRDEPSNDTSGPAS
FT                   GSGPSAPSTASSSTRMAVSDLIDR"
FT   gene            complement(<931851..>932255)
FT                   /locus_tag="YALI0_E07964g"
FT                   /old_locus_tag="YALI-IPF11380"
FT   CDS_pept        complement(931851..932255)
FT                   /locus_tag="YALI0_E07964g"
FT                   /old_locus_tag="YALI-IPF11380"
FT                   /product="YALI0E07964p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79268"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N3"
FT                   /protein_id="CAG79268.1"
FT                   /translation="MSDNWSDTFSLKLESQLPGSDPVVTGRYVLQSTVSSTHMSWNLKG
FT                   SPIIRAQHHSLFLQTASRWWLVGQKLPKETTTLCNRTALKTTQKMAQKMAQKMAQKMAQ
FT                   KLAQKRSSCSRDLSGLCLHSWNQPNDQELT"
FT   gene            <933047..>933580
FT                   /locus_tag="YALI0_E07986g"
FT                   /old_locus_tag="YALI-IPF11382"
FT                   /old_locus_tag="YALI-CDS5698.1"
FT   CDS_pept        933047..933580
FT                   /locus_tag="YALI0_E07986g"
FT                   /old_locus_tag="YALI-IPF11382"
FT                   /old_locus_tag="YALI-CDS5698.1"
FT                   /product="YALI0E07986p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79269"
FT                   /db_xref="GOA:Q6C6N2"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N2"
FT                   /protein_id="CAG79269.1"
FT                   /translation="MKYCCPYPQCKSRLVVANKHPIELLVRASAASEDALKVQKAALNF
FT                   VNSKDVVASDSEKTDTKAIESEKSELKTDAAEATHVATTNPDSEFFLPFYDPFDFDNIS
FT                   VTKPVFEAGQEPSLISSDGKTTVSIERLLACAECDRGPFGVIGKVSNVGTHDGLTHDKN
FT                   VYLLRPESVVVTES"
FT   gene            complement(<934849..>936210)
FT                   /locus_tag="YALI0_E08008g"
FT                   /old_locus_tag="YALI-IPF2271"
FT                   /old_locus_tag="YALI-CDS2767.1"
FT   CDS_pept        complement(934849..936210)
FT                   /locus_tag="YALI0_E08008g"
FT                   /old_locus_tag="YALI-IPF2271"
FT                   /old_locus_tag="YALI-CDS2767.1"
FT                   /product="YALI0E08008p"
FT                   /note="weakly similar to uniprot|Q08294 Saccharomyces
FT                   cerevisiae YOL155c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79270"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6N1"
FT                   /protein_id="CAG79270.1"
FT                   /translation="MKLSLATIVAFSALVVAQNPSPETVSSDIATGTPSTLSPGSTSQA
FT                   ASGTLAAPTATPTSTATSANLSVLDNVLSEVQAVLADVLAELPDIPELQALIATVNASL
FT                   TDILARLPALEAGQSASSAAAASSTASASPSSNFTNPLLVRQVRRVVKLVARDSIAELS
FT                   DDVSTLVGNLQAIVAIIEGVEPRSDSLQAALDQILAIIARLENWLAETNGEEVPTSSAG
FT                   SAISGSASVISGSAPATSTSPFVTTLSISSASASASVSAGSDGSSSSSSSSSTEVTIVY
FT                   VKECGCYKHKDGSVATHEEVEAHEAAHSQSKGDTESKGDTKGSSSGGKTTYSTDSASSG
FT                   SSSSGSSSSGSSSSGSASHAGSSFSGASSPGSAVSDSSSSSRLAAHAGSSSSSGSSSSS
FT                   SPAAAAGGSSAPGSAPAAGPALSPAGEHVAQANGASAMSVGTAALALPFIMALF"
FT   gene            complement(<938541..>940673)
FT                   /locus_tag="YALI0_E08030g"
FT                   /old_locus_tag="YALI-IPF2270"
FT                   /old_locus_tag="YALI-CDS1119.1"
FT   CDS_pept        complement(938541..940673)
FT                   /locus_tag="YALI0_E08030g"
FT                   /old_locus_tag="YALI-IPF2270"
FT                   /old_locus_tag="YALI-CDS1119.1"
FT                   /product="YALI0E08030p"
FT                   /note="similar to uniprot|P40416 Saccharomyces cerevisiae
FT                   YMR301c ATM1 ATP-binding cassette transporter protein
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79271"
FT                   /db_xref="GOA:Q6C6N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6N0"
FT                   /protein_id="CAG79271.1"
FT                   /translation="MWLSLPRSGYGSVATLTSKRVLACLTPLRQFSTSPAVSNANHKNV
FT                   DNINKSPANDAANNAVEKGDKPTTSPEKLATKAEKSSANSVKAAANALGESNLSNSEQR
FT                   RLDWIIMKDMLKYIWPKGKTSVKFRVLVAVALLVGAKLLNVQVPFFFKEIIDDMNIEWN
FT                   SATALGVGITALIFSYGAARFGAVLFGELRNAIFASVAQKAIKEVATNVFRHLLKLDMA
FT                   FHLSRQTGGITRAIDRGTKGISFVLSSMVFHIIPIALEISLVCGILSYNFGWKYALVTG
FT                   ATMVSYAIFTITTTSWRTKFRRNANRADNEASNVCLDSLINIEAVKSFGNEGYMVDKYQ
FT                   SALTKYEKASIKIATSLAFLNSGQNLIFSSALTAMMYMTCCGVADGSLTVGDLVLVNQL
FT                   VFQLSVPLNFLGSVYRDLRQSLLDMGSLFSLQKVAGQIQESPNAKPLQLTNGEIRFENV
FT                   TYGYHPDRPILKNASFVIPGGLKTAIVGPSGSGKSTILKLAFRFYDTQEGRILIDGQDV
FT                   REVTLASLRSAIGVVPQDTPLFNDSIMNNIRFGRLEADDKEVENAACAAKLDALVRQLP
FT                   DGWNTNVGERGMMISGGEKQRLAVARVLLKNSPVVFLDEATSALDTNTERQLLANMDQV
FT                   LGDKTCVAIAHRLRTVADSDKIICLNQGGVEEEGTQAELLLKDGLYKSMWDAQEQVELG
FT                   EEGIKEAEEKAAKKDV"
FT   gene            complement(<941685..>942635)
FT                   /locus_tag="YALI0_E08052g"
FT                   /old_locus_tag="YALI-IPF2266"
FT                   /old_locus_tag="YALI-CDS4192.1"
FT   CDS_pept        complement(941685..942635)
FT                   /locus_tag="YALI0_E08052g"
FT                   /old_locus_tag="YALI-IPF2266"
FT                   /old_locus_tag="YALI-CDS4192.1"
FT                   /product="YALI0E08052p"
FT                   /note="weakly similar to DEHA0E14619g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79272"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M9"
FT                   /protein_id="CAG79272.1"
FT                   /translation="MSGAIVDTLNVAFTAGSVVADTFGIRALLEFNRYGTATVAPLPTQ
FT                   NLKAYYIRRNRRDRNRMVNVFAGNGQLVYTIERKTQFSTVWSVLSTDRREVATVNAGLF
FT                   NRCFDFHNKPEVQHRDLLAETGLTGIYRKFYLADGAAYEWSRSSGFLERIVNPGGGDEE
FT                   IRQRVAKARLMRQFRFDYELVVDESGIDADVAIVTGFITMLCSWGLGNSTATRGPTYIP
FT                   GNPGPNPAPRPLPMPTPAPGYPLLPPGGPLPGPMSDPNNGVELVIHSGSGTQNATTTVS
FT                   LDDDNVFLVLDEADEHGNFMSNDELLREVERQLGV"
FT   gene            <943659..>944207
FT                   /locus_tag="YALI0_E08074g"
FT                   /old_locus_tag="YALI-IPF2264"
FT                   /old_locus_tag="YALI-CDS5655.1"
FT   CDS_pept        943659..944207
FT                   /locus_tag="YALI0_E08074g"
FT                   /old_locus_tag="YALI-IPF2264"
FT                   /old_locus_tag="YALI-CDS5655.1"
FT                   /product="YALI0E08074p"
FT                   /note="some similarities with DEHA0F23397g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79273"
FT                   /db_xref="GOA:Q6C6M8"
FT                   /db_xref="InterPro:IPR008594"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M8"
FT                   /protein_id="CAG79273.1"
FT                   /translation="MTATTIIETPDYFYSSVLPVVQNSFALDHKWADGVLYRDESPQDV
FT                   IYGDLDQKTGFVLFIHQKWNERDFRELNLIAIAYRHDVHSLRDLVPDHVDWLQSMRNQV
FT                   VNILPEIYGIKMKSMQPVLYVPYPPGKYHFHFLIREKSSPILQEELRSGRALLLDHVIN
FT                   QLQQGVFYRDVTLKFEVNQ"
FT   gene            complement(<947212..>947487)
FT                   /locus_tag="YALI0_E08085g"
FT   CDS_pept        complement(947212..947487)
FT                   /locus_tag="YALI0_E08085g"
FT                   /product="YALI0E08085p"
FT                   /note="weakly similar to uniprot|Q6BRR7 Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08085g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64326"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH2"
FT                   /protein_id="CAR64326.1"
FT                   /translation="MDSQSITNLMDSIYIPSTKKTTSTSIPAHHPSLIQQDNVGDNHAL
FT                   PCGCTGNTCISNQLWWSKNSSAAAASSPVLASRRDSMVSQDSFMSL"
FT   gene            complement(<952145..>954247)
FT                   /locus_tag="YALI0_E08096g"
FT                   /old_locus_tag="YALI-IPF2263"
FT                   /old_locus_tag="YALI-CDS1160.1"
FT   CDS_pept        complement(952145..954247)
FT                   /locus_tag="YALI0_E08096g"
FT                   /old_locus_tag="YALI-IPF2263"
FT                   /old_locus_tag="YALI-CDS1160.1"
FT                   /product="YALI0E08096p"
FT                   /note="weakly similar to uniprot|P53746 Saccharomyces
FT                   cerevisiae YNR060w FRE4 Ferric reductase transmembrane
FT                   component 4 [Precursor]"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79274"
FT                   /db_xref="GOA:Q6C6M7"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M7"
FT                   /protein_id="CAG79274.1"
FT                   /translation="MKVSTVLVTFLSASSASAKTYRRQDSLNNKPYWAALGCDHLIGGH
FT                   YKFNFPKFDSSTVKSRKQILEEYCKVMPFIQSKLLCYQGAIEPEHYHTQVRKQIIQGCP
FT                   NYLTLEMTDEWLANATKIAVEPEDPTEILYLPVPFDREHWEEEYEEVKPHYVALDYASY
FT                   YGVALLAYWALVFVIGTIINFSQHALFSVYKKVGFNKFRKYVSLPALFGYKHSQPMGWD
FT                   PLKMASPTRIQSLVVLGYLIMAFVLCFPSYPFDDDYEEAGPWGAQLEAFVADRTGIMSF
FT                   TQAPIVFLFAGRNNLLMWLTGWSFDTFNVYHRWTSRVMMIYAIIHSCIWTWMCRHSLAR
FT                   DAAELYWVLGTVATIAGSLMLLQAMHVFRSRWYEIFLVLHIVFGILFVVGLWYHCWTIG
FT                   WMQWVWATIAVWGFDRIIRVCRIAYCGGIVTGDFTLVDREQLIVKAEIPCSRLWSIYPG
FT                   AHVYIYFLSGNKFWESHPFTIYQSPEACKNGNMTLLLKAKDGITFDIVTRLVSAGGARP
FT                   MKMLIEGPYGAKHPVGKYDSSIYIAGGIGITATYSYAQKVVANSVSKSIIFTWVVRGDS
FT                   CLEWFGDELEYLLADPRVRVNLYITKIDKKEGLAEELAEEACELESKSPEKLSITSSNR
FT                   DNLNIQHFRPHMAELLPEYLKESPGSTAIVVCGPPAMNDDVRQALCANIESKSERVDYF
FT                   EESFSW"
FT   gene            complement(<956044..>956162)
FT                   /locus_tag="YALI0_E08107r"
FT                   /old_locus_tag="YALI0E08116r"
FT   rRNA            complement(956044..956162)
FT                   /locus_tag="YALI0_E08107r"
FT                   /old_locus_tag="YALI0E08116r"
FT                   /note="5S RNA"
FT   gene            complement(<956167..>956257)
FT                   /locus_tag="YALI0_E08118r"
FT   tRNA            complement(join(956167..956202,956220..956257))
FT                   /locus_tag="YALI0_E08118r"
FT                   /product="transfer RNA Asp (GTC) cove"
FT   gene            complement(<956673..>958208)
FT                   /locus_tag="YALI0_E08162g"
FT                   /old_locus_tag="YALI-IPF2260"
FT                   /old_locus_tag="YALI-CDS2265.1"
FT   CDS_pept        complement(956673..958208)
FT                   /locus_tag="YALI0_E08162g"
FT                   /old_locus_tag="YALI-IPF2260"
FT                   /old_locus_tag="YALI-CDS2265.1"
FT                   /product="YALI0E08162p"
FT                   /note="weakly similar to CA0775|CaIFK2 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79275"
FT                   /db_xref="GOA:Q6C6M6"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M6"
FT                   /protein_id="CAG79275.1"
FT                   /translation="MSTVFADGSLFSNVLILGTGFSGLATSIKLRTSWKEADFHLYDRD
FT                   HSWGGTWAANTYPGCGSDIPAIWYCLTSDPKGDWSKAFPPRDEIYDYIQKLVAKYELRH
FT                   MATFRTEIEGCKWNADEKLWYVNVRSLETGKKWVHKCRVLFTCKGGLVEPNRVQIEGLY
FT                   TDFKGPVMHTARWDHSVDYTNKNVVVIGNGCSAIQVIAAIHDQTKTLTQFARTPQWITP
FT                   RPEFVPGRITRFIFTRFPFVLHLLRTIVFFVIEAAYPMFKKGWLGTFIRRIRAHHATQN
FT                   IRKKSPEKYWKVLKPDYEFACKRLIFDCGYLGPALNNPNMELTFDRVVKVESNKVITKD
FT                   GNSYPADIIIDATGFDLSGGFTNIPFIGEHGVSLEDFWANGRVSAYETVLVPNFPNNFL
FT                   IFGPNSATGHNSVLFAIENAIKFCESVGVKKLISGETDYIGVRAEAYDRWIHDVDSSHA
FT                   QGLLQQGGCQSWYLADNGRNATTYPWSQLTAWLRARWIDKNAIVIGNGEKKTK"
FT   gene            <962949..>963293
FT                   /locus_tag="YALI0_E08184g"
FT                   /old_locus_tag="YALI-IPF11377"
FT                   /old_locus_tag="YALI-CDS6008.1"
FT   CDS_pept        962949..963293
FT                   /locus_tag="YALI0_E08184g"
FT                   /old_locus_tag="YALI-IPF11377"
FT                   /old_locus_tag="YALI-CDS6008.1"
FT                   /product="YALI0E08184p"
FT                   /note="weakly similar to uniprot|P40096 Saccharomyces
FT                   cerevisiae YER159c NCB1 functional homolog of human
FT                   NC2alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79276"
FT                   /db_xref="GOA:Q6C6M5"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6M5"
FT                   /protein_id="CAG79276.1"
FT                   /translation="MSEKPREIKTRFPVARIKKLMQSDDDIGKVAQATPTAVAKALELF
FT                   MISLIEETCNQARMRNSKRVSPSHLKQAVLETEQFDFLQDIVSKHPDAVAPATGEEEQP
FT                   KRRGRKPAQE"
FT   gene            <967050..>969642
FT                   /locus_tag="YALI0_E08206g"
FT                   /old_locus_tag="YALI-IPF2258"
FT                   /old_locus_tag="YALI-CDS0802.1"
FT   CDS_pept        join(967050..967086,967199..969642)
FT                   /locus_tag="YALI0_E08206g"
FT                   /old_locus_tag="YALI-IPF2258"
FT                   /old_locus_tag="YALI-CDS0802.1"
FT                   /product="YALI0E08206p"
FT                   /note="weakly similar to uniprot|P47139 Saccharomyces
FT                   cerevisiae YJR098c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79277"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M4"
FT                   /protein_id="CAG79277.2"
FT                   /translation="MPVCVYEQACSLMIPTSELDHSVDHQISTEYRANGDHNPHFNEHK
FT                   DHHHPEGAEQGFTGNLELRSDEDVESDSTMSDIESEEELEDDEFVDHAEEVLDRQKHHE
FT                   DIIGGVHQIHHHHHHHYHRHKPEGNEGRGRESLSPARSTMSMGGSMPDGEQLSPKASAI
FT                   AGIVRSDTTDSRREDSPDMLTHKSKHKTFTFGMPFSNPLANKESKKGKKEKKEKKEKKE
FT                   KIKRAATFGSVFNKEEDEAELAKMDSATQAEHESVAQIRQKLNRNLSITTEEEDKLFGN
FT                   KHDLQSVRVNKIVSNATMPTVLDSMKIGNKQKLSKHDAFNALEGDFVILGGYRGSVLRD
FT                   AKSKRRVWIPIKVGFNLRKIDLTVDTSDDSETNMEKKIYPDGMLTHIGPIDLSKRLIQK
FT                   ISYNPKCRIRDFGYDWRLDCGLNSKKLIEFLEKIYAENGNKKITVMAHSMGGLVTHKAM
FT                   LMRPDLFKGVLYLGSPSECPAIIGPIKNGDAVLLSSKVLTAQINFLMRSSFIFLPEDKQ
FT                   LFVDKNTGQRIDIDFYDPEQWKKYALSPCVSEEHRQRCLQKKRRGTELSKLKPSNLSEH
FT                   EHHHHHHGVGEKLHKLASVIAHPREHKDHYENMHPEATASGADAMAVATGHSGLVTMGS
FT                   STGNNDANIPTIDYDDACNYLERTLKRTKELRASFWYDEKRKDEYPPLACVIGTTVPTL
FT                   KACRVDGFEGIYKGDFSDFVLGSGDGVVYSKWNMPEPFGFKVVAKVKTNRGHVCLMTDH
FT                   VAVAKALIALQEAAEKREKGEPYLPDITPVHSIPVTDDDSGASTPVHSQPVSAQNSPAP
FT                   GHPPQFSSPLKYSA"
FT   gene            complement(<969836..>971239)
FT                   /locus_tag="YALI0_E08228g"
FT                   /old_locus_tag="YALI-IPF2256"
FT                   /old_locus_tag="YALI-CDS2619.1"
FT   CDS_pept        complement(969836..971239)
FT                   /locus_tag="YALI0_E08228g"
FT                   /old_locus_tag="YALI-IPF2256"
FT                   /old_locus_tag="YALI-CDS2619.1"
FT                   /product="YALI0E08228p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79278"
FT                   /db_xref="GOA:Q6C6M3"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR028846"
FT                   /db_xref="InterPro:IPR041981"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M3"
FT                   /protein_id="CAG79278.1"
FT                   /translation="MDRPFTRPLSTADISTSLADLFKQPHPSNNSEILGLLYHLAETCS
FT                   KNIGVVHRGITCDGCGTSPIVGTRYHCSECVDVDLCQYCVVLRKHQWSHVLIKIKIPAP
FT                   LKYSPQWVCEGWTGCDNDVITRTNVKEEETNGSRDEPCDKNDSDTNHMEAHVLSNDPPQ
FT                   DDLSDKEKHTISAQTGIEPNAVQKAWRKFFVLCDERDPEPSEIKSTSFYISHSKLIATY
FT                   TIVSGDDRPDATQENIVRLYNLSRHPTRVSFVDFLTVEHWMDSTAPHCELDLVAGFFDL
FT                   NKNEGPSSTRKRVSRMALLHSLMKLFNTIITQQIWWGANNESRDMEEIVTGPGPVSSKF
FT                   QEYNDFIRQRYFDRKPFPKEDHPDGDMSKPYLQPPISAISSMENMARDTPVDALHAHFG
FT                   GHYSLLQEMIGMACGTELMNPLLKILKSRGVIDRKTRHIIGDVHVMAGDQEAMLLISRL
FT                   AGLIRKLRG"
FT   gene            <972471..>975203
FT                   /locus_tag="YALI0_E08250g"
FT                   /old_locus_tag="YALI-IPF2255"
FT                   /old_locus_tag="YALI-CDS0593.1"
FT   CDS_pept        972471..975203
FT                   /locus_tag="YALI0_E08250g"
FT                   /old_locus_tag="YALI-IPF2255"
FT                   /old_locus_tag="YALI-CDS0593.1"
FT                   /product="YALI0E08250p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79279"
FT                   /db_xref="GOA:Q6C6M2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M2"
FT                   /protein_id="CAG79279.1"
FT                   /translation="MTLPLSQESPADSPKGDSRFSRFFKNLRGNESRESIATRKSSVGK
FT                   QPQVHFQSTEFLSRDSPDSSESRGLPTTPDVDINQYFLQFNKLTGYDSKIPEKPRDLDT
FT                   PEQRGMLGVYEDFMRAQRGTQWRDGDLGPMEREAKLKDDYSAHSRPSDDLKISPVDPES
FT                   HDLGTSRPYDWSRDVDNATLTPMTPHVPSSCYSIHKENPYLESRDASRDGDKSREIYDF
FT                   VTKSDGSSKPRGYDNCHSTTSDPPSRASRASRVFFALTLTCLLIILKTRVTTIILNYGI
FT                   EDSQIYSQTACATLNTYAATTHFGPNLLYSAITGQAAGYVGDMAQGLLPGSDVTMRTPG
FT                   FVDGLLSQMKQDYVHSLTHTIDFGVDLTKNTTSKNARDAQKILSEELKPLQDNITLFET
FT                   SLNSLSANLLKNPIFGFEKSGNTSQLSLDRLKNVNFSDIFFSDFLPHFQSSFDVSKSFQ
FT                   SPFSSAKDAILTDLDNFNNGVRKLALNLPTAKAVAKQLDNSSYNQLFSTFKLCTKEDEI
FT                   KEHYEKMVQSINSKSGAVVILFVVFAVIFLLITCFLELFGLTRKKQLQKVSYLRKLKLT
FT                   ESHVEPTHSKNKSHKPRDFIPFPHHLSTLTIVTVAVAVSCICDLSLLSSLRISGGAQIE
FT                   FVSDMYEYPTDNVPGSVSENVSEPVEHVNELNARDLESEDDAKPLGYTAVDYMAIFSTA
FT                   DKPSATLVETAASVATPVHITDLTNNSIATLHNISSDIIRLVDSANIYLEGLQTNLETE
FT                   CLSFQSQLLKGVNSTLMKLEKDLNEAVANRFGFERGDIGSLNSDKFLSAILDKSRHKVA
FT                   AGTAKLFKIDSKQAVLAFSQAHINSLPGFAPLQTKTTIATSLENLVDMMQKVVLSQQWF
FT                   ALGLFIVWILIMIIGGVRWILAIKREVGFINMRVKRWEV"
FT   gene            <975849..>975934
FT                   /locus_tag="YALI0_E08272r"
FT   tRNA            join(975849..975886,975898..975934)
FT                   /locus_tag="YALI0_E08272r"
FT                   /product="transfer RNA Lys (CTT) cove"
FT   gene            complement(<976073..>978715)
FT                   /locus_tag="YALI0_E08316g"
FT                   /old_locus_tag="YALI-IPF2254"
FT                   /old_locus_tag="YALI-CDS0650.1"
FT   CDS_pept        complement(976073..978715)
FT                   /locus_tag="YALI0_E08316g"
FT                   /old_locus_tag="YALI-IPF2254"
FT                   /old_locus_tag="YALI-CDS0650.1"
FT                   /product="YALI0E08316p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79280"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6M1"
FT                   /protein_id="CAG79280.1"
FT                   /translation="MTEPNTSSTLSLPYTRGYDRVIIDSKDLAQTGRVSDNDLLLALSH
FT                   TMNRSVDNIKHRLDYLSGLDESQIKRIRHARYPSTIDWESLFTFLSDRNWSALRASSNS
FT                   RDNVWAKFDPIEDVLLLYHVYTSTSLHDAIDQLGQQFPHRLKKHWRSRYTLLKNQYSPE
FT                   QLETRMKDAERMFILDTTLAYFQQKFPRFYSTNSDPNRPWFDEDDKEDDEGDADGPQTM
FT                   FSSSEDKFILDTNALFASKRVPDRLLLKILEFVLSIGPYTIRKHLAELRQESEMVTLAL
FT                   KESALPENVDWPKFESAIMNLDENSTVADLKWPEITEAVSWEAGKFSTNEDRCLMAHLE
FT                   VAATIFDGARAVHRKYPHKSLQQWHKRYYRLLADKGSVSKTTRIAAARFSERESEELFV
FT                   EQYPDVYRFKDNKFSIIGEEDTVVEEPQPEPPSEPIPEHIPNPIPEPEEVLANVPRPQQ
FT                   TLPSGYDTSKFTRTQDKVIYAANKTATENNVTIEVLVQTVSYVLNRDPELVRQRLVTIT
FT                   TEMSQNEIARLQRHNYPYGIDWHQIKDFLISAQSKPKEAVDWNELYTRSRAFNVKKRLD
FT                   DKERKALLAIAHSEKTPVAAMMKLHSLYPHRSRHAWSDSLRILKSKPNYLEEVRVAKQE
FT                   YDHVTFKEHFTKSFPEYYGAKEVIRTVVDNNHNPKGKPRTEGSRYPLKPLKSKRVHVDE
FT                   PNAESEKSLPAAPTTSAPKKSRKKRTKLLKDEAEQLKAEDLIRTVVQDAVDEGHVDPKD
FT                   PAAADGLRPRRKRKAAAQIGSLAEAEIEEHDEQLSESQQSQQAPIEGDDMSMMDLSVDS
FT                   INEEDLMRAVQNATNSVDDHILMEPNVVDVAVAAAAMRPEPAEEKEKRDKDEAFVPEDD
FT                   DDEEEEMFN"
FT   gene            <981474..>986102
FT                   /locus_tag="YALI0_E08338g"
FT                   /old_locus_tag="YALI-IPF2253"
FT                   /old_locus_tag="YALI-CDS1254.1"
FT   CDS_pept        join(981474..983480,983532..986102)
FT                   /locus_tag="YALI0_E08338g"
FT                   /old_locus_tag="YALI-IPF2253"
FT                   /old_locus_tag="YALI-CDS1254.1"
FT                   /product="YALI0E08338p"
FT                   /note="similar to uniprot|P53855 Saccharomyces cerevisiae
FT                   YNL242w SPO72 required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79281"
FT                   /db_xref="GOA:Q6C6M0"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR026849"
FT                   /db_xref="InterPro:IPR026885"
FT                   /db_xref="InterPro:IPR026886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6M0"
FT                   /protein_id="CAG79281.2"
FT                   /translation="MNWIPNVQKRAFHYVLNRLALFSDLELDNMDISLGTAQKAALTNV
FT                   KLDPDRVSLPAGMYMRSGKIDEVSVEMRLLGGAGIAVKIDGVHITASMKQMDVETATEH
FT                   VEEFLERTTADLAASILSEDLSASLQIDPAEEPPLLGMGGSGISEALVKKVTQTVLSQL
FT                   TVDVTNVHVTLFVAADDKMDLVVDEVRLRPQGGQEMALEVRGVKMKVMDKKARGTSAPV
FT                   TAGSTAHATTGFTSESDSDSDTDPFSNAKKSLLQSTIFSHEEASSIYMSAIAESANLGF
FT                   ESDPLFGVFYVDTIDVLVFLGEEMRVSCEVGIVRASLDLLPTVILSLVKVGNGGSGGKK
FT                   SRDSETKEGTAMDLNMSIKSISASICQLGDDWEFKNIDTNLLFSLSDISGSSGAFHKLQ
FT                   IGVCEVKRGSTRVFGFESDEKNTDDEEPTPRDSDILLKASSASFTLVLPKKAVGVFTIP
FT                   DLIDVVSLITYLLSLIESKQQKAATMTERSERAGASKTTVQTNTFDFDVAGHKLYILPI
FT                   RLSNGQMSLSRVSFGDVHVKGISFENSIVSVDKVDFDIGLPIVEELHQLLLPIIDAMNS
FT                   AKNRPVPASVQTAPPKLLRIVEEPVNASSLVINVARVKGKVDLGGKVGVIEVVLGGISV
FT                   TGPTDRIEISTVEIGRDLSDLGLSKKWLLHPLKRESNVVVELSSGQIQLITVKNCALEF
FT                   YTELLELFGGKGDDTKAAELQESSSPDSSSRESSSGSESPPKRIPLQIHNCAVGLNPTN
FT                   SSSSAQFIVKHVTCEIKPSPTFSMTSFIGSASLLLIDDASLVTPNPTDLMSSYLEQYTS
FT                   VASLTATSISISTSPGNPTCININGDTVTLSTCADSTQTLIHLINSLKPAVELSGAKFQ
FT                   LETLDPFLNTFQDVDDCFFKAKNKDACESSCSSDNDDIDMVSDDVPNNMSFVESYYGGD
FT                   KPSQSRKSGRQKMAESYTHADFLLDSDLDSLVKRERVRFEEICFEEDYFDKEEEDMPVM
FT                   SRPRASSHDLASSNELLTPPTVVINIDLIHNIVCNFHDGYDWQYTRNEINGAVDGLKKR
FT                   MKERPVVEEPPVMTTDLLFNSIYIQAKDEDDLDDVVGEQTEPAKPKEANKSRRGLLSRS
FT                   SNPLVQVWLQGIACLLTVYAGLEDPDLPPGQVLNSLDVKIKDVEIIDHVPTSTWNKFLT
FT                   YMRSRGEREAGAVMAHITMQNVKPVSTLSSQEVICHVTILPLRLHVDQDTLDFLTRFFN
FT                   FKDVRTTAPPDETFIQKFDIRDVPVKLDYKPKKVDYSGLKSGKSTELMNFFILDESDMV
FT                   LRRIKLRGITGFANLGQKLNDIWMPDVRRTQLPGVLAGVAPVRPLVNLGGGIRNLIVVP
FT                   VREYKKDGRVVRSLNQGAYAFAKTTTNELVRFGAKLAVGTQNLLEGVVSTERAGESRDL
FT                   DDSDLESTTKYYTYMGYSDSNNKLISLYANQPLGVYAGLQDAYSSFGKHMNVAKTAIHN
FT                   LSEDISEADTAGAAAYAVVKAAPVALIRPIIGTTEAVSKTLFGVANEMDPSGRELARDK
FT                   YKEAN"
FT   gene            <986512..>987807
FT                   /locus_tag="YALI0_E08360g"
FT                   /old_locus_tag="YALI-IPF2251"
FT                   /old_locus_tag="YALI-CDS2950.1"
FT   CDS_pept        986512..987807
FT                   /locus_tag="YALI0_E08360g"
FT                   /old_locus_tag="YALI-IPF2251"
FT                   /old_locus_tag="YALI-CDS2950.1"
FT                   /product="YALI0E08360p"
FT                   /note="similar to DEHA0A08206g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79282"
FT                   /db_xref="GOA:Q6C6L9"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L9"
FT                   /protein_id="CAG79282.1"
FT                   /translation="MINLFKGHPSDDLFPEKEVLAAAASLLSRDRPEDDDDENRHPLTY
FT                   GPDQGALYVRQLIAKWVTERELLEKTPIAANCINLTCGASFGFADILQSCTLPQTGYTR
FT                   RAFIVSPCYYLINSVFIDCGFKGKLTAIREDFGRLDLTKLEADLEKYSSEEGHEHEKSP
FT                   LDVVGDESRPTKKIYKFVFYFVPTFSNPGSAIIPLEDRVKLLELARKYDMLIVSDDVYD
FT                   FLEHSIERENLPPRMVTLDRETVTSTHGNTVSNLSCSKLLGPGLRVGWQETATGALALQ
FT                   LADSGASRSGGTPAHLNTMIVGEMIKLGLFDKVVNHLNKIYNARATVYKEALKKYLPEG
FT                   THIEGGDGGYFIWVTLDKVDARKMVELAKERGLVLASGDKFEVNGDPQNWGKTSVRVSV
FT                   SYTDADKALEGIKIWGGVCDDLIKWDEAIDVC"
FT   gene            complement(<987913..>988671)
FT                   /locus_tag="YALI0_E08382g"
FT                   /old_locus_tag="YALI-IPF2250"
FT                   /old_locus_tag="YALI-CDS4880.1"
FT   CDS_pept        complement(987913..988671)
FT                   /locus_tag="YALI0_E08382g"
FT                   /old_locus_tag="YALI-IPF2250"
FT                   /old_locus_tag="YALI-CDS4880.1"
FT                   /product="YALI0E08382p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79283"
FT                   /db_xref="GOA:Q6C6L8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L8"
FT                   /protein_id="CAG79283.1"
FT                   /translation="MSYSAIPSEPTDSAPGVVAVPQPSSPKAGLIQNFIFLQVKKSIAI
FT                   AVVVLVSQGASLNATLEGVLILATSILPFWTPPMWTPNMAPHKFTAIVFYACWLLQLGV
FT                   QFLCLDFNPSNQFSKVLQISALNLVTGFLGNQIKYSQAYFVKRLYPADQQIKATKYAFL
FT                   FAFLYPQVLESVLVALYLNVTFLPAWTLEGFRAAAYLYFAADLYFRYPVESESGVTAWN
FT                   DSSLYSFYKTELASVWKGILFYYYFFLQFL"
FT   gene            complement(<989391..>989558)
FT                   /locus_tag="YALI0_E08387g"
FT   CDS_pept        complement(989391..989558)
FT                   /locus_tag="YALI0_E08387g"
FT                   /product="YALI0E08387p"
FT                   /note="highly similar to uniprot|P41927 Yarrowia lipolytica
FT                   Metallothionein-I MTLI"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08387g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64327"
FT                   /db_xref="GOA:B5FVH3"
FT                   /db_xref="InterPro:IPR000869"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH3"
FT                   /protein_id="CAR64327.1"
FT                   /translation="MGFSSAMFGASLISNSISSESNFNKRDLVNNCCCSSQNMPDTCAC
FT                   KKCGCKACKY"
FT   gene            <990164..>990613
FT                   /locus_tag="YALI0_E08392g"
FT   CDS_pept        990164..990613
FT                   /locus_tag="YALI0_E08392g"
FT                   /product="YALI0E08392p"
FT                   /note="similar to uniprot|P41927 Yarrowia lipolytica
FT                   Metallothionein-I MTLI"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64328"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH4"
FT                   /protein_id="CAR64328.1"
FT                   /translation="MESPYHQHSYCTALPYDCPFPSRSTKTLLLMFDLSKYPQIIPNLS
FT                   SSRHSLATFVYRHFSNRPVPLSARFVHSTTAEYNFIVEIWEPEFYVIRAEFPILFLHTC
FT                   TSAQSSLWTSLKQNTQSILKEFAYTRLRASLICSKPPDHEQTQSC"
FT   gene            <990930..>991010
FT                   /locus_tag="YALI0_E08404r"
FT   tRNA            join(990930..990966,990975..991010)
FT                   /locus_tag="YALI0_E08404r"
FT                   /product="transfer RNA Gly (TCC) cove"
FT   gene            complement(<992873..>994348)
FT                   /locus_tag="YALI0_E08448g"
FT                   /old_locus_tag="YALI-IPF2248"
FT                   /old_locus_tag="YALI-CDS2422.1"
FT   CDS_pept        complement(992873..994348)
FT                   /locus_tag="YALI0_E08448g"
FT                   /old_locus_tag="YALI-IPF2248"
FT                   /old_locus_tag="YALI-CDS2422.1"
FT                   /product="YALI0E08448p"
FT                   /note="weakly similar to uniprot|P34078 Saccharomyces
FT                   cerevisiae YKL143w LTV1 low-temperature viability protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79284"
FT                   /db_xref="GOA:Q6C6L7"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L7"
FT                   /protein_id="CAG79284.1"
FT                   /translation="MGKTWVKKKDAETFSLVYRAQDDPLYHDEDASERVFVKVDNLNQQ
FT                   RREREAVARSVAASEAASQASEAGDVPELHDDSQDPHRALTRADLEAELDKFAKQGRRE
FT                   NEGEAALYGIEYDDSKYDYMQHLRPMGMSDSVYLERKTNNKEHSGPGGRRGKGTDLILK
FT                   ADYAAKNGVQLPAEALPSEVKKKLTYQDQQDIPDAHRQLLMDPDLREVLEALEDEAYVE
FT                   EDAEDDVFGELIQSGEYDEEEEAALDDQYDDEDYYDDYSDVGTIQGAFDTVEEEHNDEE
FT                   IEALRQQAIKQARAMGRSKGNKEEEAGKEVEVSQPLAAELDVEAEEEEEDEFDPQYSWQ
FT                   QDFDKFKKDQKKKRGEEVESEIDGAAYTAMSRRSRRKREKAAKNGTAMSGYSMTSSALF
FT                   RNEGLTFLDDRFDKVEAEYNDESKDEPQPEFDMKKERNDFESIMDDFMDNYSVVGKKMY
FT                   KKKASTLNNSTGLQQVDDLRQALKGLSVDDKQK"
FT   gene            <994848..>995972
FT                   /locus_tag="YALI0_E08470g"
FT                   /old_locus_tag="YALI-IPF2247"
FT                   /old_locus_tag="YALI-CDS3525.1"
FT   CDS_pept        994848..995972
FT                   /locus_tag="YALI0_E08470g"
FT                   /old_locus_tag="YALI-IPF2247"
FT                   /old_locus_tag="YALI-CDS3525.1"
FT                   /product="YALI0E08470p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79285"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L6"
FT                   /protein_id="CAG79285.1"
FT                   /translation="MAKINPNPRATRRGVADYVRPGTRIARPSHHTPTIERNTRDTNHT
FT                   ESDATVPQQCIRVEVIAEKPSTRPLPRTFETMLAFYGILFMSTLASVVTRDTYLKIASY
FT                   MCSLTSTEMNTRYWFRTFTRRNKHLFDDTMETLKKLPSMVQPVDIYGMDSTWFSDDGHV
FT                   DLHTAPVTTKMEWLKTFLKDTDNGGVLRMLVVPYHEGLEEFVAACLVNYVLVSHESTTY
FT                   VLGDDTDIHDSISVGVPEPEVIGVDAVDPNSQRLDSPAPAEGSDNADACGSTDTDTRDD
FT                   SSNDNKQHPGDIPETADTEDTITEPPSSQLVIVSRKSTEEEEGVTVCTEFSDKALSYPS
FT                   GDVLKLLEHTLEERTKLIMKVITMEKELRAARGG"
FT   gene            complement(<996134..>997354)
FT                   /locus_tag="YALI0_E08492g"
FT                   /old_locus_tag="YALI-IPF2246"
FT                   /old_locus_tag="YALI-CDS3170.1"
FT   CDS_pept        complement(996134..997354)
FT                   /locus_tag="YALI0_E08492g"
FT                   /old_locus_tag="YALI-IPF2246"
FT                   /old_locus_tag="YALI-CDS3170.1"
FT                   /product="YALI0E08492p"
FT                   /note="uniprot|Q872L6|emb|CAD70713 Yarrowia lipolytica
FT                   YALI0E08492g LIP4 Lipase (EC 3.1.1.3)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79286"
FT                   /db_xref="GOA:Q6C6L5"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L5"
FT                   /protein_id="CAG79286.1"
FT                   /translation="MAGFNFTFGQVISYLASMLYGQVDATSSSTRIQATQDLYDFTAKF
FT                   SRLSNIAYCINAPFTPLRTDFTCGESCRYFPDLQLDSVFGGNFSSASTTGYIAYDHKKK
FT                   EKYIVFRGTFSIPDIITDIQFQTAPWLTSLPTHLIPTKEDFEHKQAILKHYAAENKGLS
FT                   NLEERQDVVHEDPSLVPKKMDKCENCQIHDGFAKGFNETIEHAGPQIEKFLGNNTDYKM
FT                   FVVGHSLGAAQAQLFATQFKLLGFDPYMINFGQPRLGNPEFAAYINQLWFNDTGLVVND
FT                   ARRFYRVTHWNDIVVGVPDWLNYTHSIGEVFIDEESVYPKLDKVVVCEGGENPLCHRGT
FT                   FNLWSRINFLQNHLAYIFYIGLCAFNIGRRDVLNMPQYQGNFSYQHNIDPNYNYDTKVP
FT                   TRISKSN"
FT   gene            complement(<999772..>1001172)
FT                   /locus_tag="YALI0_E08514g"
FT                   /old_locus_tag="YALI-IPF2245"
FT                   /old_locus_tag="YALI-CDS2630.1"
FT   CDS_pept        complement(999772..1001172)
FT                   /locus_tag="YALI0_E08514g"
FT                   /old_locus_tag="YALI-IPF2245"
FT                   /old_locus_tag="YALI-CDS2630.1"
FT                   /product="YALI0E08514p"
FT                   /note="weakly similar to CAGL0I10901g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79287"
FT                   /db_xref="InterPro:IPR029191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L4"
FT                   /protein_id="CAG79287.1"
FT                   /translation="MSNYNYSPDNFSDANDFLPPPNPSDTHISVSPFINIEKDPVSFNF
FT                   LVQAAIVDAKNYHILSYDELDEKKKELQLLESRYETLLHKIELEKKVGEAAKSLARLHE
FT                   DGSKRSSFLKSTKRHSQQATDEHIISVRKITEMNTDAIELHNRITALKETVLQHSVAVL
FT                   AYSQLNPAAAAAAQAEDPVKVGKQLDTLISQLGDDHVMQQTESRDLPAKVHALSGLCQQ
FT                   LTQQCRDQIDYNTDMLGRVLESRDQAFDQRQYPHFHDMLAYLQEGGGSGGNGEVSKSRE
FT                   VGAGHEIKPTGAHEMGQTRDVVSTPVLKSDSRDLLDLQDALRSHKFASSAQIQDLNSEL
FT                   TLATEQVSEYRDKCDSLSRELDSVVQSLEDLTVQTVDYESERQKMEDQINQLRSKLQEA
FT                   GTSRAVTGLEASGGSESESVTMLVHKFRDQIRTMREEHLQELQKEQDEKKKLVSVVREI
FT                   KRSSYIRA"
FT   gene            <1001741..>1002913
FT                   /locus_tag="YALI0_E08536g"
FT                   /old_locus_tag="YALI-IPF2244"
FT                   /old_locus_tag="YALI-CDS3347.1"
FT   CDS_pept        1001741..1002913
FT                   /locus_tag="YALI0_E08536g"
FT                   /old_locus_tag="YALI-IPF2244"
FT                   /old_locus_tag="YALI-CDS3347.1"
FT                   /product="YALI0E08536p"
FT                   /note="similar to uniprot|P53206 Saccharomyces cerevisiae
FT                   YGR012w putative cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79288"
FT                   /db_xref="GOA:Q6C6L3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L3"
FT                   /protein_id="CAG79288.1"
FT                   /translation="MSRWIYTASGVLIGISISGILYTAFLRPESQKKRSKSNKNTPSQP
FT                   IVDPPKARIGLQGLIGNTPMVLVPSLSHATGCKIYAKVEACNPGGSAKDRVALGIIQAA
FT                   EKSGAIAPHEGHVIYEGTSGSTGISLAMLSKAMGYNSHICLPDDTSSEKVDLLTNLGAV
FT                   VDKVRPAGIVDKNHYVNSARDKAVECETGAVFSDQFENDANWRIHYNTTGPEIFIQTDG
FT                   EVDLFVTGSGTGGTISGVAKYLKEKLDDVRVVLADCQGSGLYRKIKYGVMYDSVEKEGT
FT                   RRRHQVDTLVEGIGINRITHNLSQGLEFIDDAIRVTDEEAVKMAKYLVDNDGMFVGSST
FT                   AVNMVAAYKCAKSLGPNHTIVTLWCDGGHRHLSKFWKQARELGEIKLEDF"
FT   gene            complement(<1006068..>1006994)
FT                   /locus_tag="YALI0_E08558g"
FT                   /old_locus_tag="YALI-IPF2243"
FT                   /old_locus_tag="YALI-CDS4286.1"
FT   CDS_pept        complement(1006068..1006994)
FT                   /locus_tag="YALI0_E08558g"
FT                   /old_locus_tag="YALI-IPF2243"
FT                   /old_locus_tag="YALI-CDS4286.1"
FT                   /product="YALI0E08558p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79289"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L2"
FT                   /protein_id="CAG79289.1"
FT                   /translation="MDLLGTTLENAILPTLNATIRSKKPFPTPIPQLEHTNVLISKFYN
FT                   RPRDSPGSSWLICCVDDRRKRVLCAISPEVAKQFQDKYHTELTEETSLVIKFLNAPYLS
FT                   LVSGSFVDSLPLFLPVQYDPSKYMGISDARMIVVVTQPVHKIAQGASLQHRFVPMLSVV
FT                   IDKQPDQAGKPIYPPDRRAAKRRVEFQEGYMSQRTVFTDLRRLSEPSRGSLDDAPGKHI
FT                   SEELLRIGGMRAQSGGDRQEKRVPKKFDHSGYLRDIMGGEEVRTEIESLDVDEEHLEYW
FT                   TEVFELLNEDTEVPRRTPFLNVKKTVT"
FT   gene            complement(<1007612..>1009684)
FT                   /locus_tag="YALI0_E08580g"
FT                   /old_locus_tag="YALI-IPF2242"
FT                   /old_locus_tag="YALI-CDS1195.1"
FT   CDS_pept        complement(1007612..1009684)
FT                   /locus_tag="YALI0_E08580g"
FT                   /old_locus_tag="YALI-IPF2242"
FT                   /old_locus_tag="YALI-CDS1195.1"
FT                   /product="YALI0E08580p"
FT                   /note="weakly similar to uniprot|P53835 Saccharomyces
FT                   cerevisiae YNL279w PRM1 coiled-coil protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79290"
FT                   /db_xref="GOA:Q6C6L1"
FT                   /db_xref="InterPro:IPR026777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6L1"
FT                   /protein_id="CAG79290.1"
FT                   /translation="MAMSLASQIKLWWNTQNSPTEHSSIPLLKARLSQTWLNKWTIGLL
FT                   LVSIKLWMFKMSLSGQLDGAESNSERSCSALERSVSKMMSIPHYTATGMNHVIATAIQK
FT                   FVSGLIKMVLLIITGVQELLIFAVNMLISTYTCLITLVVQGAVSLAVDTSKHVISFVND
FT                   TISTVVPEIEKGLNGLADGLNTATNAFVDLGNLITGKQAEEYTGQIDFVKLQLDGLKNV
FT                   SIPASVNEKLDSVKDKVPDFETVKNEIESLIRKPFQTISKSMNETLATPLNVSDSLKVP
FT                   ALKSAQFCKDANIPEVYAKLNSGLNTGLKVIISLLLILALIMIVPVAWSEWRLWRYHEE
FT                   LWVEQSTVDVKQEKRHAFHTVLFQAQHKYVTMVKQKLAWGKKLYQRNLSQWYWAYILYP
FT                   YMLTLLLVGLFGILAFLLQLGLLSILKSGLQSLTVPTSEVGADVTETVVREIETWKNDT
FT                   NLFLNSQETHINKNLLGWVVDSTSTVNTTLSTFIDTMNNGIDSVFKDTPLHGAVQGVTK
FT                   CLVTLKLQKVADGMGWVSDNAHVTLPRIDKELMSHQDIEQEASEKADYVSDGIARIIKT
FT                   VEKLLFTELYIALACLGIWLFMCLIALVYVLIKSRDRTTNFEPSRELKFDMVDTSRDIN
FT                   VPRVLPPQITIPKPALFMRNHIPSPATDPFEEYPIRRNKSSSWLFNLKSPVLRKS"
FT   gene            <1010800..>1011792
FT                   /locus_tag="YALI0_E08602g"
FT                   /old_locus_tag="YALI-IPF2240"
FT                   /old_locus_tag="YALI-CDS4012.1"
FT   CDS_pept        1010800..1011792
FT                   /locus_tag="YALI0_E08602g"
FT                   /old_locus_tag="YALI-IPF2240"
FT                   /old_locus_tag="YALI-CDS4012.1"
FT                   /product="YALI0E08602p"
FT                   /note="weakly similar to uniprot|P17558 Saccharomyces
FT                   cerevisiae YOR158w PET123 ribosomal protein mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6L0"
FT                   /protein_id="CAG79291.1"
FT                   /translation="MSSRVSGVLPKPRSIVVPYASRRGFPVGQGYADEKMVPRGSHRFP
FT                   KKKTVPTEEQLIATRNPPRTSAKHATPRSEIHKWHLKMADLRKQYLADSLVSAERADKA
FT                   KYHYHKRYLAAAEKVKEDARNAGLTEAELLTLPTISGLLTNSQLKRQTEDEYEQKRLER
FT                   QYNDQLQQLKDEEERARVTVQLIDQADDFIVTEEQLIAGVEKAFVNGSSSGRNPVGGWS
FT                   ITSFKEDSIMGVGRNSAGLEKLVSLASESEESKLTEIGDAIALELTGVTNNGKPGLGRI
FT                   AEILRGDNVLERAEKLRLDQTKAGKAQIKKDMGEAEDLAEIRQALKDME"
FT   gene            complement(<1013187..>1014555)
FT                   /locus_tag="YALI0_E08617g"
FT                   /old_locus_tag="YALI-IPF41105"
FT   CDS_pept        complement(join(1013187..1014506,1014553..1014555))
FT                   /locus_tag="YALI0_E08617g"
FT                   /old_locus_tag="YALI-IPF41105"
FT                   /product="YALI0E08617p"
FT                   /note="weakly similar to uniprot|P41807 Saccharomyces
FT                   cerevisiae YPR036w VMA13 H+-ATPase V1 domain 54 KD subunit
FT                   vacuolar"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08617g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79292"
FT                   /db_xref="GOA:Q6C6K9"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038497"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K9"
FT                   /protein_id="CAG79292.1"
FT                   /translation="MSIAFNSSYLDEIQTAIRSRPIPWDGYVRANLLTPDEAALIKTIE
FT                   KQSPEARKETVKKDLTHYATSFVSLLRKIPREDVAKYILSFVASLVQELPEFAQAMLEL
FT                   SKLDSDSPFGPLLKLLESEDEQIQLLAVKSIVVLLADSKTVDLTTEKYAAQYLQFVGLL
FT                   IGSSASVQVQDVGTVSLAVLLSNRSYRPLFWKFNSELVPKLLDIIKADKGGLHLQYYTL
FT                   LVIWLESFDNKAAHQLVSSFSELIPTLLQAARTSVKEKITRLCVAIIVNVLKAAPKDTV
FT                   ASLLLNQGQAVFKNFSDRKWTDEELIEDIEVVYTQLNEEVARMTTFDRYYAEIKSGKLS
FT                   WTPAHKSEFFWQENVGQFKDDDWKVLKMLAGIVKSATDPTVQAVACSDVANVCKLLPDA
FT                   IQVLQDDGAKLKIMELMSSDNSEVRFEALKATQVFVAQSLK"
FT   gene            <1015315..>1016253
FT                   /locus_tag="YALI0_E08646g"
FT                   /old_locus_tag="YALI-IPF42029"
FT   CDS_pept        join(1015315..1015563,1016065..1016253)
FT                   /locus_tag="YALI0_E08646g"
FT                   /old_locus_tag="YALI-IPF42029"
FT                   /product="YALI0E08646p"
FT                   /note="some similarities with uniprot|P46964 Saccharomyces
FT                   cerevisiae YOR103c OST2 oligosaccharyltransferase epsilon
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79293"
FT                   /db_xref="GOA:Q6C6K8"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K8"
FT                   /protein_id="CAG79293.1"
FT                   /translation="MAPKKSVKKNVDATLEKKDAPPVAVPVHVTKSADNDNTNVFTKVL
FT                   NNYTKQSTPKLKLIDSFLAFLVVLGVFQFVFCLLVGNFPFNAFLGGFASTVGQFVLTAA
FT                   LRIQTAKQNAKEFPGVSSERSFADFLLGSLVLHFCVYHFIN"
FT   gene            complement(<1017652..>1017744)
FT                   /locus_tag="YALI0_E08668r"
FT   tRNA            complement(join(1017652..1017688,1017706..1017744))
FT                   /locus_tag="YALI0_E08668r"
FT                   /product="transfer RNA Asn (GTT) cove"
FT   gene            <1018577..>1018664
FT                   /locus_tag="YALI0_E08712r"
FT   tRNA            join(1018577..1018614,1018629..1018664)
FT                   /locus_tag="YALI0_E08712r"
FT                   /product="transfer RNA Asp (GTC) cove"
FT   gene            complement(<1023488..>1024982)
FT                   /locus_tag="YALI0_E08756g"
FT                   /old_locus_tag="YALI-IPF2236"
FT                   /old_locus_tag="YALI-CDS5414.1"
FT   CDS_pept        complement(join(1023488..1024035,1024859..1024982))
FT                   /locus_tag="YALI0_E08756g"
FT                   /old_locus_tag="YALI-IPF2236"
FT                   /old_locus_tag="YALI-CDS5414.1"
FT                   /product="YALI0E08756p"
FT                   /note="similar to uniprot|P01119 Saccharomyces cerevisiae
FT                   YOR101w RAS1 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79294"
FT                   /db_xref="GOA:Q6C6K7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K7"
FT                   /protein_id="CAG79294.2"
FT                   /translation="MNISQREYKVVVVGGGGVGKSAITLQFVQSHFVDEYDPTIEDSYR
FT                   KEIIIDTNLTTLDVLDTAGQEEYSAMREQYMRNGDGFLLVYSITSRDSFEEAQLFYNQI
FT                   LRVKDVARAPVVLVSNKCDLSADRQVSTVEGQRLAREWNVPFFETSARYRVNVDEPFCD
FT                   LVREIRRHQIERHRQGSSSSTMHMSMGSSMGSVKGRSVREKLEEGDDGEKKEKKACCVI
FT                   C"
FT   gene            complement(<1035423..>1035518)
FT                   /locus_tag="YALI0_E08778r"
FT   tRNA            complement(join(1035423..1035467,1035480..1035518))
FT                   /locus_tag="YALI0_E08778r"
FT                   /product="transfer RNA Leu (CAG) cove"
FT   gene            complement(<1036555..>1037667)
FT                   /locus_tag="YALI0_E08822g"
FT                   /old_locus_tag="YALI-IPF2235"
FT   CDS_pept        complement(1036555..1037667)
FT                   /locus_tag="YALI0_E08822g"
FT                   /old_locus_tag="YALI-IPF2235"
FT                   /product="YALI0E08822p"
FT                   /note="similar to ca|CA0227|CaPHO23 Candida albicans
FT                   CaPHO23 Involved in transcriptional regulation of PHO5 (by
FT                   homology)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79295"
FT                   /db_xref="GOA:Q6C6K6"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K6"
FT                   /protein_id="CAG79295.1"
FT                   /translation="MKGYNTRSSSRRAQDKPVGLYPGLNDLTDALEALPLETVRHFTLL
FT                   REIDAKCTTTTPLVADLIAKFLAIPPAAKDDPECAKKTEERENMLLEIRGLIRELMPCL
FT                   EEKMHVAGVAAEAVARHISRIDADYELITSREIPQVIQYGEPDHPAIIVDVKPSVAERS
FT                   AQSQRSESRREAIAAKKAAAAAAAEKSGNGGRRGTPSKEGGKDSGKETGGKKAAATNGA
FT                   AAVGAGAKKNGEKRTATSASVSDTVASSAAAAGAKKRKTAAKASPAPGNRKSPPSSDDT
FT                   PAASATRSARLVNKSRKGQEAAESAKAAEEEEDDGEPVYCYCEQVSYGEMVACDGPQCT
FT                   REWFHLPCLGLSSPPKGNWYCDECKQGRKR"
FT   gene            complement(<1038587..>1040836)
FT                   /locus_tag="YALI0_E08844g"
FT                   /old_locus_tag="YALI-IPF2234"
FT                   /old_locus_tag="YALI-CDS0981.1"
FT   CDS_pept        complement(1038587..1040836)
FT                   /locus_tag="YALI0_E08844g"
FT                   /old_locus_tag="YALI-IPF2234"
FT                   /old_locus_tag="YALI-CDS0981.1"
FT                   /product="YALI0E08844p"
FT                   /note="weakly similar to uniprot|Q01477 Saccharomyces
FT                   cerevisiae YER151c UBP3 ubiquitin-specific proteinase
FT                   singleton Ubiquitin carboxyl-terminal hydrolase 3
FT                   (Deubiquitinating enzyme 3)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79296"
FT                   /db_xref="GOA:Q6C6K5"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K5"
FT                   /protein_id="CAG79296.1"
FT                   /translation="MMYHPNGYMPVPPYYGGFNQAPFMHYYPDGQMHQMMGHQSQPQAG
FT                   QPPQPGQGPLPHMMQPPPPHDFEQQQHQQHQQHQQHQQNQARKPKSFSFNVGAAAFTPG
FT                   GAGSGGGGGGAPAGPQAFVPGAAAPFNPGGASFSPAATAPFTPGAPSFTPNAPAAAAAP
FT                   AGMPSTTPTYAVNSSSAPSYYNANDTPIESIFQLIKDNNRLPQLPVLIGGRFEVRPLGG
FT                   ASKLRLSKPVSFATSRLVDVRGEDFSVQIGDTICDSADLVVEKYEPVVAQKFQTKVEVK
FT                   DEAPVAAAKPTKSSWAAAASKAVPKVEKKDAKEAQEGESSAVANGDATTEDSAESDSPT
FT                   ASPAPPATLGSIIAAVKAHSYDSELFDSSTSTNHHSLLTARPRGIVNNGNVCFMNSILQ
FT                   ILVHCLPFSRLIDLIREKVPRSLDGDSPLTEAVVDFLDDYKRGAVNGVNGGSTPATSKL
FT                   PDITIDSFYKSIVSVPRFSHFQRGKQEDAEEFLGYLLDGLHEEFVAVIGAREEAAAKEE
FT                   GATGSAEWTQVGAKKNSTTRSPQFPWSPVSDIFGGKFESNLDVPRQSVSKVLEPFHVIH
FT                   LDVENPNITSVESGFKALSAKEQVETFGEGGRPITGASKQTLLEELPRILVVQLKRFTY
FT                   CGDDLMDLQVRKINKKISYGADLSVPMESLSLKAKQQFRASGGKSNQYNLVGVVFHHGT
FT                   STTTGHYTVNVLVGGTKWYRIDDVKIEAIRNENWYAKEEDGKDDKTAYLLIYQRV"
FT   gene            complement(<1043796..>1046997)
FT                   /locus_tag="YALI0_E08866g"
FT                   /old_locus_tag="YALI-IPF2230"
FT                   /old_locus_tag="YALI-CDS0784.1"
FT   CDS_pept        complement(join(1043796..1046365,1046985..1046997))
FT                   /locus_tag="YALI0_E08866g"
FT                   /old_locus_tag="YALI-IPF2230"
FT                   /old_locus_tag="YALI-CDS0784.1"
FT                   /product="YALI0E08866p"
FT                   /note="similar to uniprot|Q7S698 Neurospora crassa
FT                   NCU04755.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79297"
FT                   /db_xref="GOA:Q6C6K4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K4"
FT                   /protein_id="CAG79297.2"
FT                   /translation="MRCVFKSGHSANYNISSEPAFHAGAWAVHNATRRTTNDPVSVFTF
FT                   DKKKFESFCSKNGLKNSKGSDEIYSRLRNEATNLARLRHPNFLRIVEPLYEGKSSLSFV
FT                   TERVETCIRAKVEADASRDSRSTRDHIPPELSPLVIQKGLLQVSEGLKFMHEDAKMVHM
FT                   NLNLNTVFVDSLGDWKLGGCGYACEVAGSESRDFFIPQFDARYPRFVQINLDYSAPELV
FT                   LDKNLDFSADVFSLACLAITLYNFKSPIDSNNNYNNYEEDVKSLGSFLRKPNNTTKIPA
FT                   SLIEILPKLLTRYPTDRYPIQAILSANFFNSFLLKSLKFIDEFSGKTDEEIEAFIPQFI
FT                   KIIPEFPFEILKNKILKILISSLSHVSEAIMASLLHVIFLISAQLSSLDFCKIILPILS
FT                   DNEKLQQNSDVQKVVLEDLDIFLKNLNSKEIEKTILPFFFIMFDNAGAPEVQENALFKC
FT                   QKDILEKLDFPIIKNKIFPKIGEVFTKTTSLGVKIAAINALKELVVSGLDKHSVTDKLL
FT                   GMLKAVKSRDPRVMMSMLSLYETLVKMLDVDVIANEVIPVLWSMAVGPKYTVAQFEKFM
FT                   TVIKQFSTKVETEQKKKLTNNVEVPMASREDLSAGIGGMSSGIGGMTLEPSKPNNDFML
FT                   DDGPSFVTPVPVVTPKPSIPSSIPALQAPKKQNDDFGSFASASTSNNSFGNFQSSVKPS
FT                   IPPLQAQPLQPLQPQPLQSQTLTASKPAANYNINTGSTGGGINWNSGSSGGTSNAGSGI
FT                   NWNSNSNSNTGSSINWNTNSSNSNTTSNWNSNPMGNNNTMGSMNTGGMNTGGMNTMNNM
FT                   NNMNNNMGGSLNWNTNNNATTNTSSGNMNSNINWNASSANNNNSDSLL"
FT   gene            <1048174..>1050067
FT                   /locus_tag="YALI0_E08888g"
FT                   /old_locus_tag="YALI-IPF40255"
FT   CDS_pept        join(1048174,1048902..1050067)
FT                   /locus_tag="YALI0_E08888g"
FT                   /old_locus_tag="YALI-IPF40255"
FT                   /product="YALI0E08888p"
FT                   /note="some similarities with uniprot|Q06810 Saccharomyces
FT                   cerevisiae YPR075c OPY2 pheromone resistant yeast 2"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79298"
FT                   /db_xref="GOA:Q6C6K3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K3"
FT                   /protein_id="CAG79298.2"
FT                   /translation="MSQACPPQDCTKCASNEVCVLGVASQDNPCPSITCSAAMANTNTD
FT                   SGKSSSGTSAGAIAGGVVGGVAAAAIFGFFVWFFCFSKRAQRVREEKEWIPVVGQDHVT
FT                   DNHTAGQMPPNHRNSSSTFASLASSALSRASNVIPIAYVPGVTSRGQMSRDSSTGGTLG
FT                   SNPPIPNVPWEYQFTPEELLRQSRQSTVYGIRDSVNTEAYRESQAYVSSAMMTAIQAKP
FT                   MLVNVKDGHVTNNDGSARDSALRQSFMSGTSDGSVYEVASAERVNARSIRIGKAQRVGL
FT                   QSTYISEESEEEIGGGASRTRDSTHSAAVPIGLDRPTLGRSLTGNSGSGVSGVSRKSEV
FT                   PPLPAALEVSSSEAPQLDEDIFAGLDIPVQLITTDDGQESPFDDKFRL"
FT   gene            <1050541..>1052327
FT                   /locus_tag="YALI0_E08910g"
FT                   /old_locus_tag="YALI-IPF2226"
FT                   /old_locus_tag="YALI-CDS3479.1"
FT   CDS_pept        join(1050541..1050715,1051060..1052327)
FT                   /locus_tag="YALI0_E08910g"
FT                   /old_locus_tag="YALI-IPF2226"
FT                   /old_locus_tag="YALI-CDS3479.1"
FT                   /product="YALI0E08910p"
FT                   /note="weakly similar to uniprot|Q873E9 Neurospora crassa
FT                   NCU03338.1 predicted protein no"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79299"
FT                   /db_xref="GOA:Q6C6K2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015242"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K2"
FT                   /protein_id="CAG79299.2"
FT                   /translation="MDSSHYPHLSSNLKSRVSLPHPRTAVYELSRSFFSMSKTKFQQLT
FT                   NKALAALALECGLKRSGTKPDLQATLRSVVDSPPVTPPKSLRITSIDMGVRNLSVCQVT
FT                   LGRTRIEKENAVTPTSTVTQDAKVEKKTKATKTKTKAKDSTKDTTPEPDSGVISPTILS
FT                   ADVSVATVSTWNTRDISEFSTSPGATQEDIPWDLRNDSLLEVAYNFVSRELLGDNVRKK
FT                   PHVVLLERQRHRSQGSPSVLEWVFRVNMFESILAGTVYTYKQRSHDKKAGTPENIDSDS
FT                   HNTDLFRVDPRMVADYFIRGKRAKGKKFDIKAEKIGVVGQWLEAESHDLPEFENMVKMQ
FT                   AVAEKPKPKKSTRKKKDEEAEVVEEIKPLAEEEVPRETTPPQPMERKFIPRDLKSIPGF
FT                   SPLTPQLHSLASHLEVMSSILAKKRYNSVKSKKADDVADSLLQALAWYNWQYNREYLRE
FT                   LLENEDDERWLEVNAWVKENVE"
FT   gene            <1055306..>1056220
FT                   /locus_tag="YALI0_E08932g"
FT                   /old_locus_tag="YALI-IPF2225"
FT                   /old_locus_tag="YALI-CDS4470.1"
FT   CDS_pept        1055306..1056220
FT                   /locus_tag="YALI0_E08932g"
FT                   /old_locus_tag="YALI-IPF2225"
FT                   /old_locus_tag="YALI-CDS4470.1"
FT                   /product="YALI0E08932p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K1"
FT                   /protein_id="CAG79300.1"
FT                   /translation="MMNLLRRKDSSRAMTLPGREGDRERAAALEEQIKILAETASQALD
FT                   RVGELEQEVAKQQKEIEAYKTEVGEKQLCIERLSNEVGELMTQSVTCRDSNDAHGTPQK
FT                   QCAKCKSRELITSKSVSTQTTVATTTKIKAEDTRVGARGQTDSAVSRGGLSRDSIQSQD
FT                   SHNSHDSHDSHDSAAHIEHVARVVVAEEMTRPRGVSTSTSTTADSSFSSSVHSSPSRDS
FT                   SRDSSFTELSDFSDDDIGAVRTVIMSAEQIKAVDRSNLEHHVTQLQRLLKKSQSRDDDL
FT                   FRMQKLEAALVAVSRARAVLRKA"
FT   gene            <1058793..>1059248
FT                   /locus_tag="YALI0_E08954g"
FT                   /old_locus_tag="YALI-IPF19980"
FT   CDS_pept        1058793..1059248
FT                   /locus_tag="YALI0_E08954g"
FT                   /old_locus_tag="YALI-IPF19980"
FT                   /product="YALI0E08954p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79301"
FT                   /db_xref="GOA:Q6C6K0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6K0"
FT                   /protein_id="CAG79301.1"
FT                   /translation="MDETIHTLITSLGSIKDPSTRTATDAFEIRTSHFGNLVTLTQESR
FT                   NAFVALTYLLPHFDDALGLLDSAEFKKLSDTRWEVKMPREEFRLVDIHAMFCTCHDYAV
FT                   ACYGDDAQKQIAYFPRHQPFDEYAGVQGICKHLVAVYIRKYSGLFPS"
FT   gene            <1060507..>1064993
FT                   /locus_tag="YALI0_E08969g"
FT                   /old_locus_tag="YALI-IPF19978"
FT   CDS_pept        join(1060507..1060698,1060821..1064993)
FT                   /locus_tag="YALI0_E08969g"
FT                   /old_locus_tag="YALI-IPF19978"
FT                   /product="YALI0E08969p"
FT                   /note="similar to uniprot|P39109 Saccharomyces cerevisiae
FT                   YDR135c YCF1 glutathione S-conjugate transporter vacuolar"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08969g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79302"
FT                   /db_xref="GOA:Q6C6J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J9"
FT                   /protein_id="CAG79302.1"
FT                   /translation="MSLCNDPEGWQLLTNYYDVSPCVSQNVFFILPGSVAALFGVPAVV
FT                   HLYFQPGKRPAVWSYTLKQILTLIQLSIAVSIPFTTTFQHDLRHWSPLVLAFGSIIIFF
FT                   IQKLEFEKRKPSSTVALSFWGLQTLDSAIVVYGLGIRGFDEATYVVSLISIAFLGLFNL
FT                   VLETTYSPSSEPAFYDDSNLFVKLTYSYVSPILSKGINSTLKIGNVPKPPLELRSQYIF
FT                   REFSEVWGPKIDLYTKAAAKDPETAKFPSLIATFSYIHGYDYLKISLLQVFSIVVPFVQ
FT                   PLLLKQLILFVAKYNNGLAPLSQGISIVFAAGSMMLLRTIIESKEELMTNNLMLRIETA
FT                   LSQTVYEKALRLSTAAVADTSIGEIVNILSNSVKQLTSVVSYLHMIWSIPLQITICWLT
FT                   MYSMIGNAMWVGMAALLLVVPFTAFISKLKMGLFLAMQGICESRYTVTNNLLSNIKSVK
FT                   LYGWEPTFYGKVEKIRNEEELAIVRKMSYLSAIESILMRTCNNLAATASFAFIVLFQHI
FT                   PLSAASAIPALNLFTRLLMPFMFVPYIVQFGIQAWVALTKINNFLGLTEVEKFNGQEHI
FT                   PDSSKSVPVNVNGSFFWDKQLEKAALENISYTADKGATVCIIGKVGAGKTATLMATLNE
FT                   LFVQNGSTSVTGSVAYSSQVPWILNSTVKDNILFGSREDPIFYNLVIEACALTHDLQLL
FT                   ADGDQTEVGEKGISLSGGQKARLSIARAVYSRADVQLYDDPLSAVDEHVQAHLIKNVFG
FT                   PGGLLSSKTVVVATNTVNLLRHSSTIHLIEDKTFVESGEFSELMTRDGKIKKLVDEFQT
FT                   QAGESTPDASKVIDAIEVDDKRIESDAKHPFSLRRASSISHFSVITVADDDARRTRVED
FT                   EVKETEALNFVELYKKYFVAVGYINMGVYLVLSLVGSALTIASTYWVAEWGSDKIDLSD
FT                   IQLVLGYFFIRFASALFEAFGGLAFSTFGAVRASKLLHERMLKAVLRAPMSFFEATPLG
FT                   RLTTRFSQDIAKLDWMMNNFITRLATAVITSFSSLVLIVGSSPSTLVVVPPALYLYRII
FT                   QKYYLITSRQVRRLSAATMSPVVSHFQETLNGLTTVRAFGKSRFFSTKSTAHIDVRTKM
FT                   EFLSYSLQQWLGLRLTTIGVVIFLSSGLSLVATLHWKPLSAGLVGLVMSYASTISSCLS
FT                   EVVKAAISVEQESVVLERIFEFCQIEPEAPPKAKEPAAHWPNEGRITFSNYSTKYRANL
FT                   DPVLNELSFNIKPREKVGVVGRTGAGKSSLTMALFRIIEASGGSITIDGEEISNIGLQD
FT                   LRSRLSIIPQDAQMFEGTIKTNLDPSGKFSDTELLQVLEHASLKKFADDNEGLETKLSD
FT                   GGSNLSLGQKQLICLGRALLTPSSILVLDEATAAVDYETDKLIQKTIRREFKDRTILTI
FT                   AHRLNTVMDSDRILVLDAGNVVEFDTPEELLKNKNSLFYALVNANNGDKLDT"
FT   gene            <1065330..>1065632
FT                   /locus_tag="YALI0_E08998g"
FT                   /old_locus_tag="YALI-IPF19974"
FT   CDS_pept        1065330..1065632
FT                   /locus_tag="YALI0_E08998g"
FT                   /old_locus_tag="YALI-IPF19974"
FT                   /product="YALI0E08998p"
FT                   /note="weakly similar to ca|CA5148|CaTFG1 Candida albicans
FT                   CaTFG1 RNA pol.II transcription initiation factor TFIIF (by
FT                   homology)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79303"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J8"
FT                   /protein_id="CAG79303.1"
FT                   /translation="MADFEDSDYDEEFDEDYYEDLPATRQQCLEQISHLEEDIQENNTN
FT                   KRNLLKEIETQPGPATEDQDELLWFIEDAGRRMDEHMENLKRLLSKDEWQGEKEK"
FT   gene            complement(<1065864..>1070822)
FT                   /locus_tag="YALI0_E09012g"
FT                   /old_locus_tag="YALI-IPF2222"
FT                   /old_locus_tag="YALI-CDS0111.1"
FT   CDS_pept        complement(join(1065864..1070204,1070790..1070822))
FT                   /locus_tag="YALI0_E09012g"
FT                   /old_locus_tag="YALI-IPF2222"
FT                   /old_locus_tag="YALI-CDS0111.1"
FT                   /product="YALI0E09012p"
FT                   /note="similar to uniprot|P53115 Saccharomyces cerevisiae
FT                   YGL150c INO80"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79304"
FT                   /db_xref="GOA:Q6C6J7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031047"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J7"
FT                   /protein_id="CAG79304.2"
FT                   /translation="MNGHNNNHDETNRGAMSISSILSGGERRASDASQQPPAPPLQQQS
FT                   PLQQQPPPALHHPPPPPHLSPHQTHQAPHISPQHSPQNGHTMPGPPMMGHEQHYMQQQH
FT                   PQHPQHPQQQSPPMLPQHHQHHPHPHHSPQHSPPMLQHQHHSSTSPPMYHKQQPHPQHQ
FT                   HPPPPHPGHMSPQGHPNMSPHPVQHQGPHPGHQGHPGHPGHQGHPAPPDMYAPRIYMSQ
FT                   QQIPQQAPWPIQIPIQGHTSVDGDHSAPESPPADADDPAYADAKTGFLQQVQSRLEAVV
FT                   QLEELRDKVVIDEYTKTKAYTNAARYAAVKQSAKTSLQKEAIVRVAFVEYEEGGGLAGA
FT                   HTSASPAASSSSSAAPVSSTSSAPASASSAAGAAAAAAATTSSVSTPKAKKRSKAVSKT
FT                   SAAASVAAGTSSKEASPAPKPKTKKQLQAEQREKDREIREENAAAKEAAAAAKQLDQAY
FT                   DSIWKDMARRDAAKVHKTVAATIAVKQSNHRKTAVLASKEARRWQYRTNKSIKDMQGKA
FT                   RRAMREMLSFWKRNEKEERDLRKKAEKEALDQAKKDEEDRESKRQARKLNFLLTQTELY
FT                   SHFIGRKIKTDEMEDGEAAKDGDEDYEAMEKIAKSGSDVETKRAAELDFDEDDDDKLRQ
FT                   IAMQNAHNQVRRNQQQAQAFDAQSETPTAESGAAADSDDAFQNPTSLGDLQLSQPKLLN
FT                   CTLKEYQLKGLNWLANLYEQGINGILADEMGLGKTVQSISVMAYLAETHNIWGPYLVIA
FT                   PASTLHNWQQEISKFVPDFKVLPYWGNGKDRKILRKFWDRKNVKYTRDSPFHVLVTSYQ
FT                   LVVSDAQYFSRVKWQYMILDEAQAIKSSSSSRWKSLLAFQCRNRLLLTGTPIQNSMQEL
FT                   WALLHFIMPSLFDSHDEFSEWFSKDIESHAKEKSQLDQQQLKRLHMILKPFMLRRVKKH
FT                   VQQELGDKIEIDVYCNLTTRQRVMYKILKSQINLQELLAKAQSGSEENTQSLMNLVMQF
FT                   RKVCNHPDLFERADVKSAYNFGPSNCGSDKDTWIGSSNRNLISFEVPKLVYREGGFLDV
FT                   PGEHSKAGSLNKLLKVDLNIWEPSWMGRKRDLVVEEEGGVGRVSRVSQMGVMERVINEV
FT                   NRDVPSVGALPRYTPAPSPFDVFETLYDSYLHRLEPAYDPRVVAPPVDFVCRDRGFQIE
FT                   QEEKMGGVDVRRALTPLTLGQELWWLEKAEAEVKGTNVTALTPGSVSLPPNDLFPSRVL
FT                   DFNGINTLRMPSMSKFISCSGKLAKLDELLAELKAGGHRVLVYFQMTKMMDLAEEYLTF
FT                   KQYNYCRLDGSSKLSDRRDLVNDWQTKPELFVFLLSTRAGGLGINLTAADTVIFYDSDW
FT                   NPTIDSQAMDRAHRLGQTRQVTVYRLLVKGTIEERMRDRAKQKEHVQNVVMSGQSQSHE
FT                   EEVNSKPSRDVALWLLDDDQDEASFVKGKENRGVKRGAEGEEEKKVEEIKKPKTE"
FT   gene            <1073721..>1076039
FT                   /locus_tag="YALI0_E09015g"
FT                   /old_locus_tag="YALI-IPF2217"
FT                   /old_locus_tag="YALI-CDS0911.1"
FT   CDS_pept        1073721..1076039
FT                   /locus_tag="YALI0_E09015g"
FT                   /old_locus_tag="YALI-IPF2217"
FT                   /old_locus_tag="YALI-CDS0911.1"
FT                   /product="YALI0E09015p"
FT                   /note="weakly similar to uniprot|P37020 Saccharomyces
FT                   cerevisiae YJR040w GEF1 voltage-gated chloride channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09015g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79305"
FT                   /db_xref="GOA:Q6C6J6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J6"
FT                   /protein_id="CAG79305.1"
FT                   /translation="MVTTPRDSFDSLISENSNPQITEPEPPSSPRNVFRPFTDTINRAQ
FT                   ALASAALTDDSEFTYNHNIFYDDKTTIDWMHEFAKERQQRRIAWDTPGVRGQALRLVNT
FT                   SRRWIILIGTGIAVGLIAACIDITSHWIADVRLGYCQNAFYLSRDSCCSGIATNDPCPG
FT                   WIEWSSSYFLRYMMYTFICVICATSASVLVITYSPHSKLSGISEIKTILAGYIIKGFMG
FT                   KWTLLIKSLGLGLAVGSGVWVGKEGPLVHVACCCANLLIRYTSREHNEAQKREILSAAA
FT                   AAGISVAFGSPIGGVLFSLEQVSYYFPDKTMWHSFVCAMIAAVTLQFVNPFRTGKLVLF
FT                   QVEYDRLWHRFELVPFAILGIFGGLYGAYFIKLNLKYAKMRKTTFIKNFPILEVAILAL
FT                   ITGLINYPNVYMRLQPSVLLSYLFQECNASTPEALCNLDNWSQSVALLLSACGLGFLLA
FT                   SYSFGVALPAGIIIPSMCIGALFGRAVGILMATWHETNRDFFLFASCPAEGTCVTPGVY
FT                   AVVGAASALGGVTRLTISIVVITFELTGALNYVLPIMAGVMVSKWVGDAIGGKRGIYES
FT                   WIHVLNLPYLDNKDDEPVPVVYVKEFMTSIDDLVVIQTNSSDHVNTIDSLQSTISSCTF
FT                   QGFPIVNQDTILQGYIFRSELKFSIDKALLFDHLTGETECVFESRDAEDSSCLLLREWV
FT                   VQAPPTVTSSATLQLVSNMFFKLGLRYICVVDKGKLVGLITKEDLWRLFNSDRLKTMAV
FT                   PILGTVNDESRQGLLHDDV"
FT   gene            complement(<1076365..>1079004)
FT                   /locus_tag="YALI0_E09020g"
FT                   /old_locus_tag="YALI-IPF2216"
FT                   /old_locus_tag="YALI-CDS0717.1"
FT   CDS_pept        complement(1076365..1079004)
FT                   /locus_tag="YALI0_E09020g"
FT                   /old_locus_tag="YALI-IPF2216"
FT                   /old_locus_tag="YALI-CDS0717.1"
FT                   /product="YALI0E09020p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79306"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J5"
FT                   /protein_id="CAG79306.1"
FT                   /translation="MHNLIISASNITRTHTTTKIDIYFRHCDRVMIRGIRVIKRIRPGV
FT                   SRDCRYRHVAPNMSMALPLNFSNFLHTGGKRSKAVELPTLTTVEDFNHVVNKLVQKTSG
FT                   GKNAIKTKTKTKKARRGDVSTMSEILNNQESTVQNKSFQDSFISDSNPSVVDSSSRPAD
FT                   SALPTALQQLLNTAPLTSSQQLASSDLIDIDSASPSKLRDHVEHFCITQPPDILLSCLL
FT                   QLIASQAYQGAQITLHYLIERAHTEKDLFEILQQACIEICGGKQLPLFRYLMKQNSLVD
FT                   TRKNILPFFLSTAVKLGKEQGHATSVEDLVSTNKNEGGDKNKIRKLGHMKLSSQLKGFF
FT                   YDRPNDLLHLLETSPDLTHLVSAYVMIFSTSLLSSSYVEKQHHLWEKIYLHLSHNEPLE
FT                   WYISHERLLRGLSANFWGNVISRGKAPTIKQLRTKIRKLPPSQAIWIEATLMTNELAHA
FT                   NALVEAMLNEGFSATEEIGQHLVRLFTRDMDPADALDVIDDLHKQYGSYISLHTTFFSH
FT                   WCRTRNSRAIMSMIKVLKARDQMTREFYIQAFQRLLKNGDFRGALYLAEIMARDTETSN
FT                   HITAGEFLSAALYRGRLSIFPKKTTSDVSGLMTEGLRYHLHVERFANYISKFNETREEP
FT                   TTRLPVHVTLRYLNELHKRGLYASMAWYQYNLEMMQICALTQPEVEVFLRGLARLFSRD
FT                   RYISLDFDKEFADIVQQSEAIVERINDRISKTGKGLVEEEESAFASEMEPLSASEPLIK
FT                   EPNSGFSNDSGVLESSDFPSANPVQPPSYNQVFSSPYFQFETIKWGAIKSPKDPGSGVR
FT                   ILNMLRKNSKSYIRSYVVADAIQHVATKLYISTPPSYHRLRSQTSFNMVEFLQQCEREW
FT                   NKPLKWKK"
FT   gene            <1080760..>1083009
FT                   /locus_tag="YALI0_E09042g"
FT                   /old_locus_tag="YALI-IPF2215"
FT                   /old_locus_tag="YALI-CDS0980.1"
FT   CDS_pept        1080760..1083009
FT                   /locus_tag="YALI0_E09042g"
FT                   /old_locus_tag="YALI-IPF2215"
FT                   /old_locus_tag="YALI-CDS0980.1"
FT                   /product="YALI0E09042p"
FT                   /note="weakly similar to DEHA0C18436g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79307"
FT                   /db_xref="GOA:Q6C6J4"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J4"
FT                   /protein_id="CAG79307.1"
FT                   /translation="MRHSIDTPADDYSDSELLSDSNMDMDADELDAEILDGLGNGKKLG
FT                   MSKPKNQKKAKKSVKIEVPAASDESPAYDESSPYGGQGLDYEGGDQSRDASGENLTSSQ
FT                   DQPKTVHWPEEDIDENYPDAIPLKEVKKPKKNTLKSIIKKGKSKFGGNSSEDSSSYSLL
FT                   GGGRRSSLSGGRSGRYNKVNFNRFATDSSDEDSDADSDFGQISIDVENRPRRKVRHQNT
FT                   KTLNLLLFALLIIAVYFILTLTFGGNTGPKGRPSTYKSREKILLNNGTHDFHPTTLVIS
FT                   LDGFHPHYISPELTPHLDNLMRKESGAPYMLPSFPTSTFPNHWTLITGLYPSSHGIVGN
FT                   TFFDPDLNKQFVNTDPSRSRDVAFWGGEPIWQTLSYQNVSTAVHMWPGSEANWLPEDAP
FT                   LIVDPFNQTEALYKKLDRLTEWLDRPIQTRPELMLTYVPTVDTLGHVHGISGSELEQGI
FT                   HEVDLLVGAFREALDNRNLTDVVNLVVLSDHGMAPTSDERLIFLDDLIDVGQIDHLDGW
FT                   PLVGLRPGNNMTESELFNILKKQEPENESWKVYTRKNLPARWNFGGKTGGRYQNRLAPV
FT                   WIIPKTGWSILTHDDYAKMDNSYQPHGTHGYDNRDILMRALFLGSGPYFPDFKFEPFSN
FT                   VNVYSILCDTLHVYPSKNDAQPLTKALVRLNDDWQDDSDLYPGVDFSTSVVEGSTYDEL
FT                   YRTEGHANGSVPTNGQEPSSQKGGKKQSWADYLKGQTNEAIDWLADKWAGIVGHD"
FT   gene            <1083481..>1084461
FT                   /locus_tag="YALI0_E09064g"
FT                   /old_locus_tag="YALI-IPF2214"
FT                   /old_locus_tag="YALI-CDS4285.1"
FT   CDS_pept        1083481..1084461
FT                   /locus_tag="YALI0_E09064g"
FT                   /old_locus_tag="YALI-IPF2214"
FT                   /old_locus_tag="YALI-CDS4285.1"
FT                   /product="YALI0E09064p"
FT                   /note="similar to DEHA0F07326g Debaryomyces hansenii IPF
FT                   8538.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79308"
FT                   /db_xref="GOA:Q6C6J3"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J3"
FT                   /protein_id="CAG79308.1"
FT                   /translation="MSSSLAIGTSFIITKKGLMASSAHSSDPSDSYAYLRTPVWWAGII
FT                   TMAVGEIANFAAYTFAPAVLVTPLGALSVIIGAVLASFFLNERLGFLGSVGCAICLVGS
FT                   LMIVLHAPADKDVQTVDEILNYAVQPGFLVYVCMVAIFAVFMIYRVAPRLGRTNPMIYI
FT                   SICSSVGSISVMSIKAFGIALKLSLEGNNQFTHPSTYLFLLVVAICIVTQMNYFNKALD
FT                   QFDTNIVNPLYYVTFTTCTLAASFILFQGFNTSSRVDSFWLIAGFLIIFAGVYLLNVSK
FT                   QNNITSSQDQRSTDEESVAMTLLNHQDEDDGFDVDDDDTEILRNY"
FT   gene            complement(<1084557..>1086881)
FT                   /locus_tag="YALI0_E09086g"
FT                   /old_locus_tag="YALI-IPF2213"
FT                   /old_locus_tag="YALI-CDS0913.1"
FT   CDS_pept        complement(1084557..1086881)
FT                   /locus_tag="YALI0_E09086g"
FT                   /old_locus_tag="YALI-IPF2213"
FT                   /old_locus_tag="YALI-CDS0913.1"
FT                   /product="YALI0E09086p"
FT                   /note="similar to uniprot|P33277 Schizosaccharomyces pombe
FT                   GAP1 GTPase-activating protein (Ras GTPase-activating
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79309"
FT                   /db_xref="GOA:W0TYM2"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYM2"
FT                   /protein_id="CAG79309.4"
FT                   /translation="MLPLQRQQTGTSTAPSQRQSKRFSVAAMYMSMGGVDKDDDIDDAL
FT                   AKAQKHLRFLKAAISEQSKHNFVLEKDVRYLDTRIALIIQNKMGVEEQKDIASRLDEHE
FT                   AISETSFPDRKKTDLYSNLFFLLQSEPKHIASLCTLVSMTEIDSLLQTVMFTIYGNQYE
FT                   QREEHLLLSMFQAVLAYQFDTTLEFSSLLRANTPVSRMMTTYTRRGPGQSYLRETLSHC
FT                   LNDIISNPQTLEINPMRVLIETDSAPDMTMDQAAENPEVIAIIEPRLRTLEAICENVLS
FT                   TIINSKSIVPYGIRWICKQIRGLARRKYPDAPDASVCSLIGAFFFLRFINPAIVSPQTY
FT                   MLIDKLPNDANCRRTLTLVAKVLQNIANKPTTSKEPYMASLTPFLEVNKNRVNKFLNEL
FT                   CEVPDFYESLEMDQYIALSKKDLSISITLNEIYGMHGLLVKYISDTKDVHLQKVMGDLG
FT                   TCPALVPRAQNATIDLSLFSQWEASVLNESHSDSGAYNGLSLLPDISRSDVVFMELKTI
FT                   LINIIRAFPPGHPILTRPLRLRSIADFAASSSVDDSGVIKRGIKALDLLDEMDKDEYAD
FT                   DDKFVLVSEIENELSQLGSLQDSVEQEAVSLETVYRVITEQNEYLRSQLDTYRSYLNNV
FT                   RSHTGSKKDRKIVQDDTTTATTPNPLLNPAGSTSSYSEGLVKKYNVTQLMRDGVILTCS
FT                   LPLNRVGPSLVFYIASPAPGTFVLALVMKGRSDPVVTVDFKIDDLLEIADQEVDEIDLQ
FT                   CLVLSVKNLQVLLKREFDRRR"
FT   gene            <1090902..>1092518
FT                   /locus_tag="YALI0_E09108g"
FT                   /old_locus_tag="YALI-IPF2212"
FT                   /old_locus_tag="YALI-CDS2037.1"
FT   CDS_pept        1090902..1092518
FT                   /locus_tag="YALI0_E09108g"
FT                   /old_locus_tag="YALI-IPF2212"
FT                   /old_locus_tag="YALI-CDS2037.1"
FT                   /product="YALI0E09108p"
FT                   /note="similar to uniprot|P32582 Saccharomyces cerevisiae
FT                   YGR155w CYS4 cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79310"
FT                   /db_xref="GOA:Q6C6J2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J2"
FT                   /protein_id="CAG79310.1"
FT                   /translation="MVTFFLHLSQATFLPPPHPHIFTTYTMTPPPVAQTVLEHIGDTPM
FT                   VELQKIPQSLGIKCRILGKCEYFNAGGSVKDRIAKRMVLEAEKQGRIKPDAGYTLIEPT
FT                   SGNTGIGLALVGAVRGYRTIITLPEKMSNEKVSVLKALGAEIVRTPTEAAWDAPESHIG
FT                   VARRLEQEIPKAVILDQYGNEANPDAHLYGTGAEIWEQTEGKVTHLVAGAGTGGTITGI
FT                   AKALKAKNKDVVVVAADPKGSILAVPESLNDSNEGYKVEGIGYDFVPDVLDRDVINSWI
FT                   KTEDRESFLLSRRLIKEEGLLVGGSSGSALAAALQVAKDLTENDTVVVVFPDSVRSYIT
FT                   KFIDDDWMKNNGFVDDATLAEQAKRKQQYKGATIADLHLKPVVTVKGDSTVATAVELMR
FT                   EKGFDQIPVSSKSSGKLIGLVTLGNLLSYLSHGRATPETPVEKVMLDFRKLDSHQLTAD
FT                   AIASATASLSIGTPSGDKKASKQRQFVEVTVDTPLSALNKFFEHNSSVIVTEKDSDGVK
FT                   PVHIVTKVDLLAYLVKNGSFE"
FT   gene            complement(<1093893..>1094297)
FT                   /locus_tag="YALI0_E09130g"
FT                   /old_locus_tag="YALI-IPF19948"
FT   CDS_pept        complement(1093893..1094297)
FT                   /locus_tag="YALI0_E09130g"
FT                   /old_locus_tag="YALI-IPF19948"
FT                   /product="YALI0E09130p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79311"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J1"
FT                   /protein_id="CAG79311.1"
FT                   /translation="MFRLARFSASSNVVRLAVARPAVRPFSTSLARFNEQKKPEPELMN
FT                   TLEQSEFIQKIRNNDRVLHEIAGFQDFMLEKGYVNPDGTRASGLMTMMKMISDKEVGKR
FT                   LEGLNAVLEQEQIEVTKDDIKSLVAALGMK"
FT   gene            complement(<1095212..>1096195)
FT                   /locus_tag="YALI0_E09152g"
FT                   /old_locus_tag="YALI-IPF2209"
FT                   /old_locus_tag="YALI-CDS4052.1"
FT   CDS_pept        complement(1095212..1096195)
FT                   /locus_tag="YALI0_E09152g"
FT                   /old_locus_tag="YALI-IPF2209"
FT                   /old_locus_tag="YALI-CDS4052.1"
FT                   /product="YALI0E09152p"
FT                   /note="some similarities with uniprot|P27476 Saccharomyces
FT                   cerevisiae YGR159c NSR1 nuclear localization sequence
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79312"
FT                   /db_xref="GOA:Q6C6J0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6J0"
FT                   /protein_id="CAG79312.1"
FT                   /translation="MLGRHGTVVGFRLVTERGPADNRRSKGYGFVEYSSIPEAERALES
FT                   LRDVRIGQRQIRTAFTQDMQQHRAERAREGYGRDQGYGGRDGGQGYGRDGGRDYRSPHP
FT                   DGPQSGYGGNQGYGGGQGYGQGQGYGQGQGYGSAQGYGGHGGQGYGGQGHGYDRQQSTP
FT                   NPTTPNPSTPIPTPAPTLTTPDATSTVLSALQPNQLLDLIAHLKTLITKNPAEAAQILQ
FT                   VSEPITYAAVQAMLLMGLIDAKVVQQVVGGQQPQAPAHSTPQPQHVTPQPQAQHHVAAP
FT                   THLDPQQQQMINQVLALTDAQLASLPHDQRATLQQLRENYRRGIFS"
FT   gene            complement(<1096953..>1097714)
FT                   /locus_tag="YALI0_E09174g"
FT                   /old_locus_tag="YALI-IPF2207"
FT                   /old_locus_tag="YALI-CDS4869.1"
FT   CDS_pept        complement(1096953..1097714)
FT                   /locus_tag="YALI0_E09174g"
FT                   /old_locus_tag="YALI-IPF2207"
FT                   /old_locus_tag="YALI-CDS4869.1"
FT                   /product="YALI0E09174p"
FT                   /note="similar to uniprot|P25299 Saccharomyces cerevisiae
FT                   YGL044c RNA15 component of pre-mRNA 3 -end processing
FT                   factor CF I"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79313"
FT                   /db_xref="GOA:Q6C6I9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I9"
FT                   /protein_id="CAG79313.1"
FT                   /translation="MTDRVVYVGSIPYDQTEEQMLDIFKSVGPVISLKLMFDKETGRSK
FT                   GYGFAEYPDADTARSAIRNLNGFQVGSRQLRVDHSHEGQVREFFASQNRFPNPNVSKNG
FT                   RPGLPAGVPLRQGLEPAQQVSETMNGYTKSQMVAVVTDLMSMSKNSPQLLADLFAQAPQ
FT                   LAYAAVQCLLNLGLVDEQRVLSVVRGNPALNAGGNPPSAPAQSTPDPVAGNAALIQQVM
FT                   ALSEADINALAPEHQRSIRELRDRIQRGEVI"
FT   gene            <1099456..>1100343
FT                   /locus_tag="YALI0_E09196g"
FT                   /old_locus_tag="YALI-IPF2205"
FT                   /old_locus_tag="YALI-CDS4425.1"
FT   CDS_pept        1099456..1100343
FT                   /locus_tag="YALI0_E09196g"
FT                   /old_locus_tag="YALI-IPF2205"
FT                   /old_locus_tag="YALI-CDS4425.1"
FT                   /product="YALI0E09196p"
FT                   /note="similar to uniprot|P07273 Saccharomyces cerevisiae
FT                   YGL043w DST1 TFIIS (transcription elongation factor)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79314"
FT                   /db_xref="GOA:Q6C6I8"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I8"
FT                   /protein_id="CAG79314.1"
FT                   /translation="MGLSVAEIKKLMADLEKASGEAVYDILQVLHKEVEPTEKLLRETK
FT                   LGIAVNKLRTSSDSRISDLVKKMIKSWKDTVTAQKRDASKKVEGKKETKEESRPVKSSS
FT                   ASSGNATSYTPPSGQRTPAKDGVSTEIYSDKVRNRCIDVTYTALAVGMTAHPNEVLACA
FT                   KAIENEVYKMENGTGGNYRPKMRSLYINLKDPKNPGLRGNVISGKISAERLCRMSPQEM
FT                   ASDELKKEIEEMEKQNLFAARGATEQRAVTDRFTCGKCKQKKVSYYQMQTRSADEPLTT
FT                   FCTCENCGTRWKFS"
FT   gene            complement(<1100922..>1101203)
FT                   /locus_tag="YALI0_E09218g"
FT                   /old_locus_tag="YALI-IPF11369"
FT   CDS_pept        complement(1100922..1101203)
FT                   /locus_tag="YALI0_E09218g"
FT                   /old_locus_tag="YALI-IPF11369"
FT                   /product="YALI0E09218p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I7"
FT                   /protein_id="CAG79315.1"
FT                   /translation="MQIKNLALLSMAALAVAAPMNDQAESPEDIHQFKDKIHSKKCPQK
FT                   ECPKSTTIITTHYTTITGTIAIDAKPCAPTPTQKKHCPKCGDPNCGGC"
FT   gene            <1102515..>1104164
FT                   /locus_tag="YALI0_E09240g"
FT                   /old_locus_tag="YALI-IPF2204"
FT                   /old_locus_tag="YALI-CDS1961.1"
FT   CDS_pept        1102515..1104164
FT                   /locus_tag="YALI0_E09240g"
FT                   /old_locus_tag="YALI-IPF2204"
FT                   /old_locus_tag="YALI-CDS1961.1"
FT                   /product="YALI0E09240p"
FT                   /note="weakly similar to uniprot|P33893 Saccharomyces
FT                   cerevisiae YBL080c PET112 required to maintain rho+
FT                   mitochondrial DNA"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79316"
FT                   /db_xref="GOA:Q6C6I6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6I6"
FT                   /protein_id="CAG79316.1"
FT                   /translation="MLRISRDTKIVARVTHVTKSRTYATSTAPKLVVGLEIHTQLLTKR
FT                   KLFSSTTVPSLSTTPNTKVSYFDAALPGTQPRLNPQALLLALKAAIALRCDVKELTAFD
FT                   RKHYFYPDQPAGYQITQHRKPLAINGKLKLNWWDLYSQNEWPALLAKEANTDSADTRDL
FT                   ASRSIDVPILQIQLEQDTGKSTYHGSETLVDLNRTNMPLIEIVTAPVIHTASHAAAFVK
FT                   KLQTLLKRIGVSTGEFESGAMRVDVNVSIGEDGERCEIKNLPNTSSIEAAIEAEYNRQV
FT                   ELVGKGGTVEKSTMGFDGKKTFILRSKENAVDYRYMPDPELPLIRLSKGTLLKVRDSLP
FT                   ELPDKVFSRLTDDPYYVTTKDALTLIHVAGLSDYYFEVFERVSEETEDAKALKQPVNWV
FT                   VNELLGRVRKADEARAAESAESGEPDLGAHDYNSIYPPAKLAELILAVHNHQLTLPSAR
FT                   LLFQHFLANPEDLKNMTIEQAITEFELGESGDVVDACRQVINEHESVVKSVKDGSKPGS
FT                   IKFLIGMVMKATQGRINPAVIERQLKTEMRHM"
FT   gene            complement(<1104303..>1105562)
FT                   /locus_tag="YALI0_E09262g"
FT                   /old_locus_tag="YALI-IPF2202"
FT                   /old_locus_tag="YALI-CDS3049.1"
FT   CDS_pept        complement(1104303..1105562)
FT                   /locus_tag="YALI0_E09262g"
FT                   /old_locus_tag="YALI-IPF2202"
FT                   /old_locus_tag="YALI-CDS3049.1"
FT                   /product="YALI0E09262p"
FT                   /note="similar to uniprot|O94021 Candida albicans CA49C10.
FT                   07C hypothetical 48.1 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79317"
FT                   /db_xref="GOA:Q6C6I5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I5"
FT                   /protein_id="CAG79317.1"
FT                   /translation="MTTTFGHTARHKFWDFDSQNTPLNHGSFGATPKDVEEKRFELIRK
FT                   IEKNTDKFMRVDLYKMEDETRELVSKWINSEKLNTVFVPNASVGFNTVIRSLPLKEGDV
FT                   IVHCSTLYGACDKTLQFMENRYGVKSAKVDITYPEDSDKDIVEKFRKVIKENPKTKMVI
FT                   FDTVSSMPGCLLPFNELTQLCKDLDVLSFIDGAHGIGLVELNLKENEPDFFVSNLHKWG
FT                   YVPRGAAVLVVAKKHHNKIHTLPVSHTYLDDEFEAASELDKSRRLVDRFTFVGTTDFST
FT                   HLSTPAAVKFREQIGGEEAIRNYCFELAKKVGTFAADFFGTEVLENAAGTLTTAMVNIR
FT                   LPVSEKWLNEASAEDKEHLLQVINTYPLENFDTFVPPVFHNGKLYIRLSCQVYNELSDY
FT                   KVGVQSVKEALKQVPGVLAE"
FT   gene            <1106919..>1108392
FT                   /locus_tag="YALI0_E09276g"
FT                   /old_locus_tag="YALI-IPF42030"
FT   CDS_pept        join(1106919..1107201,1107515..1108392)
FT                   /locus_tag="YALI0_E09276g"
FT                   /old_locus_tag="YALI-IPF42030"
FT                   /product="YALI0E09276p"
FT                   /note="weakly similar to uniprot|P18898 Saccharomyces
FT                   cerevisiae YGL155w CDC43 geranylgeranyltransferase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79318"
FT                   /db_xref="GOA:Q6C6I4"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR041960"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I4"
FT                   /protein_id="CAG79318.1"
FT                   /translation="MEKTKHTKYFSRCLFLLPAQATSYDGNRLSIVYFCLSGLDLLGTL
FT                   DQFIKTDEQRKEYIEWIYKQVVESGEGFRGSPTFKLCGHEHSESREGDNKYDPANLAAT
FT                   FFGLACLGILGDREIWTRLSRDKILSYVASCQRDDGSFGSFCIDGKVAPDYDMRYCYLA
FT                   TGIRRLARDTSERLSSSRDINIPAMVGHIKNTESFQGGIGQGQTGNVTEPHSGLTYCGL
FT                   SALKNAGQLNNKEWGTTLEWLVGRQCDERTSETQVSESSKRDDNDSSEEEQGDPQTGGF
FT                   NGRVGKLADTCYSFWVGASLASLGGTNYVSADLAREYLLNNTQNTLLGGFGKTPGEIPD
FT                   PLHSYLGVCALSIFGQPGLGKVVPELCISEKAFETLTGGDSTSVAV"
FT   gene            complement(<1108630..>1109544)
FT                   /locus_tag="YALI0_E09284g"
FT                   /old_locus_tag="YALI-IPF2199"
FT                   /old_locus_tag="YALI-CDS4332.1"
FT   CDS_pept        complement(1108630..1109544)
FT                   /locus_tag="YALI0_E09284g"
FT                   /old_locus_tag="YALI-IPF2199"
FT                   /old_locus_tag="YALI-CDS4332.1"
FT                   /product="YALI0E09284p"
FT                   /note="similar to KLLA0E08877g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79319"
FT                   /db_xref="GOA:Q6C6I3"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR030847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6I3"
FT                   /protein_id="CAG79319.1"
FT                   /translation="MAGKSKNHIYAGFTSGLVSAVVLQPFDLLKTRVQQSNGKSMVQVI
FT                   KSLNTPLDLWRGTLPSALRMSVGSAMYFTCLNTVREAVAGGRRLTVGDRSTSSLPKLTN
FT                   TENLISGGLVRGTVGLLVMPITVIKVRYESSTYHYKSIVDAATSIYKHNGMRGFFYGWA
FT                   ATFARDAPYAGLYMLFYEQLKVALPSILFSDITTSSHSEKYYSSWSSAMINSVAAATSA
FT                   GIATTCTNPFDTVKTRMQLAPKEYPNFLTSVKTIIQHEGIQALFRGLALRICRKACQAG
FT                   ISWCIYEDLVKRFERMNLPGPQL"
FT   gene            complement(<1115564..>1116343)
FT                   /locus_tag="YALI0_E09306g"
FT                   /old_locus_tag="YALI-IPF2198"
FT                   /old_locus_tag="YALI-CDS4659.1"
FT   CDS_pept        complement(1115564..1116343)
FT                   /locus_tag="YALI0_E09306g"
FT                   /old_locus_tag="YALI-IPF2198"
FT                   /old_locus_tag="YALI-CDS4659.1"
FT                   /product="YALI0E09306p"
FT                   /note="weakly similar to uniprot|P50113 Saccharomyces
FT                   cerevisiae YGL154c LYS5 L-aminoadipate-semialdehyde
FT                   dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79320"
FT                   /db_xref="GOA:Q6C6I2"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I2"
FT                   /protein_id="CAG79320.1"
FT                   /translation="MRLLPVESQLDISRFRYRSDAKMALGSQLLQRYIATVLTGKKWTD
FT                   IVISKTPQGKSFVANSPFDYNISHHSELVVVAVRPDGKQIGVDITSTVPPSNWTMNWME
FT                   GFSQIFSPFEYSQVTSDSTGNGEFFLRWALKESYSKAIGMGLNMDLAKLEFRNLDTARL
FT                   MDAAKDKTGTDVVGAVAVQRGWSNSAQLWIDGVAQDRWHHEIFMLNNNHVIALATHKEG
FT                   VNEVEQVRLRNLTVEELMSRALPFGPAVAMQPHSNPV"
FT   mobile_element  complement(1117573..1127025)
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="YALI0_E09319t"
FT                   /note="uniprot|Q9C0U1 Yarrowia lipolytica Ylt1 LTR-
FT                   retrotransposon"
FT   repeat_region   complement(1117573..1118286)
FT                   /locus_tag="YALI0_E09328t"
FT                   /old_locus_tag="Yali0E_1117573_1118286_repeat_region"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="LTR of uniprot|Q9C0U1 Yarrowia lipolytica Ylt1 LTR-
FT                   retrotransposon"
FT   gene            complement(<1118335..>1126200)
FT                   /locus_tag="YALI0_E09350g"
FT                   /old_locus_tag="YALI-IPF19929"
FT   CDS_pept        complement(1118335..1126200)
FT                   /locus_tag="YALI0_E09350g"
FT                   /old_locus_tag="YALI-IPF19929"
FT                   /product="YALI0E09350p"
FT                   /note="uniprot|Q9C0U1 Yarrowia lipolytica LTR-
FT                   retrotransposon"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79321"
FT                   /db_xref="GOA:Q6CHG3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041577"
FT                   /db_xref="InterPro:IPR041588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6CHG3"
FT                   /protein_id="CAG79321.1"
FT                   /translation="MSKVTKDEFQALTAKMDALTLSHQEITTTLATAVNTKEFRSALDE
FT                   LKQSNESFKTHQAGEFEKLHQLVSAQHETIANLSKRVDSPPSTSSLEGISRIGKADSEF
FT                   EPDTPQKGNSVLHGMDFAASDTGSVDYRKESDALKSIIRNEVYPSLSSEEFRKQLYAYK
FT                   SFDSRVATFILLQDDIRWSTRARAFHLWCGVNDKQPLFDQQYLQLRSTFEAETADESTK
FT                   PGAHARLNTACERLLRDLFRKRGFDHEPAVSFAEQEEELRFRFKDYHTAFSIETLRAYL
FT                   SALSTALTSSPLPVLSRCLQLQKLAPTHLGTALGREIPRDNTRWLSLGMDSDPERDHQV
FT                   ATELIQPLAKMITQHVQRLDDLNDEALLRWRQHTVSFEDVWMWVEPSAPPEPSTPEPDK
FT                   VVVHVAGRGRSTRKPADGPVSTETVQKPTIRASDASTSWAADKAPCVFCGSTAHALVNC
FT                   DDSEGSPLVKAKYLGSFKSFTRLGYQGFEKYLSPVDADFPLKQSALYTSWKQKEWSNPL
FT                   MEPRLRTFNAQWRPALAGRVNAVEFVHVEDPGGPLDNSYDSDSSASGYDFQDLLQPGTF
FT                   SVCLGGVPRDLLSDTFSSYDEPRTIIDSTDSQLELTKEAIHQHILQMAKQPTPLPVTYA
FT                   IDAPVSGSYSGNMKRLVAHPAFMQLVARLTAPPGTFKASTLEAGFVGAVMAPSSPVAGR
FT                   VYFVDAVQRLLNKYNVVLPTKLYECFATVRNDLMEPAYATEGDPRRQSLKTNINALKTV
FT                   VDSKHPDRPVAPLPRRSPRRDVREDMPPPALPQATKRGAASSTVSSAAPPTAKRTKAVA
FT                   NPSSVGPTDSASSTGAVVDVPSSRVAVHPPRLGDNHYVSPGTRVTNHIHDASAVAENAP
FT                   LKDYKDALDRLPSDLEDSKALFTRDHPRYDNALLKAGRLPLFKLEAIHALPESEKADLF
FT                   ERILKASDVDGLVLFELLQVCPDLTKYIWKNFRHQRHRLAGPDIQAIALELGDDLMECA
FT                   MDLALNVISSTPYELNSGTFGRLQEVFTTIDRQLYDDKVGRPLSPHFTDNIALFDQQTS
FT                   ALFDSGSSNNVIDTDFFALVLAKAGVTPDRVIVFSDGQSHATVANGAKVKVDFWALLPV
FT                   TFLGVVTLETFCVMKCSMKCILGTGYISKLRISFDHDRYRVASVENPGNPGVRCYPSDR
FT                   PSAGLVAHLGLLDRLVRPGRRPVPAFPAAKLSRQNVMAHVRPTPSLCGDVDEATNLLDA
FT                   SSLGGPQPGSYSHRSETAAGCFAISFADDCESAGPPSSAATAILKALASSSGPDPLGIP
FT                   PRDDPDESYSSSPGHHGDVSGEPNSSSPGHTSAPVDGTLGPLLPTDASSVDDSNELCSS
FT                   SSGSEAPSEAPSGVSAALSDVGTVFQESYTSYRFHDNLADNALHARPPDAHALSGFISS
FT                   ADLDSVFQYPPPASPCSCCQQPVRECRVLGNTVFIMADIGDSATIVQVQPDTDLSMRQQ
FT                   LYLAEVLSDAQEITPEDSLHSLSVSVNAMYKPLHKRSLPLNKLRPDGSFPVGDGSKPSP
FT                   RHRNFSGDESCQFDAKLAPVLFPAELALCRHRMSDMEGVWAFNEDQEGVLSHHIEEPTK
FT                   IYVEEGGVINSKHFPLRGAMVGAAKDIIMKGLANGQMEPSSSPHRNAWFLVSKKSSGYR
FT                   FILDCQGLNKITLRDAFHPPNADLLAESFCGRAVTSLLDIKNGYGQKEIAPESRDLTAF
FT                   NTDFGSYRLTRLPQGWCNSPAVFHRAMLRVLGPLFPDQAVVFLDDIGVLGPKTDYGGAM
FT                   HDDFPGCRRYIVEHMDNLMAVLQNLYEAGLTVSFDKAELFVSEAEFLGFLTTSEGRFPS
FT                   PGSSEKIESFEFPTTVRGVRSFLGAVVYFRMWIPHFSSIAAPLYDCISAAQKAGKLKIT
FT                   KTEATESAFMALKKAMVSPAVLHRYDPTLPIVITTDASSLGWGAVMSHIVSVGPPAARR
FT                   PVRFESGLWNPTERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSR
FT                   VELPNAMFTRWFAYIKQFDYEVRFVKGRDNPVADWLSREKFSDFRPVDFRPPVADTARQ
FT                   ADELAPLVPPTWSPVASITVLSIGPEPVFIHKGISLDLIFTTIASGDLDRDGVDIPPRL
FT                   RQICSEFFIFDDILLLISSPGLHRRVLFTEKEVSEVLRATHEQYGHRGAAAILHALRRL
FT                   YYWPGMADHVKSHRASCGTCAKATNHGLLKASLHFVVPRLIWETVQLDILYLPAVHGPT
FT                   KEYPDLADPAKALAAQTTLTDFLPTAPQFTDVSSAPRGRLNVTIAPYQYVLVARDEFSG
FT                   WPEAVPLRSINSLSTAAFFYDFIIARFGVPRRVYTDGGSEFKGDFKHLCEDFHIKQVFT
FT                   TPAHGQSTGIVERGHQNLLHCLRKYGRQWILYLHTALWADRCTRRSSTGKSPFELMYGV
FT                   SGVLPVESRFLTWNYLSGKTDLAHNDPAHAAFLRTLQLAASTFEVGSARDHLTLQRQRQ
FT                   KAFYDKHHNTADTDPLAVNDFVFVHDLRPHNKLTPRWTGPSIVTACHPETSTYTVNDVD
FT                   GENPRRIHRNRLKVFHPASIVEFQDRMKEHQSRESALPAIPGRFSACSPHVLPPASVAT
FT                   RSVRSAATTASTRVTSRSKLARVDSGLAQGSFLAQGLYS"
FT   repeat_region   complement(1126312..1127025)
FT                   /locus_tag="YALI0_E09361t"
FT                   /old_locus_tag="Yali0E_1126312_1127025_repeat_region"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="LTR of uniprot|Q9C0U1 Yarrowia lipolytica Ylt1 LTR-
FT                   retrotransposon"
FT   gene            complement(<1127021..>1127548)
FT                   /locus_tag="YALI0_E09372g"
FT                   /old_locus_tag="YALI-IPF3057"
FT   CDS_pept        complement(1127021..1127548)
FT                   /locus_tag="YALI0_E09372g"
FT                   /old_locus_tag="YALI-IPF3057"
FT                   /product="YALI0E09372p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79322"
FT                   /db_xref="GOA:Q6C6I0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6I0"
FT                   /protein_id="CAG79322.1"
FT                   /translation="MSRKTNRRELTEFDKGRIVGLADCGKNLAEISKQLDIPRSTVRDF
FT                   IKRSKERGHYENVPRPGRPRKTTEEIDKLIVEVTDDRSDSLEDIQKQIVPELSVRTIKR
FT                   RIREAADRPEVLSPVSASAPGSSTLQHTTLHRNSVSKPGLKKPSLSGTNLSGSALEAYG
FT                   VKQEYQPQMNHV"
FT   gene            <1133533..>1134675
FT                   /locus_tag="YALI0_E09405g"
FT                   /old_locus_tag="YALI-IPF3056"
FT                   /old_locus_tag="YALI-CDS3456.1"
FT   CDS_pept        1133533..1134675
FT                   /locus_tag="YALI0_E09405g"
FT                   /old_locus_tag="YALI-IPF3056"
FT                   /old_locus_tag="YALI-CDS3456.1"
FT                   /product="YALI0E09405p"
FT                   /note="weakly similar to uniprot|P53112 Saccharomyces
FT                   cerevisiae YGL153w PEX14 peroxisomal protein involved in
FT                   protein import - peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09405g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79323"
FT                   /db_xref="GOA:Q6C6H9"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="InterPro:IPR025655"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H9"
FT                   /protein_id="CAG79323.1"
FT                   /translation="MIPSCLSTQHMAPREDLVQSAVAFLNDPQAATAPLAKRIEFLESK
FT                   DMTPEEIEEALKRAGSGSAQSHPGSVVSHGGAAPTVPASYAFQSAPPLPERDWKDVFIM
FT                   ATVTVGVGFGLYTVAKRYLMPLILPPTPPSLEADKEALEAEFARVQGLLDQVQQDTEEV
FT                   KNSQVEVAKRVTDALKGVEETIDQLKSQTKKRDDEMKLVTAEVERIRDRLPKNIDKLKD
FT                   SQEQGLADIQSELKSLKQLLSTRTAASSGPKLPPIPPPSSYLTRKASPAVPAAAPAPVT
FT                   PGSPVHNVSSSSTVPADRDDFIPTPAGAVPMIPQPASMSSSSTSTVPNSAISSAPSPIQ
FT                   EPEPFVPEPGNSAVKKPAPKASIPAWQLAALEKEKEKEKE"
FT   gene            <1136746..>1137141
FT                   /locus_tag="YALI0_E09427g"
FT                   /old_locus_tag="YALI-IPF11367"
FT                   /old_locus_tag="YALI-CDS5938.1"
FT   CDS_pept        1136746..1137141
FT                   /locus_tag="YALI0_E09427g"
FT                   /old_locus_tag="YALI-IPF11367"
FT                   /old_locus_tag="YALI-CDS5938.1"
FT                   /product="YALI0E09427p"
FT                   /note="similar to uniprot|P22217 Saccharomyces cerevisiae
FT                   YLR043c TRX1 thioredoxin I"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09427g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79324"
FT                   /db_xref="GOA:Q6C6H8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H8"
FT                   /protein_id="CAG79324.1"
FT                   /translation="MTITDLHSLGEFEEAIKSEELTVIKFSTKTCIPCKMIAPVYEKYS
FT                   KAYKGAKYYNCDSEELVEVASMVPVSSVPTFALYKNGEIVLIVSGNGADPRKLRSGIRK
FT                   YAAKDETKKPRPVTNGIKKRRRPKKIT"
FT   gene            <1137881..>1139002
FT                   /locus_tag="YALI0_E09449g"
FT                   /old_locus_tag="YALI-IPF3054"
FT                   /old_locus_tag="YALI-CDS3539.1"
FT   CDS_pept        1137881..1139002
FT                   /locus_tag="YALI0_E09449g"
FT                   /old_locus_tag="YALI-IPF3054"
FT                   /old_locus_tag="YALI-CDS3539.1"
FT                   /product="YALI0E09449p"
FT                   /note="similar to uniprot|P32579 Saccharomyces cerevisiae
FT                   YGL169w SUA5 translation initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09449g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79325"
FT                   /db_xref="GOA:Q6C6H7"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H7"
FT                   /protein_id="CAG79325.1"
FT                   /translation="MNTSIVRLKTASIQFDKSPRARQPSISDSETLEALKHASHVLQTT
FT                   HEPVAFPTETVYGLGASALSTESVKSIYAAKNRPADNPLIVHVSSLDQLKRKILKGREI
FT                   PDVYTPLIEKFWPGPLTILLPLDSDSDVSPACTVGQPTVAVRMPDHPVARSLIALSDLP
FT                   LAAPSANASTRPSPTTADHVYHDLQGRIPLILDGGACHVGVESTVVDGLSDPPMLLRPG
FT                   GVSLEQIREHGGEKWKNVLVGRANAKTDEAVRTPGMKYKHYSPTGKVVLFGPVSDKSVE
FT                   QAVKEYVTSGELEGKKIGLLTSLTLSNDTLPDVHTLSMGTTPALVSRNLFAGLRDMDIA
FT                   EVEVILVEGIREEDEGLAVMNRLRKAASEEITV"
FT   gene            complement(<1139464..>1142250)
FT                   /locus_tag="YALI0_E09471g"
FT                   /old_locus_tag="YALI-IPF3053"
FT                   /old_locus_tag="YALI-CDS0563.1"
FT   CDS_pept        complement(1139464..1142250)
FT                   /locus_tag="YALI0_E09471g"
FT                   /old_locus_tag="YALI-IPF3053"
FT                   /old_locus_tag="YALI-CDS0563.1"
FT                   /product="YALI0E09471p"
FT                   /note="uniprot|O43108 Yarrowia lipolytica Calcium-
FT                   transporting ATPase 1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09471g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79326"
FT                   /db_xref="GOA:O43108"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43108"
FT                   /protein_id="CAG79326.1"
FT                   /translation="MDSHTSTEGVPLSETNNRSHATPSAQYCQMTVEETCSKLQTNPET
FT                   GLTSSQEAMHRRDIHGSNEFAQEEEDSLIKKFFEQFSENPLLLLLIGAAAVSFFMGNHD
FT                   DAISITLAILIVTTVGFVQEYRSEKSLEALNKLVPPEAHLIRAGNSQTVLASTLVPGDL
FT                   VEFSVGDRIPADCRIVKAVHLSIDESNLTGETTPVTKDTNPVTGTPPIGLADRTNTAYM
FT                   GTLVRDGNGTGIVVGTGSHTAFGAVYDMVSEISTPKTPLQASMDNLGKDLSLVSFGVIG
FT                   VICLIGMFQGRDWLEMFTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSRQKAIVRKLPS
FT                   VETLGSVNVICSDKTGTLTRNHMSCTTCWTVDMGDLANAVTLKPGQSHTEADPKAVAAL
FT                   KNSVSLANMLKVGNLCNNSKFNREAGHLVGNATDIALIEVLDYFGLEDTRETRKRVAEV
FT                   PFSSSRKWMLTSTTTGDSSTPMISVKGAGEVIAPFCEYYCKKDGKTAPFNDDMRKKVTE
FT                   IASEMSNDGLRIIAFAYKQGKYEEGSEEAPEGLVFAGLMGLYDPPRPDVPRAIRRLTTG
FT                   GVRVVMITGDSAATALSIGRRIGMPLMPGTQSVVEGSKLATMSDQALDECLQTASIFAR
FT                   TSPEDKMKIVKGFQRRGDVVAMTGDGVNDAPALKLADIGIAMGQGGTDVAKEAADMILT
FT                   DDDFATILSAIEEGKGIFNNIRNFITFQLSTSMAALSIVAVATIMGLENPLNPMQILWI
FT                   NILMDGPPAQSLGVEPVDPDVMNKPPRPRNEKVMTPDLVKKCVEAAVIILVGTMLVYVT
FT                   QMQDGVIDKRDTTMTFTCFVFYDMFNALACRSATKSVFEIGFFSNKMFLYACGASIIGQ
FT                   LAVVYVPFLQSVFQTEALSVKDLLSLVLISSSVWILDEAKKYFLKSRSTNNYTNSVV"
FT   gene            complement(<1145093..>1151653)
FT                   /locus_tag="YALI0_E09493g"
FT                   /old_locus_tag="YALI-IPF3048"
FT                   /old_locus_tag="YALI-CDS0020.1"
FT   CDS_pept        complement(1145093..1151653)
FT                   /locus_tag="YALI0_E09493g"
FT                   /old_locus_tag="YALI-IPF3048"
FT                   /old_locus_tag="YALI-CDS0020.1"
FT                   /product="YALI0E09493p"
FT                   /note="similar to uniprot|P07259 Saccharomyces cerevisiae
FT                   YJL130c URA2 multifunctional pyrimidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09493g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79327"
FT                   /db_xref="GOA:Q6C6H5"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H5"
FT                   /protein_id="CAG79327.1"
FT                   /translation="MTPSLPIFPPLNPEDKLMTLELQDGTAVQGYSFGADKPVAGELVF
FT                   QTGMVGYPESITDPSYQGQILIVTFPLVGNYGVPSREAVDEVVKGLPKHFESNKIHVAG
FT                   LVVASYTEEYSHFLAESSLGAWLKEQDIPAIYGVDTRRMTKHIREEGSMLGRLCIDNAV
FT                   PEWVDPNKLNLVAEVSIKEPKLYTPPADRAIHVNGKPVRILAVDVGMKYNQIRCFVNRG
FT                   VELLVVPYDYDFLNEEYDGLFLSNGPGDPSVLKETAARIAKAVEAKKTPIFGICLGHQL
FT                   LSRSTGATTLKMKFGNRGHNIPCTNLLSGRCYITSQNHGYAVDAKSLTGGWEELFVNSN
FT                   DGSNEGIYHKDLPFFSVQFHPESTPGPRDTEFLFDVFIKAVVEHKTSGVLKAIEFPGGT
FT                   IEENRAAHPRVQVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIAT
FT                   IQTSKGLADKVYFLPVTPEFVRKVIKYERPDAIYVTFGGQTALNVGIEMKDEFEGLGVK
FT                   VLGTPIDTVITTEDRELFARSMEEIGEKCAKSATASSKEEALAVVEEIGYPVIVRAAYA
FT                   LGGLGSGFADNEAELIELCNKAFAGSPQILVERSMKGWKEIEYEVVRDAFDNCITVCNM
FT                   ENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKE
FT                   YCIIEVNARLSRSSALASKATGYPLAFIAAKLGLNIPLNEIRNSVTQVTCACFEPSLDY
FT                   VVVKIPRWDLKKFTRVSTLLSSAMKSVGEVMSIGRTFEEAIQKAIRSTDYQNLGFNETE
FT                   ALMSIDIDSELQTPSDQRLFAIANALHSGYTVDKIWELTNIDKWFLNKLDGLVKFAKGL
FT                   TKYNNSNLPVNIMREAKQLGFDDRQIAKYTGSNELAVRLKRVEAGVTPFVKQIDTVAAE
FT                   FPAFTNYLYMTYNADSHDLTFDDHGTMVLGSGVYRIGSSVEFDWCAVRAVRTLREQGAK
FT                   TIMVNYNPETVSTDYDEADRLYFEVINMERILDIYELERSSGVVISMGGQTSNNIALQL
FT                   YRQNVNILGTSPEMIDSAENRYKFSRMLDTIEVDQPAWKELTSIDEAEAFAEKVSYPVL
FT                   VRPSYVLSGAAMNTVYTRDDLASYLNQAVEVSRDYPVVITKYIENAKEIEMDAVAKDGK
FT                   LIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVRRIVVATAKIGKALQVTGPFNIQFI
FT                   AKDNEIKVIECNVRASRSFPFVSKVTGVDLIEMATKAICGFPVSPYPLEELPQDFVAVK
FT                   VPQFSFSRLSGADPILGVEMASTGEVATFGKNKYEAYLKALLATGFKLPKKNILLSVGS
FT                   YKEKVELMPSIKRLHELGFKLFATAGTADFIQEHGVPVQYLDVLNEGADEEKSEYSLTQ
FT                   HLANNMIDLYINLPSSNRFRRPANYMSKGYRTRRLAVDYAVPLVTNVKNAKLLTEALAR
FT                   NMTLDVSATDFQSSHNTVTLPGLVNVAGVVPDIAIAGSSDIADFTKVSLRSGFTFSRLL
FT                   PMGVSESIIDLASLQTAQANAEGHSFTDYNLSVAATAHNANEVGKVTGKVGSLVLPFSK
FT                   LGDNTTKVAAISEHFGAWPANKPIVTDATTTDLASILLLASLHNRPIHVTGVVDKNDIV
FT                   LVAMAKERGLAVTCDVSVFALFFAREDYPEAHSLPTQEDQDALWANLATIDCFSVGILP
FT                   SQMAKELGQPVVAGLGVAETLPLLLSAVADKRLTVEDIEARLYTNPVRIFELVEQPDTS
FT                   IVVNLGRKYTFKSKGLWSPMAGKPATGSVERVIVGGQTVVLEGDLNGASTGKAISIHPQ
FT                   AAPVEAAPATQEMVHSPTTPRMARFSFSSDVRPFANNHVESSVVGAIPPEVSAPSILNK
FT                   LRRNPFLGQHILSVNQFSKENLHDIFALANELRQAVKRVGVLDILKGRLLTTLFYEPST
FT                   RTATSFDAAMQRLGGRVIAVNVDASSYKKGETLQDTLRSVACYSDAIALRHPDPESANI
FT                   AGRFSPVPVINGGNGSVEHPTQALLDMYTIREEVGTLNGTTITFMGDLRYGRTVHSLVR
FT                   LLTHYKVNIRLVCPPELTLPDELKTLLKSQGKLDLESATLTPEIVSTTDVLYCTRVQKE
FT                   RFTNEKEFEAIKESYLVDNKVLKDAKPHMCVMHPLPRNAEINPEVDFDARAAYFRQMRH
FT                   GLFVRMALLAMVMGPVQ"
FT   gene            complement(<1154339..>1154683)
FT                   /locus_tag="YALI0_E09515g"
FT                   /old_locus_tag="YALI-IPF3043"
FT                   /old_locus_tag="YALI-CDS5062.1"
FT   CDS_pept        complement(1154339..1154683)
FT                   /locus_tag="YALI0_E09515g"
FT                   /old_locus_tag="YALI-IPF3043"
FT                   /old_locus_tag="YALI-CDS5062.1"
FT                   /product="YALI0E09515p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09515g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79328"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H4"
FT                   /protein_id="CAG79328.1"
FT                   /translation="MLYWICTQLVTNQSVSNQQRHLTNISPVQIETERLAAFFLGVLLT
FT                   QGPNGKRIFRRESEMKNTEMFSAITKQKICDFPSLSLCGRRSMVLKWCLGSDHGSGNDD
FT                   LQLQLQYSTQ"
FT   gene            <1158378..>1159700
FT                   /locus_tag="YALI0_E09559g"
FT                   /old_locus_tag="YALI-IPF3041"
FT                   /old_locus_tag="YALI-CDS2880.1"
FT   CDS_pept        1158378..1159700
FT                   /locus_tag="YALI0_E09559g"
FT                   /old_locus_tag="YALI-IPF3041"
FT                   /old_locus_tag="YALI-CDS2880.1"
FT                   /product="YALI0E09559p"
FT                   /note="weakly similar to ca|CA0204|CaIKI3 Candida albicans
FT                   killer toxin insensitive protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09559g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79330"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H3"
FT                   /protein_id="CAG79330.1"
FT                   /translation="MKHISLEIYISGSFRPRQNGFDRLSLKLTMLHKLPLEQLSTVFSF
FT                   CDARSVVALSLVSPYLRSCVQSNRIVYEHALNDIFFGLTNSTGSRNMSVAQSLNFIASL
FT                   GHQVDIEQEVNLLAAEKISKTTIAPFHNDYELHNNVLVNPTATLDNSLYNFTNPITQND
FT                   DCLTWLVKDYHYVTLYEMSLRDGFLRVKHRENMENMIDYSGTSVSRSSQMQIGRGHLGH
FT                   YYATNDTQIFQDQLWIRKKENHVIKSIMLPIGYNLPGVGVQKLQSRVNSRYSYCRLDSK
FT                   DDSAWFLLDWNQAKSFLLFKTDKYSDKIDLHACAETGCVFITSNTSLNTLKLFPRISER
FT                   EITWYTAQTNDLPKSYLSLQYGCVVREGAEVTYLKHKGSILLVGQVEGTTQCWKFTRPF
FT                   LSKLDAYVKRCLPVWKADSEEWRDWKMDLSGYFYPQRRRTR"
FT   gene            <1162297..>1162902
FT                   /locus_tag="YALI0_E09581g"
FT                   /old_locus_tag="YALI-IPF3040"
FT                   /old_locus_tag="YALI-CDS5478.1"
FT   CDS_pept        1162297..1162902
FT                   /locus_tag="YALI0_E09581g"
FT                   /old_locus_tag="YALI-IPF3040"
FT                   /old_locus_tag="YALI-CDS5478.1"
FT                   /product="YALI0E09581p"
FT                   /note="weakly similar to DEHA0F11682g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09581g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79331"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H2"
FT                   /protein_id="CAG79331.1"
FT                   /translation="MSYNTEALERGRAFFNRMKHQMTIQTDTTDKEESTQLQDSLVKYY
FT                   MTRNKTIPEWLETEETRQSLERLKIKDASTAASTNLVTPTAPIQIKTPASNVPELTHRG
FT                   RSPSPTSPQTPTSPAFTNQRPPLKSRPSQLQDIYARRGSSADVSRQNSVTGFEKYGRPN
FT                   GYQEVRNARVPPPLNQESTDRMREKLRNLSRSNSVQCH"
FT   gene            complement(<1166202..>1169165)
FT                   /locus_tag="YALI0_E09603g"
FT                   /old_locus_tag="YALI-IPF3038"
FT                   /old_locus_tag="YALI-CDS0466.1"
FT   CDS_pept        complement(1166202..1169165)
FT                   /locus_tag="YALI0_E09603g"
FT                   /old_locus_tag="YALI-IPF3038"
FT                   /old_locus_tag="YALI-CDS0466.1"
FT                   /product="YALI0E09603p"
FT                   /note="similar to uniprot|P33327 Saccharomyces cerevisiae
FT                   YDL215c GDH2 NAD-specific glutamate dehydrogenase (NAD)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09603g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79332"
FT                   /db_xref="GOA:Q6C6H1"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H1"
FT                   /protein_id="CAG79332.1"
FT                   /translation="MDAIDVKGFIPENLIENETKWFYEQLSIDDSFFATESIDNIVSYI
FT                   HTLYSAKIAAYARTDKKLDIQLVREDDAHAFYIDTSNPGTTNLEGPQYETRIDEKYLSS
FT                   PNGKFRVETFRATNDSIPGDGALRCYFVYKCDFIEPNPKEGETDLTKISDKTFYEKATE
FT                   YTRAIYSEIVNQVVQREGPVIEMFEIDGSRERRVIIGYKQETTPGYFSALSDLYHFYGL
FT                   TSTRKYVEQFSNGVTIISMYLVPAFPQTANTADEIKAMKRYPPIENSIHQIVKEASLLF
FT                   CLPNNAFKHHFARGDMSLQESIYAHCAFIFVQHFLNRLGSEYTTLQQMLGTGKEHVEIL
FT                   EKLKRRLRQETFTRDYLFELINNQLDVVKQMYLQFADVHYIQSKSEGDSFLPTLSYQRL
FT                   QTQSVLSTDELKKLIRKKAANDHEAMVMEAFLTFNTHVLKTNFYTPTKVALSFRLSPDF
FT                   LPESEYPQPLYGMFLVVGQEFRGFHLRFADIARGGIRIVKSRNREAYSINARSMFDENY
FT                   NLANTQQRKNKDIPEGGSKGVILLNNEHQDKAEIAFHKYIDSVIDLLLKGDTPGIKEPI
FT                   VDLHGSPEILFMGPDENTAGLVNWATMHAKQRGAPWWKSFFTGKSPSLGGIPHDEYGMT
FT                   SLSVREYVKGIYRKLEIEQPTVRRQQTGGPDGDLGSNEILLSAEKYTTVIDGAGVLYDP
FT                   NGLDREELLSLAKRRVMISEYDASKLSPEGYRVLVDENDVTLPSGEVVSNGTQFRNTYH
FT                   LRCESVDMFVPCGGRPEAIDINNVSQLFVDGKPKIKWLVEGANLFITQQAKLRLEEAGV
FT                   VVYKDASANKGGVTSSSLEVLASLAFDDESFAKDMCIRDGVVPEFYKAYVKEVQSIIQN
FT                   NARLEFEAIWREHEKTGKPRSILSDELSIAINDLSGELKNSALWDDVEFRNSVLHEALP
FT                   KLLVNEIGLDVMLKRVPESYLKAIFGSYLAGRFVYEKGANPGQFAFFEYMAEKTKKQ"
FT   gene            complement(<1169941..>1170609)
FT                   /locus_tag="YALI0_E09625g"
FT                   /old_locus_tag="YALI-IPF3036"
FT                   /old_locus_tag="YALI-CDS5219.1"
FT   CDS_pept        complement(1169941..1170609)
FT                   /locus_tag="YALI0_E09625g"
FT                   /old_locus_tag="YALI-IPF3036"
FT                   /old_locus_tag="YALI-CDS5219.1"
FT                   /product="YALI0E09625p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09625g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79333"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6H0"
FT                   /protein_id="CAG79333.1"
FT                   /translation="MLACVWGGRGGRLPSWESASSQVRTSVVLYLLEDPVISCQHVSSS
FT                   LVTPGCLCVAKTVHGTESEPPLVMTLNNQQAVISTHPKIASSPTLFVWGPNTLSHARHD
FT                   GVGPNHRHPFSACLFCKTRRLLTCRCTLARAPRGTRFSSEVCHQDASAGGCMHAQKLAF
FT                   CVFFFFFFGVRQKHKVKPNTHRRAGWERTMPIYIYTSGASTIERHKTNTSHNHACHSRR
FT                   "
FT   gene            <1171740..>1172162
FT                   /locus_tag="YALI0_E09647g"
FT                   /old_locus_tag="YALI-IPF3035"
FT                   /old_locus_tag="YALI-CDS5899.1"
FT   CDS_pept        1171740..1172162
FT                   /locus_tag="YALI0_E09647g"
FT                   /old_locus_tag="YALI-IPF3035"
FT                   /old_locus_tag="YALI-CDS5899.1"
FT                   /product="YALI0E09647p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09647g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79334"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G9"
FT                   /protein_id="CAG79334.1"
FT                   /translation="MLVHDFGAERRRLKTEVLGHTFSPRGEVAAEEEEKTEVDARILQI
FT                   SGVRCIPNSPPTPGDILPKTCRPKHRSQNTTVHGKESLLPGFPLFFVPSKKQRPKDGPA
FT                   YLWPMASPRYHEKERGNVISKHSKRFTSAINKGKDD"
FT   gene            <1176716..>1177207
FT                   /locus_tag="YALI0_E09669g"
FT                   /old_locus_tag="YALI-IPF3034"
FT                   /old_locus_tag="YALI-CDS5798.1"
FT   CDS_pept        1176716..1177207
FT                   /locus_tag="YALI0_E09669g"
FT                   /old_locus_tag="YALI-IPF3034"
FT                   /old_locus_tag="YALI-CDS5798.1"
FT                   /product="YALI0E09669p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09669g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G8"
FT                   /protein_id="CAG79335.1"
FT                   /translation="MDHCIDLTFGSGVQNTALVVITYKTFLAPKHNWNSANPYRPQFCC
FT                   SGSSNDPKPRAYLPEFLSQGHEVTSHEVTRSQGHEDGHVMAHSLTLSSSNPLISCDEIY
FT                   HHSLHPVLFAEIFRVSLLCKGVSRGGKSCFFFLSNFSLLCGPISNIMTCVRQPEMLCYE
FT                   "
FT   gene            <1181475..>1181795
FT                   /locus_tag="YALI0_E09691g"
FT                   /old_locus_tag="YALI-IPF11363"
FT                   /old_locus_tag="YALI-CDS6039.1"
FT   CDS_pept        1181475..1181795
FT                   /locus_tag="YALI0_E09691g"
FT                   /old_locus_tag="YALI-IPF11363"
FT                   /old_locus_tag="YALI-CDS6039.1"
FT                   /product="YALI0E09691p"
FT                   /note="similar to uniprot|Q02608 Saccharomyces cerevisiae
FT                   YPL013c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09691g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79336"
FT                   /db_xref="GOA:Q6C6G7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G7"
FT                   /protein_id="CAG79336.1"
FT                   /translation="MKGGIRIRLARFGRRHSPLYNIVVAKAGQRRDGLPIEVIGTYNPI
FT                   PAPRSHEELKRGVLPVKDVELDFDRAKYWIGTGAQPSDTATRILMLAGVLPEDWKGVDK
FT                   KQ"
FT   gene            complement(<1182842..>1183087)
FT                   /locus_tag="YALI0_E09713g"
FT                   /old_locus_tag="YALI-IPF11365"
FT                   /old_locus_tag="YALI-CDS6124.1"
FT   CDS_pept        complement(1182842..1183087)
FT                   /locus_tag="YALI0_E09713g"
FT                   /old_locus_tag="YALI-IPF11365"
FT                   /old_locus_tag="YALI-CDS6124.1"
FT                   /product="YALI0E09713p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09713g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79337"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G6"
FT                   /protein_id="CAG79337.1"
FT                   /translation="MVTKYSNICPDNYVSPPCDEQTAALSSVASATSAADAAANTGPAR
FT                   APSVTSPTLLSPLPSIRDSLTDALASSISASYGDLP"
FT   gene            complement(<1183199..>1183387)
FT                   /locus_tag="YALI0_E09735g"
FT                   /old_locus_tag="YALI-IPF11362"
FT                   /old_locus_tag="YALI-CDS6192.1"
FT   CDS_pept        complement(1183199..1183387)
FT                   /locus_tag="YALI0_E09735g"
FT                   /old_locus_tag="YALI-IPF11362"
FT                   /old_locus_tag="YALI-CDS6192.1"
FT                   /product="YALI0E09735p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09735g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G5"
FT                   /protein_id="CAG79338.1"
FT                   /translation="MNLPALETTQCHSRMIPSHSGSLTRQPEPGSRLDITENWGWKRLT
FT                   CSGRRGGAGTAAGVLVS"
FT   gene            complement(<1184098..>1185057)
FT                   /locus_tag="YALI0_E09757g"
FT                   /old_locus_tag="YALI-IPF3033"
FT                   /old_locus_tag="YALI-CDS4156.1"
FT   CDS_pept        complement(1184098..1185057)
FT                   /locus_tag="YALI0_E09757g"
FT                   /old_locus_tag="YALI-IPF3033"
FT                   /old_locus_tag="YALI-CDS4156.1"
FT                   /product="YALI0E09757p"
FT                   /note="some similarities with KLLA0F27225g Kluyveromyces
FT                   lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09757g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79339"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G4"
FT                   /protein_id="CAG79339.1"
FT                   /translation="MKTTRPNLHINLHNSPNPQSCGGAALGRTLSNTSQSSLPSTPMDQ
FT                   TIHTPHGYLSRNNSITSSVATSEDEDGYMSDLNSNPLTSISNQFWPEHDDAFLMHIYYK
FT                   VVDNPTIAPFVGHTPPSGIIHRVAKDCAKRAKAESRDFPHSMVAIRRRLLVLTQRGGGN
FT                   TVGLGQTPVKESNSNFEGAGTLLFGSHVSSGDHVNENVDGSSSGHVDFNSDWLQDDDAM
FT                   DTSIDSNTPLTPPTLSRPTRITLSHQSPVFSMDSVPLQSPFQEGFNFSGSKRLAESPMM
FT                   GDGHDKDPKEEDVEGLPTNITSQRKRDSLRFKRGQQKK"
FT   gene            complement(<1190191..>1190676)
FT                   /locus_tag="YALI0_E09779g"
FT                   /old_locus_tag="YALI-IPF3032"
FT                   /old_locus_tag="YALI-CDS5477.1"
FT   CDS_pept        complement(1190191..1190676)
FT                   /locus_tag="YALI0_E09779g"
FT                   /old_locus_tag="YALI-IPF3032"
FT                   /old_locus_tag="YALI-CDS5477.1"
FT                   /product="YALI0E09779p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09779g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G3"
FT                   /protein_id="CAG79340.1"
FT                   /translation="MDFGGDCERNATDRMIFKREFCLDFDGYHKGGLNMSLQSLFVELD
FT                   PEKQSNPSTPTKQLHQNHEKQPIQAQSSIPLLLAKVSRNKLKTEFVSTIYWCINGSITG
FT                   SNTGKRRCIIVDVVVLSETSRTYYYDPLDRPSHFHYFLFPPPSLPHPKMKITSACSY"
FT   gene            complement(<1194421..>1195392)
FT                   /locus_tag="YALI0_E09801g"
FT                   /old_locus_tag="YALI-IPF3031"
FT                   /old_locus_tag="YALI-CDS4106.1"
FT   CDS_pept        complement(1194421..1195392)
FT                   /locus_tag="YALI0_E09801g"
FT                   /old_locus_tag="YALI-IPF3031"
FT                   /old_locus_tag="YALI-CDS4106.1"
FT                   /product="YALI0E09801p"
FT                   /note="similar to DEHA0C16368g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09801g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79341"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G2"
FT                   /protein_id="CAG79341.1"
FT                   /translation="MIRAKFTEYKQALRNNWVGQPQYTEKDYPDIDGKNFVVTGATGGV
FT                   GLEVTKLLLDKKSHVIMVGRSRSDWQPVLDQLQKDHSHGTLDFVEADLADLTTVQRAGE
FT                   YIRTKYPTLDGAIFNAGVMAPPYSLTPQGQESQWGVNVVSHFLLAKYISPAVIAAAKTA
FT                   PKDSVRLVWLSSSVTFVSPYEGGIKFDDINHQDDKNPSPWTLYSQSKIGDAYLAYLWSK
FT                   HHPDSGVVSVSVDPGNLSSNLSRHYPILSTLKSYIQYPPKYGAYTELSALLNPAVKNNE
FT                   HLIPWGVRGHLRLDVDDGRRGSVGEELWQRLNKDVAPYFKEE"
FT   gene            complement(<1196189..>1197642)
FT                   /locus_tag="YALI0_E09823g"
FT                   /old_locus_tag="YALI-IPF42017"
FT   CDS_pept        complement(join(1196189..1197104,1197629..1197642))
FT                   /locus_tag="YALI0_E09823g"
FT                   /old_locus_tag="YALI-IPF42017"
FT                   /product="YALI0E09823p"
FT                   /note="similar to DEHA0F24321g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09823g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79342"
FT                   /db_xref="GOA:Q6C6G1"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR025845"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G1"
FT                   /protein_id="CAG79342.1"
FT                   /translation="MAKSRYEYVKNFEQENHLLPDCHIVVRVDGRGFHKFSKFYNFEKP
FT                   NDLRAIELMNKCAELIVSQFDDVIMAYGDSDEYSFLLRRKCSLFERRESKLVSTFASTF
FT                   TSYYVALWGRYFNGNESRDETRETTEERKEEDMKEEERKEEERKEEERKAVKSEPRDDS
FT                   RDSRSNELVIHMLPTFDARCVVYPNAQSIRDYFSWRQVDCHINNLYNTTFWTLVQQGNM
FT                   TTQEAEQRLSKTVSKDKHELLFTEFGLNYNNEPDVFKKGTTIVKEFDTTGLSQRQVERK
FT                   MKKMGRVRVMHCDIIRDGWWDERKWILE"
FT   gene            <1199178..>1202675
FT                   /locus_tag="YALI0_E09845g"
FT                   /old_locus_tag="YALI-IPF3029"
FT                   /old_locus_tag="YALI-CDS0277.1"
FT   CDS_pept        1199178..1202675
FT                   /locus_tag="YALI0_E09845g"
FT                   /old_locus_tag="YALI-IPF3029"
FT                   /old_locus_tag="YALI-CDS0277.1"
FT                   /product="YALI0E09845p"
FT                   /note="similar to uniprot|P22138 Saccharomyces cerevisiae
FT                   YPR010c RPA135 DNA-directed RNA polymerase I 135 KD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09845g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79343"
FT                   /db_xref="GOA:Q6C6G0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6G0"
FT                   /protein_id="CAG79343.1"
FT                   /translation="MSETKKASFHTLEREEYFANPPDEQKYPLLRDAVAPHIGSFNALT
FT                   EGGMDSLLNLAAKEVGERVVFDGDDENLGNRLAIRVANVQLGRPTVSANDKTTINRKVF
FT                   PSECRERMATYRARMVLTLGYSVNGGPEKFESRDVGMIPIMMGSNRCHLEGMGPKDMVA
FT                   HKEESEEQGGYFVINGLEKLIRLLIVQRRNHPLAIIRKSFTKRGSNYTTFGVQIRSVRP
FT                   DQSSQTNVLHYLSDGGITMRFSWRKNEYLVPVMMILKALVETNDREIFDGIVASEGSNS
FT                   FLTDRLELLLRNYKSYKLTSKQENLAFLGEKFRIVMDAPKDMSNEDVGRLMLKRVILVH
FT                   LQDNTDKFRMLLFMIRKLYALVASECSPDNPDAVQHQEVLLGGFLYGMIIKERMEEYLS
FT                   NFCATVRTELQKKKQSLHLDDPKIMQRICPRINEDIGRKLHYFLSTGNLVSHTGLDLQQ
FT                   TTGYTVIVEKINFHRFIAHFRMIHRGSFFAELKTTDVRKLLPESWGFLCPVHTPDGSPC
FT                   GLLNHLAHKCLISVKKSDVGDIDSVLNQLGISPAGALANTPQKSVVMLDGKIIGWCTHE
FT                   IAQQAANTIRQWKVTGDARLPQDLEVGLVPPSRGGQYPGLYLFAEASRFMRPVKHLATE
FT                   KEDIVGPFEQVYLNVAVTPDEITNVHSHVEYSPTNILSILANMTPFSDFNQSPRNMYQC
FT                   QMGKQAMGTPGVLTHRSDNKMYRLQTGQSPIVRAGLFDEYGLDNFPNGMNAVVAVISYT
FT                   GYDMDDAMIINKSAHERGFGHGTIYKTEKVDLTEKQKPGDPTLLHFGFGPDNWPREWTQ
FT                   TLDVDGLPLVGAKLSNGDPIAAYYDSNSNKTMCLKYKSGETGFVEEVKLLGDDSLGELQ
FT                   KITVKLRIPRSPVIGDKFSSRHGQKGVCSQKWPTYDMPFSESGIQPDVIINPHAFPSRM
FT                   TIGMFVESLAAKSGALHGMAQDATPWQFSETNTAAEYFGEQLLKAGYNYHGNEPMYSGV
FT                   TGQELRCDIYVGVVFYQRLRHMVNDKFQVRSTGPVNPLTMQPVKGRKRSGGIRVGEMER
FT                   DALIGHGTSYLLQDRLLNCSDYTQTSMCRTCGSLTATQEAQSTTGHRRGVKCRRCATQL
FT                   EKDSFSWDSPPEGMWQDAIGNCFVGGDDTTTVAIPFVLKYLNSELSAMGIKMKYNIDP"
FT   gene            <1204352..>1214033
FT                   /locus_tag="YALI0_E09867g"
FT                   /old_locus_tag="YALI-IPF40280"
FT   CDS_pept        join(1204352..1204407,1204628..1214033)
FT                   /locus_tag="YALI0_E09867g"
FT                   /old_locus_tag="YALI-IPF40280"
FT                   /product="YALI0E09867p"
FT                   /note="similar to uniprot|Q12150 Saccharomyces cerevisiae
FT                   YLR087c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09867g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79344"
FT                   /db_xref="GOA:Q6C6F9"
FT                   /db_xref="InterPro:IPR029636"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F9"
FT                   /protein_id="CAG79344.1"
FT                   /translation="MEVVADCFLFWGSTTRSSWDSSSRFQPEAISGGVDFSPVFLMDVI
FT                   MILLVSLFVIFYFNRLIAWVTNFGLRFVFWHKHRIRVKVQSVQISLLGGRIFFKNLTYI
FT                   GTNQTICFLKGHFTWRYWLWKSRKSELQMSEDSESNVTPEKLQSRLALEVDGLEWFVYN
FT                   RTPAYDAVFEQFQARHKANAESKCENNDTLQTAHTTTSYEPKNFSFGEQIYLDLFPIDL
FT                   KVHKGSMVVGNRDTQSVWMFHFKNATGLVDVAPTPSYLDRYRQVYRADFEHPVVEMRPN
FT                   IDYKGMDSTQFEHKPKVKKSLWAKTYENEPNTSKLRRSLRAIRAVLLARALPDNESEHS
FT                   REGMPWMGLSRYLTQDTEYYVEDDKNEGAFEDYARVPQILDAPSGSLTMYYDVQGQVPQ
FT                   IEGVGAKDSPQWGMKITATNATINYGPSTERQRTDLHQMLIPRTCIDAVPSPKPLPGDL
FT                   RPYEQFRVDVEFQEEMILRVPIREESKNLEFANLFRDDPGANTKRPFGWMEIKTNNTVT
FT                   VEEIQSMEATKDGWAHTVSINLGQTEVRTSVNHGLLFTGDHVSLECDLSTPLEWNGLCD
FT                   WKFDLQSSSVKLFLLDEHITLFSDLTNDFGSDTPVPYTLFTPYKYTFHWGVSHFCNIYL
FT                   NINDANIINNPTDFEDNTFLVFESDALDIDFSLPLDQIHQSLNEASFKISAPIMDFNLS
FT                   VPPWHTLDSFLETEKMGRAYEFAIVGTYSYYSSFDKEHTDSMHVEIYGTDVTMVAHGIF
FT                   VCYLMKVIDNYFGINTKFQTMEEYAQRDAPKVVDPVNFIKEKNDMDVVVDTFITNGVIV
FT                   LPANLYSTREYLRLDFPSLDIDCRFTNYYMDLQSNIAPIRGRCVTEATTKAYMLARESH
FT                   SRTLGEVQPHIYIDGIDVHGHRLFGRPPEEPTYYCKWDFHLGDIQIRGPMSAIAVLGQA
FT                   ADCFDYGFDDTENKLLMAIPLLFDVTFVSAKINSLTFRLETDPGAVEVLTSAVAFKLND
FT                   LNNSDYTARASVKIPWIQLSVMTNEEVLSQLTTSVLVTDYIQKRNMDDRRGKQQEHIRL
FT                   HDDSFGRCDFLLTHKYAPDAKPYTIVPTLPLPPLAEPLTDENINSLGTAGIFSTYKKRE
FT                   NYDIAQSSLSSASTNSHRLSIDSSFMTRSSGISRISRSRNSYKIRKFRRPRIENKFLAP
FT                   KPWRKASKTAVSDIDVDPDFAQDFFASKMRPGMSASRETPDEDTETDNIVVQLGKIGGT
FT                   LTPAALTVVLAIMAQTPQDGFHVTLDKLQIQVMKKLNYILSGQPETKNIRVVIPGVDIE
FT                   MKASPGGSEEYVHLQMGTIDIMVRDNVHKRPQSIEDYIQDTMDGNEPRENSLIVYGSMD
FT                   LTLEVVKSSHTIGPSPNPLVLGLTQFEFWLNQDVSNSASAQIKELDVSLDNQQLEWLLR
FT                   NTDRQLDRLKLLLDDIPNQNKATQSDRTKDVVYSLALAGQQFDITSDPSTLTKPAYIIR
FT                   LSQQHVRAHDSWKILIRLRHILQTVPAAWYAHKEKQLIHGDCKVPVDARTKVINVFKKW
FT                   RFWEINSIPKSYLFLHVFPPESKRAITMTTRVLVDVDGIGLRLLFAECENYLLFDYVQV
FT                   YVDVSEGDDHVIDADAGVCVASIRTHFSLEIVDTIQTIARYVDATKPSSDDETDQDTTR
FT                   PSTGDVIKIEVPQSPLSMSTSMISDKSTTTPEPDKSVSPGPEKVASKSPPIRVMVNTLL
FT                   SSWVVSIKSSAITLSVSGQEFLNSVFVEKTGDDLINDVAVILTGTFGSTGMELIATETD
FT                   EQVVSYAINSTAASIAFGKSIHVTCDTQNMLLTVSQDLLTLVKLTTQFFEHDWEVIDKL
FT                   IEELSGEEDIKAHHTPGSAAAAAADAADELKEELCEEPGPLKDIIPFLDRVSFRYSLTS
FT                   LQCSSMLMPNWVYANEFRNMQVVVGSGIDSRTTLNGSFEVGEQMHEVRNHSSGDSQIVL
FT                   GIALSAVSALGGSVITEEFALLDCALRFGIFDAQTVSPSMLTRYLASENERECVKQMSD
FT                   AIDDLQEILKKRISKGGGETTEIPVSSKQNTPSTPSYPLHFTTQILADRFSFTIPALDS
FT                   SLCLECDKVSALAYNFVMSEKTKAIEHTALTGAVTPDHVRFLLQNKRLPGGVATLVDLH
FT                   IRISLYEYIKSGERKRGADIESEFIRICLSSPSLLKLMEILTNIEGDISLLEWESDDKS
FT                   PKRKSPKRKMSRDSVDSKVSHESFVSAESEPAIVEEEPESRQETASPAIDSGDDDSTSS
FT                   DSPLQNWRIRTSFEQVTFGWLFPPNSGFNGIVFGCDNVAVVALSGYGQLRLKGVYITPA
FT                   HGNKDTDFFPDKVFPTHANTVYLPRLLVTFATLDTREYHLRILGEELKGTILPSIVEIV
FT                   SCTATTIKQTVKELELLSKERNKRLEKSNSSVRVVEPNTAPSDSSLLSIDHSFVFRADA
FT                   KFQGAVVSLWSESEYAMEMYAETRHIQASSGGRRSTARVVESSPELYLQAPALEAKVDF
FT                   RHNTGSANKELLKFGVTVEPSSNTLYPRMIPVVLDIVSGMRTLLEDKSDKHKDLKLDLK
FT                   SEIKKVKIETPQPQQPSKDLTFSEWDITAGIQIERQELIMSCEPTARVSASLSYQNLSL
FT                   NMTTVDASEEGLGKFFSFTCRLHEFNCSLQHTYSREISAMVGIDEILCVVNKDKEVDPA
FT                   LANTWNVAVSIVDVIADINVKHTQDLKLFQELWLSEMPEKEKEVKVNTDPERFVLKYHR
FT                   ATSGTRICWNATVSNVKFSADLGQSIGKVTVGLDRFWLLTDKKEHLDQHITLGFELIKI
FT                   HSDGRLGGMVSLARFRLELALLWEIDEDAQVTPEDVPLVTLVASLASAEIRMAFDYQQF
FT                   GIASIKNLGFSVSNQREVADYLSAIVDIEQICVFITVLAPSNILDLVQILVRTKQGIEG
FT                   AYEEEVGASNEETPSKEKKVGRPHLLTSVDVSINSGTLQVYPSTLLDTQVLYVNLSGTH
FT                   AMFVCDTQKRGLVKSHLELGMHEFIIALSTFKTQINEEDLLTLTVDEFVAHTRRAKGGT
FT                   IVRIPKVDINMHTWQYDTNPTEVKFTYSSEFAGKVDIGWNFGSVTFIREMWNSHAKAFA
FT                   SRREAYKLNFVANPSVLKDGELEEKLKDVALDEKYVYVALEPPNIEIPQLRDMGEATPP
FT                   IEWIGLHRQRFPGLTHQVVIVGLQGLVKEVEVAYFTVLGA"
FT   gene            <1215043..>1216848
FT                   /locus_tag="YALI0_E09889g"
FT                   /old_locus_tag="YALI-IPF3021"
FT   CDS_pept        1215043..1216848
FT                   /locus_tag="YALI0_E09889g"
FT                   /old_locus_tag="YALI-IPF3021"
FT                   /product="YALI0E09889p"
FT                   /note="weakly similar to uniprot|Q9ZR39 Nicotiana
FT                   plumbaginifolia U2 snRNP auxiliary factor large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09889g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79345"
FT                   /db_xref="GOA:Q6C6F8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F8"
FT                   /protein_id="CAG79345.1"
FT                   /translation="MNNSVEEFLAQTQRGLDTQQPPRPRSHDSRDTERDVRDRERERDR
FT                   DFRDRDRERDRERDRYRNQRWRRRDDSVDRERERERHRDRDYRDRGDRGDRRDRYSRDG
FT                   GRDRRDRRDDDRTRDRPRDRDRDRDRDRDRDRDRDRDRDRDRDRDRGDRERARDRTRER
FT                   DRDVSIDDSVVPLDERPLSAPTGWDVKARGYERVSSELAKRSGLFPLPGRPTQVNYNVL
FT                   RGLVEGLPDQPTDHETAAMMPLVDTGPINNGKGSVRPEFSRVARRLILSGIPADQIDTV
FT                   AIKSFFTDFIEGLELQGSKERIVDGVYKHPRLPEVLVEFFSAEMATLALALSGLGINYS
FT                   GPPISIRRPSNYICPTPERSEVSRRSLDEEKEVASVVEDSNTKIIVWDIPFNVEEDQVR
FT                   QLTASFGELSAFQLIRQLPSRESAGIALVDYKDPEVVKDAVSGLSGQVIGGKNLKVMLA
FT                   CEGPTQLSCSSNNGLKGIVTVMNDVKSRPESSVIVLFNLVTLDELLDDVAYREITEQVE
FT                   SECLKYGGGEEVQIKIPRPDPEAMKASYRRLIFETRPGVGKVYVKFASVETSRVAMQKL
FT                   TGLRFSRRSVIASYYSEECFDMNVF"
FT   gene            complement(<1218811..>1220046)
FT                   /locus_tag="YALI0_E09911g"
FT                   /old_locus_tag="YALI-IPF3019"
FT                   /old_locus_tag="YALI-CDS3119.1"
FT   CDS_pept        complement(1218811..1220046)
FT                   /locus_tag="YALI0_E09911g"
FT                   /old_locus_tag="YALI-IPF3019"
FT                   /old_locus_tag="YALI-CDS3119.1"
FT                   /product="YALI0E09911p"
FT                   /note="weakly similar to uniprot|P26448 Saccharomyces
FT                   cerevisiae YMR055c BUB2 cell cycle arrest protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09911g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79346"
FT                   /db_xref="GOA:Q6C6F7"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F7"
FT                   /protein_id="CAG79346.1"
FT                   /translation="MATGDVSSAPATPSSSAFVSPESDPIKVTDYQVADPQFPTSNNQL
FT                   RGPNLHLRRTPNKSSSHMSRRDSLEKLERDLRKTSSISSFSERKSPTKPRSRRKDTIEN
FT                   FLSKTPIILKSSLGQLRYLVLVEGLKANDQAECTYRATVWSVLLQVPPTRAEDYIRLIK
FT                   LGPSPMYGKIRNDTFRTMATDTVFKQKVPEDALIRVLNSYAWKNEMREQKASLEEGIDH
FT                   LQKSHRDQYVQGMNVLAAPFLYVCKSEAMAFNLLDVMLSRDCPLYVKPTLEGVHSALAL
FT                   IDKCLEIIDPTLYKYLNSKMLKAELYAFASVLTLSACTPPLSEVVVLWDFLFAYGVHMN
FT                   VLFVIAQVNLMRDKLLESKSPMSLLRSLPPLRAQEIIKLGMSFVAKLPEDLYDLLVRHP
FT                   YDEAIYEEVKTI"
FT   gene            complement(<1220562..>1223024)
FT                   /locus_tag="YALI0_E09933g"
FT                   /old_locus_tag="YALI-IPF3018"
FT                   /old_locus_tag="YALI-CDS0785.1"
FT   CDS_pept        complement(1220562..1223024)
FT                   /locus_tag="YALI0_E09933g"
FT                   /old_locus_tag="YALI-IPF3018"
FT                   /old_locus_tag="YALI-CDS0785.1"
FT                   /product="YALI0E09933p"
FT                   /note="similar to uniprot|P32563 Saccharomyces cerevisiae
FT                   YOR270c VPH1 H+-ATPase V0 domain 95K subunit vacuolar"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09933g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79347"
FT                   /db_xref="GOA:Q6C6F6"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F6"
FT                   /protein_id="CAG79347.1"
FT                   /translation="MEREAIFRSAEMSLVQLYVASEIGRDVVAALGELGVVMFRDLNTS
FT                   VNVFQRSFIKEIRRVDGVERQLRGLRAHIDKHGVAIDEQPEGVAAPTLDEVDNMCHQVG
FT                   ALEERVGHLDTTWNELVDKRALILERREMVQTAGIFFADARENRHEIRASLEGDRAGLL
FT                   YDLDDPQPDVEAATVTWNSVAGLSFVTGVIPSTKTAIFERILWRSLRGNLYFRHQAIEK
FT                   PLAGVRKDVFIVFGHGESLLAKIKRIALTLDATLYPVSEDFDTRREQVEELNIKLADVD
FT                   NVLGSTNNALMTELALAANTLPHWEVLANKEKAIYHTLNMFNYDQTRRCLIAEGWIPKA
FT                   DFRAVQEVLRDVTLSSGVAINSILNEIKTSKTPPTFHRTNKFTAAFQLIVDAYGIASYQ
FT                   EINPGLATVVTFPFMFAIMFGDLGHGVILALAGLVMVLKEKSILKMRNRDEIFDMAFSG
FT                   RYIVLLMGIFSLYTGLMYNDIFSKSMTLFRSGWAWPESWEEKERITAHQTGVYPFGLDP
FT                   AWHGTDNNLLFTNSYKMKLSILMGFTHMSYSFFFSFLNYKFFNSQIDIWGNFVPGLLFM
FT                   QSIFGYLSLTIVYKWCVDWIAKDKTPPGLLNMLINMFLSPGTIDAPLYPGQKFVQIILV
FT                   LIALVCVPWLLLLKPLYLRRQHKQTQYDAIRQPNAYHIGDTDDDADSFDMTIEEFEEEG
FT                   EGHEQFEFGEVMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHAQLSTVLWDMTIQGAF
FT                   GPTGPAGVAMVVIMFAMWFVLTVVILVMMEGTSAMLHSLRLHWVEAMSKFFEGEGYAYA
FT                   PFNFKDQQ"
FT   gene            <1224407..>1227058
FT                   /locus_tag="YALI0_E09955g"
FT                   /old_locus_tag="YALI-IPF3016"
FT                   /old_locus_tag="YALI-CDS0638.1"
FT   CDS_pept        1224407..1227058
FT                   /locus_tag="YALI0_E09955g"
FT                   /old_locus_tag="YALI-IPF3016"
FT                   /old_locus_tag="YALI-CDS0638.1"
FT                   /product="YALI0E09955p"
FT                   /note="some similarities with uniprot|P36085 Saccharomyces
FT                   cerevisiae YKL072w STB6 SIN3 binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09955g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79348"
FT                   /db_xref="GOA:Q6C6F5"
FT                   /db_xref="InterPro:IPR038919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F5"
FT                   /protein_id="CAG79348.1"
FT                   /translation="MHHIVAHDREKERQHDLRDMMHRTHSRSTSAVSPDDSDKCVTTEK
FT                   KTSKRTLPQGETVRYLFVDFKAFHYLRQEQQCSLVSEEAVIHGYESYMVEQWVCERRKV
FT                   TVITSYTGNQSNTVRVGVLALPRNPSLWTPRTKAYFDELLKGYARAKETELGVLFVTSL
FT                   SSFPSFLTLVSVPGGDVRKTWEYFDVNENLKRMGCGGRASLAICEPSGTAAAKFKNIYK
FT                   IHDSVPITFAAKELVVLVQLSLFYFGVLQPEYCDGLLCNETVDAINTWWDMWGVRKYNT
FT                   KPKDGVLGPTTVAGLIGFVIGVRNRMAYVLNSKVAKDPFDCEGFVAGLSRFQKHERLPK
FT                   TRIIDQRTMDRLYLLTNKGSYNSDIIDLFKSSIKEVSGKQHLHMTASETFNLEQLTKSL
FT                   QGARCKYLWAGKGHQRTVDASLVSNCVGIPMSSAGHTELAAARDIRRVIRNPASSTTTS
FT                   LVSTNNNIPGGADTSRRAMFKLRKPRDVVEVPPSRLYRGIRGRLRSTSPNDSVDDDIAI
FT                   RGHSSTPELDLPLDNMLTDRLLPQEYRDDSSDDDDGHHLRPGRQDSIKTTKTNHSATSF
FT                   DNSNPALHFRRRSKSVDQFHHELSVPEQLEKHHRSVMRRNSFSLIENFILRQPPEKSFV
FT                   SEKRIRRSYEKSQLYHFLFKRHVKKMRDVCEQIDQESRMLGKAKMRDDVLFDKLTSYLK
FT                   NSYREEARLKAALHEVEVMSSRIRYESKMLQSKIQDVEETMESFVGKVQSLEERVQKAS
FT                   AARGYGSGGFNVKKCELEENHHEGHKASPLETHRPPPLKIPTMKVACTEVGKGGLANAG
FT                   SGASTPIQSPLGDIFEDGPTPSSLSAVLWPDSKPGEEGLVQRLFNKLCELAGYETKSAF
FT                   DANAAGERVYAE"
FT   gene            complement(<1227382..>1228914)
FT                   /locus_tag="YALI0_E09977g"
FT                   /old_locus_tag="YALI-IPF3014"
FT                   /old_locus_tag="YALI-CDS2273.1"
FT   CDS_pept        complement(1227382..1228914)
FT                   /locus_tag="YALI0_E09977g"
FT                   /old_locus_tag="YALI-IPF3014"
FT                   /old_locus_tag="YALI-CDS2273.1"
FT                   /product="YALI0E09977p"
FT                   /note="some similarities with uniprot|P35208 Saccharomyces
FT                   cerevisiae YJL127c SPT10 transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09977g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79349"
FT                   /db_xref="GOA:Q6C6F4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015416"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F4"
FT                   /protein_id="CAG79349.1"
FT                   /translation="MMTTFEDTSHPIQLRGDELNLDSAAQVEPLTVVLKDQVTTATIYP
FT                   IRNLQSVPQTLQYFLFDEFNMELERGDTFPHYHPIQFDDFQNFWFGTFSAIMLLGNEPL
FT                   IRDDRAWEKECLGSFFIRPNYPGRSCHICTANFLVNAGIRGQGIGRTLVESYIEWAPKL
FT                   GYTYSVFNLVYETNVAARKIFDALSFKKVGRIKGAGHLKDNENGPVDALIYGKELIEET
FT                   DESIGELRFDKIKYYLETGKYPPQSDRQEKSRLRSSAAHYRLRDGKLMLKDREVVSDPE
FT                   RQIQIATEVHKQSHAGINKSTSIITESYHWTRIKETVAAAIRNCVECREVARPPIKRIK
FT                   KDDFEDLSALQVHQHVPSSSEQQTQQTQQTQSQSQHQSQQSRNTGMMNLGSHMPLGYNM
FT                   NQIGRLQADLGLDTEDGQQLMASVAAQNRENENAANIASNNQQMSQFDVDLASYNQDEQ
FT                   LTRHDNIPVDPQVENAFEEHVHGGEEIAIARALIQANESSEGKDDPSDFFSQ"
FT   gene            complement(<1230257..>1230910)
FT                   /locus_tag="YALI0_E09999g"
FT                   /old_locus_tag="YALI-IPF3013"
FT                   /old_locus_tag="YALI-CDS5594.1"
FT   CDS_pept        complement(1230257..1230910)
FT                   /locus_tag="YALI0_E09999g"
FT                   /old_locus_tag="YALI-IPF3013"
FT                   /old_locus_tag="YALI-CDS5594.1"
FT                   /product="YALI0E09999p"
FT                   /note="similar to uniprot|P35208 Saccharomyces cerevisiae
FT                   YJL127c SPT10 transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E09999g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79350"
FT                   /db_xref="GOA:Q6C6F3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F3"
FT                   /protein_id="CAG79350.1"
FT                   /translation="MTVCIEKPTRPFTETLAVTLKDGSQAAIVPVNGYEEAGKLPQRLV
FT                   EFMFNEFNKEIEDGQTYPQLKPFASSAEFVKYWFVGWVGLLVRGTELPTNSDWSECLLG
FT                   HYYIRPNYPGRCSHNCNAGFMVNPRHRGLGVGKALGRSYIYVGPRLGYTYSVFNLVFVT
FT                   NTASRKIWDSMDFEVVGRIPGAAILNGFDEPVDALIYGRKLDVEETDSWRLTAA"
FT   gene            complement(<1231405..>1233510)
FT                   /locus_tag="YALI0_E10021g"
FT                   /old_locus_tag="YALI-IPF3012"
FT   CDS_pept        complement(1231405..1233510)
FT                   /locus_tag="YALI0_E10021g"
FT                   /old_locus_tag="YALI-IPF3012"
FT                   /product="YALI0E10021p"
FT                   /note="some similarities with uniprot|P53306 Saccharomyces
FT                   cerevisiae YGR216C N-acetylglucosaminyl-
FT                   phosphatidylinositol biosynthetic protein GPI1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10021g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79351"
FT                   /db_xref="GOA:Q6C6F2"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F2"
FT                   /protein_id="CAG79351.1"
FT                   /translation="MDPSLPDEPRENGSTTPMRVFWPLEEMHVMRGRRYDDCLVIGWRN
FT                   DGCNVVVIATCVELPEVARKRGLEIVGYVGKARDLCDLSRETKNESRSTPSRHLIPFTY
FT                   TADSPLTCSLPDVTIITYKTPNPQRMQFYSTDPISLGILGWSVPMRVISQEFEQELVHE
FT                   QQKKQCLMDKLVQHGGVEFGGDDYVEGDKEIVVETLEKTDEQGDCQLGVLSYTEETEAP
FT                   RLNGTVHAEGGAPECQLERILAQINSAYRLQKLVHNNKESHVISTLLCTLVNPLIPLFT
FT                   NLVIYFIMGIRIFCEACLLLIEFRVLGKNLKQTSATAIQLDLRLQQVCYLPVQWMRIRG
FT                   HDSHTQSPSHIAIERRISESGHGSAAKRHVPPEYIRMYNTVWLVLNDLILGFALSAYLL
FT                   DNQTWIAENGPRLASYILVTFPESTIIWLMDSPAGLKLNTELAKFFGQFLLWVIHFWSR
FT                   TVVHGLIIPAMPYMPALGSVISRVGGITLTISVLCDLISFTTLHIYAFYIASAKIFHWQ
FT                   LGVITSLFHLFRGKRQNVLRHRIDSCNYDLDQLLMGTIFFTVLVFLLPTVMVFYGAFAL
FT                   ARLSIIILSAVLETILAFLNHFPLFALLLRAKDRKRLPGGIKFVANGVTLELQNIPLGF
FT                   SKIFYQYSLLSDRIRFHYLSVRVIKRLLTGQFVPVQRNRLYILLYSTLPEQRIDIGSLW
FT                   KLLRGGE"
FT   gene            <1236217..>1237011
FT                   /locus_tag="YALI0_E10043g"
FT                   /old_locus_tag="YALI-IPF3011"
FT   CDS_pept        1236217..1237011
FT                   /locus_tag="YALI0_E10043g"
FT                   /old_locus_tag="YALI-IPF3011"
FT                   /product="YALI0E10043p"
FT                   /note="weakly similar to uniprot|Q9P5S9 Neurospora crassa
FT                   Nebula related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10043g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79352"
FT                   /db_xref="GOA:Q6C6F1"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F1"
FT                   /protein_id="CAG79352.1"
FT                   /translation="MTEPSETPSTSPIDTDTDTKTTMATVAVPLASLNNASKKHKMATN
FT                   TLIITGLSRAHFSSEPFMLELKKALESDDLVCWAPLKSLGRIVCVFVTPDSCSVAKKYI
FT                   KQAAEAAYVDEEFLNYSTLKAQYAPNNTDMATLGDTKQRLQLPDAGKLFFISPPPSPPA
FT                   GWTSRLEDTPNPNAFDSQFYDMLHKELSNVAEPKEEKNDPINIPVSAGTRKITLHEGLK
FT                   LDTNQGVSSGMNSPTIILECEEGDVVSPGVAFAKTERPPVEL"
FT   gene            complement(<1238212..>1239144)
FT                   /locus_tag="YALI0_E10065g"
FT                   /old_locus_tag="YALI-IPF3010"
FT                   /old_locus_tag="YALI-CDS4702.1"
FT   CDS_pept        complement(1238212..1239144)
FT                   /locus_tag="YALI0_E10065g"
FT                   /old_locus_tag="YALI-IPF3010"
FT                   /old_locus_tag="YALI-CDS4702.1"
FT                   /product="YALI0E10065p"
FT                   /note="similar to uniprot|P19516 Saccharomyces cerevisiae
FT                   YPL132w COX11 cytochrome-c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10065g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79353"
FT                   /db_xref="GOA:Q6C6F0"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6F0"
FT                   /protein_id="CAG79353.1"
FT                   /translation="MLQSLPRATRLRSSLLTARLVSSLAKTSLTQTQTRLLSTSRAVFN
FT                   NRKPYEAARDEFLRKRDANMKRLGVSEEEYRELFSKARKQRRQQDVNSTILYGLSVVIA
FT                   FLGLSYLAVPVYRIVCQQMGWGGQITPGGNMKTGDYENPRFAAERLKPIEQGRHIRITF
FT                   SGDVSGILPWDFRPQQREVSVIPGETALCFYKAKNRTDKDIIGMATYTVTPAIASQYFN
FT                   KIQCFCFEEQQLLAGEEVDMPVFFFIDPDYATDPNLRGISDIVLHYTFFRAKYNDDGVL
FT                   SPVATAEASEQELASQLQIAKEVEAQAAA"
FT   gene            <1241723..>1243159
FT                   /locus_tag="YALI0_E10087g"
FT                   /old_locus_tag="YALI-IPF3009"
FT                   /old_locus_tag="YALI-CDS2039.1"
FT   CDS_pept        1241723..1243159
FT                   /locus_tag="YALI0_E10087g"
FT                   /old_locus_tag="YALI-IPF3009"
FT                   /old_locus_tag="YALI-CDS2039.1"
FT                   /product="YALI0E10087p"
FT                   /note="similar to CAGL0M02651g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10087g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79354"
FT                   /db_xref="GOA:Q6C6E9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E9"
FT                   /protein_id="CAG79354.1"
FT                   /translation="MYGNHQPQQQPIKRTKRKKVDQACVYCRRSHMTCDNNRPCSRCVK
FT                   RNISHLCHDEAKPVRGKRQQSQSDDEEEVQGQQQQQQQQQGQGQQGQGQVSGLNTPNAG
FT                   MSAQFMNAGGIQNGLFFSEHAGSEFSSLNDFLTMFDDVVYEGQPSQGQNQGQQQGQGQS
FT                   QGQSENGTGTQYRQGQGMHQTQSQNHSQTQSQTQTQAQAMSQGQRQQPGHQHQQLQSPG
FT                   MAHPAVTQQQQQGQSQAQAQSQNLSNASLTHEDPPQVSEAARNKFFLTAADPTIDNSPE
FT                   ERLKQVIYAKLEAGLLQPFNYVKGYARLQQYMDNYMNISSKQRILKPLSIFRPAFRAIA
FT                   QSLKDIDLVLVEEAFERMLLDYDRVFTTMAIPACLWRRTGEIYRGNKEFAGLVGVPVED
FT                   LRNGKLAIYELMSEDSAVNYWEKYGNIAFDSGQKAVLTSCNLRSKDGRKRKLCCFSFTI
FT                   RRDRYNIPSCIVGNFIPINP"
FT   gene            complement(<1243766..>1245124)
FT                   /locus_tag="YALI0_E10109g"
FT                   /old_locus_tag="YALI-IPF3006"
FT                   /old_locus_tag="YALI-CDS2776.1"
FT   CDS_pept        complement(1243766..1245124)
FT                   /locus_tag="YALI0_E10109g"
FT                   /old_locus_tag="YALI-IPF3006"
FT                   /old_locus_tag="YALI-CDS2776.1"
FT                   /product="YALI0E10109p"
FT                   /note="weakly similar to DEHA0E22308g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10109g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79355"
FT                   /db_xref="GOA:Q6C6E8"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E8"
FT                   /protein_id="CAG79355.1"
FT                   /translation="MVAKSASKGTPKGTPVKSKVATPKSAAKGTPKGTPKGTPKGTPKG
FT                   TPKSTKSAKAAVDTPTKGDTPSKATPTKRRSSVSTAETSSCPLASSDNTINAAQALLKF
FT                   TQKQAEEDANNLLADDNEEQFIYLVITSKRFVSSEKAQVPTLVQVPHGLWTKSAEQPSI
FT                   CLLSQNPQNSYKRALKGATTPALSRVVGTQKLRGKFKPYEARRQLFAAHDIFVVDEDIT
FT                   EEMPFCLGKTFYKNGAVKLPLPITVLHKKEEKQTLIKSKAERVVETEDIDVEATQQGLS
FT                   NIMTSTWYLKSQSNHTNVRVATTLFTPKEIAANVYAVVDQFTADLPNGFDGVRSVYLKT
FT                   GSSPALPIYLADNLYTQDDVFNENDEEEEEEIGQQSDGRFVMPKGLKIGAGEEDEEKVV
FT                   VEGHKLSALDAALAEVVDVEDILEHNRRADKALQERKRKRSDQDGGAKKAKTE"
FT   gene            <1245963..>1246887
FT                   /locus_tag="YALI0_E10131g"
FT                   /old_locus_tag="YALI-IPF11359"
FT                   /old_locus_tag="YALI-CDS5989.1"
FT   CDS_pept        join(1245963..1245965,1246540..1246887)
FT                   /locus_tag="YALI0_E10131g"
FT                   /old_locus_tag="YALI-IPF11359"
FT                   /old_locus_tag="YALI-CDS5989.1"
FT                   /product="YALI0E10131p"
FT                   /note="similar to uniprot|P36053 Saccharomyces cerevisiae
FT                   YKL160w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10131g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79356"
FT                   /db_xref="GOA:Q6C6E7"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="InterPro:IPR038567"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E7"
FT                   /protein_id="CAG79356.2"
FT                   /translation="MGKRKSSSAPAKKVKQTLATQFACLFCNHNDSVVCSMDKKMGIGS
FT                   LSCKVCGQSFQASINALSAPIDVYSEWIDACEAVAEQEKNKDDEFIEKDGGYASDDDHV
FT                   PKEEDDEFSDLE"
FT   gene            complement(<1247549..>1248434)
FT                   /locus_tag="YALI0_E10144g"
FT                   /old_locus_tag="YALI-IPF40081"
FT   CDS_pept        complement(join(1247549..1247834,1248268..1248434))
FT                   /locus_tag="YALI0_E10144g"
FT                   /old_locus_tag="YALI-IPF40081"
FT                   /product="YALI0E10144p"
FT                   /note="similar to uniprot|P00427 Saccharomyces cerevisiae
FT                   YHR051w COX6 cytochrome-c oxidase subunit VI"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79357"
FT                   /db_xref="GOA:Q6C6E6"
FT                   /db_xref="InterPro:IPR003204"
FT                   /db_xref="InterPro:IPR036545"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E6"
FT                   /protein_id="CAG79357.1"
FT                   /translation="MVFASAFRSIARGSALNSAARLSIARPTFQAVRAQPLAIRNYSAA
FT                   HEETFDEFTTRFEKEFEEAYDLFEVQRVLNNCFAYDLVPAPSVIEKALQACRRVNDFPT
FT                   AVRVFEGLKYKVDNKSQYQAYLDALKDVREELGITLKEDLFPKLAE"
FT   gene            <1249476..>1251863
FT                   /locus_tag="YALI0_E10153g"
FT                   /old_locus_tag="YALI-IPF3005"
FT                   /old_locus_tag="YALI-CDS0690.1"
FT   CDS_pept        1249476..1251863
FT                   /locus_tag="YALI0_E10153g"
FT                   /old_locus_tag="YALI-IPF3005"
FT                   /old_locus_tag="YALI-CDS0690.1"
FT                   /product="YALI0E10153p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10153g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79358"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E5"
FT                   /protein_id="CAG79358.1"
FT                   /translation="MRRINVAVRTVGLGPRYDYKALVPSIQMPRVSIRVPRRAFSALQA
FT                   PQGGLQFIQDILLAEEPTFLHLVQEVIEQPIREGKKGPKGAVHKLQMQKLRVLARIKHM
FT                   NLGLEEQVRMVAANRLIDHSSLLQFWETCSMDDGGDPQLPLSTAILLGQQMVADGEFEL
FT                   VADFLANQFSFGDILMLGGRVIADGGPKNKQKQVVTAFELCRAFDKHGFAQQLAREFWI
FT                   GNINGGLHFCLGLDSCATEQQLQDFLYHNDRINYRLSKYNSGAFILEDALKPYEKMRLL
FT                   EKYVQLGNTEVLRNLFFNQAAEKHQEWIHACIERVIRMAITDSRLLGVVKDVLEKKNDL
FT                   PVWCTARVTALVTDQKSLRSLWARYTAQYAHLAEDETVKQTMVTFLEKAVALGDIHSAS
FT                   SITKVLGENTPIPLVKQYLHLLFNNRLHKRESDKFDLITRLLDAYSSHPSVIMKAVGAV
FT                   WPHKRYHKSEVLLWDLLRAFEASKLPHWSQLLEKHFALAIFTRPPVEKVEYYFLPKVSV
FT                   RAIWLCIQTELSKAMEAVTGDVDRSGRLQLITIALMAIRIKSRRRRFQRGHFLEAEKEE
FT                   SEVESDDQPETRLVVSNPYADLDLSLLPPRAQLERLQIPSEYLKIRDLDMFLLQHIGKQ
FT                   EKPFSQLVDMDQWIYDVLSVETYKPNLETLSVEDPALAYRLIRWFRHDFMFPIPPRILR
FT                   AMVPGFATSEQLTNSMSFRYISEVISQLRLQHERVGPEVCEELVDSLFDRVALPGASRD
FT                   KKRLQWALTLAKQEQVDEQVVERWNKRLEDMKKRQDGFWKEA"
FT   gene            <1254162..>1255766
FT                   /locus_tag="YALI0_E10175g"
FT                   /old_locus_tag="YALI-IPF3003"
FT                   /old_locus_tag="YALI-CDS2063.1"
FT   CDS_pept        1254162..1255766
FT                   /locus_tag="YALI0_E10175g"
FT                   /old_locus_tag="YALI-IPF3003"
FT                   /old_locus_tag="YALI-CDS2063.1"
FT                   /product="YALI0E10175p"
FT                   /note="weakly similar to uniprot|Q12303 Saccharomyces
FT                   cerevisiae YLR121c YPS3 GPI-anchored aspartyl protease 3
FT                   (yapsin 3)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10175g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79359"
FT                   /db_xref="GOA:Q6C6E4"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E4"
FT                   /protein_id="CAG79359.1"
FT                   /translation="MHFSNFLLGALAATAAAKNTYQINKYGSPLTNQKRSLSENSVVQL
FT                   DTVGVRSIRDEPAPRDAALMKRQTATLPLKNLVTYYEAEVKIGTPAQTVKLLIDTGSSD
FT                   IWVIGSGNPDCGSAQDAQRDPNIIDCSISGTFDTSKSSSWSQNQTDFFIQYGDQTAAEG
FT                   GWGTDTFAFGNTNVSGLSIAVASKTNSSNGVMGIGLAGLESTITYRGNDQISGNPYENL
FT                   PMKMKAEGLIKANAYSLWLNNLSSDSGNVLFGGVDYAKIDGDLFTVKLVNPQRSVSSKP
FT                   IAFYVGLDSVSITDVKGVSGFITKQPVPALLDSGTTLTYLPQDAFNYVVRAMGATYDPQ
FT                   NGYVCPCKNGYSGHLDYNFSGANISVPLYQLTYPIQLQSQSGRVVNAQFRNGDDACLLL
FT                   MQASQDHVILGDSFLRAAYVVYNLDSYEVSMGQTKYGVTDTNIVEIDSNGVKNANPAPE
FT                   YSSSFTNVNSETTILRGAPGSADSNPSTTLSGGLVAGSSASSGSSGDGKGKNNAAGLEL
FT                   SIVGLAVAVVMASFGLM"
FT   gene            <1259541..>1261766
FT                   /locus_tag="YALI0_E10197g"
FT                   /old_locus_tag="YALI-IPF3001"
FT                   /old_locus_tag="YALI-CDS1005.1"
FT   CDS_pept        1259541..1261766
FT                   /locus_tag="YALI0_E10197g"
FT                   /old_locus_tag="YALI-IPF3001"
FT                   /old_locus_tag="YALI-CDS1005.1"
FT                   /product="YALI0E10197p"
FT                   /note="similar to DEHA0F25982g Debaryomyces hansenii IPF
FT                   6093.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10197g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79360"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E3"
FT                   /protein_id="CAG79360.1"
FT                   /translation="MLQYAIPAFLVLGLALVFVNSSAKTLAIFAWNCFIKPFTGHKDVA
FT                   AGQQGALESFYKGQANIYDRTRATLLKGREQALATTAAELRKKHDLVWVDIGGGTGWNI
FT                   EHMTTNYLPISCFKAIYLVDLSPSLCEVARKRFAEKNWKNVHVLCIDAADFTPPAGSSV
FT                   DLFTMSYSLSMIPTYYAVIDRLSTLLGKDGLVTVIDFYVQSHATLTAKSTTMGGELLRH
FT                   VNWFSRTFWRLWFEFDRVYLDSARRDYLEYRFGTIKSVNCRNTRLGGIPYYYWIGCDKD
FT                   RSTNILQRANALATESPYLSPQNELVVGDEDAANNTLAIRSKGYDAALVNMQRNFPAPS
FT                   FFYQTEIWRIFYNQELPKYHQFANQYIYAFTWEDPREDKNILQFKPSDTVLAITSAGDN
FT                   ILSYASMDAPPKRIHCVDLNPCQNHLLELKLACLRVLPFEDMWKLFGEGKHPKFQELLT
FT                   TKLAPHLSSHAFQYWHKRGHASFTGKGLFDTGSSRWAIRLAHWVFAISGVSPHISALCE
FT                   AKTLDEQWSVWEKSLRPCLSNPIVAKVLVGNPIFLWKALGVPVEQTSMIEGGMLKFVID
FT                   TFEPIIKRSLISDDNYFYYLCLKGCYAANNCPDFLTKHGHANLAKRKGALDGIRIHTDE
FT                   INEVVKRLNPGSVNHAIVMDHMDWFPKDGNAAREEIKSLHHALTEGGNVMLRSASQKPW
FT                   YLSVYEEEGFTTRPAAIRESGTSIDRVNMYASTWVCTKKGAMESLKI"
FT   gene            <1264102..>1265883
FT                   /locus_tag="YALI0_E10219g"
FT                   /old_locus_tag="YALI-IPF2997"
FT                   /old_locus_tag="YALI-CDS1648.1"
FT   CDS_pept        1264102..1265883
FT                   /locus_tag="YALI0_E10219g"
FT                   /old_locus_tag="YALI-IPF2997"
FT                   /old_locus_tag="YALI-CDS1648.1"
FT                   /product="YALI0E10219p"
FT                   /note="similar to uniprot|P19145 Saccharomyces cerevisiae
FT                   YKR039w GAP1 general amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10219g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79361"
FT                   /db_xref="GOA:Q6C6E2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E2"
FT                   /protein_id="CAG79361.1"
FT                   /translation="MSERKSFTENVESDNSVGEIHEVKAEGPPDTSHLSYWGRFKHGFG
FT                   PADVAHLDLEGLTPMEITALKTANAPLQRNLKGRHLQMIAIGGSIGTGLFVGSGSTLAN
FT                   GGPAALLIAYGVIGIMLLLTMHALGELAVCFPVSGGFCTYFTRFLDPGWGFAMSWNYIM
FT                   GWFVILPLELVAASMTVNFWNEMNGTHINAAAWVSIFWIIICAINLFGVKGYGEAEFVF
FT                   SIIKVAAIVGFILFGIVMAAGGGPKGGAFHEYQGGKLWQHPGAFAHGFKGVCSVFVTAA
FT                   FAFAGTELCGLAAAETENPRVMLPKATKQVFWRICLFYLVSLTIVGLLVPWNNDQLLNG
FT                   SSSADAAASPFVIAIRVAGVKGLPSVMNVVIMISVLSVGNAAVYGFSRTIAAMGESGQA
FT                   PKIFAYIDREGRPIFGILVVLAFGLFSFIAAAGAETRNEVFNWLLALSGLSSVFIWGSI
FT                   CAAHIRFRMALKYRGRGTDELSFVAGFGVWGSVIGVVLNCLVLMAQFWIALYPLGVKTP
FT                   NASDFFQAYLAAPVILGFWIFWKIWKRDGLFLLLKDLDIDTGRREPDLERVKAEMAEER
FT                   YALSQKNFMYRLYNFWC"
FT   gene            complement(<1266779..>1268596)
FT                   /locus_tag="YALI0_E10241g"
FT                   /old_locus_tag="YALI-IPF2995"
FT                   /old_locus_tag="YALI-CDS1881.1"
FT   CDS_pept        complement(1266779..1268596)
FT                   /locus_tag="YALI0_E10241g"
FT                   /old_locus_tag="YALI-IPF2995"
FT                   /old_locus_tag="YALI-CDS1881.1"
FT                   /product="YALI0E10241p"
FT                   /note="weakly similar to uniprot|Q6CI91 Yarrowia lipolytica
FT                   YALI0A00550g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10241g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79362"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E1"
FT                   /protein_id="CAG79362.1"
FT                   /translation="MLSNELIRLIFEYCNLEGCVALSQVCSSYWSVWTELDESLIRERV
FT                   VERAPWFIALDTECGLDSWRKCALLLTRRSYRALEEDGTGGNANKHLYVLRNLSVPVSL
FT                   CCNKVEFVDSVDFSKDKEVRETIEPIFDELYLLPIDVYEGGAIQGTKLLLPGEELDFKT
FT                   MEVSKSDFPGTHRLQYTYRRTDMAMSPSGLRVVNDHEGYKIRVVDENDSLLHVRYWSQI
FT                   GGADAIVHKTSHPRDQSGACIVSAKDGNAWPLPDNNAVNNPLGTLVSLVPGPGGALVVS
FT                   NTEGGKTAQYLAYIEPLPSLPGVVLCELPMGMGFKRMHNHLSFPFFTFYNGYLYLYFEG
FT                   RFLRLWVDLGLRSRQHPTGGLMSHVYSKGFRGQVLTVWDRRFPAIGTFNEGEAEFQGAR
FT                   IQRKGQFVTVGDAKGLVVGDLKTGTTYFNPKQVLSIPFAAGDGSSVGFFSVDNWVSKKV
FT                   IKKISNGSSDGDNIIRWWDEACIPQTVRGGDPVFTRVIHSEDVSDEPHKFEDSSRGTHD
FT                   AVRIPDAYDERQKVYRRIYKGRPPFSLDETTLVATFQFEHFEDHELPKEMYQVEGSGSR
FT                   GEDSNGVVNGGPTDGGDTDMSDIPRRATN"
FT   gene            complement(<1268922..>1270007)
FT                   /locus_tag="YALI0_E10263g"
FT                   /old_locus_tag="YALI-IPF2994"
FT                   /old_locus_tag="YALI-CDS3818.1"
FT   CDS_pept        complement(1268922..1270007)
FT                   /locus_tag="YALI0_E10263g"
FT                   /old_locus_tag="YALI-IPF2994"
FT                   /old_locus_tag="YALI-CDS3818.1"
FT                   /product="YALI0E10263p"
FT                   /note="uniprot|Q6H9R7 Yarrowia lipolytica similar to
FT                   uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1 DnaJ-
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10263g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79363"
FT                   /db_xref="GOA:Q6C6E0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6E0"
FT                   /protein_id="CAG79363.1"
FT                   /translation="MRLAIQAVFLLATLMWLVAAQADFYAVLGLKKGASDKDIKKAYRT
FT                   LSKKYHPDKNPGNEEAHQTFIEIGEAYEVLSDEEKRGKYDKFGHEGLKNGGGGGTNPFD
FT                   LFAQFFGGGGGGQRRGVPKGPNTETHIDVSMKRMFKGFDMDLQVNLQGICSSCKGSGSA
FT                   DGVNHKCDGCDGSGVVIQVAQMGMMIQKFQQQCPKCQGKGHLISNPCNKCGGQKVQRED
FT                   RKYNVYIEPGTPRVHSYSFEEEADKSPDHVAGDLIVQVREAPTENMGYRRRRNDLFRTE
FT                   ALSLKEALHGGWTRKIPFLDEESEVVLSRKKGEPTQHGHIEVIKNHGMPQMGVDDSHGD
FT                   LYIKYVIVMPMGASSKVRDEL"
FT   gene            <1271013..>1272431
FT                   /locus_tag="YALI0_E10285g"
FT                   /old_locus_tag="YALI-IPF2992"
FT                   /old_locus_tag="YALI-CDS2573.1"
FT   CDS_pept        1271013..1272431
FT                   /locus_tag="YALI0_E10285g"
FT                   /old_locus_tag="YALI-IPF2992"
FT                   /old_locus_tag="YALI-CDS2573.1"
FT                   /product="YALI0E10285p"
FT                   /note="similar to CAGL0F03795g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10285g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79364"
FT                   /db_xref="GOA:Q6C6D9"
FT                   /db_xref="InterPro:IPR019605"
FT                   /db_xref="InterPro:IPR029209"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6D9"
FT                   /protein_id="CAG79364.1"
FT                   /translation="MREIITLSFGQTAGHINADYFNSQEHYFPLATKSTSDPTVRFRRG
FT                   VATDSRTETYNPRLLTWELKGGYGAFQAFNQFYTEGDKSQPQVWNEGEIKEIKEQPVDK
FT                   NEYQKALDLGRENASQLNTDTTKRWTDYNRLFHHPKTRHQLDNWLFDPDTAPQGIHRGG
FT                   DQKWTGFDVGVNEWEHVLNSDKEYLDSTLRSWVEECDSLGGLNVVVDDSAWAGVAAKIL
FT                   ANYRDDFDAKGTVVTWSVEAKPEKKTRETQKNAIQTTVALSQVSSIYIPVSFPTKTPID
FT                   ADFDPTSPWHQAALFGLSVYEPVQLMATQRTGGLSLDAMAALLDTTGERNIVSEVGGTL
FT                   TDVDGDKSTVQYDSRLFQELFLPSRIPPKTPHVFSDLSIARLEDQDDDANSYRLNQPMP
FT                   EVSSQPEFTKQFVSSKTRLAVTTKPRRTLLDMAKFVSVYERGDEREEMKQELGDMASKY
FT                   EHGWEEESDDDDDY"
FT   gene            complement(<1272576..>1273565)
FT                   /locus_tag="YALI0_E10307g"
FT                   /old_locus_tag="YALI-IPF2991"
FT                   /old_locus_tag="YALI-CDS4033.1"
FT   CDS_pept        complement(1272576..1273565)
FT                   /locus_tag="YALI0_E10307g"
FT                   /old_locus_tag="YALI-IPF2991"
FT                   /old_locus_tag="YALI-CDS4033.1"
FT                   /product="YALI0E10307p"
FT                   /note="similar to uniprot|P17324 Saccharomyces cerevisiae
FT                   YIL168W SDL1 L-serine dehydratase and uniprot|P25379
FT                   Saccharomyces cerevisiae YCL064c CHA1 L-serine/L-threonine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10307g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79365"
FT                   /db_xref="GOA:Q6C6D8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D8"
FT                   /protein_id="CAG79365.1"
FT                   /translation="MRPGYIETPLLKNDIFSHQVGCNVYLKMENLQPSGSFKSRGMTQV
FT                   ISDALDSDPQASLDTLHVCSSSGGNAGLAAAVTSRLNGVACTVVVPESTKPRMVEKLRA
FT                   AGAEVIVHGKHWSEANDFLQKEEMPRLEKTGKTPIYCHPFDAPAVWKGNSTLIDEIIKQ
FT                   GITPDAVVCSVGGGGLFNGVVEGLKRHKLNCPVIVVETNGADALSRSLQKGEQVTLPGI
FT                   TSIATSLGAVRVADKTFENAQTYPTVSAVVSDDDAVSALVEYAETKQIIVEPACGASLA
FT                   VLPALKDLVDLKPDSNVVVVLCGGSATGISDIAQFKKDLEAKETTEEK"
FT   gene            complement(<1274093..>1275871)
FT                   /locus_tag="YALI0_E10329g"
FT                   /old_locus_tag="YALI-IPF2990"
FT                   /old_locus_tag="YALI-CDS1653.1"
FT   CDS_pept        complement(1274093..1275871)
FT                   /locus_tag="YALI0_E10329g"
FT                   /old_locus_tag="YALI-IPF2990"
FT                   /old_locus_tag="YALI-CDS1653.1"
FT                   /product="YALI0E10329p"
FT                   /note="weakly similar to uniprot|Q08760 Saccharomyces
FT                   cerevisiae YOR301w RAX1 similarity to S. pombe SPAC23G3.
FT                   05c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10329g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79366"
FT                   /db_xref="GOA:Q6C6D7"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D7"
FT                   /protein_id="CAG79366.1"
FT                   /translation="MSLTRLPQDERKRLPTLFEVLNRKSLAPVDLWSFYVYTRDQHRGV
FT                   DYLDFWLDVVQHLSLCRHYIRGLRQSILASEHTNLSISNITGQGLAEQSRESSILLETL
FT                   IHDHNLLEDGDSHRLSEYLRGENLLSDHDSSAASRLSALLGAMHVRESQISDDHAPSNR
FT                   SERFMMNLEEKRASHLSNASSNLFQSAAASPIDEEDAGEEHGMVRPGSRASMTHSLQGS
FT                   SRLSLNRKSSRASLGLAAQAQPSLQQLYDEEQTNLSMSNVSQSQIGPTLQSQLQFPSPD
FT                   NSGEQPQQQPQTPQPQSALPQQPQPTGPNLATRRNSQLSQILPQSPNANSPLLGTQPAS
FT                   PLQTQLNALPQTLPQPRGPIGVDSRASSQPLTLEIIEKLFPKRNEHGVMSDVNSPNFIT
FT                   RERIRESSQQILVTYFMPGAERELALPAPLMESVRTAIEQQGRDDPEVFDECREYVFQI
FT                   LEREVFPGFLATKALGNLVPLGALVRMVAGLVAVFGAVWTGFCLIFLNYSRTERVWVLL
FT                   PFAIGWYLVIAGLFSLDPIQAVLGFSESSLTKRVRIKEPFVRRLLLIRSSWVMLWVVIV
FT                   TACFTVIFACVPGHRL"
FT   gene            <1278177..>1278722
FT                   /locus_tag="YALI0_E10351g"
FT                   /old_locus_tag="YALI-IPF2988"
FT                   /old_locus_tag="YALI-CDS5665.1"
FT   CDS_pept        1278177..1278722
FT                   /locus_tag="YALI0_E10351g"
FT                   /old_locus_tag="YALI-IPF2988"
FT                   /old_locus_tag="YALI-CDS5665.1"
FT                   /product="YALI0E10351p"
FT                   /note="weakly similar to uniprot|Q9Y7N2 Schizosaccharomyces
FT                   pombe RNA polymerase II mediator complex protein rox3"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10351g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79367"
FT                   /db_xref="GOA:Q6C6D6"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6D6"
FT                   /protein_id="CAG79367.1"
FT                   /translation="MPNYYLADDTKYTRPSTSAMSNLTELCGLKGLADSMARFDPVTGE
FT                   KNKLRKSYKNQLLDLTGKFDIPSQPSLVRIIRDPVLAETGGKSLSVFDRDLLSRGLDFD
FT                   ATPSTGIPGFNPAMLGMPGPGKPGIGPQVGGNRLLSVRRSYNTESARESSNNEETPMAR
FT                   RKRKGDDDTDGERRRKRK"
FT   gene            <1282971..>1284299
FT                   /locus_tag="YALI0_E10373g"
FT                   /old_locus_tag="YALI-IPF2987"
FT                   /old_locus_tag="YALI-CDS2862.1"
FT   CDS_pept        1282971..1284299
FT                   /locus_tag="YALI0_E10373g"
FT                   /old_locus_tag="YALI-IPF2987"
FT                   /old_locus_tag="YALI-CDS2862.1"
FT                   /product="YALI0E10373p"
FT                   /note="weakly similar to uniprot|Q09873 Schizosaccharomyces
FT                   pombe Hypothetical protein C12G12.10 in chromosome"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10373g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79368"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D5"
FT                   /protein_id="CAG79368.1"
FT                   /translation="MPPKLPGFYYDEERKKYFKIVKTGQATSASQDYSISAVENTKRQK
FT                   TRERKFHRTEQRHVRKPTAPKIDKIVLPKHSVHVTSRDTFHTQLQRYLHCREMGTLQPG
FT                   FQSRLESRALGSLIRVTDVEQVGQVSGRDDVTAIALDEENGDVFTGRASGIVNAVRRGS
FT                   SLIRESYIRRIPDNGTIGTVIGINYNPRTRFLWSLSQGMHSVLCGGISEDTYNDSLFYD
FT                   LHSMTRLQLWDDKCVFSCAQSPEGDILLGLNSQIQTFTGTAGLHRLHAIDMKSDATSVC
FT                   YEQEQVVFAGCRDGNLRQIDLREDRKGKRVRSPFRISSPVTNIGAQGNFVACTGLQGVV
FT                   TVFDRRIEKQSLWTASYKNDCTFRHGFALDPSGRLMMVANDDQTVQLFNLAGGEENWGG
FT                   SAANLVSSVNGHRFADNLACIRWTEGGVVAGGGTNLYFMSDRS"
FT   gene            <1287997..>1289697
FT                   /locus_tag="YALI0_E10395g"
FT                   /old_locus_tag="YALI-IPF2986"
FT                   /old_locus_tag="YALI-CDS1838.1"
FT   CDS_pept        1287997..1289697
FT                   /locus_tag="YALI0_E10395g"
FT                   /old_locus_tag="YALI-IPF2986"
FT                   /old_locus_tag="YALI-CDS1838.1"
FT                   /product="YALI0E10395p"
FT                   /note="similar to uniprot|Q8X035 Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10395g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79369"
FT                   /db_xref="GOA:Q6C6D4"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D4"
FT                   /protein_id="CAG79369.1"
FT                   /translation="MHASSLSVGSISTAEEPHTPKQAWNLPGYATHDSRFMLGGYDDLV
FT                   GDVSRLNLAPSQNGNMPMSQNGKMNMSQNGHPNLPVSHNHSQHHRTHSGAGGSPIFGKS
FT                   VFVENEDKFPILVRRPSSAVSPPLEETFQQQHHNHHGNHGSYNGNGSPPMHQPLTPPYE
FT                   KAGGKFNCSTAANNNNSHSVMQAIPASPLTPNLHTNLSPTFVGSNNHYRRASQPASSCI
FT                   PPAFTPERSPNGTASSGVQTPSTTSSKISSIDLNNCDIFALCKDQHGCRYLQRKLEEEP
FT                   YYLNLIFEQTHSHVVELMTDPFGNYLCQKLLENCSVAQTTVLIRTAAPSLVQVALNQHG
FT                   TRALQKMIDYVTNDEQIEIIVQALERNVVRLIQDLNGNHVIQKCLNRLNSCDTNFIYRA
FT                   VSQNLVVVATHRHGCCVLQRCVDYADVLQREMLIGVITKHALQLVCDPFGNYVTQYVLG
FT                   EQVIRQFVGHVVALSMQKFSSNVIEKSLKVASYELRAVLIAEICASPLLPKLLSDCYGN
FT                   YVVQTALDTANQYTRAQLIDRIRPVLPMIRQTPYGRRIQAKVDARVFYY"
FT   gene            <1290713..>1294750
FT                   /locus_tag="YALI0_E10417g"
FT                   /old_locus_tag="YALI-IPF2985"
FT                   /old_locus_tag="YALI-CDS0152.1"
FT   CDS_pept        1290713..1294750
FT                   /locus_tag="YALI0_E10417g"
FT                   /old_locus_tag="YALI-IPF2985"
FT                   /old_locus_tag="YALI-CDS0152.1"
FT                   /product="YALI0E10417p"
FT                   /note="similar to uniprot|Q8TF96 Aspergillus oryzae CHSZ
FT                   chitin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10417g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79370"
FT                   /db_xref="GOA:Q6C6D3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D3"
FT                   /protein_id="CAG79370.1"
FT                   /translation="MRAIEGLGVDTELIQLILPFTHGLEPMVSVTIDRDERVLKSRVNV
FT                   GEMYYDNYETIKGAFAELYGSLTPQEREYLNVKPEFNDYTKADELCDFDVRHMLRQAFS
FT                   KKQIRQLLSILSGLILLIHDQDDLEACSLIEIDPHVLQDAGMTRQQVIYAIYDKLLRFI
FT                   VGSINAKLSQGTTNSSSASIHSGDTLNDADDSIAAVVHFLSITKSSSLVRQQMFDVNQG
FT                   INAEMVGDGLKLKSSPELFGELSLHRPVDISDITSFTQSHLLTKEARKAYSLPDLFASS
FT                   RLWTVFTRDHPPIDSWNAFKQGNNFTTDFDHEEFVDRYYDAYPSLQSILPLDVCEHPLS
FT                   YYIGLWARNNVGSASEIYVGRDRVWISENTYRKLEAKYAEFSQTTPVQEQGEWAAQGGD
FT                   EKAMLESHSHELHYDDKEIVDESLLKDVDPELGENVHVEEQTRQRRVWMTIVWAMTWWV
FT                   PSGFLHHLGRLKRKEERIAWREKFAIFVLIFFLNCVVIFYMIFLGRILCPDFDKAWTAK
FT                   EVGYHQGEDDFFVSIQGKVYDITKFYRQQHSDTSITTSAANMIPFAGQDMTSYFPNPLT
FT                   SACQGLVDDPTVWLASNNTIYDPTAIHYSGDYKTSDTGSALYNLTWYNDVFQPSIAQYY
FT                   KGPLVAKSKELKENGEKGWNKWVVIDGSIYDLTNYFYTLDQVEGYPNKDAYDFLHKDVK
FT                   AMVDDNAGQDVTDIWKRMDLKPSERVQNMECLKNAFYAGKPDFRQSARCQVSNYILLVV
FT                   AILLCSVVLIKFLAAMQLGSLATPDTQNKYVVCHVPAYTEDEEALRRAIDSIAALEYPD
FT                   SRKLLLVVCDGMIVGQGNDQTTPQIVLDIVGHDPRAASEVIPYAFESIGDGAARLNYGK
FT                   VYSGLYHYDGRNIPYCIVVKVGKESETSKPGNRGKRDSQVLLMRFFNRVASNGAMNPLE
FT                   LEMFHHIGNVIGVDPGAYEYMFMVDADTRVKEDSLNFLVADCVSDVNVVGICGETALQN
FT                   ENQSIWTMVQVYEYFISHHLSKAFESLFGSVTCLPGCFSMYRLKNLIDNRVLEEYSTNK
FT                   VNTLHMKNLLSLGEDRFLTTLMTKRWPKMRFTFCRGAMAYTTAPDSFSVLVSQRRRWIN
FT                   STVHNLVELLRINSMCGFCFFGMRFIVFIDLAGTLMLPSVCVYLAYLIYVIAAHAGAFP
FT                   LVSVIMFAAVYGLQAIIYIIKQEWQHIFWMIIYICAYPFHSFLLPIYSFWKMNDFSWGN
FT                   TRIVVEKDGKQLVQSDIPRLSDKEFNALCPLDTWESHALRNNLPIFAPDDTATVYNEDY
FT                   LDQPAYTPRASTFYTNTMTNTMRSNRMSLLEQQEQLIEHRRNRFSQLGDRHNSMQSGFT
FT                   GF"
FT   gene            complement(<1295208..>1296290)
FT                   /locus_tag="YALI0_E10439g"
FT                   /old_locus_tag="YALI-IPF2982"
FT                   /old_locus_tag="YALI-CDS3688.1"
FT   CDS_pept        complement(1295208..1296290)
FT                   /locus_tag="YALI0_E10439g"
FT                   /old_locus_tag="YALI-IPF2982"
FT                   /old_locus_tag="YALI-CDS3688.1"
FT                   /product="YALI0E10439p"
FT                   /note="weakly similar to uniprot|P40079 Saccharomyces
FT                   cerevisiae YER127w LCP5 NGG1P interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10439g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79371"
FT                   /db_xref="GOA:Q6C6D2"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D2"
FT                   /protein_id="CAG79371.1"
FT                   /translation="MTKLFFSGRRKNVQTGISSQIKTTQMEALLKEITTATDNSATKLK
FT                   EEQQAYNALDDDVKAQIQRDSLSLLGLKNHTMLAYLHHLAVVTLAQVQRVEKEQKDDAL
FT                   EKGRQAAIQGTVKNRVVLEKGIKGLESKVNYQIDKMLKAYTQDKERKAEREKQRAEKAL
FT                   LGEEKDDDDEGDKDDRDDDDESESEDDNLAFKPNVSNLTRDKNARPVRDSRGKKSEQDD
FT                   DRESASNTIYRPPKISAVAPESKSMRKSKKKNATMEEYLKYSSSAPMVEQSIGSGILEH
FT                   GRGGEKTDRDRKREEEVQRYEEDNFVRLPGANKKERSKLKKARAGAFFGEDWGVGGDIG
FT                   EATKRKRGGSSMWEKSKKRR"
FT   gene            <1296966..>1297754
FT                   /locus_tag="YALI0_E10461g"
FT                   /old_locus_tag="YALI-IPF2980"
FT                   /old_locus_tag="YALI-CDS4766.1"
FT   CDS_pept        1296966..1297754
FT                   /locus_tag="YALI0_E10461g"
FT                   /old_locus_tag="YALI-IPF2980"
FT                   /old_locus_tag="YALI-CDS4766.1"
FT                   /product="YALI0E10461p"
FT                   /note="highly similar to DEHA0C15422g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10461g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79372"
FT                   /db_xref="GOA:Q6C6D1"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="InterPro:IPR039411"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6D1"
FT                   /protein_id="CAG79372.1"
FT                   /translation="MPQNEYIEAHIKKHGRRLDHDERKRKREAREGHRISKDAQNLTGF
FT                   RAKMFAKKRYAEKVAMKKKIREHEQSKVNGTPKEHNPEDGDALPTYLLDRQQPNSAKAL
FT                   SSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVLKSGKRRNKSWKRMITKHTFVGEGFT
FT                   RRPVKLERIIRPSALRQKKANVTHPELGVTVHLPILGVKKNPQSPMYTQLGVLTRGTII
FT                   EVNVSELGLVTAGGKVVWGKYAQITNEPDRDGCVNAVLLV"
FT   gene            complement(<1299696..>1301246)
FT                   /locus_tag="YALI0_E10483g"
FT                   /old_locus_tag="YALI-IPF2978"
FT                   /old_locus_tag="YALI-CDS2222.1"
FT   CDS_pept        complement(1299696..1301246)
FT                   /locus_tag="YALI0_E10483g"
FT                   /old_locus_tag="YALI-IPF2978"
FT                   /old_locus_tag="YALI-CDS2222.1"
FT                   /product="YALI0E10483p"
FT                   /note="weakly similar to uniprot|P53943 Saccharomyces
FT                   cerevisiae YNL065w similarity to resistance proteins"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10483g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79373"
FT                   /db_xref="GOA:Q6C6D0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6D0"
FT                   /protein_id="CAG79373.1"
FT                   /translation="MRALLNKADETFASTGGSIDIELDSIDQKLPRVSVSSDLGSGSDT
FT                   AGEGDGPVSANTDDSNTNTLDVEALPATAPDDDVKFNRFTLSQKRIMTAVLAFCFFQPF
FT                   LVTYAMLPAVPLIAEQFDVSGTIVTVGNAIFFLITGFSSCFFGPFSDAYGRKAALITCC
FT                   IIFIVSNIGIAASPNLVSYYIFRATTAMGGTAFFSVSGSAIADIWRPEHRGKAVGACLL
FT                   GSQSGMTIGPIIGGWIVTKTSWRVIFWMQAGVALANLLLVTFVLREPMATTKHQMLCAE
FT                   QNKRFVWIWINPFKVLMGLRNMHLLLAGLSIVPIMYGMDCLLTPLSLVVEPRFDIKSPV
FT                   VAALFYLPQGVGFLIGCYFGGMYADKTVQRWTKIRGRRVCEDRLRSQLPFVGILLPVCM
FT                   LIYGWSLEKEFGGVAVPVVTMFLVGFGLSMYFPSLNAYCADSSPELGTAAAISGNYAIR
FT                   NCGSAIAAASTLKAVENIGIGWTSTVAAFGFIASTIPVFILLWKGEDMRQKAVRRMMR"
FT   gene            complement(<1303088..>1304254)
FT                   /locus_tag="YALI0_E10505g"
FT                   /old_locus_tag="YALI-IPF2974"
FT   CDS_pept        complement(1303088..1304254)
FT                   /locus_tag="YALI0_E10505g"
FT                   /old_locus_tag="YALI-IPF2974"
FT                   /product="YALI0E10505p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10505g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79374"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C9"
FT                   /protein_id="CAG79374.1"
FT                   /translation="MMPSHFDINEVVACDTHEPCLGYDILSPVPFVVNPMYSPQEEEDD
FT                   CDEFPDIPQSLDHITQQQQQQQQPQLAVPQRSFSDVLNGPQYDFSLFPPDQSFPDVNSS
FT                   APYVEPRRVSLPARNQTGNISKPNVATNIANTDYSVFVQQLMAGSNTMNNNMNYIPTTV
FT                   IKEEQHAFGNYSFDFTQGQMQTQLQPQQHSTQLLTQSIDIPLPDVNLSITPPQPSTTPL
FT                   PATVTIKEEHEPPNVSAKPEVVPEVEEPVEVDFNGRKHRKWRNRKYKCKHCDEIFYDKN
FT                   LEEFAAHIQKVEKETGTTEVAGRHYKCESPDCLWHIIGFVRKLEAQKHYDRRHGHPKFQ
FT                   CRFWCEGDMEKFPGSKTCSTRWHVDSGNRARHERAVHGQVFEQSKFSS"
FT   gene            <1308512..>1309096
FT                   /locus_tag="YALI0_E10527g"
FT                   /old_locus_tag="YALI-IPF2972"
FT                   /old_locus_tag="YALI-CDS5019.1"
FT   CDS_pept        1308512..1309096
FT                   /locus_tag="YALI0_E10527g"
FT                   /old_locus_tag="YALI-IPF2972"
FT                   /old_locus_tag="YALI-CDS5019.1"
FT                   /product="YALI0E10527p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10527g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C8"
FT                   /protein_id="CAG79375.1"
FT                   /translation="MASQRTIDPSHLLVFSHSAATRSTSPPSSKLRSDCPMIYLSDCRS
FT                   AVSHTHSQLFHPVPGAFFLQLPTDETVFLADALHGSASGARVTMTGSSHVNGARTLDLV
FT                   SDECKVQHVQESMYCGRPLHSPHSTQNRTSINMQGRAIISSRNKQSIRRSHCLQTRVVV
FT                   SRYKAQVRYNVNIKKGKSTEWIIFRMPRFGP"
FT   gene            complement(<1309106..>1311064)
FT                   /locus_tag="YALI0_E10549g"
FT                   /old_locus_tag="YALI-IPF2971"
FT                   /old_locus_tag="YALI-CDS1338.1"
FT   CDS_pept        complement(1309106..1311064)
FT                   /locus_tag="YALI0_E10549g"
FT                   /old_locus_tag="YALI-IPF2971"
FT                   /old_locus_tag="YALI-CDS1338.1"
FT                   /product="YALI0E10549p"
FT                   /note="similar to CAGL0F08481g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10549g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79376"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C7"
FT                   /protein_id="CAG79376.1"
FT                   /translation="MRDKAADVWRGTIMICTEDMSSDLSTTPFLTITSTNGFQNTLEAK
FT                   NILSEMGISFWRWSVEIPMTNEEQKLHYRINEEAAAASFFVPALEQSMNVVFHSCNGFS
FT                   MGVDPSVFNGSLWTDVMKEHEKAHYHVMLGGGDQIYCDSVKQYTEHFKEWIEAEHGHKD
FT                   RIKWTPEMRDELHRFYLFHYMAWFGAGFWRGPKGSTQQTNLPLAFASIPMINIFDDHDI
FT                   IDGFGSYPEKTMTGPVFGGIGRVAYKYYMLFQNQTLVDIEGGARDNLTDDVEDPSWVLG
FT                   AKTGPYIHNRSRSIYARLGKSIAFHGLDCRTERKIDQIITRETYQLNFQRIEKELAAAK
FT                   GEIKHLLLMIGVPMAYPRLVWLERLLTSPLLAPIRYLSRRKVVAAGLVNEFDGRVEILD
FT                   DLDDHWCAQRHKKERNALVERLFELAQKYSVRITILSGDVHLAGIGRFYTKSLNPTKHH
FT                   KVSVPVINDHRNMLNVISSAIVNTPPPDTMADFLNKRNKVHHFDFKTDENMVSIFPCDV
FT                   DGSHRNNKRLLPRRNWCSIIELDNLQKFDPKAARIGENRRPGPMGPDFKTSGDYTTHMG
FT                   GGSKSQHAGKKVEHISSKPVEEELPIEALPSSLSLALRIEIDPSKPSGDTNPYEILIPE
FT                   LQLRPSSGLSSKLSSKA"
FT   gene            <1315472..>1316527
FT                   /locus_tag="YALI0_E10571g"
FT                   /old_locus_tag="YALI-IPF2969"
FT                   /old_locus_tag="YALI-CDS3777.1"
FT   CDS_pept        1315472..1316527
FT                   /locus_tag="YALI0_E10571g"
FT                   /old_locus_tag="YALI-IPF2969"
FT                   /old_locus_tag="YALI-CDS3777.1"
FT                   /product="YALI0E10571p"
FT                   /note="similar to uniprot|P32875 Saccharomyces cerevisiae
FT                   YOR196c LIP5 lipoic acid synthase mitochondrial precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10571g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79377"
FT                   /db_xref="GOA:Q6C6C6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C6C6"
FT                   /protein_id="CAG79377.1"
FT                   /translation="MLKRQLHSASKRSATRFSDALNKGPSFDDFLTGRAGKAAAVDPVL
FT                   AASSDGKRLPKWLKTEIPKGKNLHNIREDLRGLGLHTVCEEARCPNIGECWGGSDKSKA
FT                   TATIMLMGDTCTRGCRFCSVKTNRNPGPLDPNEPENTAVAISKWGLGYVVLTTVDRDDL
FT                   SDGGSWHFADTVKRIKEKAPHILVETLSGDFRGNLDHVTTLAESGLDVFAHNMETVEAL
FT                   TPFVRDRRATFQQSLSVLRQAKVAVPDLITKTSIMLGFGETDEQVEDTLMQLRGVGVDI
FT                   VTFGQYMRPTIRHLKVAEYVTPEKFDYWQKRAMDMGFLYCASGPLVRSSYKAGEVFIEN
FT                   VLKKRNAAKAV"
FT   gene            complement(<1316700..>1317755)
FT                   /locus_tag="YALI0_E10593g"
FT                   /old_locus_tag="YALI-IPF2967"
FT                   /old_locus_tag="YALI-CDS3776.1"
FT   CDS_pept        complement(1316700..1317755)
FT                   /locus_tag="YALI0_E10593g"
FT                   /old_locus_tag="YALI-IPF2967"
FT                   /old_locus_tag="YALI-CDS3776.1"
FT                   /product="YALI0E10593p"
FT                   /note="weakly similar to CAGL0D00924g Candida glabrata"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10593g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79378"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C5"
FT                   /protein_id="CAG79378.1"
FT                   /translation="MTGWEEQPPPYGMDESADVTASVTATSEADDPFRIVERLTNENQL
FT                   LSQQVAHLERLVQALSDPSSPECQQVHQTVFAEAARFKENAETYCFELLRDSEQSEKAR
FT                   ADARIAEVEKEMLALQQTHIAGQQELSRVTSVLNSMELAHEDETSRLRAINDRRRDTIK
FT                   RLRGSLDDKKFQRKENRKKIMAENAELKSSLGNLQKDIKKLEKTNGEIQSQLASTQRWA
FT                   ERLEETESTLQAEVEELRRENVRLNCDVEDLQSDREDEYLMDDGQRDWQALRDQLHTQY
FT                   CELAAVANIINLHVKDTTVLEALSNAVKSVQNVKLSDRKRAKRKPVLSTSKSDADSEMG
FT                   DYEGQPKRSKT"
FT   gene            complement(<1318680..>1319159)
FT                   /locus_tag="YALI0_E10615g"
FT                   /old_locus_tag="YALI-IPF2966"
FT                   /old_locus_tag="YALI-CDS5155.1"
FT   CDS_pept        complement(1318680..1319159)
FT                   /locus_tag="YALI0_E10615g"
FT                   /old_locus_tag="YALI-IPF2966"
FT                   /old_locus_tag="YALI-CDS5155.1"
FT                   /product="YALI0E10615p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10615g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C4"
FT                   /protein_id="CAG79379.1"
FT                   /translation="MSPTGGFRPSQTETRCSAACIRVSVSYSLGVCPIAAVLSGEKCSH
FT                   ERRARWQLISRAVNVTPSRDEKTLISLDLPFEQPPPHHTGTSIVVLYTSTLYWTTSRSE
FT                   ANLLRLRIQISIIGRNNSYHLNLPSKYRKPAGWRWRKRIRADPCNLWTASGAFSV"
FT   gene            <1319672..>1321888
FT                   /locus_tag="YALI0_E10637g"
FT                   /old_locus_tag="YALI-IPF2965"
FT                   /old_locus_tag="YALI-CDS1015.1"
FT   CDS_pept        1319672..1321888
FT                   /locus_tag="YALI0_E10637g"
FT                   /old_locus_tag="YALI-IPF2965"
FT                   /old_locus_tag="YALI-CDS1015.1"
FT                   /product="YALI0E10637p"
FT                   /note="similar to uniprot|Q9C257 Neurospora crassa and
FT                   uniprot|P36062 Saccharomyces cerevisiae YKL146w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10637g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79380"
FT                   /db_xref="GOA:Q6C6C3"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C3"
FT                   /protein_id="CAG79380.1"
FT                   /translation="MSYPDRRASFGSSPRQSAIQRLGTPVQVGSPNSNPGSVTGSFKDS
FT                   MRESMKRFEEQADANKNVEEVTFNKRTPEEQHKNGSDSSKGGLKGLMDKGKEKDDASNK
FT                   TDSNTNTTTKTTPSNSSKNNSNTKTNNNSNSNSSNDTKKDQSASPANPPNPADADTQSI
FT                   HSVDIDNPNPEVVKAVGRHLVSDDKTRNYGATESENFDSLKLQGGDITRQLYKWQKEHE
FT                   EGGLKRSKSFDAGEGASSSATQELGQDINSIKAPGGFRRNFIAQKVQQENGQDKPPTFL
FT                   TRNFIEFLSIYGHFAGEELEEDDDDDDDDDYDGDDEVDENDYDEETPLRRRARKQRGAK
FT                   PGHPPQGNASATKAVMLLLKSFVGTGVLFLPKAFFNGGLLFSACVLTMVAALSYWCFLL
FT                   LIQCRMKTGVSSFGDIGGALYGPKMRSLILFSIVISQIGFAAAYIVFTSENLQAFILSV
FT                   TKGETFVKIETLIFLQLIIFLPLSMIRDIAKLSGTALIADLFILLGLVYLYYWSGMIVA
FT                   TEGVADVKMFNPNSWSLFLGTAIFTFEGIGLIIPIQESMKKPEQFTPVLAGVMVGITAL
FT                   FVSMGAICYMAFGSEVKTVVISNLPQDSKFVNGVQILYSAAILLSTPLQLFPAIRIIEN
FT                   GLFTRSGKYNSTIKWQKNIFRFFLVFVTAFVAWGGADDLDRFVALTGSFACVPLVYIYP
FT                   PLLHYKGVARGTTARTADVCIFIFGLCAMGYTTANTVGSWIGGN"
FT   gene            <1322389..>1323849
FT                   /locus_tag="YALI0_E10659g"
FT                   /old_locus_tag="YALI-IPF2961"
FT                   /old_locus_tag="YALI-CDS2458.1"
FT   CDS_pept        1322389..1323849
FT                   /locus_tag="YALI0_E10659g"
FT                   /old_locus_tag="YALI-IPF2961"
FT                   /old_locus_tag="YALI-CDS2458.1"
FT                   /product="YALI0E10659p"
FT                   /note="uniprot|Q99156 Yarrowia lipolytica Lipase 1
FT                   precursor (EC 3.1.1.3)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10659g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79381"
FT                   /db_xref="GOA:Q99156"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99156"
FT                   /protein_id="CAG79381.1"
FT                   /translation="MSVTSTSLNGTFNGISEDGIEIFKGIKYANIPYRWAYAERIDDYD
FT                   NGVFDCTQEGMACPQVLPFDYNIEKGPKEMPFDEFECSNLMITRPQGATNLPVFVWIHG
FT                   GGNLAGNGYCSDHNPVPFVKHSIVAGRPVLHVMIEYRLSAFGYLAVPDTNGNWVGNWGA
FT                   RDQYTALQWISKHIVEFGGDPSQITIGGESAGSIGLHALMVHESMKPKEECIIHNVILS
FT                   SGTMDRMGTGTISENAFKPIYDGIKTLVGDINTCSADELLEAQIKAGLDLGFYLQDDFF
FT                   PPDWRNVRFKVSRVLLSDVIVDGTNFKNKINPAVRVTPENDFDHKVFKLYNISTEDTWE
FT                   DYHYKMMLFKGDETFIRGNQQLELLFEQENIPVWRQLFDQIHPNDPSRLCHHAVDLYYM
FT                   WDNWEMPEDKHAVARQYQDTLTKFVYGQDPWPVDKLHYVHDNQFEILDKSQFGDFRNVP
FT                   ALKFLLGFSAEELGELTKKYTGEGHYTL"
FT   gene            complement(<1323902..>1326229)
FT                   /locus_tag="YALI0_E10681g"
FT                   /old_locus_tag="YALI-IPF2959"
FT                   /old_locus_tag="YALI-CDS0902.1"
FT   CDS_pept        complement(1323902..1326229)
FT                   /locus_tag="YALI0_E10681g"
FT                   /old_locus_tag="YALI-IPF2959"
FT                   /old_locus_tag="YALI-CDS0902.1"
FT                   /product="YALI0E10681p"
FT                   /note="weakly similar to uniprot|Q03631 Saccharomyces
FT                   cerevisiae YML076c putative transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10681g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79382"
FT                   /db_xref="GOA:Q6C6C1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C1"
FT                   /protein_id="CAG79382.1"
FT                   /translation="MDEKLRRPRACENCRALKVKCLPSDSADPGGPCARCARFNKECVV
FT                   NNARRKRRPKTRSKIAELEEKLEMLSRGLQVSEASAAAAGAPQGQPMIHQPLQPQPQPQ
FT                   QQQQQQQQQTQPQQHQLPPQSLPQPGPMGHIMSIGQGHGHMQSPQMHGQTPPNGGIPPQ
FT                   MPINGIAGMLNPSPTTQSERTPESSGTPTSASSFSVRNKDLQPRLPAAADRLFREVQNS
FT                   SGNNPRNLQTGIDGVDEKQKTLATWNALVQLSAKRTELIHSTTHAYCGQLGPHNDIIAR
FT                   GVITQEEADMRLQQYRSVLQCLYGIVVIPDDCSVDELRSTKPFLFLAIMNSSSNAILGP
FT                   KFQNTSIEINVECYKSITSEIMVVGTKSFELVQCLALMMIWYNNCELAFNQKYHLLISM
FT                   AVSIANDIGINDGPFTRVSSLDSYESIMRPNIVMDPKSRECRKLWLVIYFQQVNMSSLL
FT                   KKPVTITWNAYLQECCDLFSTPDSTINEIRCAKLAKVFKELEDMMAMLRSEDYKKPLDI
FT                   NDERTQRLVKHFDRRIDEVFTFDKRGFPIDHVLELFKSSLKISLHELSLLTNVSPTVPR
FT                   TPFSEFGLNIFDLKLTPAVINSAMATADAVRTSLEGFSELYTMQILSSSTLYLARMTYC
FT                   ATTALMLRSCALLHPKFGDLIETEYPLQLIQKIISNMNDVVDQAGCCSHVLHFKFILHL
FT                   LLFYFDRQMKTWYDLMEAKNAISPRDTEVPEILAAPIDNIGNYGIPESVYRTFPQLVSV
FT                   DMDGVIPFEYSSWLLSEQYEAL"
FT   repeat_region   complement(1326997..1327710)
FT                   /locus_tag="YALI0_E10703t"
FT                   /old_locus_tag="Yali0E_1326997_1327710_repeat_region"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of uniprot|Q9C0U1 Yarrowia lipolytica Ylt1
FT                   LTR-retrotransposon"
FT   gene            complement(<1328728..>1330152)
FT                   /locus_tag="YALI0_E10725g"
FT                   /old_locus_tag="YALI-IPF2655"
FT   CDS_pept        complement(1328728..1330152)
FT                   /locus_tag="YALI0_E10725g"
FT                   /old_locus_tag="YALI-IPF2655"
FT                   /product="YALI0E10725p"
FT                   /note="weakly similar to uniprot|Q9UST8 Schizosaccharomyces
FT                   pombe Ribonuclease H (RNase H)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10725g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79383"
FT                   /db_xref="GOA:Q6C6C0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6C0"
FT                   /protein_id="CAG79383.1"
FT                   /translation="MPKKFYAVRAGHKPGIYDYADAQKQVRGYSRSDWKGFNVLQDATD
FT                   YLHATKSESETQSKHQKQLKTQPKVKEQTKVKEQTKVKEQTKVQTKAQNQSKSRPEAKS
FT                   QPEAKTKTQSKTRDQSQTQSKLKFQDQPKTRDQSKSKDRSKTAVQSQVNHKTQSGVQPE
FT                   TKTGAKAKTKAKGKPEAETDIETATNELLSAQADVKSLTKALLEAQDRVKSHKQALQLA
FT                   RDNIKGGDSAEPKQSFYIVDCFIFDTREAAVMYYGGSKGVVKAASWDEATEKVRKAGYD
FT                   QNHKAFSEDISYVNKQGNTVYQVFVDGACSNNGGPDAKAGYGLYFGENNPWNVAASVMG
FT                   TVHTSQRAELQAIMKAYQVIEKKDNGHSYEIMSDSSYAINCLTKWRHDWKKHGWKTSEG
FT                   KPVENVDLIQDCIKIMDRLVKRGIALKKVQAHGDSKGNKRADVLARQGVQVARGHVGGN
FT                   DASKSWSVLGLSPVSK"
FT   gene            <1332719..>1333855
FT                   /locus_tag="YALI0_E10747g"
FT                   /old_locus_tag="YALI-IPF2656"
FT                   /old_locus_tag="YALI-CDS3481.1"
FT   CDS_pept        1332719..1333855
FT                   /locus_tag="YALI0_E10747g"
FT                   /old_locus_tag="YALI-IPF2656"
FT                   /old_locus_tag="YALI-CDS3481.1"
FT                   /product="YALI0E10747p"
FT                   /note="similar to uniprot|P40348 Saccharomyces cerevisiae
FT                   YJR068w RFC2 DNA replication factor C 41 KD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10747g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79384"
FT                   /db_xref="GOA:Q6C6B9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B9"
FT                   /protein_id="CAG79384.1"
FT                   /translation="MQSFFAKSQQAQKADGKKTSKNKAPPPWVEKYRPKSLDDVSSQDH
FT                   AVTVLKRTLGSANLPHMLFYGPPGTGKTSTVLALAKELYGPELMKDRVLELNASDERGI
FT                   AIVRDSIKNFAAQKVVAPKDHIAEKYPCPPFKIIILDEADSMTTDAQSALRRTMETYSA
FT                   QTRFCLICNYVTRIIDPLASRCSKFRFRLLDGNDALARLRHVSDAEQLSVEDGVLEKIL
FT                   EVANGDLRRAITILQSCSRLSGESSAAQNDEDGDATMAETRPITIADVNETAGVIPTET
FT                   LKAIIKACKDSKGPIGDTVPDILVAVKELTYSGWSSAQITSQMHDLIITDVLIEGKEKS
FT                   KIAELLSVTDKRLADGADESLAMLNLIVGIADVLGAAK"
FT   gene            complement(<1334052..>1336733)
FT                   /locus_tag="YALI0_E10769g"
FT                   /old_locus_tag="YALI-IPF2658"
FT                   /old_locus_tag="YALI-CDS0624.1"
FT   CDS_pept        complement(1334052..1336733)
FT                   /locus_tag="YALI0_E10769g"
FT                   /old_locus_tag="YALI-IPF2658"
FT                   /old_locus_tag="YALI-CDS0624.1"
FT                   /product="YALI0E10769p"
FT                   /note="similar to uniprot|P14242 Saccharomyces cerevisiae
FT                   YNL082w PMS1 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10769g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79385"
FT                   /db_xref="GOA:Q6C6B8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B8"
FT                   /protein_id="CAG79385.1"
FT                   /translation="MAIKAIDTASIRQITSAQVVTDLNSAVKEVVENSLDANAKNVEIK
FT                   IFDYGKDRVEIIDDGDGIPKSEFDHVARKHMTSKIIEFDDLASVLSYGFRGEALASICE
FT                   MAELEIVTCGNTSEPATRLEFNRDGSIKSTKPVAGKRGTTVTIRRLFHSAIVRRKEFEK
FT                   NAKNSHPGLIRMLETYAIIRSDVRFSIVHVTNNKNRNVQLTTDGSGDMIKTVGRVFGNE
FT                   LKAHLMDVNFSFDVNYTKRGFLSSEELPNYVVRVTGLVSKPVFGMGRNANDKQLLFINK
FT                   RPFTMKKLQKVFQDVYTSFVHLQKPVLIINLDIPPSAYDVNVSPDKRTIMLHNEVDVIN
FT                   CIRENLVDVFESSGQSVPRHTVDVKVQPMSSQSYWGVKDDVGEQEIEEVEDVEESGEVG
FT                   PVELDHNVQLDEAATSDDVPNQLEVRQAAAGQIERAGLFVTDQEQEEDVSMTYVEETES
FT                   LVINDMTTDEADHPREQEDEGMVDDEAEEVEEEEEEEEEEEGQAEEEDPEKIPPEYAYI
FT                   DTAATLEDEGEDRGNDDETNDDDDDDNDNDPTSSLSYSQSDTSMNSVSDTSISLTTPIT
FT                   SRRRVTKSNVNKLNLSQFSASSRPSSSSSTRPSTASSLPSLPASQRASSRKRTYANLPE
FT                   FDTFGHRESLTITAEDLERGERASETLSTFNTSSSTSQPQTSALDDSSAESKLNLTISR
FT                   NDFLNFNIIGQFNEAFIIVSDPENLFIIDQHASDEKYNFERLQRDTKITPQPFVNPLTV
FT                   ELTPLEESVVSSNLELLKKNGFLVTIDNSLPPGEKCQIRGFPQTGNIVFGMPDFRELVV
FT                   LFEDNPGNDSVRPKKVRDVFASRACRGSVMVGTALKEKEMDRIVRNLAGLDKPWNCPHG
FT                   RPTMRHLMEIDKWPVFTQDYEF"
FT   gene            <1337292..>1337903
FT                   /locus_tag="YALI0_E10791g"
FT                   /old_locus_tag="YALI-IPF2659"
FT                   /old_locus_tag="YALI-CDS5452.1"
FT   CDS_pept        1337292..1337903
FT                   /locus_tag="YALI0_E10791g"
FT                   /old_locus_tag="YALI-IPF2659"
FT                   /old_locus_tag="YALI-CDS5452.1"
FT                   /product="YALI0E10791p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10791g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79386"
FT                   /db_xref="GOA:Q6C6B7"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B7"
FT                   /protein_id="CAG79386.1"
FT                   /translation="MKAQEPDTTTYAAVLESIRTFLAVFIHNIAYYFNVYPADAFQQVR
FT                   QFNSAVWLCRAPVVNGYIDEASHECVNLLKDGKCAAVAISIHNSASKHVATIPIKFNIP
FT                   VVPESDQTVPVTDAPTLIEDLQLEFNAFFTRLANYGPNFNPSKLEHTFKIQCELEGRHT
FT                   LEGWISSEAQSSKQVPGLEDVVVRKIETGPIEVVSWLEYV"
FT   gene            complement(<1338164..>1339819)
FT                   /locus_tag="YALI0_E10813g"
FT                   /old_locus_tag="YALI-IPF2661"
FT                   /old_locus_tag="YALI-CDS1949.1"
FT   CDS_pept        complement(1338164..1339819)
FT                   /locus_tag="YALI0_E10813g"
FT                   /old_locus_tag="YALI-IPF2661"
FT                   /old_locus_tag="YALI-CDS1949.1"
FT                   /product="YALI0E10813p"
FT                   /note="weakly similar to uniprot|P48233 Saccharomyces
FT                   cerevisiae YNL083w weak similarity to rabbit peroxisomal
FT                   Ca-dependent solute carrier"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10813g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79387"
FT                   /db_xref="GOA:Q6C6B6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B6"
FT                   /protein_id="CAG79387.1"
FT                   /translation="MTEPTKAAEHTHKSAEQAQAQLLKAEKQQQLALSTGETPEQRSAR
FT                   YERMFRKLDREGKGQLSKEDFVAAFSGSLGGSVPESHTLRNADSLVGNLVNLMDTNEDG
FT                   LVDLSEFQSYLELTEQNLVYLFHIIDDKGDGKLDREELADGMAAVGLGDMDSDTIDDFF
FT                   KALDRDKDGYICFDEWRDFLLLVPNEAGSTLKAAYKFFVEELDLSSEGDVIFHRDVLQG
FT                   LGYFLAGGLAGAISRTATAPLDRLKVYLIADPITPATTAAASGASEAVYESIAKNASKA
FT                   KPPSGFMARHHVLINAIKNIWAEGGIRSFFIGNGLNVFKVIPESAMKFGSFETAKKFLC
FT                   QLEGVEDTADLSRASTFLAGGIGGVVSQFVVYPIDTLKFRIQCEPPTGALQGNALLWHT
FT                   MKQMWRNGGLATYYRGLWAGLGGIFPYAALDLGTFEVMKRGYITREAKRLGCENSDVKI
FT                   GNMAVLTMGALSGSVGATVVYPINLLRTRLQAQGTAAHPQTYTGIMDAYHKAVTKDGYR
FT                   GLFRGLAPNLAKVAPAVSISYLVYENTKTMLGLE"
FT   gene            complement(<1340180..>1340788)
FT                   /locus_tag="YALI0_E10835g"
FT                   /old_locus_tag="YALI-IPF2662"
FT                   /old_locus_tag="YALI-CDS5209.1"
FT   CDS_pept        complement(1340180..1340788)
FT                   /locus_tag="YALI0_E10835g"
FT                   /old_locus_tag="YALI-IPF2662"
FT                   /old_locus_tag="YALI-CDS5209.1"
FT                   /product="YALI0E10835p"
FT                   /note="no similarity possibly noncoding"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10835g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B5"
FT                   /protein_id="CAG79388.1"
FT                   /translation="MTCIWRWTSMWRKRWQEKAVNVGSRCVNTLPTEGEQSTTKGEIDL
FT                   IEHNNCPMTTNTRSSKHKNPYQLPCQTQKHTSKPQTLDSDASPSIYIEEVKIMCTEQTC
FT                   QSDSTVGCAGCSKSGGIEPTSLKFIDCSNRATRGHVTHLWQAPCLLVRRCTGSHSLEGP
FT                   FYSQPNHTVSILYRVCLSMRGGVDVPYNAMIGTVWRHVT"
FT   gene            <1341726..>1342329
FT                   /locus_tag="YALI0_E10857g"
FT                   /old_locus_tag="YALI-IPF11348"
FT                   /old_locus_tag="YALI-CDS6086.1"
FT   CDS_pept        join(1341726..1341944,1342081..1342329)
FT                   /locus_tag="YALI0_E10857g"
FT                   /old_locus_tag="YALI-IPF11348"
FT                   /old_locus_tag="YALI-CDS6086.1"
FT                   /product="YALI0E10857p"
FT                   /note="some similarities with uniprot|P40518 Saccharomyces
FT                   cerevisiae YIL062c ARC15 subunit of the ARP2/3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10857g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79389"
FT                   /db_xref="GOA:Q6C6B4"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="InterPro:IPR036743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B4"
FT                   /protein_id="CAG79389.1"
FT                   /translation="MSQIDFRRIDVDQYDPDSFISKEDLTPPCKPVSAAEQQQVATEIR
FT                   GAISRGEAKAALPIALDFAPYGGDDKVKDAHLKSVIEVLSATKSAEIPSVVKALNKEQQ
FT                   DVLIKYLYKAMGSPQGQSQGVGAILLAWYEKTVDITGQGAVVRYMSDRRTV"
FT   gene            complement(<1342852..>1344537)
FT                   /locus_tag="YALI0_E10879g"
FT                   /old_locus_tag="YALI-IPF2663"
FT                   /old_locus_tag="YALI-CDS1879.1"
FT   CDS_pept        complement(1342852..1344537)
FT                   /locus_tag="YALI0_E10879g"
FT                   /old_locus_tag="YALI-IPF2663"
FT                   /old_locus_tag="YALI-CDS1879.1"
FT                   /product="YALI0E10879p"
FT                   /note="weakly similar to uniprot|AAO59297 Cochliobolus
FT                   heterostrophus KLP10 kinesin"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10879g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79390"
FT                   /db_xref="GOA:Q6C6B3"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B3"
FT                   /protein_id="CAG79390.1"
FT                   /translation="MSLPVYLRLRKDDEQPSSRPSSATDKPYLEIASDDPSTIITNPPE
FT                   KSRTRTKEKFAFSEVFDGSTQEEVYKKVMLPMVKNVVTGSGDGLLFAMGTTGSGKTHTL
FT                   LGNPRLGRPGMVHYALKSVFDAIGDRLCLFDEAEAVAEKSAGPNRESHVLEAIPFIDNG
FT                   ILTQSQHQLNQFIENAVVAENADLYSSVGQRSSHGVYISMVEIYNDRVFDLLDKRRPVV
FT                   VKCDTKGKFGIPSQTKLFCATIQEAFQVLEQAHALRSTHSTESNSVSSRSHALFTVTVK
FT                   RLGRTMLTTSLTIGDLAGSERNKSTRAEGERLSEACSINQSLMMLGQCLQRQREVKGYK
FT                   LDRSILRSSKLAQLLLPVAFSRDAMTALLITANQNADFSSTIQIMRYSALARDTIKPPV
FT                   TPAYLKRAGSGPSTPAQRAVSNSSISSTGSTMSHMSSASHTSHDDTKDNLIRTIAALQE
FT                   QLYQAQQREDALEIQIREEVNQEMETHMEQMRQWYLDQLDQATDAAQNFTDKKISILGR
FT                   RVNSDNVSDELVKLRKENQLLKQRLNVDKENVEIAHGPDSFRSD"
FT   gene            <1345550..>1346923
FT                   /locus_tag="YALI0_E10901g"
FT                   /old_locus_tag="YALI-IPF2665"
FT                   /old_locus_tag="YALI-CDS2731.1"
FT   CDS_pept        1345550..1346923
FT                   /locus_tag="YALI0_E10901g"
FT                   /old_locus_tag="YALI-IPF2665"
FT                   /old_locus_tag="YALI-CDS2731.1"
FT                   /product="YALI0E10901p"
FT                   /note="weakly similar to uniprot|P40517 Saccharomyces
FT                   cerevisiae YIL063C YRB2 Ran-specific GTPase-activating
FT                   protein 2 involved in nuclear protein export"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10901g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79391"
FT                   /db_xref="GOA:Q6C6B2"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B2"
FT                   /protein_id="CAG79391.1"
FT                   /translation="MSKRTREERESIATPQKIDIKRRKSEEDVVDAAEVETTPTKPVTG
FT                   IKWTPSEEDVADAVAEAAEETKAIAAETQVVADEIKAAEKEVEELKEEVKADENDTKQE
FT                   SKEVGKEAGDAGSKQESNADNNTETKADETTGTKADETIETKAGETAETVTESATETKL
FT                   AKAAETKTESSAPETKDTNGDSKPKHVFGTNSKFSGGFGAFKGGSLWGKPASTTTSSIT
FT                   TPASPAPAAASTGSSGYVFGSATKYSGGFSSVLNNLKKDDTKSDNPWAEKKKEDKTEDK
FT                   KTDKDGEDKNDKDKDADDKEKEKEQELEKEKEAEHYIGVSAPLAKKESMETGEEGEESI
FT                   YTCRAKLYYFDLTNTTEGWKERGVGQVHINKLKPEDVTETCSGRIVMRTDAVHRVVLNM
FT                   GLVKGLEVQAGMGASLSSDKVVRISTIEDNKPVQYALKTGNPDAAKQLLAGIKGLIPV"
FT   gene            complement(<1347056..>1347763)
FT                   /locus_tag="YALI0_E10923g"
FT                   /old_locus_tag="YALI-IPF2667"
FT                   /old_locus_tag="YALI-CDS5061.1"
FT   CDS_pept        complement(1347056..1347763)
FT                   /locus_tag="YALI0_E10923g"
FT                   /old_locus_tag="YALI-IPF2667"
FT                   /old_locus_tag="YALI-CDS5061.1"
FT                   /product="YALI0E10923p"
FT                   /note="similar to KLLA0C07931g Kluyveromyces lactis and
FT                   uniprot|Q9GYH9 Caenorhabditis elegans F29B9.1"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10923g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79392"
FT                   /db_xref="GOA:Q6C6B1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026635"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B1"
FT                   /protein_id="CAG79392.1"
FT                   /translation="MSDVEQLTSSKLGTKQYWDEFYNLEKNNYAENPNDSGECWFSDSG
FT                   AEEKMVDFLVDEEEQGQGESLISLDCKMCDLGTGNGRLLFSIREGGFTGHLTGLDYSQP
FT                   AVEFSTKIAEQEEMENITFEHADFLGDAAMWSTGNRQWDVVLDKGTLDAIALSDIKYEG
FT                   KTGVQTYPHVVQHMVKTRGVVLITSCNFTSDELVKIMTTDTCLKEWKHVKYPSFRFGGT
FT                   DGSTVCTIAFKKE"
FT   gene            complement(<1348015..>1348086)
FT                   /locus_tag="YALI0_E10945r"
FT   tRNA            complement(1348015..1348086)
FT                   /locus_tag="YALI0_E10945r"
FT                   /product="transfer RNA His (GTG) cove score=66.09"
FT   gene            complement(<1348257..>1348328)
FT                   /locus_tag="YALI0_E10967r"
FT   tRNA            complement(1348257..1348328)
FT                   /locus_tag="YALI0_E10967r"
FT                   /product="transfer RNA His (GTG) cove score=66.09"
FT   gene            complement(<1348774..>1349811)
FT                   /locus_tag="YALI0_E10989g"
FT                   /old_locus_tag="YALI-IPF2668"
FT                   /old_locus_tag="YALI-CDS3836.1"
FT   CDS_pept        complement(1348774..1349811)
FT                   /locus_tag="YALI0_E10989g"
FT                   /old_locus_tag="YALI-IPF2668"
FT                   /old_locus_tag="YALI-CDS3836.1"
FT                   /product="YALI0E10989p"
FT                   /note="weakly similar to uniprot|Q00916 Saccharomyces
FT                   cerevisiae YIL061c SNP1 U1 small nuclear ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E10989g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79393"
FT                   /db_xref="GOA:Q6C6B0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6B0"
FT                   /protein_id="CAG79393.1"
FT                   /translation="MVSICATFALQSTTRLTQAELERLPPHIQRLFPECPEPRYLEPID
FT                   YAPEDRRTQKISGVSAYMELLKQPDSEYVPTESWLVKQQREKRLKSERQKVTQQERKEA
FT                   WDPKKDDKIVGDPFKTLFVARLAFDVTENDLEEHYIKFGPVKHVRIVRDLKSGKSNGYG
FT                   FVEFQEEDDFRKAFQMTNGSIIKGRKVVVDVERGRTVSGWLPRRLGGGKGGRHYTKESE
FT                   RKPLGPPMPPGGAGGRDLFPGHRDRGGPRSRDPRGSRPPEDYRDSFRGRGGGRGGRDFR
FT                   DRDPRDRDPRDRDRERDPRDRDRERRPQYRDRSPPRRERDRGDFRRGPADRGGDRGGRE
FT                   PTKYY"
FT   gene            complement(<1350245..>1350859)
FT                   /locus_tag="YALI0_E11011g"
FT                   /old_locus_tag="YALI-IPF2670"
FT                   /old_locus_tag="YALI-CDS5434.1"
FT   CDS_pept        complement(1350245..1350859)
FT                   /locus_tag="YALI0_E11011g"
FT                   /old_locus_tag="YALI-IPF2670"
FT                   /old_locus_tag="YALI-CDS5434.1"
FT                   /product="YALI0E11011p"
FT                   /note="weakly similar to DEHA0F01914g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11011g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79394"
FT                   /db_xref="GOA:Q6C6A9"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034095"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A9"
FT                   /protein_id="CAG79394.1"
FT                   /translation="MLRTRAVGILSRSIHTSRVCAKNVKLENPWFKGEGPMERTKRKLE
FT                   NTAARPGGALAEYDLYGDLETAHNNVEAVLSNGFVFKDDKVLKSKSPSGKKPVGAILMG
FT                   LSEVLAWNLTPECVKGLDTGLVEIDPAALGVFEVVYPRPELLIFGLGKKSRVLSPKTRN
FT                   YLNSLGISVEISDSANGAKNFDLLATERPGLVAAALFPPDL"
FT   gene            <1351308..>1351920
FT                   /locus_tag="YALI0_E11033g"
FT                   /old_locus_tag="YALI-IPF40080"
FT   CDS_pept        join(1351308..1351432,1351623..1351920)
FT                   /locus_tag="YALI0_E11033g"
FT                   /old_locus_tag="YALI-IPF40080"
FT                   /product="YALI0E11033p"
FT                   /note="some similarities with uniprot|Q06090 Saccharomyces
FT                   cerevisiae YPR100w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11033g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79395"
FT                   /db_xref="GOA:Q6C6A8"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A8"
FT                   /protein_id="CAG79395.1"
FT                   /translation="MSARPAYQTVARNLNGVGNFVLQCKKVTFRYCNWGGSSDGMRQYL
FT                   DKNLQKIAAQNPEIEFVAVKDIGHPFIRGEFVNGAEKTICCKNKHPRFINGKFEMLKSS
FT                   DGAPRKQMKSPVESINESVRGIWSPYHTDPKARHKI"
FT   gene            <1351952..>1352488
FT                   /locus_tag="YALI0_E11055g"
FT                   /old_locus_tag="YALI-IPF11343"
FT                   /old_locus_tag="YALI-CDS5689.1"
FT   CDS_pept        1351952..1352488
FT                   /locus_tag="YALI0_E11055g"
FT                   /old_locus_tag="YALI-IPF11343"
FT                   /old_locus_tag="YALI-CDS5689.1"
FT                   /product="YALI0E11055p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11055g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A7"
FT                   /protein_id="CAG79396.1"
FT                   /translation="MVKERRTMADTNRHSRGMERMVVCKWLLYHNSCDTVEARLLNYAA
FT                   LRRSLTTIYRGAQVRSTCTRQTSGCTTSVRTSTVLISTELVPTCMKSLNYYRDEQKHNY
FT                   WKQKGVKGNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNKNGNRSNLNVVKRILVVDSA
FT                   RCKVTSTSATVNLGN"
FT   gene            complement(<1352587..>1353900)
FT                   /locus_tag="YALI0_E11077g"
FT                   /old_locus_tag="YALI-IPF2672"
FT                   /old_locus_tag="YALI-CDS2898.1"
FT   CDS_pept        complement(1352587..1353900)
FT                   /locus_tag="YALI0_E11077g"
FT                   /old_locus_tag="YALI-IPF2672"
FT                   /old_locus_tag="YALI-CDS2898.1"
FT                   /product="YALI0E11077p"
FT                   /note="similar to uniprot|Q07538 Schizosaccharomyces pombe
FT                   SPCC777.14 PRP4 Serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11077g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79398"
FT                   /db_xref="GOA:Q6C6A5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A5"
FT                   /protein_id="CAG79398.1"
FT                   /translation="MATSTAPLKRVQPTPSKIANPMDSDDSDDMFDLASDTDSPNKKRQ
FT                   KTEADKPARKGQKLDQKLLDKWDDEENYYKTIIGEVLNDKYKVVDHLGKGVSATVVKVE
FT                   EVGKEGNEKEDKNGSSNGHENDGLAVKIIRSNDAMRKIGDREGKIIDRLNKHQSTSSII
FT                   GLIDRFDHKGHLCLVFEGMHSNLRDILKEFGRNQGINIRAVRLYARQIFTSLQILRECQ
FT                   ILHGDFKPDNVLVNAKRSSTRLCDFGSAVEANKDQKAWTEPMPYLASRFYRAPELILGA
FT                   PFDYGVDMWSAGCTLYELYTGCILFAGSSNNHMIKCIMDVRGKFSHKQLKKGKLTEKYF
FT                   DENLDFKSDEVDPHTGRMITHTLRYTQNQAPLPVKKLLGKCRETGSDIILQGHLIDLLD
FT                   KLFALNPEKRMTPEQALEHPFCHDREADIDQLDPQHKA"
FT   gene            complement(<1357785..>1358978)
FT                   /locus_tag="YALI0_E11099g"
FT                   /old_locus_tag="YALI-IPF2673"
FT                   /old_locus_tag="YALI-CDS3266.1"
FT   CDS_pept        complement(1357785..1358978)
FT                   /locus_tag="YALI0_E11099g"
FT                   /old_locus_tag="YALI-IPF2673"
FT                   /old_locus_tag="YALI-CDS3266.1"
FT                   /product="YALI0E11099p"
FT                   /note="uniprot|Q9C1T3 Yarrowia lipolytica Acetoacetyl-CoA
FT                   thiolase (EC 2.3.1.9)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11099g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79399"
FT                   /db_xref="GOA:Q6L8K7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6L8K7"
FT                   /protein_id="CAG79399.1"
FT                   /translation="MRLTLPRLNAAYIVGAARTPVGKFNGALKSVSAIDLGITAAKAAV
FT                   QRSKVPADQIDEFLFGQVLTANSGQAPARQVVIKGGFPESVEATTINKVCSSGLKTVAL
FT                   AAQAIKAGDRNVIVAGGMESMSNTPYYSGRGLVFGNQKLEDSIVKDGLWDPYNNIHMGN
FT                   CCENTNKRDGITREQQDEYAIESYRRANESIKNGAFKDEIVPVEIKTRKGTVTVSEDEE
FT                   PKGANAEKLKGLKPVFDKQGSVTAGNASPINDGASAVVVASGTKAKELGTPVLAKIVSY
FT                   ADAATAPIDFTIAPSLAIPAALKKAGLTKDDIALWEINEAFSGVALANLMRLGIDKSKV
FT                   NVKGGAVALGHPIGASGNRIFVTLVNALKEGEYGVAAICNGGGASTAIVIKKVSSVE"
FT   gene            <1361654..>1363354
FT                   /locus_tag="YALI0_E11121g"
FT                   /old_locus_tag="YALI-IPF2676"
FT                   /old_locus_tag="YALI-CDS1837.1"
FT   CDS_pept        1361654..1363354
FT                   /locus_tag="YALI0_E11121g"
FT                   /old_locus_tag="YALI-IPF2676"
FT                   /old_locus_tag="YALI-CDS1837.1"
FT                   /product="YALI0E11121p"
FT                   /note="weakly similar to uniprot|Q10260 Schizosaccharomyces
FT                   pombe Hypothetical protein C56F8.12 in chromosome I"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11121g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79400"
FT                   /db_xref="GOA:Q6C6A3"
FT                   /db_xref="InterPro:IPR018830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A3"
FT                   /protein_id="CAG79400.1"
FT                   /translation="MGRPPGSGMDGPVYTDYDPAIMEKLNLHVDIENGTLTNGPQCWLS
FT                   FGDHIPTFVHIEYLDTYAINGTTCDSPYYSMGNKGYLGVMLSVGIAAATLVTFFNLRKH
FT                   GMNFMHEPKAEELMSQGGRPSKTKTAEPGWIRGRRLPWFLLLVLGLMLILTGFFAVDID
FT                   RNYIQGTAAGMYGVFLSVCPVLGLMVSWEFIRRWGFFEERKLLEQDPYAIDQTDLKSKA
FT                   RIIPPIVFYVSCFFAMFMMVLRNWSKHLDYNTFFDLDVRWVIGGICEVFAFIQLVNSLR
FT                   VTITYYQVPQVPLVLPFMVFMNLLTEIYQVTVMVVNDKTVSPFYPSSSVVLPVFLVYLP
FT                   LWAITIAGNLSGLARDNEDQVILRLRALRWKIKQENAERARSQGEQEQEAAQIAERRET
FT                   DATFNEQYPHFEDSDAEADEEGSDPNASGGGRQTSRYQKLGNEGGNRAGLFKRLFGEYR
FT                   PTNTWFGHNMAYVPLSRTKNQLFDEEDFPAITLQKTRVRSEVNEDPDEMEGGFDNYHKP
FT                   SLFSFLSNSFRPIPSKGRRDLNDLEMQDLGTPKSIKQQKLYGGRRGSRP"
FT   gene            complement(<1363894..>1365378)
FT                   /locus_tag="YALI0_E11143g"
FT                   /old_locus_tag="YALI-IPF2678"
FT                   /old_locus_tag="YALI-CDS2394.1"
FT   CDS_pept        complement(1363894..1365378)
FT                   /locus_tag="YALI0_E11143g"
FT                   /old_locus_tag="YALI-IPF2678"
FT                   /old_locus_tag="YALI-CDS2394.1"
FT                   /product="YALI0E11143p"
FT                   /note="some similarities with DEHA0F01892g Debaryomyces
FT                   hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11143g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79401"
FT                   /db_xref="InterPro:IPR035189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A2"
FT                   /protein_id="CAG79401.1"
FT                   /translation="MTGLFSFLWPSSTTPAITIPTYYQGDNEDHIDLQIKSLTFMYKRC
FT                   NRQIHTPFRRDSSEDMTKDVKECLMRHKLNKKRSHQVLPTALSSEKNNLRPSRSEEDFT
FT                   GMTASEVEKLDIMYNRSEFERQLFNDQHRITIDWAKNKFRSVCILTAMPAHSSTLPVID
FT                   KLNNCKFTLLRADATDEEYIRTLADSDLYREHNIARNTRMRFARDCIDRTRDAKQPSSA
FT                   NFTKDERALIIRTFLQKLAVEVQVQRLYRGAFRERLREKEKESTKGTLKLHKSASKENF
FT                   KDFVTSSSRDSLRDTIFQLEESSAIPNAAPRPSTPRSPKLEVRSLNIPTHTPSLKGKKS
FT                   HAELFLLMSPEKQKSYFDPPLSPPKQQSSPSPNSSPTRSPRRQYNTPNLPITNSGTSSS
FT                   SNRLKKKASTMSLGSGCGAPHIPPPPTYAPSTSPESANSINSCVSTATSTTSISSRTTA
FT                   VSEATLSEDTNRELLAQARIAVRSRLESEKMRIFGP"
FT   gene            complement(<1367671..>1369546)
FT                   /locus_tag="YALI0_E11165g"
FT                   /old_locus_tag="YALI-IPF2680"
FT                   /old_locus_tag="YALI-CDS1930.1"
FT   CDS_pept        complement(join(1367671..1369320,1369379..1369546))
FT                   /locus_tag="YALI0_E11165g"
FT                   /old_locus_tag="YALI-IPF2680"
FT                   /old_locus_tag="YALI-CDS1930.1"
FT                   /product="YALI0E11165p"
FT                   /note="weakly similar to KLLA0F02596g Kluyveromyces lactis
FT                   no start"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11165g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79402"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A1"
FT                   /protein_id="CAG79402.2"
FT                   /translation="MESIRYEQLSLTEDEIRAYSRWYTDLLLRKGKESIVVGDVLTFVD
FT                   NFGVKDEDKQKILNACGQHLVNLDPGQFYGFLRLVSHALNGSNVSAAMIYQPAPLLRPK
FT                   SILSRKRKNSEPELAVTPTGTPLDINSFTSLLLTGDRRKKSKKKVQFTSEPPQVTAAAG
FT                   RTLEELMRQRQSGSAPVYSQSMSDLLDDDTAQEDEPKPLERQQTGPPPRTSFMAYMHQT
FT                   EQDLQAEVQPQSQQQQSQPPPPPQQHQQPPPPVTVTAPIQQAPPPNPSTGEDDENEVIE
FT                   ALEDSGFKNVKVDSVLHHGKPQVGPPPITFGSTYGETPGDAFRNILQSQATGSPAPGGS
FT                   PAPGDAFRDALVSQATGNNNSNNSNNSNNTNNNLQPSNTGSSFKPTLGRQATGAPSTSF
FT                   AGYMSYGDGSANSSYSPSPASTPQPQTQSQPSAAATNYSGLSGVFSTPHTQQAYGQQQQ
FT                   QQQQQYQPHQYHQQQQQQQQQQSQHQQHNMNSVYNLMVPGVSRSQSVSPTPTSFGNGGG
FT                   YNAVGGRRVPPPPPPPRNKSASPQPPPVSFQREAPVPPPPRRGSTALHSAPPQTSFNGN
FT                   GYSSQTSPDLLADLRALQDEVDKLSGANR"
FT   gene            <1370406..>1371368
FT                   /locus_tag="YALI0_E11187g"
FT                   /old_locus_tag="YALI-IPF2681"
FT                   /old_locus_tag="YALI-CDS4142.1"
FT   CDS_pept        1370406..1371368
FT                   /locus_tag="YALI0_E11187g"
FT                   /old_locus_tag="YALI-IPF2681"
FT                   /old_locus_tag="YALI-CDS4142.1"
FT                   /product="YALI0E11187p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11187g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79403"
FT                   /db_xref="GOA:Q6C6A0"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C6A0"
FT                   /protein_id="CAG79403.1"
FT                   /translation="MSDEDEYLRQQKLQADYDEFQKDVEDADGEHVLGMIERANEVKNK
FT                   YKDDRRALIKDADLLKTVATKKTKHIKKYALAQPGTIDLKEVQNMVTRFIDTAAEIEDP
FT                   AFDRVVDAFTGLSADPQAVPDFKRIAALGRVGMKHGRVARGASHLIGALEKDRPQKVRQ
FT                   MKPRQDPTEVGTQEKAKQLKGDEIDSTKNNIQRFGGIMRRRLTAEYNYRKQCGEPLPML
FT                   QAIIDPRSFESTVQNFFVFSTLVAGGMAKLSEYEDNTPVIDMCSEEETAKLVNDRDSRC
FT                   PVVLEMDYETYEMILDAYEMRGQEPLLDLGDTTMGLSAE"
FT   gene            <1371815..>1373158
FT                   /locus_tag="YALI0_E11209g"
FT                   /old_locus_tag="YALI-IPF2683"
FT                   /old_locus_tag="YALI-CDS2820.1"
FT   CDS_pept        1371815..1373158
FT                   /locus_tag="YALI0_E11209g"
FT                   /old_locus_tag="YALI-IPF2683"
FT                   /old_locus_tag="YALI-CDS2820.1"
FT                   /product="YALI0E11209p"
FT                   /note="weakly similar to uniprot|Q6BZV2 Yarrowia lipolytica
FT                   YALI0F30657g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11209g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79404"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C699"
FT                   /protein_id="CAG79404.1"
FT                   /translation="MHAVYLYIHAIFRAYQRTLDSINAPTPPLMSTLLEVLGLDNREHS
FT                   PFEIDQAYRNRTFLALGLLPSDSDPFYAVSDAYQVLRNPSHRAKYVKLGDKRFFDQCRN
FT                   IQYIDAVDILLGSFGVDRLKFLVADMPAFSTIVNCFKEMKEIAVAAGPLDISNRSLDIM
FT                   RRPGWTQGKAKVEYQFKCTKGDYSRVTVMPQMREMQHLLDEYDGEKGNRQVAEKLLDAF
FT                   KQTTLGLDWMHVVAAVFRTRGTNQYNKCRKLINNRSNIECPIKRVAYMRKYVIRTQKFW
FT                   KYANKSYDDQVNLFYLACACSLILEAKKALDKTIDYLFDAQRQQISKRKDRMVPAKRLA
FT                   DLGEWMGQKDEVFITYDDVLASAITHTAYHVVYVVTKMEKVDLPDIRYSLPKTDFPDRS
FT                   KTLVKMALDIYNAEDLSAGPDPFNSDLVVWNLASMNALMTGPTPGTYY"
FT   gene            <1380176..>1380261
FT                   /locus_tag="YALI0_E11231r"
FT   tRNA            join(1380176..1380212,1380225..1380261)
FT                   /locus_tag="YALI0_E11231r"
FT                   /product="transfer RNA Pro (AGG) cove"
FT   gene            <1380273..>1380362
FT                   /locus_tag="YALI0_E11275r"
FT   tRNA            join(1380273..1380312,1380326..1380362)
FT                   /locus_tag="YALI0_E11275r"
FT                   /product="transfer RNA Tyr (GTA) cove"
FT   gene            <1382459..>1383268
FT                   /locus_tag="YALI0_E11319g"
FT                   /old_locus_tag="YALI-IPF2684"
FT                   /old_locus_tag="YALI-CDS4693.1"
FT   CDS_pept        1382459..1383268
FT                   /locus_tag="YALI0_E11319g"
FT                   /old_locus_tag="YALI-IPF2684"
FT                   /old_locus_tag="YALI-CDS4693.1"
FT                   /product="YALI0E11319p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11319g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C698"
FT                   /protein_id="CAG79405.1"
FT                   /translation="MTKPTTPLHSVDFYDWNVLTQFKLRGDLFKDPVLNRVASYFNEGV
FT                   TYLLNGGYVYKARGSGKWMALPKTAATDEASKTASPDANRDYPKELLELIISDADSASS
FT                   LEECKIVGRDPSSWAPEHRVLLERATESNPDLSIVADFLAIGGTYAKKDNYLFRVDNGV
FT                   DRMVVPRGDVRDQLIRECLEGISEGEDPVERVQTMVAQYYVIPELETDVVRVMSSEEGE
FT                   KRLQPTTKEAAIAPKTPVVTAAAATSTPTTPSALSSPASDVSVAPSL"
FT   gene            <1383658..>1384108
FT                   /locus_tag="YALI0_E11330g"
FT   CDS_pept        join(1383658..1383666,1383920..1384108)
FT                   /locus_tag="YALI0_E11330g"
FT                   /product="YALI0E11330p"
FT                   /note="some similarities with uniprot|A2E345 Trichomonas
FT                   vaginalis Myb-like DNA-binding domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64329"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH5"
FT                   /protein_id="CAR64329.1"
FT                   /translation="MTRMTKWDPENDNIVKSFVKEHGREWSISEMADELKSQLPGFDNS
FT                   SIQRRILQWLQNPRGPSDLL"
FT   gene            complement(<1385499..>1387385)
FT                   /locus_tag="YALI0_E11341g"
FT                   /old_locus_tag="YALI-IPF2686"
FT                   /old_locus_tag="YALI-CDS1451.1"
FT   CDS_pept        complement(1385499..1387385)
FT                   /locus_tag="YALI0_E11341g"
FT                   /old_locus_tag="YALI-IPF2686"
FT                   /old_locus_tag="YALI-CDS1451.1"
FT                   /product="YALI0E11341p"
FT                   /note="similar to uniprot|P38694 Saccharomyces cerevisiae
FT                   YHR039c"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11341g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79406"
FT                   /db_xref="GOA:Q6C697"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C697"
FT                   /protein_id="CAG79406.1"
FT                   /translation="MEYAETAWSAVEEAWLDLDQYINLRDLQSLSSGSLQWENILLVST
FT                   TISVTVTLILATQRWFFGYKNAAEKPAVIHVRTPDQALPHWKGIRMDPPTLRSQEEPDM
FT                   IQCYCPATGQFLGATPASTLLDIDAAIECAAAAQCQWNPSFSARNKVLKTIRKFLLENQ
FT                   EVVARVACRDTGKTMIDASMGEIMVTLEKINWLIKNGERALQPSSRPGSSNPLMFYKAA
FT                   KVVYEPLGVVAALVSWNYPLHNLMGPILASLYAGNAVIIKCSESVVWSSQYFVQIAREA
FT                   LQACGHSPDLVQLVCCWPETANHLTSHPQISHVTFIGSKPVAHKVAAAAAESLVPLVVE
FT                   LGGKDPCVVFDDDGLDLKTIAHTILRGTFQAAGQNCIGFERVIAQPSAYKTLLDIFRET
FT                   IPKLRVGAGIDQQDDVDVGACISNMHFDRLEELIADAVAQGAELVAGGHRYPHPKYPQG
FT                   HYFQPTLLVGVTADMEIAQTEVFGPVLTMMQAETVDQAIDLANSTIYGLGAAVFGANTV
FT                   TLRKAINDIKSGNIAVNDLAAFYVCQLPFGGCKGSGYGKFGGEEGLQGLCLAKSVAFDS
FT                   VPFCKTTLPRPLQYPIPSAVKGWEFVKNVNIAGYGVGLWKRFKSLVSLGKSA"
FT   gene            complement(<1387953..>1388692)
FT                   /locus_tag="YALI0_E11355g"
FT                   /old_locus_tag="YALI-IPF13451"
FT   CDS_pept        complement(join(1387953..1388215,1388280..1388361,
FT                   1388690..1388692))
FT                   /locus_tag="YALI0_E11355g"
FT                   /old_locus_tag="YALI-IPF13451"
FT                   /product="YALI0E11355p"
FT                   /note="similar to uniprot|P48836 Saccharomyces cerevisiae
FT                   YHR039ca VMA10 H+-transporting ATPase V0 domain 13 KD
FT                   subunit vacuolar"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11355g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79407"
FT                   /db_xref="GOA:W0TYM5"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYM5"
FT                   /protein_id="CAG79407.4"
FT                   /translation="MSAQNSKEIQKLLQAEKKAHEIVQKARGYRTQKLKDAKTDAAADI
FT                   EAYKKKKEEDFSKTKNADSGSNTKAEAEAEESAKSELAEIKKAGEKAEKDVLKKLIDEV
FT                   LTPKPIVHINA"
FT   gene            <1388910..>1390034
FT                   /locus_tag="YALI0_E11363g"
FT                   /old_locus_tag="YALI-IPF2688"
FT                   /old_locus_tag="YALI-CDS3526.1"
FT   CDS_pept        1388910..1390034
FT                   /locus_tag="YALI0_E11363g"
FT                   /old_locus_tag="YALI-IPF2688"
FT                   /old_locus_tag="YALI-CDS3526.1"
FT                   /product="YALI0E11363p"
FT                   /note="weakly similar to uniprot|P38772 Saccharomyces
FT                   cerevisiae YHR040w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11363g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79409"
FT                   /db_xref="GOA:Q6C696"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C696"
FT                   /protein_id="CAG79409.1"
FT                   /translation="MHELKRFTIQKKEKNHTHTHTHTHTQTTTHSMSCSICQQESKYRC
FT                   PACSARTCSLACSKQHKASEKCSGLPDPTKYLNREALFTDTSVNRDYRFLKRLERDIVV
FT                   RKQDGESMPIFKRARYNQNRKDGKDGSVMERNGVKIHKVAQGMGRQKRNHSRWDPNIKQ
FT                   FCWTVEWVNVDTNETMTVDKVNPVQSLLECFQKRGSEKGGNGDNKGERKVEKNDTEQTE
FT                   MKDEHSKQKDGDKKDEEKEVVPLTPRSFYMKRIKSKNTSPILLDPSKPLSENLKDKSVV
FT                   EYPTIYYTNEEIVASDSDSDSDSDSDSDSGSDDSDDSDDSDDDSDDDSDSAPEEESARQ
FT                   PEMPDIVKTLADSAVNDMAGLEDAFEKAQEEGKQ"
FT   gene            complement(<1390086..>1390865)
FT                   /locus_tag="YALI0_E11385g"
FT                   /old_locus_tag="YALI-IPF2689"
FT                   /old_locus_tag="YALI-CDS4806.1"
FT   CDS_pept        complement(1390086..1390865)
FT                   /locus_tag="YALI0_E11385g"
FT                   /old_locus_tag="YALI-IPF2689"
FT                   /old_locus_tag="YALI-CDS4806.1"
FT                   /product="YALI0E11385p"
FT                   /note="weakly similar to uniprot|P38772 Saccharomyces
FT                   cerevisiae YHR040w"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11385g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79410"
FT                   /db_xref="GOA:Q6C695"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C695"
FT                   /protein_id="CAG79410.1"
FT                   /translation="MAETQKFEKVQPGGSLIVAWQARGKRCLVVGGGEVASGRVLALLN
FT                   ADAEVVVVSPAITNAELENRRELKEFIWIKAPYNDDHLTAEDNYNLVLSCLDDPEVSDQ
FT                   VWRRAVSLKIPVNVADVPAKCDFYFGSIYRDGPLQIMISTNGKAPGLARKIRKEITNIF
FT                   EDKEAEEGEGESDSMITKAIDNVGKIRQAVRNVVKCDIKARMAFVSGICEKWSFKQISL
FT                   LNDDSIADLIAHFPDIPKYEDLDSQTAEVPIHTLKLA"
FT   gene            <1392090..>1394165
FT                   /locus_tag="YALI0_E11407g"
FT                   /old_locus_tag="YALI-IPF2692"
FT                   /old_locus_tag="YALI-CDS1188.1"
FT   CDS_pept        1392090..1394165
FT                   /locus_tag="YALI0_E11407g"
FT                   /old_locus_tag="YALI-IPF2692"
FT                   /old_locus_tag="YALI-CDS1188.1"
FT                   /product="YALI0E11407p"
FT                   /note="weakly similar to uniprot|Q8J2U0 Aspergillus oryzae
FT                   MOXY monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11407g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79411"
FT                   /db_xref="GOA:Q6C694"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C694"
FT                   /protein_id="CAG79411.1"
FT                   /translation="MRRLKYNFQSVYIQTRLRQFKHISPSTTPIGYIWLAHHVPDHPTH
FT                   PSGNPRLVIYTFSTTKMPTGQELYDSLPNLHFPDEPNTAAEEILKRDFAGHRKVRAVVV
FT                   GGGLAGITLGTILPRKLDNLDLVIYERWPETGGVWHRNTYPGVKCDIPSHNYQLSFDPK
FT                   TDWSATYAPGQEIKSYWQGIEKKYGVDKLIKTNHDIQSADWDAEKGKWIFKIKDLNTNT
FT                   EFTDEAEFFIQATGILNNARYPPYQPGFDDFQGPKFHPSQWPKDLSLKGKRVALIGNGA
FT                   SGVQILPQLLAQGVSHVDHYAKRGTWISQHVFGKHLPPHREYSPEEIAELRNTEKYHKF
FT                   RKDLETRGQGNIASDVYGSEQNRQQLNAFLLLMYERLGGDEELFKKVVPDYAPGSRRFL
FT                   PAPGYLEALTDPRVSYHLGTVKSFTKTGVVGADDVERPTDIIVASTGYTRANGESHAPN
FT                   FEVTGLDGTNLKEHFSGAGSKLGYTNNYYGITSPHFPNYFYVLAQNSYLFCGPAPIAAE
FT                   LWSTYISKVIRKVQLENIKSLVVSEKAALGFSRVVTELSKASSTSRGIDGFFVEKTKDG
FT                   EYRIALAWPGTITHAVTLLREPRWEDYEYEYLDNDNPFSFFGNGHTFLDFAPKGDKTFF
FT                   VQTGVPPKLLHEEYLTIPRDHVAEGYEYDGTGDFLKNHHVGLDDDEDVEQAKEVSL"
FT   gene            <1395771..>1397753
FT                   /locus_tag="YALI0_E11429g"
FT                   /old_locus_tag="YALI-IPF2693"
FT                   /old_locus_tag="YALI-CDS1298.1"
FT   CDS_pept        1395771..1397753
FT                   /locus_tag="YALI0_E11429g"
FT                   /old_locus_tag="YALI-IPF2693"
FT                   /old_locus_tag="YALI-CDS1298.1"
FT                   /product="YALI0E11429p"
FT                   /note="weakly similar to uniprot|Q9P4F1 Aspergillus
FT                   parasiticus MOXY monooxigenase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11429g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79412"
FT                   /db_xref="GOA:Q6C693"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C693"
FT                   /protein_id="CAG79412.1"
FT                   /translation="MTISKPPSPNNLDNAGITSSSQAGRGHTNVTGVDKEALWNEFDFL
FT                   KNLEPPSEWAETILNREYHGRRPVKVVISGAGLSGITTGILINGKVDDVDLTILERNEE
FT                   AGGVWFKNTYPGVRCDVPSHSYQLSFDPKTDWKSVYAYGEDIKKYWQSRAEKYGISDKI
FT                   KTQQNILEAKWDQEDGQWHILVEDLTKPHQDQYTVKADFFISSSGTLNQPRYPPTQPGY
FT                   DKFKGEKFHPVNWPKGLSLEGKRVALIGNGATGVQLLPQIALQAAHVDHYTKRGVWIGH
FT                   SLYGSRVPGYVDYTQEEIDEIQQSSEYHKFRKQLDEALLGNYGGSFFGTESYKGLIKEL
FT                   LAIMFIRVGKDLELFKKVVPNYPPGARRLLPAPGYLEALTRENVSYHLGDIQEFTEKGI
FT                   IGPDGVEREVDVIIASTGYVRDDGAGVTPNYEIYGQEGYTLRQHFNPPESKLGYSACYL
FT                   GLAAPHFPNFFYTLSVNSYIYCGTAPFGVELQATYIAKAIRKAQLEDIKSLVPSVRASV
FT                   LFNRRINEFSKTSCVCRGIDGYYTERDTEGNVRLKGSWPGTMTHALSMLREPRWEDYDY
FT                   EYLNPDDPFSYFGSGKTWIDDHDGDKTFYLTEPGKVSVRNVHEGWVSLSRHHAPNCSHN
FT                   ADEHIEDGPKANGHVNGLKSKVNGV"
FT   gene            <1399046..>1400389
FT                   /locus_tag="YALI0_E11451g"
FT                   /old_locus_tag="YALI-IPF2694"
FT                   /old_locus_tag="YALI-CDS2821.1"
FT   CDS_pept        1399046..1400389
FT                   /locus_tag="YALI0_E11451g"
FT                   /old_locus_tag="YALI-IPF2694"
FT                   /old_locus_tag="YALI-CDS2821.1"
FT                   /product="YALI0E11451p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11451g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79413"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C692"
FT                   /protein_id="CAG79413.1"
FT                   /translation="MYKTRAAFDTISPPQLAPDGPERSLDLPFYSLAAKHPGVKLSYHA
FT                   RTVLFSYTGKQQADNALKWLMDELIEDNDELVCLKIIDKHSAKDVEKYHKQAADILRAV
FT                   VAEADKVGKKLTIDVELGQGSVSKVVKHCTYLYQPALAVVARTNYIDPRVSEMPKDTAT
FT                   NYLLRSSVVPVIVVRPPMIDKWQERKKAHANDQPPFTVPWLIHDPRITVPKDYETQQGL
FT                   LENPSFKLDDLKLLQHYQIDYKKQPTGTSLQVPSTAPNRRMSSNASQSPSNMRTPAPET
FT                   LSAPTSPAQMRTNSVGGGGLPHPMYKADGFLQLPPDSSALKKQQQRRKSTLLLDDEPPK
FT                   PPPTPADRYDENALDDSSPERDNSGSQPPSSRTISIVHPEKPERSRSRGKDNLRPSLSL
FT                   TRTLSSSSMSSDSSKSSHKWGLGWLKGKSSKKKKGGSSGNSLKPSVTN"
FT   gene            complement(<1400671..>1403070)
FT                   /locus_tag="YALI0_E11473g"
FT                   /old_locus_tag="YALI-IPF2696"
FT                   /old_locus_tag="YALI-CDS0842.1"
FT   CDS_pept        complement(1400671..1403070)
FT                   /locus_tag="YALI0_E11473g"
FT                   /old_locus_tag="YALI-IPF2696"
FT                   /old_locus_tag="YALI-CDS0842.1"
FT                   /product="YALI0E11473p"
FT                   /note="similar to uniprot|P50505 Debaryomyces occidentalis
FT                   HAK1 high affinity potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11473g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79414"
FT                   /db_xref="GOA:Q6C691"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C691"
FT                   /protein_id="CAG79414.1"
FT                   /translation="MAPEERERATLDSDVPVEMINGINYRDVESHQVAESTTKRAMKLG
FT                   MLAFSSLGAVYGDLATSPLYTLNSIFPEDPTEKETMGAVSCIFWGLTIVVLFKYAIIVF
FT                   AFGPNNGEGGIVAIYAKIARELNLGQRGSASTNPEDDLIQLQKSETQGSWAASGNHKTD
FT                   DMWNNKVWRAVAPFLRIMPLFLCLLGSSFLMSDGLLTPVQSVLSAIEGIEIPQPSMQKH
FT                   VVLISCFIIVFIFVFQRLGSAKLSMVCSPILFVWLISLGVIGIYNITYHPAILKATNPK
FT                   YAIDYLKAGGIDSMGNVILCLTGTEAMFADVGHFSPWAIRLSVLVLVYPMCALAYFGQG
FT                   ARMVLEPSLMKNIFYLTIPGPQNGGLYWFIFVLALLSTIIASQSIILGVFSISKQLIQL
FT                   DCMPNFPVVHTSEKIYGKVYVPILNYFLLVCCVLATIGFKNSNNTASAFGLCVAVDFFI
FT                   TTVMISMSIVLVHKHHWVWGILMLFSFGLLDMTFVAAEMKKVPSGAWFPLMMGVIFISV
FT                   MLLWRWGNGERMKYEFDHRVPMRRLFERKKPRPSHIQSLNLGTKEKYAQNFDDSIETVS
FT                   DDNVSELDLGVKEKKDVQVRHREINAATNAAPIPRYPGMSIFYNNLRFTLRSPNTVPGV
FT                   FKTFVDSFPTLSEHVVLLAIRIATVPRVKPEDRVKIVPVPGVDGLFRGVVSFGFVESAK
FT                   MTPELEDEIAARVGYTIDGYNEDRKVVHVFNKQLCYGAGYDKDDYANRGKVARTAIYSA
FT                   IWCRRMLIDWIYGPAEYFFNASDRVVKIIVKDPSSTPISVTTAAYI"
FT   gene            complement(<1404519..>1407128)
FT                   /locus_tag="YALI0_E11495g"
FT                   /old_locus_tag="YALI-IPF2698"
FT                   /old_locus_tag="YALI-CDS0671.1"
FT   CDS_pept        complement(1404519..1407128)
FT                   /locus_tag="YALI0_E11495g"
FT                   /old_locus_tag="YALI-IPF2698"
FT                   /old_locus_tag="YALI-CDS0671.1"
FT                   /product="YALI0E11495p"
FT                   /note="similar to uniprot|P15274 Saccharomyces cerevisiae
FT                   YML035c AMD1 AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11495g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79415"
FT                   /db_xref="GOA:Q6C690"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C690"
FT                   /protein_id="CAG79415.1"
FT                   /translation="MPQQAMDIKGKAKSVPMPEEDDLDSHFVGPISPRPHGADEIAGYV
FT                   GCEDDEDELEELGMLGRSASTHFSYAEERHLIEVDAKYRALHGHLPHQHSQSPVSRSSS
FT                   FVRAEMNHPPPPPSSHTHQQPEDDDASSTRSRSSSRASGRKFNRNRTKSGSSLSKGLQQ
FT                   LNMTGSLEEEPYESDDDARLSAEDDIVYDATQKDTCKPISPTLKRTRTKDDMKNMSIND
FT                   VKITTTTEDPLVAQELSMMFEKVQYCRDLRDKYQTVSLQKDGDNPKDDKTHWKIYPEPP
FT                   PPSWHETEKRFRGSSKKEHQKKDPTMDEFKFEDCEIPGPNDMVFKRDPTCVYQVYEDES
FT                   SLNENKPFVAIPSIRDYYMDLEDLIVASSDGPAKSFAFRRLQYLEAKWNLYYLLNEYTE
FT                   TTESKTNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKYKMKNCPDEVVIHRDGRELTL
FT                   SQVFESLNLTAYDLSIDTLDMHAHKDSFHRFDKFNLKYNPVGESRLREIFLKTDNYIQG
FT                   RYLAEITKEVFQDLENSKYQMAEYRISIYGRSKDEWDKLAAWVLDNKLFSPNVRWLIQV
FT                   PRLYDIYKKAGLVNTFADIVQNVFEPLFEVTKDPSTHPKLHVFLQRVVGFDSVDDESKL
FT                   DRRFHRKFPTAAYWDSAQNPPYSYWQYYLYANMASINTWRQRLGYNTFELRPHAGEAGD
FT                   PEHLLCTYLVAQGINHGILLRKVPFIQYLYYLDQIPIAMSPVSNNALFLTFDKNPFYSY
FT                   FKRGLNVSLSSDDPLQFAYTKEALIEEYSVAALIYKLSNVDMCELARNSVLQSGFERII
FT                   KEHWIGENYEIHGPEGNTIQKTNVPNVRLAFRDETLTHELALVDKYTNLEEFERLHG"
FT   gene            complement(<1409591..>1409709)
FT                   /locus_tag="YALI0_E11506r"
FT                   /old_locus_tag="YALI0E11511r"
FT   rRNA            complement(1409591..1409709)
FT                   /locus_tag="YALI0_E11506r"
FT                   /old_locus_tag="YALI0E11511r"
FT                   /note="5S RNA"
FT   gene            complement(<1409924..>1410598)
FT                   /locus_tag="YALI0_E11517g"
FT                   /old_locus_tag="YALI-IPF2700"
FT                   /old_locus_tag="YALI-CDS5191.1"
FT   CDS_pept        complement(1409924..1410598)
FT                   /locus_tag="YALI0_E11517g"
FT                   /old_locus_tag="YALI-IPF2700"
FT                   /old_locus_tag="YALI-CDS5191.1"
FT                   /product="YALI0E11517p"
FT                   /note="weakly similar to uniprot|Q8TFK5 Yarrowia lipolytica
FT                   CWP1 Cell wall protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11517g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C689"
FT                   /protein_id="CAG79416.1"
FT                   /translation="MKFSAVLLASAAALVSAKKFTIVAIRSGSDIQNSPVVSDGKKLVL
FT                   GGDGGIPTTYEVKDGVLYANDKPVQFGNGATIEDGEGQGTDGVTVDGQDHLYVPNYTFT
FT                   ACAAQGRAYKYTVTSSEDCNQGATPFAARVIYQDEDSKTESAAAAGNGTVVTKTGVVTA
FT                   QSTALVTITSCEDDKCHKPTGEPSQPAQATEPTTGPAQANGAAAFGVSVAAAGVAAAAL
FT                   LI"
FT   gene            <1414116..>1417008
FT                   /locus_tag="YALI0_E11539g"
FT                   /old_locus_tag="YALI-IPF42016"
FT   CDS_pept        join(1414116..1414143,1414220..1416417,1416469..1417008)
FT                   /locus_tag="YALI0_E11539g"
FT                   /old_locus_tag="YALI-IPF42016"
FT                   /product="YALI0E11539p"
FT                   /note="weakly similar to uniprot|Q03707 Saccharomyces
FT                   cerevisiae YML034W SRC1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11539g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79417"
FT                   /db_xref="InterPro:IPR018996"
FT                   /db_xref="InterPro:IPR025856"
FT                   /db_xref="InterPro:IPR041885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C688"
FT                   /protein_id="CAG79417.2"
FT                   /translation="MDSYEYLTEGFDPKSLRIADLRRIFAHHDIEYNVSGKKAEMISVF
FT                   RNEISPRAAELYAREIATPGGEGIVDAGAPKIKSKKEGKEKKEKKEDKEKTTRAPAKRR
FT                   VTSRNKTPELQAPDEIQVRRSPRRSPSKQDISLDLDEVLASPKKKKASLDSPKKKVGRP
FT                   RKIKEPSPEPESEEEEEAEEIIEQVKTTRKLELDDIPVIAAPKQQRQPSGYAVDDDEVV
FT                   EMDEQEVAELIAPIVDQSPKKSPKKNKRRLSQPVVDPERSDNEDARPKKKKLSKEEKEA
FT                   KALRKEKKRKEKEALARKVFSFEDAETAESKLLGEEDEVADFEYKKVDTPLKVKKEEDS
FT                   ADSPFTSQNVFQSGGTPDKKRKRKSEVAENSARKVRKAEEDDDFNASLDQTFASVPEAF
FT                   SGLGGAAQIPSLSPPASFFSHQQQPTTATSQTPSSSTQFSSPPHSTSNSRINRFMFSSP
FT                   EERDDENVNVVSSTPPLPVASSSQNTRQSFMPGLDELNLSSKFAEELRKQKEEELNDDD
FT                   DEEEEVDVKSKGKETTSITKTKTKNKPVVFKAKKPSVLSKIDFKAVIFNLLKLVTIGAL
FT                   ISGLVIAGGWYRKEKFAVGYCGTGEHAQALSKYDEFIEFWKEVLPPCTPCPENAECYRG
FT                   FELECHEGFVAEAHPLSFNGFLPLPPKCVYDTRIVSVAQQVLDYLRLQNSYAECGSPES
FT                   EATGFDVQVKTEFTYDELYDYGRKNVHAFDDKVWAQAMKAVGEQEDIIIGSIRISESQR
FT                   ATRLVEGEPEVYYEDVVVAQETYKSISDAYFTLRCKCDKFVRGWLAQNQFYILGVLIAA
FT                   SAAIVGKEWYNQRKREQQHVSELVNQVNEMMMTQAREHDADSTGLKQPRFLPVPQLRDE
FT                   LLVDTATSKRKASLWKKVADTVEQNANVESQTKEVRGEVTRVWEWVGNLN"
FT   gene            complement(<1417100..>1418320)
FT                   /locus_tag="YALI0_E11561g"
FT                   /old_locus_tag="YALI-IPF2705"
FT                   /old_locus_tag="YALI-CDS3171.1"
FT   CDS_pept        complement(1417100..1418320)
FT                   /locus_tag="YALI0_E11561g"
FT                   /old_locus_tag="YALI-IPF2705"
FT                   /old_locus_tag="YALI-CDS3171.1"
FT                   /product="YALI0E11561p"
FT                   /note="similar to uniprot|CAD70713 Yarrowia lipolytica
FT                   lipase LIP4"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11561g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79418"
FT                   /db_xref="GOA:Q6C687"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C687"
FT                   /protein_id="CAG79418.1"
FT                   /translation="MTFTIGIMNLTLGQVVAYLYASLFGEPPATLSKTRVQASQELYNF
FT                   TAKFSRIANIAYCVNAPVTPLRTDFTCGESCRYFPNMTLDSVFGGDFYSTSITGYIAYD
FT                   HLNKEKYVVIRGTFSIPDAVTDIQFQQSPWLVELPKHLIPTQDDMKQRWAVRPDLEVEN
FT                   KGLDNLKERALVVEDPRLIPIKTSECKGCMIHDGFAKAFNETMVNAAPQFEKFLTNHTD
FT                   YKMYVTGHSLGAAQALLFATHFKLLGHDPTMINFGQPRVGNSEFANYINQLWFNDTGLE
FT                   VNDKRRNYRLTHWNDIFVGLPDWSNYTHAIGEVYIDQESVYPALDKVSVCEGGENEACH
FT                   RGTFNLWSRIDLLQNHLAYIYYIGYCALNIGRRNVLAMPKYHGNNSYKYATEPGYTGPG
FT                   RTLVPTN"
FT   gene            <1420702..>1421646
FT                   /locus_tag="YALI0_E11583g"
FT                   /old_locus_tag="YALI-IPF2706"
FT                   /old_locus_tag="YALI-CDS4210.1"
FT   CDS_pept        1420702..1421646
FT                   /locus_tag="YALI0_E11583g"
FT                   /old_locus_tag="YALI-IPF2706"
FT                   /old_locus_tag="YALI-CDS4210.1"
FT                   /product="YALI0E11583p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11583g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C686"
FT                   /protein_id="CAG79419.1"
FT                   /translation="MDNATMTSYRSAIDHNHYGQPETIPLGVLQPSSNRLNCKTAESVY
FT                   KTKPQLNSAPINQPSLTSTRWDGSAVMTTAQKMTSPQYVTYGDGVDPVDLSTNFTSMDN
FT                   DPGPTSICMVKPSDLRQTSVSKSIMEQYRSQIRREKEAVEEQDYSTIRSVTFHPVEDLR
FT                   IYEPLTGEHSENTFFPSPGSGSKVPRRLENGAARMEQQGSHLENSLFLSKMYRSPTPLE
FT                   SYSPVHMLEYGGSIHLGDSGWGPYGNKKSYTMKSTASMPRYMKDTISYRNKKRSKHDTQ
FT                   NGTEKGTRKGQDRDSAKGVGRKAKRDLLDFFRR"
FT   gene            complement(<1422030..>1422575)
FT                   /locus_tag="YALI0_E11605g"
FT                   /old_locus_tag="YALI-IPF2707"
FT                   /old_locus_tag="YALI-CDS5664.1"
FT   CDS_pept        complement(1422030..1422575)
FT                   /locus_tag="YALI0_E11605g"
FT                   /old_locus_tag="YALI-IPF2707"
FT                   /old_locus_tag="YALI-CDS5664.1"
FT                   /product="YALI0E11605p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11605g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79420"
FT                   /db_xref="GOA:Q6C685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C685"
FT                   /protein_id="CAG79420.1"
FT                   /translation="MIRTIARSTRVARPATRAYSTAPHPVAVPPAPTKIQPAANYSAQA
FT                   KTAAVENAAANTANNAANTVNNAANNAANAASNAASNVSSAAQGASTGAQATAKAAQAG
FT                   ATIGSSAQKLKPRKKSSVRGTLLGFLLGTTLTGFGAYSYLVDQYRQANNVIIADVIALN
FT                   GSIRNLEEQVKQLQLKKD"
FT   gene            complement(<1423277..>1424509)
FT                   /locus_tag="YALI0_E11627g"
FT                   /old_locus_tag="YALI-IPF2709"
FT                   /old_locus_tag="YALI-CDS3131.1"
FT   CDS_pept        complement(1423277..1424509)
FT                   /locus_tag="YALI0_E11627g"
FT                   /old_locus_tag="YALI-IPF2709"
FT                   /old_locus_tag="YALI-CDS3131.1"
FT                   /product="YALI0E11627p"
FT                   /note="similar to uniprot|P28868 Candida albicans GPA1
FT                   Guanine nucleotide-binding protein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11627g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79421"
FT                   /db_xref="GOA:Q6C684"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C684"
FT                   /protein_id="CAG79421.1"
FT                   /translation="MGCVPSKPEYGAEHDQHLLIEENMRFRVGKLSSSRSFDDSKPPKL
FT                   LLLGTGESGKSTILKQMKLIHGQGFTHQERSLYAQVMWEQAFVQMMEIVRQARFLGISL
FT                   DCDDPHSVLNSHMTLLTNADPNDSAMPDWDALYEDIKSQRRFMEGENLPMVYTDSPLKF
FT                   ADNVLKVSPAERPQIAHAISELWTKDTGIKQCFARSNEYQLEDAASYYFDNVHSLADPY
FT                   YLASDEDVIRGRIKTTGVSETPFLVGGQMLSIIDVGGQKSERKKWMHCFDDVTSVLFVV
FT                   ALSEYDQVLYEDSGVNRMQDSICLFDYICNFKTFIDKPIILFLNKCDLLEAKLKKSPVR
FT                   KYFPSFNGPNEVTAVKAFFKNLFLAQNKCGPSKEIYVHFTCATDTENMRFVMAAVTDMV
FT                   LSAQLRETGII"
FT   gene            complement(<1424976..>1425371)
FT                   /locus_tag="YALI0_E11649g"
FT                   /old_locus_tag="YALI-IPF19626"
FT   CDS_pept        complement(1424976..1425371)
FT                   /locus_tag="YALI0_E11649g"
FT                   /old_locus_tag="YALI-IPF19626"
FT                   /product="YALI0E11649p"
FT                   /note="similar to KLLA0A06710g Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11649g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79422"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C683"
FT                   /protein_id="CAG79422.1"
FT                   /translation="MSKHDREQHALYLKDQIQGLEEVIPDQQEEVDSNQENYDEAMEKV
FT                   EAAQLEADEYKGHLDDAVARLEGSQEELDEYKRELRDLEHEGKKKAKLDHDQDNDDSDD
FT                   EEEGDEEEEEEGDEDEEDIEGAFVIKF"
FT   gene            <1426147..>1426893
FT                   /locus_tag="YALI0_E11671g"
FT                   /old_locus_tag="YALI-IPF2710"
FT                   /old_locus_tag="YALI-CDS4924.1"
FT   CDS_pept        1426147..1426893
FT                   /locus_tag="YALI0_E11671g"
FT                   /old_locus_tag="YALI-IPF2710"
FT                   /old_locus_tag="YALI-CDS4924.1"
FT                   /product="YALI0E11671p"
FT                   /note="similar to uniprot|P38858 Saccharomyces cerevisiae
FT                   YHR163w SOL3 possible 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11671g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79423"
FT                   /db_xref="GOA:Q6C682"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C682"
FT                   /protein_id="CAG79423.1"
FT                   /translation="MPKVISKNESQLVAEAAAAEIIRLQNESIAATGAFHVAVSGGSLV
FT                   SALRKGLVNNSETKFPKWKIFFSDERLVKLDDADSNYGLLKKDLLDHIPKDQQPQVFTV
FT                   KESLLNDSDAVSKDYQEQIVKNVPLNGQGVPVFDLILLGCGPDGHTCSLFPGHALLKEE
FT                   TKFVATIEDSPKPPPRRITITFPVLKAAKAIAFVAEGAGKAPVLKQIFEEPEPTLPSAI
FT                   VNKVATGPVFWFVSDSAVEGVNLSKI"
FT   gene            complement(<1427233..>1429119)
FT                   /locus_tag="YALI0_E11693g"
FT                   /old_locus_tag="YALI-IPF2713"
FT   CDS_pept        complement(1427233..1429119)
FT                   /locus_tag="YALI0_E11693g"
FT                   /old_locus_tag="YALI-IPF2713"
FT                   /product="YALI0E11693p"
FT                   /note="some similarities with uniprot|Q7S2G7 Neurospora
FT                   crassa NCU08891.1 predicted protein (40940 - 37571)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11693g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79424"
FT                   /db_xref="GOA:Q6C681"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C681"
FT                   /protein_id="CAG79424.1"
FT                   /translation="MTPIRSIEPQPVRPSHGPHHALPQLAIHPQLRSNEQAPSRPIAPP
FT                   TQQSAPPKLALKPVAQTPQASQPQIQSNGPPPVLQPRPLPRLGSSSSSSSPPPVSALKP
FT                   RHVKMEDDLDMGMLSQNSSMSYSIGVSPEITNIVTSKEWVLPPRPKPGRKPSNDLPPTK
FT                   RKAQNRAAQRAFRERRAARVVELEDKLQEVEQEHDEVENDLRAALQNSNTENNKLRAVI
FT                   EELRSEVEMLRALKTQDSRESLYGFVDANPLAVRSSMFPMSERARQQREMEKERKSNLD
FT                   KENENEKKPVAILPKARPPRKRRESVITIADDTPGAQTANNSTGHHHHQHQHNHHDITP
FT                   MKPDEEPDDCGLCETGGNCLCDTLGLKAPLPAEDQNTYIVGGVNLSEIKPVAAVPLKKR
FT                   PASNGTSMIIRKRFKRVSEANEIDFTKTFGSKPTTPPVPEPVHVHGPDCKHSKTQVAKI
FT                   SRTPSISSLNSPVDSNFVDKPSPQVDPCGFCSNGTPCLCAGLDEEEGAEKPCSSALKPD
FT                   KPEVIEITDHAVDQVANEMAEVSVTEEDLSSCLCAKDPKANLFCTVLKTSARPCAESSS
FT                   PVLVPCTDAYNILSGHARFANSSLGTLVSMLRTRNGKVDVDSLYAALGTLDE"
FT   gene            complement(<1429921..>1431102)
FT                   /locus_tag="YALI0_E11715g"
FT                   /old_locus_tag="YALI-IPF2715"
FT                   /old_locus_tag="YALI-CDS3319.1"
FT   CDS_pept        complement(1429921..1431102)
FT                   /locus_tag="YALI0_E11715g"
FT                   /old_locus_tag="YALI-IPF2715"
FT                   /old_locus_tag="YALI-CDS3319.1"
FT                   /product="YALI0E11715p"
FT                   /note="weakly similar to uniprot|P12630 Saccharomyces
FT                   cerevisiae YIL015w BAR1 Barrierpepsin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11715g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79425"
FT                   /db_xref="GOA:Q6C680"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C680"
FT                   /protein_id="CAG79425.1"
FT                   /translation="MKSTFFLSTLTSLSLASANYLRAAGEYEDFQFLMLNISVGNPAVQ
FT                   VSIEVDTGSSETWFNPLSTGFKPESSASYVNTSVPMHLEYADGRKFDGFMAKERLIIAG
FT                   GIISDANIGVAEYPHPTHPRHRPQTGFMGLGLEEGEMVNPRYPNLLSQMRSQGIIRRRS
FT                   FGVYIDANQRAEVLFGGYDQDRIKGELRFTKMVNNRLNRIKDSPKPYEYDTLITSIMRN
FT                   GKDILRRPGSRPKCVETFDAHFDTGYTLITVPRHVFDVIQADFGAQNIQQEGFADYQMD
FT                   CNVPASNFKYTFDFNGVSVDVPAKALMMPVEQHSDDKCRLLIAPSLNSKTDNRLVMGLP
FT                   FFRAAYVYFDPEDYRIGLAEQNIHATGDPHIVTAGPSYGPSCWINVNGLRKCN"
FT   gene            <1431742..>1432653
FT                   /locus_tag="YALI0_E11737g"
FT                   /old_locus_tag="YALI-IPF2716"
FT                   /old_locus_tag="YALI-CDS4344.1"
FT   CDS_pept        1431742..1432653
FT                   /locus_tag="YALI0_E11737g"
FT                   /old_locus_tag="YALI-IPF2716"
FT                   /old_locus_tag="YALI-CDS4344.1"
FT                   /product="YALI0E11737p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11737g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79426"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C679"
FT                   /protein_id="CAG79426.1"
FT                   /translation="MKRDKNKTDGDTDSTDSTPDDTTATDDMTDDVHDLYATDATSPQV
FT                   DGDVDQSDVKTPGDTVTQERDTDAGSDTETESDNDAEPLLSPSQPHNVHKYRGVLHCGV
FT                   CSKVVKHGVQVRPLPCKDHVIHTECVTGNNQLPSKCMSQKCSPSSNTSTSSDASPNMAL
FT                   PKVILTVQDFERDYPVTHFLPTESEVTYCLVCQGIVNPPTQVRTMPCGHKAHASCIPAP
FT                   LAVPDKCRFCRRDNHYRREQELLDGYDPALYANQNLPVYPGRSDEGEDDDSPPPAHSPP
FT                   PPGAELGLPTYEEATEWTEETK"
FT   gene            complement(<1432751..>1432846)
FT                   /locus_tag="YALI0_E11759r"
FT   tRNA            complement(join(1432751..1432796,1432808..1432846))
FT                   /locus_tag="YALI0_E11759r"
FT                   /product="transfer RNA Ser (TGA) cove"
FT   gene            <1434234..>1434782
FT                   /locus_tag="YALI0_E11803g"
FT                   /old_locus_tag="YALI-IPF2717"
FT                   /old_locus_tag="YALI-CDS5656.1"
FT   CDS_pept        1434234..1434782
FT                   /locus_tag="YALI0_E11803g"
FT                   /old_locus_tag="YALI-IPF2717"
FT                   /old_locus_tag="YALI-CDS5656.1"
FT                   /product="YALI0E11803p"
FT                   /note="weakly similar to uniprot|P38116 Saccharomyces
FT                   cerevisiae YBR164c ARL1 ADP-ribosylation factor"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11803g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79427"
FT                   /db_xref="GOA:Q6C678"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C678"
FT                   /protein_id="CAG79427.1"
FT                   /translation="MEWFKNIYEWLLSLFWSTELDITLLGLQNAGKTSLLKAICGSDFT
FT                   PDSIPTVGFAMKRVKVGRVTLKCWDLGGQPRFRSMWERYCRGVNAVVFILDSADPSTFD
FT                   TAKTELHSLLEKESMEGIPLLVLGNKNDIADAIPVDKVIQTLGLKEITDREVSCYSISV
FT                   KEANNLSAVLKWLIANRKT"
FT   gene            complement(<1435236..>1436015)
FT                   /locus_tag="YALI0_E11825g"
FT                   /old_locus_tag="YALI-IPF2720"
FT                   /old_locus_tag="YALI-CDS4807.1"
FT   CDS_pept        complement(1435236..1436015)
FT                   /locus_tag="YALI0_E11825g"
FT                   /old_locus_tag="YALI-IPF2720"
FT                   /old_locus_tag="YALI-CDS4807.1"
FT                   /product="YALI0E11825p"
FT                   /note="similar to uniprot|P32854 Saccharomyces cerevisiae
FT                   YOR036w PEP12 syntaxin"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11825g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79428"
FT                   /db_xref="GOA:Q6C677"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C677"
FT                   /protein_id="CAG79428.1"
FT                   /translation="MDLENQKVPFQQVTTELSDSLQTISADVAKLDRFVSWIGTRKDGD
FT                   TNRGRVTDLAEKITADIKTMHANVRRLNMFPEAELSNTEQFAQKRLSNEFGLLLSRFQN
FT                   LQHQSTDAYKRQDTAARAALEEERSEQDRLLAAKPMGMNNTNYGGLQDQLLDVVDQSEV
FT                   DLQQVLIAEREEDIRGIEQGINDINGIYRDLGALIAHQGEQMDSVENNISTVADQTSAA
FT                   AGELVKANDYQKKRRTCSLIVLGIMILALIIILAVAA"
FT   gene            <1437511..>1439133
FT                   /locus_tag="YALI0_E11847g"
FT                   /old_locus_tag="YALI-IPF2722"
FT                   /old_locus_tag="YALI-CDS2021.1"
FT   CDS_pept        1437511..1439133
FT                   /locus_tag="YALI0_E11847g"
FT                   /old_locus_tag="YALI-IPF2722"
FT                   /old_locus_tag="YALI-CDS2021.1"
FT                   /product="YALI0E11847p"
FT                   /note="similar to DEHA0E05885g Debaryomyces hansenii
FT                   putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11847g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79429"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C676"
FT                   /protein_id="CAG79429.1"
FT                   /translation="MTFQDAKDIYNNRLQKSIEEVDKYFPGSHKPLPDTIPSNVRPLLK
FT                   LLHDEDYEVVTLGGIELLDKLAKGEWSAVRVTGAYIRAAVLAHKLVNCATEFLAERAYN
FT                   RAKFLDEHLAQKGPVGPFHGLPFSVKELLGVKGHISTCENSFFLDSEPMEKDLVLIQQL
FT                   ESQGGTIFVRTNGPQLCNSLDSYSPVHGSTLNPYNTSLTTGGSSSGEGALAAFGASIIG
FT                   LGTDIGGSIRAPSSFCGIYGLKPTRGRLSMLNCVGSNPGNDFIKAVVGPMSRDLRLIDL
FT                   FMENIIKQKPWKDDVSLEAVPWEIVSSIQPKKLTLGYTTFDGVAHPHPPIVHAIEELVK
FT                   KNDGKTVDGVEITFKKYTPVIPEDIIHMLIGMFMPDAGERIKKWSEKFGEPLDDPGPEV
FT                   KALAKKLEISDVFALNTKRDKYRQTVWEDWKKQGIDAVIYPVYISPSSVIRTPNYGLYT
FT                   MLWNVVDYPGVTLPLTKMDAKKDYGPTPEPANDMDKKFLGMYEPEKFDNAPIGVQIIGP
FT                   RFEEPLLLKVAQLLQGTVQPLGE"
FT   gene            <1440035..>1444162
FT                   /locus_tag="YALI0_E11869g"
FT                   /old_locus_tag="YALI-IPF2725"
FT                   /old_locus_tag="YALI-CDS0139.1"
FT   CDS_pept        1440035..1444162
FT                   /locus_tag="YALI0_E11869g"
FT                   /old_locus_tag="YALI-IPF2725"
FT                   /old_locus_tag="YALI-CDS0139.1"
FT                   /product="YALI0E11869p"
FT                   /note="similar to uniprot|P13382 Saccharomyces cerevisiae
FT                   YNL102w CDC17 DNA-directed DNA polymerase alpha 180 KD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11869g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79430"
FT                   /db_xref="GOA:Q6C675"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015088"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR024647"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038256"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C675"
FT                   /protein_id="CAG79430.1"
FT                   /translation="MSRRNALAALKAARAGEKRELTFNAEDVYDELDETEFKQHRKQEL
FT                   LQDDFVVGDNGEGYADTGAYEWEDTGKRYGSSDEDGSPKSKRAKKNSDVIKNRKLNFKA
FT                   LASKPVKTETAASAVADDFMDDLIGVIGGSGPKSADKKKPMNRKSRSARAKEEEDVFVD
FT                   MDYSYDMASPEHVSSSPPAEIVHAVREEAIADGMDFADDMDIDMGEPDIPNKVPQSESD
FT                   DDEDEVVVRPKAGQAAAAVNMRGQKPVVAVKKEIVKTEPVKKELVKEDIEEPELVPDIT
FT                   SNIQLATSKAGSADTAKISVEPNEVTTEDGKFKFFWMEHAIVRDTLYLFGKTMVLTGKN
FT                   KGQFVSCLIKVASTQRQMFVLPKNECSTSDVHEELDGIMEARGIRMRAKPVTKKYCFHL
FT                   PGVPAEAEYLEVLYSPPKEKFDVPSSGATFSHVFGANQSLFEQFVLSHQVMGPCWMQID
FT                   EPDFASAGQGRISHTGIEITAKSSAKISVCSNQEAPMPPISMISLAVRTMTEGKSQSVV
FT                   AVTLRMFQDMPHDTTSKLGELQHRSMTFFRYPSKVAPVGFKQILQEHNAGTAVDKIIPC
FT                   NSELDILSHMVRLIARVDPDLICGHRLEALHLDVLLHRLKELNVKDWSSMGRLRRTQWP
FT                   HMNYGVLDGRLILDMDNSYGRSVVQGCQSFDLTEMSLNTLGIKRMDIELDAAHSKMVSS
FT                   ARPLLSYLMHCIQDTGLVAGIVIQTQAIPLSKQLTNLAGNAWNKTLAGTRSGRNESILL
FT                   HEFTRQGYIIPDKEAGRGTNKRGKAKFQGGLVLDPVKGLYDRHVLVMDFNSLYPSIIQE
FT                   YNICFSTVDWASIPDDQIEPPAQPEPSVEQGILPRLIRTLVQRRREVKRLIKDPKASAA
FT                   QKKQWDVKQMALKLTANSMYGCLGFEGSRFYAKPLANLTTSIGRDTLRATKELAEAESL
FT                   QVVYGDTDSVMINTNTDTYKDAIKVGNDFKKKVNGLYKQLEIDIDGVFARLLLTNKKKY
FT                   AARLATEEGMGKIEVKGLDLRRRETCQISKDACTYVLEQVLGPDDQETALNNVHEYLFE
FT                   LAEKLRSGPVKDESAPFPVEHYAILKQLGKDPKAYNPPIQPFVAVALRRLERGEVIREG
FT                   DVMSFVITTVGSDESAKAQTTMDVKLSRGKLQPDAEYYISKQLYPQIERLLAHVTGTDP
FT                   VRLGEVLGIEIKKAHQSHESRELLHPLESTISDAERFKDAVKLELTCECGHSFAYEGVK
FT                   QNTTEHGIICPSCSTMFPLTRLCAQLETSIRRHISKYYETWYTCSDSACGIRTAQLTNF
FT                   GKRCMGSDGRFNTCNRGTLDYEYNDQDLYRQLLYFDTLFNMDKAAQENDKDMKLAVLAG
FT                   QNRERFVYPRQVVDKYLKDSGRAFVDMAAIFG"
FT   gene            <1444719..>1445932
FT                   /locus_tag="YALI0_E11891g"
FT                   /old_locus_tag="YALI-IPF2726"
FT                   /old_locus_tag="YALI-CDS5507.1"
FT   CDS_pept        join(1444719,1445337..1445932)
FT                   /locus_tag="YALI0_E11891g"
FT                   /old_locus_tag="YALI-IPF2726"
FT                   /old_locus_tag="YALI-CDS5507.1"
FT                   /product="YALI0E11891p"
FT                   /note="weakly similar to uniprot|P25710 Neurospora crassa
FT                   NADH- ubiquinone oxidoreductase 21.3 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11891g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79431"
FT                   /db_xref="GOA:Q6C674"
FT                   /db_xref="InterPro:IPR039205"
FT                   /db_xref="PDB:6GCS"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C674"
FT                   /protein_id="CAG79431.2"
FT                   /translation="MSEHVHLPSPTFNTSSAGHFHPYNTLGLATQSAMVGLGAGVVAAA
FT                   ARNSLATGPRNILTTFSKSGGVVTIFTGASIAYVFTYCSAANLRERKDGWNHMWAGAAT
FT                   GAVLGARTKLVPAFIGWTVLCGAACGLFGWTGARFNADRKASLEQSPKGFVQEDAHQTF
FT                   WEVVHRRPLSLTVEQLGEGRGINAVPIATATEAPN"
FT   gene            <1446549..>1447811
FT                   /locus_tag="YALI0_E11913g"
FT                   /old_locus_tag="YALI-IPF2727"
FT                   /old_locus_tag="YALI-CDS3040.1"
FT   CDS_pept        1446549..1447811
FT                   /locus_tag="YALI0_E11913g"
FT                   /old_locus_tag="YALI-IPF2727"
FT                   /old_locus_tag="YALI-CDS3040.1"
FT                   /product="YALI0E11913p"
FT                   /note="similar to DEHA0G08063g Debaryomyces hansenii"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11913g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79432"
FT                   /db_xref="GOA:Q6C673"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C673"
FT                   /protein_id="CAG79432.1"
FT                   /translation="MTSRYRVEYSLKQHRRDEFIEWVKTLLATPFVLHAGSTGDGRPGD
FT                   ENRSVVETRRRYAEIFYDVEKLIENQLYHDNNDSGERARLRQLVPTIGQFFTKLPLERA
FT                   FYTQDEIRSISHRRFVSPSFNDVRMILNTAQVMALATGRQPLKLVTFDGDVTLYADGGN
FT                   IDPDSPIIPVLLGLLRNDVYVGIVTAAGYSEKDGSKYGVRLYGLLEAIVKTDTLTEQQK
FT                   NHLLVMGGESNFLFKFIAAENRFEWIDPEEWTLPEVRTWSQEDITSVLNIGERVFTNAL
FT                   TKCSLPATIIRKVRGVGIVPLPGKKIMREQLEEMVLAAQKTLETSKATGNVQFCAFNGG
FT                   SDVWVDIGDKDLGVRSLQAYLGNITGTQTLHVGDQFAALGANDFKARLAATTVWIANPS
FT                   ETVEIIAELIDYIEHERQCSA"
FT   gene            complement(<1447925..>1448908)
FT                   /locus_tag="YALI0_E11935g"
FT                   /old_locus_tag="YALI-IPF2729"
FT                   /old_locus_tag="YALI-CDS4054.1"
FT   CDS_pept        complement(1447925..1448908)
FT                   /locus_tag="YALI0_E11935g"
FT                   /old_locus_tag="YALI-IPF2729"
FT                   /old_locus_tag="YALI-CDS4054.1"
FT                   /product="YALI0E11935p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11935g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79433"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C672"
FT                   /protein_id="CAG79433.1"
FT                   /translation="MSRKAALARCVQKSYEWETRTDTTLSGVFGSEGQELDEFLDTVPD
FT                   EYHSERTRPLLQKLTRQCEALKTAKPMPKKHGDDFGFSDEEEDEGGSAEATPLREDDPL
FT                   TALQKRYVGLEKALRHIEGIDKEDVGTLSFLFAGKAVEDSINNNISLENALEKEAKQLR
FT                   KSIRAERNLKQEHKKLTEMLQAKLRETRERSRKGPNYEKELLQAQLKEQSQLSGNDISS
FT                   GLRFIKGTLARLIADSYLKKSTKITEGEYEDLVDIYGDRIKMLIDDLFYANLVADEESL
FT                   APDDEKRYIEYHKEDIPIVQFFLTSNFVVPYPKDGFKIKLKMQLEL"
FT   gene            complement(<1449083..>1450588)
FT                   /locus_tag="YALI0_E11957g"
FT                   /old_locus_tag="YALI-IPF2732"
FT                   /old_locus_tag="YALI-CDS2340.1"
FT   CDS_pept        complement(1449083..1450588)
FT                   /locus_tag="YALI0_E11957g"
FT                   /old_locus_tag="YALI-IPF2732"
FT                   /old_locus_tag="YALI-CDS2340.1"
FT                   /product="YALI0E11957p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11957g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79434"
FT                   /db_xref="GOA:Q6C671"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C671"
FT                   /protein_id="CAG79434.1"
FT                   /translation="MDEILKKQGFPDMGEITMEQVWDVFNQLNPMEKRSLSSALEVLVE
FT                   HSNGKIEEMDETIQSGDEEGELTQQEMEELTNSIKASGNDVPDLMGPDRNSSMHSASDG
FT                   EAILGKTIIIHEDQLEKTFSMVKLDNDEAPFPADPNKLHIPFTSEQLSETSNLMKWVGA
FT                   TDMRTFIWEYEAIIRAIFAAWNGDHDVENLEFYLVYYLPFFVSLGVIYSLEAEFGYRTF
FT                   EVEGLDKLEIEDDAKEMHQRVLAGSWREIRRFVVSEFAAIKDDEEFVSHTMSLLENVAV
FT                   SKRGGLKRYLSYVARLVSRAQSEREINKCLYGEAGTGGFIDIQDVYNVVVMRLPFKWRL
FT                   EAENLGNKATSAVEFATILEHTFSKDQDFNARNEELMGGSLFEKNRKKTKTNKKEKEKE
FT                   KEKEKEKEKEKEKEKEKETDGVKKTSVKGPLNAETLAQNNSKEVLEEKLRVLITALTKE
FT                   FGPSSKEWACVQDMKLHVPDKAPSAPPPKKHDPLESLRGNNYF"
FT   gene            <1451885..>1453735
FT                   /locus_tag="YALI0_E11979g"
FT                   /old_locus_tag="YALI-IPF2733"
FT                   /old_locus_tag="YALI-CDS1512.1"
FT   CDS_pept        1451885..1453735
FT                   /locus_tag="YALI0_E11979g"
FT                   /old_locus_tag="YALI-IPF2733"
FT                   /old_locus_tag="YALI-CDS1512.1"
FT                   /product="YALI0E11979p"
FT                   /note="weakly similar to uniprot|BAC71576 Streptomyces
FT                   avermitilis SAV3864 Putative 4-coumarate:CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E11979g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79435"
FT                   /db_xref="GOA:Q6C670"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C670"
FT                   /protein_id="CAG79435.1"
FT                   /translation="MPQIIHKSAWGDIPLSTFFYGNVTDYLRSKKSFGSDKIGYIDAET
FT                   GEGITYKQLWKLANGISAVLYHHYGIGHARAPVASDHTLGDVVMLHAPNSRFFPSLHYG
FT                   MLDMGCTITSASVSYDVADLAHQLRVTDASLVLCYQEKENNVRQAIKEAQKDAAFPGIT
FT                   HPVRILLIENLLTMACNISEEKINSAMARKFEYSPQECTKRIAYLSMSSGTTGGIPKAV
FT                   RLTHFNMSSCDTLGTLSTPSFSTGDDIRVAAIVPMTHQYGLTKFIFNMCSSHATTVVHR
FT                   QFDLVKLLESQKKYKLNRLMLVPPVIVKMAKDPAVEPYIPSLYEHVDFITTGAAPLPGS
FT                   AVTNLLTRITGNPQGIRHSQSGRPPLTISQGYGLTETSPLCAVFDPLDPDVDFRSAGKA
FT                   TSHVEIRIVSEDGVDQPQLKLDDLSHLDGMLKRDEPLPVGEVLIRGPMIMDGYHKNRQS
FT                   SEESFDRSQEDPKTLIHWQDKWLKTGDIGMVDQKGRLMIVDRNKEMIKSMSKQVAPAEL
FT                   ESLLLNHDQVIDCAVIGVNSEAKATESARAFLVLKDPSYDAVKIKAWLDGQVPSYKRLY
FT                   GGVVVLKNEQIPKNPSGKILRRILRTRKDDFIQGIDVSKL"
FT   gene            complement(<1453875..>1456133)
FT                   /locus_tag="YALI0_E12001g"
FT                   /old_locus_tag="YALI-IPF2737"
FT                   /old_locus_tag="YALI-CDS0966.1"
FT   CDS_pept        complement(1453875..1456133)
FT                   /locus_tag="YALI0_E12001g"
FT                   /old_locus_tag="YALI-IPF2737"
FT                   /old_locus_tag="YALI-CDS0966.1"
FT                   /product="YALI0E12001p"
FT                   /note="weakly similar to uniprot|Q07807 Saccharomyces
FT                   cerevisiae YLL013c transcript-specific regulator of mRNA
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12001g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79436"
FT                   /db_xref="GOA:Q6C669"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C669"
FT                   /protein_id="CAG79436.1"
FT                   /translation="MTGRAQSNNWDRSPPSRGIWGEYNKSHIVPYGPPTNTDTPTWSRA
FT                   PSFQQERDLAPGGVGRKNSQGEEINPAYNPIRSGSFSGGISLIRSGNDIRRDSSMLPHP
FT                   DHQFASKHFSFNDVEMQRPHLQAPEIFNPSQAHAPIPASGSSFLSRFSNIGDATRDAEL
FT                   NLGSRKASPEDASGFGLVSRRTSTSSASPIWNNTGSPPAQQTKLHIDEVTDQMQTFTPF
FT                   VPYERYYDYGADMGAAGTGVGAGLPNVAGVAPSGLPASGAPIGPASMTMGGMPSMGGMP
FT                   GMAGLTQSPQAPTAAVSNGHDFYGFRGRPSPRKYGVKEFFPNGLDDEVEVSKKKGSPEQ
FT                   IVAKPVTTRTPTNKASVVAAPEADIASVPATTAVPTTPTPPRVESRDTNSAASAPPSSS
FT                   SRRKRDGYRSPLLEEFRNNKSKKFELKDLQGHIVEFSGDQHGSRFIQQQLESASGEEKS
FT                   AIFEEIRPSSLQLMTDVFGNYVVQKFFVHGSNAQKAVLTKQMEGHVLSLSLQMYGCRVV
FT                   QKAIEYVDTAKQAHLINELDKHVLRCVKDQNGNHVIQKAIEKIPPQHIQFIINAFNEQV
FT                   YQLATHPYGCRVIQRMLEHCEEAQAAILAELHNYAYHLIQDQYGNYVIQHVLEQGAPDD
FT                   KEAMMLVIKQHVLIFSRHKFASNVVEKCVIYGNRRQRRALIEEIATEREDGTLPITVMM
FT                   KDQFANYVIQKLLDVSEGEDFDLLVSIIKPHLASLKKYSYGKHLASIERLVLLSEGGE"
FT   gene            <1458023..>1458838
FT                   /locus_tag="YALI0_E12023g"
FT                   /old_locus_tag="YALI-IPF2738"
FT                   /old_locus_tag="YALI-CDS4676.1"
FT   CDS_pept        1458023..1458838
FT                   /locus_tag="YALI0_E12023g"
FT                   /old_locus_tag="YALI-IPF2738"
FT                   /old_locus_tag="YALI-CDS4676.1"
FT                   /product="YALI0E12023p"
FT                   /note="weakly similar to uniprot|P43605 Saccharomyces
FT                   cerevisiae YFR027w ECO1 involved in sister chromatid
FT                   cohesion during replication"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12023g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79437"
FT                   /db_xref="GOA:Q6C668"
FT                   /db_xref="InterPro:IPR028005"
FT                   /db_xref="InterPro:IPR028009"
FT                   /db_xref="InterPro:IPR033257"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C668"
FT                   /protein_id="CAG79437.1"
FT                   /translation="MKTYRAKRKYLSESEDDVFSSSPTQSPETSPLQPPNESRLNIKAA
FT                   QAVSPCQKRAKVVKKPAKTKAPVQMTLSLGQTTSTTCKTCGMTYQVAYGPDISAHKSFH
FT                   STALNGPKWKPSVSAVVVDKSKTYTVYKSRLLSHPCVSQFLKLVNSELNAPEPILSSQA
FT                   AVYVYVVDQRAVGCVLVDRITKCRHVDIQTGTLGLKEYPAVMGVSRMYVSQLFRRTGIV
FT                   TKLLDLAKSDFIYGMELEKNQVAFTQPSEGGLKVAENWAGTVRVYREGE"
FT   gene            complement(<1459027..>1461249)
FT                   /locus_tag="YALI0_E12045g"
FT                   /old_locus_tag="YALI-IPF2741"
FT                   /old_locus_tag="YALI-CDS1008.1"
FT   CDS_pept        complement(1459027..1461249)
FT                   /locus_tag="YALI0_E12045g"
FT                   /old_locus_tag="YALI-IPF2741"
FT                   /old_locus_tag="YALI-CDS1008.1"
FT                   /product="YALI0E12045p"
FT                   /note="some similarities with uniprot|Q6CC51 Yarrowia
FT                   lipolytica YALI0C12452g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12045g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79438"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C667"
FT                   /protein_id="CAG79438.1"
FT                   /translation="MSYNCLPPAAPKVLVEICGPALAVVEPDTATVYTHDPSNLTRVPN
FT                   AGYQVSDQTSIRFMTAHKTQLATLDTANVLHLAVFDLTKKKDHFCQVAEWKLPKSDIFT
FT                   SVCWNHDGTALVLSTTNGTLYRVNTLTHQMDPFGAMIGGAVTSVSAAPCGDNIFAIAHK
FT                   SGSISVLRITHQLEVYHTFKLSSRGSGTDFSKDSESEPATTPVYALTTAWHYSSRDPSN
FT                   QSLAAIDSNNKIQVWSVSLKSMVRKIRCFGLPDGAHTASPIWWTKGGSLFHALNDSRVC
FT                   VHNVKTSNVSTKIISTGKIVSCCIKSNRGKAWMATTGGIEFLDLVGGDKKMENRKRGSD
FT                   SSEGSVEQVKELALPTPELLPSPPRPLPRRTPLIPIPTEAPPPPPPSAGAQSDSWDDES
FT                   DGPSSAFSNTRSSNTSADTLPGSEYDVPVKPLLNCRPKTRFSGQTTPTRNEMLPIDTSR
FT                   ISLFHIVMSVPDPMAEKALSPSLSWESQALRVLFDWESSCYELIQSQRTEDNTIANFYL
FT                   GQWLNDSDYTLNIDSLESTLSPTQSTALLCLSLLDREPTKVDKAISVHISRVRRRLPSA
FT                   ALDTHYVCTTLLSLGLAHQAIHVYQQLGFYMEAVILGILYAQSIEETLDLWMYSAASSD
FT                   MWPDGVVHRCSVLMSLVNPQVSYPVNFDDTDLGGNLPPSLRKLSLDDLLKSSRDQNLLL
FT                   DSPMIPHEEFSVGIDSPTLMPIDFDFNKPPNFSRRGRTPKTSPNLI"
FT   gene            <1464553..>1465533
FT                   /locus_tag="YALI0_E12067g"
FT                   /old_locus_tag="YALI-IPF2742"
FT                   /old_locus_tag="YALI-CDS4068.1"
FT   CDS_pept        1464553..1465533
FT                   /locus_tag="YALI0_E12067g"
FT                   /old_locus_tag="YALI-IPF2742"
FT                   /old_locus_tag="YALI-CDS4068.1"
FT                   /product="YALI0E12067p"
FT                   /note="similar to uniprot|P23060 Saccharomyces cerevisiae
FT                   YCR019w MAK32 necessary for structural stability of L-A
FT                   dsRNA-containing particles"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12067g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79439"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C666"
FT                   /protein_id="CAG79439.1"
FT                   /translation="MTWFTTMGMFIIDEIHFGTHSVYDIVGGAGTYGVLGARFFAKQDK
FT                   AKDIGWIVDAGNDFPQSVEEQITSWDTGLVMRRDPSRKTTRGWNSYGDNDLRSFKYLTP
FT                   KKRIEVSDLQECGLDSSRSIHVICSPDRCMKICSDLANGPRQDQQVFLWEPVPDCCCPE
FT                   TFPTMLQALNSVQVLSPNCHEAALFVGLPEPTTVSEIESLVYDYWAPHLDKLKTVFVLR
FT                   CGKLGVLVYSDKKLKWYPAYHQSSEKVIDPTGGGNTFVGGFLYGYLESDGDLDTAASYG
FT                   NVAAGLAVEQVGVPLLTYQRGQELWNDTTIEQRLDVYASLLKASN"
FT   gene            complement(<1466152..>1467557)
FT                   /locus_tag="YALI0_E12081g"
FT                   /old_locus_tag="YALI-IPF11339"
FT                   /old_locus_tag="YALI-CDS5937.1"
FT   CDS_pept        complement(join(1466152..1466659,1466704..1466745,
FT                   1467553..1467557))
FT                   /locus_tag="YALI0_E12081g"
FT                   /old_locus_tag="YALI-IPF11339"
FT                   /old_locus_tag="YALI-CDS5937.1"
FT                   /product="YALI0E12081p"
FT                   /note="similar to uniprot|P28263 Saccharomyces cerevisiae
FT                   YEL012w UBC8 E2 ubiquitin-conjugating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12081g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79440"
FT                   /db_xref="GOA:Q6C665"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C665"
FT                   /protein_id="CAG79440.2"
FT                   /translation="MSSPTRRRIETDVMKLLMSDYEVTLVNDSMQEFYVRFEGPEETPF
FT                   QGGIWKIHVELPNEYPYKSPSIGFVNKIFHPNIDELSGSVCLDVINQTWSPMFDMVNIF
FT                   EVFLPQLLRYPNPSDPLNGEASGMLMREPKQYEEKVKDYVTKYASNDSVSAEKDISDDD
FT                   DLSSIGSFSDDDEEPAGELEV"
FT   gene            <1468158..>1471205
FT                   /locus_tag="YALI0_E12089g"
FT                   /old_locus_tag="YALI-IPF2744"
FT                   /old_locus_tag="YALI-CDS0418.1"
FT   CDS_pept        1468158..1471205
FT                   /locus_tag="YALI0_E12089g"
FT                   /old_locus_tag="YALI-IPF2744"
FT                   /old_locus_tag="YALI-CDS0418.1"
FT                   /product="YALI0E12089p"
FT                   /note="similar to uniprot|Q07830 Saccharomyces cerevisiae
FT                   YLL031c GPI13 protein involved in
FT                   glycosylphosphatidylinositol biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12089g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79441"
FT                   /db_xref="GOA:Q6C664"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037675"
FT                   /db_xref="InterPro:IPR039524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C664"
FT                   /protein_id="CAG79441.1"
FT                   /translation="MTDRLGPEERQMAAAQRAYTAASRGEGIETPAVAYVPRTMSFEWT
FT                   WKYFIGLFLWMVLYDAIGVGFFTRGFLLSRSVLTDVSPSDWQLTELHEPPHIDNGCWTE
FT                   PKFDKAIMLVIDALRFDFSTPQPGSNKPYHNALTVMSELNQNQPNKAFLSKFVADPPTT
FT                   TLQRLKGLTTGSLPTFIDAGSNFAGSEIDEDNWVYQMWALNQTVYQCGDDTWDALFGKY
FT                   FAAANPYDSLNVWDLYTVDNGVKEHLLPAYKSGNYRMSIGHTLGVDHAGHRYGPDSPKM
FT                   TEKLQEMDEYIREIIDSLDDDTLLIVFGDHGMDSKGDHGGESDLEVDATLFMYSKKDWV
FT                   APNDQISEGGYPSIPQIDLVPTLSLLMGLPIPFNNLGSPIAEAFLGPNKDPKALANVLQ
FT                   LTSAQIENYRQKYGFDDLGGLYKKTVKVDSSKAGMWESIVSNHYNFQRTNLDQCRSLWA
FT                   QFDFASIFAGFAIIGSSLILMILYSRLPILDVEGSLEKLCNYSGLSAFMTAPAFYALAS
FT                   YGAFGESWPFDALWTSGLGFCVGTLLGYSIYYIRHFSKKLQRAEIGTIAVILITLIHVA
FT                   LFTSNSFTIWEDNILSFLLSTIGFGLLINAAQLPSSNANRAKAISHSIMFLILTRTSAV
FT                   SRLCREEHGDKCSTTFYSSDASSVSAPYTVALLILGAFLLPLLVKGFLIESGSDHGSAK
FT                   FHIWGLFGVMMSVAVYWFLDLFVTEQLKWSDPLFGDIELLSNMKLTIARIVLGVTLLAA
FT                   NVSWMFGLCVEVKYTKKDGVNQAQILGYSNVYGAQYLLLVLNFFGAILLVSKPLGGVMM
FT                   IIQMYHIMTTIDLLHILETPASIGPVILAVLGNAYFFSTGHQATIPSVQWDIGFVATNT
FT                   ISFPLTHLALVLNSLGPQILSTVSTPLLVLWKIPPVRKSSLLFASCGQSMLVSVAYQTA
FT                   VTLSAAVFATHFRRHLMVWKIFAPRYMLGGLTLIVVDVVAVLVVGFGVGNIINHVKKTF
FT                   GTDAKKTVTANTSLKSDLGEQWDALQ"
FT   gene            complement(<1471407..>1472381)
FT                   /locus_tag="YALI0_E12111g"
FT                   /old_locus_tag="YALI-IPF2745"
FT                   /old_locus_tag="YALI-CDS4088.1"
FT   CDS_pept        complement(1471407..1472381)
FT                   /locus_tag="YALI0_E12111g"
FT                   /old_locus_tag="YALI-IPF2745"
FT                   /old_locus_tag="YALI-CDS4088.1"
FT                   /product="YALI0E12111p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12111g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C663"
FT                   /protein_id="CAG79442.1"
FT                   /translation="MAFLRFTGRQSPARHEDHKYFVSTRPGRPQSVLSDETLVSRTIVS
FT                   ADKVAGRRRKFGDKLRSLLRGDRDKADKAPVASKKSSMTLPKTSPVSSCVPKKAAAVAA
FT                   AASKPAASTRPASPSPSPACSDGFMFWHDPSDNLTPVTSHESFGSVDLSIEDTDVLEQL
FT                   AEVPRCSNRISKSTSQSSMASQLTIPNSVSCTSQLSAIAVSAFSDSGSDSGMSDSATCF
FT                   GAEELDFDVKDAYNLGDWGLPRGLTDGYSDSEDEDDLLDDIVDSVESVYAPVSAKTVGY
FT                   TFCLAIWGKPEVRSKFLALQDRVNKNKEKEMPVHEPVTLAMFW"
FT   gene            complement(<1474042..>1474802)
FT                   /locus_tag="YALI0_E12133g"
FT                   /old_locus_tag="YALI-IPF40199"
FT   CDS_pept        complement(join(1474042..1474493,1474790..1474802))
FT                   /locus_tag="YALI0_E12133g"
FT                   /old_locus_tag="YALI-IPF40199"
FT                   /product="YALI0E12133p"
FT                   /note="similar to uniprot|P00445 Saccharomyces cerevisiae
FT                   YJR104c SOD1 copper-zinc superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12133g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79443"
FT                   /db_xref="GOA:Q6C662"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C662"
FT                   /protein_id="CAG79443.1"
FT                   /translation="MVKAVAVLRGDSKVSGTVTFEQDSESGPVTVTYDIKGNDPNAERG
FT                   FHVHEFGDNTNGCTSAGPHFNPFKKNHGGPTDSERHVGDLGNVKTDSEGVAKGVLKDSL
FT                   LKLTGDNSIVGRTVVIHGGEDDLGKGGHADSLKTGNAGPRPACGVIGLTA"
FT   gene            <1476687..>1480991
FT                   /locus_tag="YALI0_E12155g"
FT                   /old_locus_tag="YALI-IPF2748"
FT                   /old_locus_tag="YALI-CDS0122.1"
FT   CDS_pept        join(1476687,1476739..1480991)
FT                   /locus_tag="YALI0_E12155g"
FT                   /old_locus_tag="YALI-IPF2748"
FT                   /old_locus_tag="YALI-CDS0122.1"
FT                   /product="YALI0E12155p"
FT                   /note="weakly similar to uniprot|Q9Y7U5 Schizosaccharomyces
FT                   pombe SPCC645.06C TUS1 similarity to GDP-GTP exchange
FT                   factors"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12155g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79444"
FT                   /db_xref="GOA:Q6C661"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR041675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C661"
FT                   /protein_id="CAG79444.1"
FT                   /translation="MHPPPLPPKPPAEVINRRTQVTDEFRTKLPERVSSLVDKRPSYHP
FT                   QGPRQLNSDAPQQTNRYLGVYSSPQAPNWRDEERSVERSNTDSSDRTSGSATDRASYSS
FT                   YSTDRTSIHGGVSGYYNDPNNGNNIGTDYDKFWAQQYSDVSRTSSMQSWRPDSERPPPL
FT                   PLKKPALNTSHRSNPASPGRAHFSQQNTNTPPPLPPQIPIYDTYMEQQAYEDYLENGFY
FT                   DQQSLYRTPEPQHPARHFTPSPNAQDRYQIPPHLSPGHSSYQPPADLPALDTNDWSHVA
FT                   SAYETDNMYPDHAYESPVRMPVADAYMSPGSPSPLKTETYSPAPSQQSPLHHHSSQSSL
FT                   NYMTSQSSPLTPQQCSERDLALRMERLDMRPAMERLEPRPMVDRIDMRPSMDIRPVDMR
FT                   PTLEKRMSLPNGMPKYQPMSPSVSPSRFNSMPNKRPVPVSAGNTPVKQLDIPEYDILSD
FT                   SMRSDTAWVELDLPSIPTRPQVDLSNVTYACPEMWSLSGVRNWIRPFFTGDKEVPEKDL
FT                   HTAVSNLFAANKTMSPVYAEQYAKHVIGALGRGDVLRHDEERGSYMFSDEGVVSGVIPA
FT                   LTLCYSKSSHDSGYTCYSTKCPYESDTRKREDKKRTESTSSDQMDWAQYWELTDDQLAR
FT                   IDPREIKRQYAMHELIVGEEHFIRDLEILHNVYGESLKSHMPDKQFRDMFAVQDIIQCS
FT                   KELLQGRLKARHIIFVTGIADIIIEWIKVARPHFLAYANRYLHADRRIRKEREDNVLFS
FT                   QWLGDMSKDPRTLGKPYSIYFHRVIPRLARYSLLLGTISKHTTNEMELELLSRAVAECD
FT                   DVTRQCNMVIGNVEKQVELLDLKSQFVFKPDCGADLKLESTQRKIMRRGDVQRKSDYGF
FT                   EWIDAHLVLLDNFLVLCKHQTGQHGPKLYVTKKPIPLELLCVEQIDEAEQQTKGRIHNI
FT                   TSHVREVRDKRMSFIGGDHHSSSSSNPGAVTVLNEDSDQTTYPFRIRHLGQNITYTLFC
FT                   PSSLDRDRWHTAMVEAKRQYSSKVYAKNAEPFRLTVLSYLDFGYEIPVRLAVPNNASTL
FT                   QRAIEKAGMAGKPHLKTQPSSTSMTTRSKVNCATSFMFDSREFVFVGTDYGVFVSELSP
FT                   ETRHKGGNNKYKRCVDLHKVTQIGVIETLNLVIILCHRGLIYYHLDQLLNRSMTKDAAT
FT                   PMGYKLSSSASFFTIGNMKNRTLVFYKSREGLNSVFKVLEPIRQKGSQKKRSRMSLSRF
FT                   SSHIGSTEYFRDAERFYVPSECWGISVFKNYFSVHCTKGFEAMSLDFKVPRTLPIISSG
FT                   STDLRKRLEGLRPLAMFQISDSKFMLCYDELLVYTDHFGNLASKPIPIMIKAKAVALQH
FT                   PYLVIVDDEMAEIRHIDGTLKQVIPGQDMRLLDDHEGQIKLCMANPNIYGRQLIVELNT
FT                   NELIVDDDDSSLTGL"
FT   gene            complement(<1481361..>1483082)
FT                   /locus_tag="YALI0_E12177g"
FT                   /old_locus_tag="YALI-IPF2750"
FT                   /old_locus_tag="YALI-CDS1783.1"
FT   CDS_pept        complement(1481361..1483082)
FT                   /locus_tag="YALI0_E12177g"
FT                   /old_locus_tag="YALI-IPF2750"
FT                   /old_locus_tag="YALI-CDS1783.1"
FT                   /product="YALI0E12177p"
FT                   /note="weakly similar to uniprot|P46944 Saccharomyces
FT                   cerevisiae YDR108w GSG1 sporulation specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12177g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79445"
FT                   /db_xref="GOA:Q6C660"
FT                   /db_xref="InterPro:IPR024420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C660"
FT                   /protein_id="CAG79445.1"
FT                   /translation="MFSLLLQSFVCCRFLSSLWLSQHSVVCLLLQVLLTHITISNSQHN
FT                   TPNPTMMKSIVARAYSPFCSVFATEDCDKLANDLGYEDLITLLAPHGDSVGRATVRDSQ
FT                   GMTNTYDDFAIRLGAKRPTERDSGGMLFNPDAMEALLREYIGHYNSDDSAFARFFAKLV
FT                   AAPPDTAFETFSQPAAHLFCVSSRNAHPLDTLQALAQGQKRDKDCLNFYVLVHDARVED
FT                   AENSTQRTIALLERAKKRFGLAGMIKLGQEGVPETIPTPQFLTVGDELVNLKTGVGFGS
FT                   RTLSQPDKESIRSLLREFTVQHLIPHMERCIMTWDTVAAGKRGLTGRMFSAGKKWLKFG
FT                   GSEKQEAGSSIQASGIYPQGSPEQTIRRLADYAFMLRDYRYAYATYELVKRDFLSDKAW
FT                   KYLAACQEQAAVALLMYTTRLTEKQRVEVLNPLLDSACYTYISRLQLPQYALRMLVVTS
FT                   DLQCLLGPDAASQGATQWFQKLLDERLVGRLGYALIMLRVSYAFSQSPKGRKAALWQLL
FT                   SAREWADANQKGEMAKCLDMTAPVYDELNWPNNEGTLLTRLKGELANEAKPTSVAS"
FT   gene            <1484247..>1485995
FT                   /locus_tag="YALI0_E12199g"
FT                   /old_locus_tag="YALI-IPF2753"
FT                   /old_locus_tag="YALI-CDS1711.1"
FT   CDS_pept        1484247..1485995
FT                   /locus_tag="YALI0_E12199g"
FT                   /old_locus_tag="YALI-IPF2753"
FT                   /old_locus_tag="YALI-CDS1711.1"
FT                   /product="YALI0E12199p"
FT                   /note="some similarities with uniprot|P50108 Saccharomyces
FT                   cerevisiae YDR245w MNN10 subunit of mannosyltransferase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12199g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79446"
FT                   /db_xref="GOA:Q6C659"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C659"
FT                   /protein_id="CAG79446.1"
FT                   /translation="MDTANQEHLRRSFGAASLSPPAASPALHTKPMFRRRFSTTLLLLG
FT                   ACVCLLFLAASQSRLDLDVPSYHGYRKSKEVTDEKLHVHKERPQEEHHEHVEHKEESKE
FT                   EIKEESKEESKEKSKEESKEESKEESKEESKEESKEESKEESKEESKEESKEESKDKSK
FT                   EESEPVAVEPEKKPEQSPEQAEEEKKKADELKVQEDRKKTEEDKKEEEKRLREEEKNGR
FT                   IDRLAEDEEQFKKTEAKLKAAEEKAKAMKEELEEARKRKEERRKKAQEQKSEKLQGIFH
FT                   KLEGEEIGSIVNKPLTYTDEEKVDGHVQPYGPKIALLSASNGKTDNEMAMLELVLPNRQ
FT                   EYCNYHGYICAFVDLNTVDTGSDHVVWAKMGAIQRVFDEHPEVEWVWWMDTDIFLMNPE
FT                   IELGEHLLSDRALVERLTYARPIRKPDATFDGEVYPSKDNPPKPENLNLLLTQDFFGIN
FT                   AGSFFIKRSPWTDMLLDLWYDPVHVEKNYIFKEQEALNNLIRGHKSILSHTGIYPQRLF
FT                   NSYTGEPNDVWTYKEGDLALHLAGCNHNNDCEKHLTGYFPQRVRVPEKYRESGLRVDFG
FT                   KKKEGN"
FT   gene            <1487259..>1489184
FT                   /locus_tag="YALI0_E12221g"
FT                   /old_locus_tag="YALI-IPF2758"
FT                   /old_locus_tag="YALI-CDS1379.1"
FT   CDS_pept        1487259..1489184
FT                   /locus_tag="YALI0_E12221g"
FT                   /old_locus_tag="YALI-IPF2758"
FT                   /old_locus_tag="YALI-CDS1379.1"
FT                   /product="YALI0E12221p"
FT                   /note="similar to uniprot|P32802 Saccharomyces cerevisiae
FT                   YLR083c EMP70 endosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12221g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79447"
FT                   /db_xref="GOA:Q6C658"
FT                   /db_xref="InterPro:IPR004240"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C658"
FT                   /protein_id="CAG79447.1"
FT                   /translation="MLHVYVVLLLAALCHAFYLPGVAPTDYEEGDKVPLLVNALTPRQI
FT                   LSESGQLESVVPYDYYYELFNFCKPVGGAEKQSESLGSILFGDRIFNSPFQLNMKEDKQ
FT                   CEELCPNRPIYDVFSARFTNKKILQGYAQNWFIDGLPAGRQLRGQEGQFFAGFELGEIE
FT                   QPNADNTDDVDDSENNEKRDEDSDIPYLNNHYDITVEYHTTKQGKHRVVGVEILPRSLD
FT                   RSGAEEDLCGDYPKLHLQTDPDTKQQVVFTYSVTWKHSDTPWATRWDKYLQVHNPQVQW
FT                   FAIINSAIVVTLLATTVATVLTRALRKDIASYNEIDLSEEVQEDSGWKLVHGDVFRTPK
FT                   NRMILCAFLGSGAQMFVMCGLTVFFAVIGFLSPSNRGALGTAFILFYSLSGFVGGYVSR
FT                   KFYNTMGGENVKMNLLLTPVLIPSIIFAAFIGLNFFLIAYNSAGAVPFGTMLALVAVWF
FT                   AISVPLSIAGGFIAKTPFSVPVKTNQIPRQIPQQPFYLEKVPSVAIAGILPFVAIFVEL
FT                   YFIVSSIWFHRMFYMFGFLFLSYGLMLVSTVVVTVLMIYLLLCSENYHWQWRSFFIAGS
FT                   CAFYVYAHALLFLINKLALGSFTSNILYLGYSAIISLIMFVLLGTVGYTCSFFFVRKIY
FT                   TAIKID"
FT   gene            <1490125..>1493262
FT                   /locus_tag="YALI0_E12243g"
FT                   /old_locus_tag="YALI-IPF2761"
FT                   /old_locus_tag="YALI-CDS0391.1"
FT   CDS_pept        1490125..1493262
FT                   /locus_tag="YALI0_E12243g"
FT                   /old_locus_tag="YALI-IPF2761"
FT                   /old_locus_tag="YALI-CDS0391.1"
FT                   /product="YALI0E12243p"
FT                   /note="similar to uniprot|P40069 Saccharomyces cerevisiae
FT                   YER110c KAP123 RAN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12243g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79448"
FT                   /db_xref="GOA:Q6C657"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C657"
FT                   /protein_id="CAG79448.1"
FT                   /translation="MDDFTVQLAQLLGQITSPKSPEDIKNASQRLQAEFYMNPQCAVSL
FT                   IHIMQKHEDSGIKQLAGIEARKQIPIYWEENDQAVRNEIKNSLLQSTLAEQVALVRHTS
FT                   ARVVAAIGEIELGLQTWNELPQSLNTAISSGDARDREVATYIIYILLEVGAETFVTNAS
FT                   NILPLVSVNMAQNDAELQVTSMLCAGMISELIDSSDSNADMFKKQVVPQMVDVLKGAMQ
FT                   RDDDKTLQLFEVFSTLLLIEGALVADHIGDLVQFMLEIAKRGDSDENKMAALRFLISAV
FT                   RFKKRRLQALGLGPTLTNSMVEIIAQQIAEFPDEQDDDDEDEDTTRKLALRVIGYLSNE
FT                   LPPKQVLVPIFELLQQQPNSDAVLSALSYAIEGSPEFVATHLDPVLESVIGTLRQNPTN
FT                   VSALMVLVRLAYHLHHIIGEHHATLVPLICSAMDASSSPAQFKAATSALESVLETLEQD
FT                   VIAEKYLAELMPRLITMLDQAQDDSLRTTLIAAVGSAAFAAKEAFTPYAEQCINGLGQL
FT                   INLENAAEMTEVELAVKGSAFDTIGAIAGAIGKEAFRPYVNTFAEKAYATLQVDLLREA
FT                   GFVFFGVIAKLYGEEFGQYLPRVIPLLVEFLGQDDFGFEDEDEDDEAIGQEDDDSKFKV
FT                   NSLLATQKETAFQVLGDMILATKGQFLNFLEEITDPLFSALDHFYEGIRKEALGAVWKI
FT                   FHSLYSMANLPQWKPGFPADTSAYPESLSTFLQLARTKTVELLEEEDSRLVVIAICEVL
FT                   VEAMKAAGPAILGDEDTLRTICSQVILVLKKEHPAQMEEEEIDAAELEQSEYDSLMLDY
FT                   AFDVCAAMSESLEAHFVPIFKALFPYVQNYANSKMDEERAFGIGALAEMTVGMKSSVSE
FT                   FTGEILNICIKGLTDAHLDVRSNSAFAFGVLAENSTVDLTSQYPAILQKLQRLLTKVDK
FT                   QAKKNLSDDPEDNNDRCLANACGCVARMTLKAPGSVPISEVVPALVARLPLGDGQEEYV
FT                   PIFGLFAALLEHNDPTIVPLKGDISNLIQEIARKDETEKILDDQVKQKLEAVMQKM"
FT   gene            complement(<1493888..>1493961)
FT                   /locus_tag="YALI0_E12265r"
FT   tRNA            complement(1493888..1493961)
FT                   /locus_tag="YALI0_E12265r"
FT                   /product="transfer RNA Ala (AGC) cove score=66.06"
FT   gene            complement(<1495034..>1495513)
FT                   /locus_tag="YALI0_E12276g"
FT   CDS_pept        complement(join(1495034..1495460,1495509..1495513))
FT                   /locus_tag="YALI0_E12276g"
FT                   /product="YALI0E12276p"
FT                   /note="similar to uniprot|Q06537 Saccharomyces cerevisiae
FT                   Ypr153wp (YPR153W)"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR64330"
FT                   /db_xref="InterPro:IPR019334"
FT                   /db_xref="UniProtKB/TrEMBL:B5FVH6"
FT                   /protein_id="CAR64330.1"
FT                   /translation="MVLLISSTYSVPIGYKVPPFPSLYWPAGSSERLYEVSSLYYTYDI
FT                   WRFTVLWTIILFCCFHFIAGMWASLVKRDFKNGLIIMFLYIGIAGIEAIVSGTIVGLII
FT                   TGVYRAGLCSVSTWIPLVWAVVQILWMVFTSYSMMNVFL"
FT   gene            complement(<1495767..>1496873)
FT                   /locus_tag="YALI0_E12287g"
FT                   /old_locus_tag="YALI-IPF2764"
FT                   /old_locus_tag="YALI-CDS3608.1"
FT   CDS_pept        complement(1495767..1496873)
FT                   /locus_tag="YALI0_E12287g"
FT                   /old_locus_tag="YALI-IPF2764"
FT                   /old_locus_tag="YALI-CDS3608.1"
FT                   /product="YALI0E12287p"
FT                   /note="some similarities with wi|NCU01858.1 Neurospora
FT                   crassa NCU01858.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12287g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79449"
FT                   /db_xref="GOA:Q6C656"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="InterPro:IPR040038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6C656"
FT                   /protein_id="CAG79449.1"
FT                   /translation="MDNDYESPWGLSQLEAPADSQNIDSQPLNDDELGINTEVQVKRTR
FT                   HVAKLDDTRMMDDKGLPALKHLCTKVNLKGNGHEVGDLGRLLDMYQMWSHDLFPKGQFK
FT                   SLYPLTSKAGRTATVRGLRLAWIDEEQRKKQTADVATAVDELEDITDFRDRGRHFETEP
FT                   RYSRQSEPPVETSVNVDNPDDLFVGMDSVDHRLVSDEDVDIQAEVSRREDDEDREQDVS
FT                   ELLEGARAQRDKDNSRSSGRLSLFDLGGSGSPSESDRGGSTLEGDIFGTGSLDPTPPPA
FT                   SETSTQAPAAQPPATQPPQAPAPTQPPSNQAPVKAPPQPMRQMDDLELDMLADFEPDFE
FT                   DQEQHEPEPDPEDYEDDEAMAVMREMGL"
FT   gene            complement(<1497300..>1498652)
FT                   /locus_tag="YALI0_E12309g"
FT                   /old_locus_tag="YALI-IPF2766"
FT                   /old_locus_tag="YALI-CDS2792.1"
FT   CDS_pept        complement(1497300..1498652)
FT                   /locus_tag="YALI0_E12309g"
FT                   /old_locus_tag="YALI-IPF2766"
FT                   /old_locus_tag="YALI-CDS2792.1"
FT                   /product="YALI0E12309p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12309g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79450"
FT                   /db_xref="GOA:Q6C655"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C655"
FT                   /protein_id="CAG79450.1"
FT                   /translation="MGTLIVVATAVVFVAEMVLQARQLVYLGASHTVPPELTHMLDCVG
FT                   LRKQNQLAWAELRSQFYLALLPFVEKTAIFGLGLLPWIIWASEFIQGRLRLRLSQIHAP
FT                   QTLITMALSDCVNAFLASAIFYILQRISLLLHAYERDANVLQLHITKMEYLSEYTSETL
FT                   QKGVVQCLIVGFAELAVSALPWKKPHMSLVFLVPLIYTATHMMVLKIHRTSPPPNAYPL
FT                   MECQLRSKLENVARDLNFPNPTQIYVYHKGKPRIHVAGWTKKTTHIYIHNHLLTMHTHP
FT                   EILLFVAHVLAGRLFPINTDTFPLGWMALSEYTRGVLTLLLCWNPSFHTYLGLKRWQPI
FT                   LLAVYIIPCIHYPIYKACQYANNYWKRSQTFQKDAGLVCLGNVHLSYYGYTLSSAYKRV
FT                   SPLDGDPLWLTDLSGRSKLKERLEAIGWVPRGLAEKDTEKDTEKDKRRASW"
FT   gene            <1501304..>1502821
FT                   /locus_tag="YALI0_E12331g"
FT                   /old_locus_tag="YALI-IPF2768"
FT                   /old_locus_tag="YALI-CDS2315.1"
FT   CDS_pept        1501304..1502821
FT                   /locus_tag="YALI0_E12331g"
FT                   /old_locus_tag="YALI-IPF2768"
FT                   /old_locus_tag="YALI-CDS2315.1"
FT                   /product="YALI0E12331p"
FT                   /note="similar to uniprot|Q6C808 Yarrowia lipolytica
FT                   YALI0D23771g"
FT                   /db_xref="EnsemblGenomes-Gn:YALI0_E12331g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG79451"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6C654"
FT                   /protein_id="CAG79451.1"
FT                   /translation="MGIKGYFSTMRERFTPLTLDQIGKGVVFVDGHIMAHQIANMVDPG
FT                   SRYDMRGVAMKLEELFNCWIGQHKWDIQLVLFDGLVPTDKMDGRRKRAMESLPTALHAQ
FT                   SLALTVLCGALCLDTIQSKFPNVPCLVSPGEADRDLACLVFNYAKLNSNKAVHIISNDS
FT