(data stored in ACNUC7421 zone)

EMBL: CR382133

ID   CR382133; SV 2; linear; genomic DNA; STD; FUN; 1249940 BP.
XX
AC   CR382133;
XX
PR   Project:PRJNA13832;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 11)
XX
DE   Debaryomyces hansenii CBS767 chromosome A complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Debaryomyces hansenii CBS767
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Debaryomyces.
XX
RN   [1]
RP   1-1249940
RA   Genoscope - CEA;
RT   ;
RL   Submitted (10-SEP-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1249940
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
RN   [3]
RP   1-1249940
RA   Casaregola S., Val M.E., Neuveglise C., Talla E., Martin T., Durrens P.,
RA   Barbe V., Bleykasten C., Bon E., Despons L., Fritsch E., Groppi A.,
RA   Iragne F., Jauniaux N., Leh V., de Montigny J., Pottier S., Straub M.L.,
RA   Wirth B., Wincker P., Sherman D.J., Gaillardin C., Souciet J.L.;
RT   "The second release of the complete genome of Debaryomyces hansenii type
RT   strain CBS767";
RL   Unpublished.
XX
DR   MD5; b7356768c86d53a7d7eef15fe1f5972f.
DR   BioSample; SAMEA3138183.
DR   CABRI; CBS 767.
DR   EnsemblGenomes-Gn; DEHA2A00924r.
DR   EnsemblGenomes-Gn; DEHA2A00990r.
DR   EnsemblGenomes-Gn; DEHA2A01078r.
DR   EnsemblGenomes-Gn; DEHA2A02002r.
DR   EnsemblGenomes-Gn; DEHA2A03762r.
DR   EnsemblGenomes-Gn; DEHA2A04598r.
DR   EnsemblGenomes-Gn; DEHA2A04906r.
DR   EnsemblGenomes-Gn; DEHA2A06468r.
DR   EnsemblGenomes-Gn; DEHA2A07304r.
DR   EnsemblGenomes-Gn; DEHA2A07898r.
DR   EnsemblGenomes-Gn; DEHA2A09064r.
DR   EnsemblGenomes-Gn; DEHA2A10692r.
DR   EnsemblGenomes-Gn; DEHA2A11726r.
DR   EnsemblGenomes-Gn; DEHA2A11748r.
DR   EnsemblGenomes-Gn; DEHA2A11770r.
DR   EnsemblGenomes-Gn; ENSRNA049507155.
DR   EnsemblGenomes-Gn; ENSRNA049568720.
DR   EnsemblGenomes-Gn; ENSRNA049568796.
DR   EnsemblGenomes-Gn; ENSRNA049568888.
DR   EnsemblGenomes-Gn; ENSRNA049568973.
DR   EnsemblGenomes-Gn; ENSRNA049569078.
DR   EnsemblGenomes-Gn; ENSRNA049569152.
DR   EnsemblGenomes-Gn; ENSRNA049569221.
DR   EnsemblGenomes-Gn; ENSRNA049569325.
DR   EnsemblGenomes-Gn; ENSRNA049569426.
DR   EnsemblGenomes-Gn; ENSRNA049569495.
DR   EnsemblGenomes-Gn; ENSRNA049569665.
DR   EnsemblGenomes-Gn; ENSRNA049569760.
DR   EnsemblGenomes-Gn; ENSRNA049569819.
DR   EnsemblGenomes-Gn; ENSRNA049569958.
DR   EnsemblGenomes-Tr; DEHA2A00924r-1.
DR   EnsemblGenomes-Tr; DEHA2A00990r-1.
DR   EnsemblGenomes-Tr; DEHA2A01078r-1.
DR   EnsemblGenomes-Tr; DEHA2A02002r-1.
DR   EnsemblGenomes-Tr; DEHA2A03762r-1.
DR   EnsemblGenomes-Tr; DEHA2A04598r-1.
DR   EnsemblGenomes-Tr; DEHA2A04906r-1.
DR   EnsemblGenomes-Tr; DEHA2A06468r-1.
DR   EnsemblGenomes-Tr; DEHA2A07304r-1.
DR   EnsemblGenomes-Tr; DEHA2A07898r-1.
DR   EnsemblGenomes-Tr; DEHA2A09064r-1.
DR   EnsemblGenomes-Tr; DEHA2A10692r-1.
DR   EnsemblGenomes-Tr; DEHA2A11726r-1.
DR   EnsemblGenomes-Tr; DEHA2A11748r-1.
DR   EnsemblGenomes-Tr; DEHA2A11770r-1.
DR   EnsemblGenomes-Tr; EFT00001977049.
DR   EnsemblGenomes-Tr; EFT00001977050.
DR   EnsemblGenomes-Tr; EFT00001977052.
DR   EnsemblGenomes-Tr; EFT00001977053.
DR   EnsemblGenomes-Tr; EFT00001977054.
DR   EnsemblGenomes-Tr; EFT00001977055.
DR   EnsemblGenomes-Tr; EFT00001977057.
DR   EnsemblGenomes-Tr; EFT00001977058.
DR   EnsemblGenomes-Tr; EFT00001977059.
DR   EnsemblGenomes-Tr; EFT00001977062.
DR   EnsemblGenomes-Tr; EFT00001977064.
DR   EnsemblGenomes-Tr; EFT00001977065.
DR   EnsemblGenomes-Tr; EFT00001977066.
DR   EnsemblGenomes-Tr; EFT00001977067.
DR   EnsemblGenomes-Tr; EFT00001977068.
DR   EnsemblGenomes-Tr; EFT00001977069.
DR   EnsemblGenomes-Tr; EFT00001977070.
DR   EuropePMC; PMC4381506; 25834639.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 120222; 0.
XX
CC   This is an updated version of the complete genome sequence. The
CC   Debaryomyces hansenii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium.
CC   For more information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1249940
FT                   /organism="Debaryomyces hansenii CBS767"
FT                   /chromosome="A"
FT                   /strain="CBS767"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Deha2A"
FT                   /db_xref="taxon:284592"
FT   gene            complement(<2023..>6370)
FT                   /locus_tag="DEHA2A00110g"
FT                   /old_locus_tag="IPF_45719.1-45741.1"
FT   CDS_pept        complement(join(2023..6069,6191..6370))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00110g"
FT                   /old_locus_tag="IPF_45719.1-45741.1"
FT                   /product="DEHA2A00110p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65341"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSN5"
FT                   /protein_id="CAR65341.1"
FT                   /translation="MRRAASYRFGCELFFFMVVNGYHHKSSQRSSQRSSRSGFWTSTTA
FT                   PSQPFNPALPVLLKPFFERYGDDGVQEPRDEHYMSHEEYEETYAAQFSYEFGSTKDTKL
FT                   RDVSETPINYDVSDYYFDPQLGLGIHKEIGLVVVFHRDPRKNYIIRSLLFERYAQAIMC
FT                   KMTSFRGALQLSRAKDELSSKLVLSCEMGEPGLEHARGKLSPQCMPLQAVPIHFGFGCG
FT                   CGIIRRRYGELSRHSCIQRDSIRPMAFQKFPQRYGLRPANFEVYCPTDDGYVEARARDG
FT                   PASSSSSSSSSSSSSSLSGTATTVQNHSRTTTVPDSQHHPLVKKILQEVDREIVDIQVK
FT                   GMKEANFVPKIAQLLVGAMTLFSANINHVNLAGLEVVRLFKGAANNTGRASNNFNRRPS
FT                   TYFRAVQTYSTCVQYSKYMAELVYMVLMYGPKPAASLALTEMLDKYRDDEVVLEVNSRD
FT                   YHNLTGYSQFITAEERTRILDQTFTESSLRDIDQLVHWIMDHCIRKEFDENLSVAGDEQ
FT                   QQQPDIDIESDAIAAGILDEDGDDNNETPEVYLEAMNTTMSSSQQQTAAESLASLYYPV
FT                   YGVNNNAEEEEEQNTSNENAFVVYLGYLGAKYPTKQYCRSLSGICYVAKTCVLLDIIKR
FT                   ARTRRVSLRDAEDPSVVDTGSYRILAQVRTHYTYLGLSLARSEGNLFRLNFSTGDIFNS
FT                   DNVVVGHTNMISKIFGRLYDLAQETIQDLSNGEELDYSVDNARLSDGMVSFTECVRVPS
FT                   YSRYKHRLLSIHNNNIDSFRKAHTNLSLILITLLHISCLPARSTEIDRLSVEGTSKEYR
FT                   GVYFLGPTFGFCYNYNKSANSKDPIIREIGPELSSLFLWYVLVFRRMYVESSRVESSEK
FT                   LYQFDAMSPDKIRRGVSYWFTYGMNNQREYKFCEVRQILKRCIEFHYTKSVTADLDMYR
FT                   SVYETIARTSGHSVATSTEHYGTIANYPPSVNAADVLRSRHLGQVWHRSGLRRKFIGFE
FT                   GEVVEPEGEPGDVDDVASDVSIDPASPVNEEVEEVEPLRDDIGGNPVYADDEVDSISDM
FT                   LMEIPRIDYNRAVGSDPTPVPPLEPSAVPPSEPPAPSRSVPVSAPDAPPVSVSWNDSSL
FT                   SPNHASSPYVHQLPGYRPPFSPPYHHAPVSSGFALPPQDAYLGAPLYDAHVSREVLSGA
FT                   RKRHSREKKERKERKMERKRKEKERISKREEDIRKREEKIRKREEKEKIRKREKREKRE
FT                   RKRAEEKREKESAALASPVTPVRTLKVKDVHLYSSATSGRLFRRESPSGPSGPSSPRAM
FT                   PSGPPTPNSSARRVHPLIYQSSTQSSAVPGSSHPTRVQKQPKQPPSARSLGSPPSFPET
FT                   PRRSLLSPQHLRQRITESLQASPLGRFFAPSDSPKSVARKGPKIPKNDPVVDDSDYSES
FT                   DYSDED"
FT   gene            complement(<6587..>7810)
FT                   /locus_tag="DEHA2A00132g"
FT                   /old_locus_tag="DEHA0A00132g"
FT                   /old_locus_tag="DEHA-IPF2"
FT                   /old_locus_tag="DEHA-CDS3114.1"
FT   CDS_pept        complement(6587..7810)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00132g"
FT                   /old_locus_tag="DEHA0A00132g"
FT                   /old_locus_tag="DEHA-IPF2"
FT                   /old_locus_tag="DEHA-CDS3114.1"
FT                   /product="DEHA2A00132p"
FT                   /note="similar to uniprot|Q03558 Saccharomyces cerevisiae
FT                   YHR179W NADPH dehydrogenase 2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84273"
FT                   /db_xref="GOA:Q6BZN8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZN8"
FT                   /protein_id="CAG84273.1"
FT                   /translation="MTKSFNYQLSTEFKPKSLADTSLFKPIKVGNMNLQHRAVLAPLTR
FT                   FRNHINSIPNPEAMGMYYGQRSSRPGTLVITEATIVSAAAGGYDTAPGIYNQEQIDAWS
FT                   KIFKRVHDNNSYVYLQLWSLGRQSDPANLKKIGKPFVSASDVYSDDRGITSEGVIAEDG
FT                   AIAVNNELRPMTIPEIKQYVNDYAQAARNSLAAGADGVEVHCGNSYMLNQFLDISSNLR
FT                   TDEYGSQTLENRARFALECIDAVVEAVGADKVGVRFAPYGRFGGMSGSDDLTAIALYAY
FT                   IFAELEKRAQQGKRVSYIHLVQARMTDFNINENDESAKFDTEFVYKIWKGVVMKAGAYA
FT                   TDPAAVRREVEVGQTLIAYGRYFISNPDLPDRLALGKPLTKYVRDSFYLPDPIAGYVDY
FT                   PTYKQQDL"
FT   gene            <8314..>9354
FT                   /locus_tag="DEHA2A00154g"
FT                   /old_locus_tag="DEHA0A00154g"
FT                   /old_locus_tag="DEHA-IPF3"
FT                   /old_locus_tag="DEHA-CDS3716.1"
FT   CDS_pept        8314..9354
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00154g"
FT                   /old_locus_tag="DEHA0A00154g"
FT                   /old_locus_tag="DEHA-IPF3"
FT                   /old_locus_tag="DEHA-CDS3716.1"
FT                   /product="DEHA2A00154p"
FT                   /note="weakly similar to uniprot|P00330 Saccharomyces
FT                   cerevisiae YOL086C ADH1 Alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84274"
FT                   /db_xref="GOA:Q6BZN7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZN7"
FT                   /protein_id="CAG84274.2"
FT                   /translation="MSTQTVFRINKGTSYEDISVNKEEIPVPAANEVLIKVKAVSLNYR
FT                   DIAISTGAYPFPVKRDVVPCSDASGEVVSFGHNVRGFEVGDKVVSNFDITNLYGPQQDW
FT                   EGGLGGPIDGVLREYVTLPYESVVKAPSSSKLSFESLASLVCTGTTAWNALYGNNQLKP
FT                   GQIVLLQGTGGVSMTGLLLAKAAGAITILTSSSDEKLERIKAKYGVDYTVNYKKFPKWG
FT                   EAVNQMIGKNRVDYIFENGGSGNIEQSIECIAYGGQIGIIGFLNVAKQSEMPDAVALAL
FT                   SKGCVMRGIAVGSKQLLEELMRFVNSKGLSIPVDKSFKFSKPEVIEAYKHLQSGSQVGK
FT                   VCVTLD"
FT   gene            complement(<9632..>9844)
FT                   /locus_tag="DEHA2A00176g"
FT                   /old_locus_tag="DEHA0A00176g"
FT                   /old_locus_tag="DEHA-IPF4"
FT                   /old_locus_tag="DEHA-CDS7995.1"
FT   CDS_pept        complement(9632..9844)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00176g"
FT                   /old_locus_tag="DEHA0A00176g"
FT                   /old_locus_tag="DEHA-IPF4"
FT                   /old_locus_tag="DEHA-CDS7995.1"
FT                   /product="DEHA2A00176p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84275"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZN6"
FT                   /protein_id="CAG84275.1"
FT                   /translation="MVAKIDHLLALRTLKDIELRIFSTLVLGYATSLKGDPSPICETIS
FT                   PFSQLWSFLNFKCSFIQGGIRFCHL"
FT   gene            complement(<10068..>10696)
FT                   /pseudo
FT                   /locus_tag="DEHA2A00187g"
FT                   /old_locus_tag="DEHA0A00198g"
FT                   /old_locus_tag="DEHA-IPF5"
FT                   /old_locus_tag="DEHA-CDS8047.1"
FT                   /old_locus_tag="DEHA0A00209g"
FT                   /old_locus_tag="DEHA-IPF6"
FT                   /old_locus_tag="DEHA-CDS6368.1"
FT                   /note="no similarity no start frameshift pseudogene"
FT   gene            <11592..>13061
FT                   /pseudo
FT                   /locus_tag="DEHA2A00190g"
FT                   /note="similar to gb|ABN64230.1 Pichia stipitis aromatic
FT                   amino acid aminotransferase"
FT   gene            <13806..>14132
FT                   /locus_tag="DEHA2A00198g"
FT                   /old_locus_tag="DEHA0A00275g"
FT                   /old_locus_tag="DEHA-IPF10"
FT                   /old_locus_tag="DEHA-CDS7264.1"
FT   CDS_pept        13806..14132
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00198g"
FT                   /old_locus_tag="DEHA0A00275g"
FT                   /old_locus_tag="DEHA-IPF10"
FT                   /old_locus_tag="DEHA-CDS7264.1"
FT                   /product="DEHA2A00198p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84280"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZN1"
FT                   /protein_id="CAG84280.2"
FT                   /translation="MLSIFKMPVSTLNQFVPLNLAMEQQNYFSSLPDEFHDNMPGFRLL
FT                   FNSDKMEFKIDGSVGVFKGVNCETDLPVNVSEAKNFISSSHSDHNYYLTTGLSEFVMCS
FT                   FCCS"
FT   gene            complement(<14558..>16519)
FT                   /locus_tag="DEHA2A00220g"
FT                   /old_locus_tag="DEHA0A00297g"
FT                   /old_locus_tag="DEHA-IPF11"
FT                   /old_locus_tag="DEHA-CDS1333.1"
FT   CDS_pept        complement(14558..16519)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00220g"
FT                   /old_locus_tag="DEHA0A00297g"
FT                   /old_locus_tag="DEHA-IPF11"
FT                   /old_locus_tag="DEHA-CDS1333.1"
FT                   /product="DEHA2A00220p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84281"
FT                   /db_xref="GOA:Q6BZN0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZN0"
FT                   /protein_id="CAG84281.1"
FT                   /translation="MNNSTFPNSIRRYILEGGGEDKDMDIDVDADIDLFEITKFNYRTL
FT                   FDKGANQNITHTEMVYKFFGTNKKSEMDMVTLKHKLYFDDHPDEWKELFIFFCVMPFTE
FT                   YEFQGVDGKLLNPDSLHAIGSSHGTDNVLIETFSELEFESFNKIIPEGRLAFNLENILK
FT                   TDIFSSNFNKDETKRILTKLLGVGFKEDYMLVTDISSTDEDTYRLNFMNYLFNPICEYV
FT                   ATLLKFEINIRTKNTAGRTGVNTKVPHQSNDIFHSHPDVVAYDKWKHRRSLAIVEVKKL
FT                   PILKGEKVVDFTESRMVSFIIQVVAEMFSDHTNKGMLTDSYTTILIEIDIERSMDIVNQ
FT                   KLTGPENCKFIALNYRLLDCQSSGLTLRGGLISFIYEAFSANEYQLNDVKRGLDAIYDY
FT                   VRKSDEEYLTYLDGLGEKADKIFKNNYNSFMRKLHVIEPKIALGEFKRIDVQSGVTFNS
FT                   QLFKVNSKDVKMYLKEDIDETVELVVKVFDPAKAKRDHNKYVIKKHDMFDNCRRAYLCE
FT                   KRAYERLLPNFKFNSVYIAQEPVYGRFFIGNHYHALGPFIVLKYLAKETLPRDEETYEK
FT                   AKEQLNIIHLYNIIHGDISPRNILYSQGKVYFIDFGYSEYTEDKLGSNPVSANPERIKS
FT                   EHQQLCGIFGQPNPKEYE"
FT   gene            <17520..>19442
FT                   /locus_tag="DEHA2A00242g"
FT                   /old_locus_tag="DEHA0A00341g"
FT                   /old_locus_tag="DEHA-IPF13"
FT                   /old_locus_tag="DEHA-CDS1407.1"
FT   CDS_pept        17520..19442
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00242g"
FT                   /old_locus_tag="DEHA0A00341g"
FT                   /old_locus_tag="DEHA-IPF13"
FT                   /old_locus_tag="DEHA-CDS1407.1"
FT                   /product="DEHA2A00242p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84283"
FT                   /db_xref="GOA:Q6BZM8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM8"
FT                   /protein_id="CAG84283.2"
FT                   /translation="MYFSGVDSDIIAYNDPENRCIRVNLDLFIKVLNNNEQNTRVFLDT
FT                   HLLKIRGNEDGQDRRAEKLVSKGNASVGLGNMPSIPIVVYSSRALITAEFREMSSDDFK
FT                   ETYLAPLDKALEESNISIPLLAPAYPYPSGDAMHVEQAIQEYFNEIAIPIKGLYRDVGD
FT                   TNNYFGSPSIIRPTLDQRRIVQPDIIHMLTKSDLNTQYPEIVFGIGDYKTGVYKMMQGF
FT                   EEFKTAISNRRRLRSHSLGNFFPDREWSPRVLFALVLSKYIYQAFLCGTDRILISDHQT
FT                   FSGFFRYEIVDGEMIIDYYVINNPETVENGITLRSAIAGFFYKNVADTADTKARLMKSF
FT                   DIANNTGIKKLEESDPFFNVRPRDPSGSSGKLARRGFSGNLDSVKENDASDNFDAIDGN
FT                   TYCRVIYDSAEFYPDLKLPSPVFVKLYYYSSRLWEENSLMCLEIPEKEGYYGMFFNELL
FT                   INERIAKSEFASNFPKLLVSGYWNGLSDHPMHIFEYLGKEVPEEKWNNKEVYKVIKSRL
FT                   EELHSIGISHNDIRLANIHVSVSGKISLIDFGLSDYTNNEEHKKNDFETLEYILRANGS
FT                   NESFKHANRVNAKSEAIPADRADKNDKYGNDSNSSSEEVFDEGSSGTFGTQITIEDIAS
FT                   KPSRR"
FT   gene            complement(<21299..>22077)
FT                   /pseudo
FT                   /locus_tag="DEHA2A00253g"
FT                   /old_locus_tag="DEHA0A00363g"
FT                   /old_locus_tag="DEHA-IPF16"
FT                   /old_locus_tag="DEHA-CDS6177.1"
FT                   /old_locus_tag="DEHA0A00374g"
FT                   /old_locus_tag="DEHA-IPF17"
FT                   /old_locus_tag="DEHA-CDS8670.1"
FT                   /note="no similarity frameshift pseudogene"
FT   gene            complement(<22619..>23977)
FT                   /locus_tag="DEHA2A00264g"
FT                   /old_locus_tag="DEHA0A00396g"
FT                   /old_locus_tag="DEHA-IPF18"
FT                   /old_locus_tag="DEHA-CDS2625.1"
FT   CDS_pept        complement(22619..23977)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00264g"
FT                   /old_locus_tag="DEHA0A00396g"
FT                   /old_locus_tag="DEHA-IPF18"
FT                   /old_locus_tag="DEHA-CDS2625.1"
FT                   /product="DEHA2A00264p"
FT                   /note="similar to uniprot|O94091 Candida albicans LIP1
FT                   Lipase 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84286"
FT                   /db_xref="GOA:Q6BZM5"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM5"
FT                   /protein_id="CAG84286.2"
FT                   /translation="MRLIIIVLSAIFCNIVCGAPAIPLKPRGLPTKPSEDPFYIAPEGF
FT                   ESKSPGDVLKHREMNNSFGIVVIPEKIKSVHQFLVRSEDSFGEPIAAVTTIFEPYNADP
FT                   TKLLSYQAAEDAANIDCSPSYAMQLGADADTILTAQIEQLLAQAGLNEGWYVVIPDHQG
FT                   PKSTFVVGESAGHIVLDSIRATLRSGNITGIHEDAKVTLWGYSGGSFASGWAAQMHPTY
FT                   ASELKIVGAAYGGIVANISQVAEKNFGGPFTGFVMAAINGLANEYPKLDNLINEIGYKD
FT                   KLDKFRKATQMCLIEELPYYAFDQVSEYVDGDKQYLLSLPIVKNITEKNTMIGSKYLPT
FT                   IPLYFYQGKGDEIIPASGTDELHNDFCERGVDIDYHEDLLSEHIIQAVTGAGGAFNWMR
FT                   DRLNGKPHTQGCNKEITASNAITPEGLSGLGDIFSGAILTLFQKPIGPYEDVL"
FT   gene            <24949..>25434
FT                   /locus_tag="DEHA2A00286g"
FT                   /old_locus_tag="DEHA0A00418g"
FT                   /old_locus_tag="DEHA-IPF20"
FT                   /old_locus_tag="DEHA-CDS5927.1"
FT   CDS_pept        24949..25434
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00286g"
FT                   /old_locus_tag="DEHA0A00418g"
FT                   /old_locus_tag="DEHA-IPF20"
FT                   /old_locus_tag="DEHA-CDS5927.1"
FT                   /product="DEHA2A00286p"
FT                   /note="some similarities with uniprot|Q9P559 Neurospora
FT                   crassa Hypothetical 35.0 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84287"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM4"
FT                   /protein_id="CAG84287.2"
FT                   /translation="MVSTMTNTDNDKCMKYRVVRGTDSGYTSKLVASCSFKKGEVLEII
FT                   TGATLGMKRYTTVQISEKEHIELNSDIVYLNHSCDPTCIMDVKNMLVRLIKDVPVGGEL
FT                   TFFYPSTEWDMDQPFRCWCKSSSCIETVNGARYLSKELLNNYFINEHILALHDKNSG"
FT   gene            complement(<26440..>26640)
FT                   /locus_tag="DEHA2A00308g"
FT                   /old_locus_tag="DEHA0A00462g"
FT                   /old_locus_tag="DEHA-IPF22"
FT                   /old_locus_tag="DEHA-CDS8997.1"
FT   CDS_pept        complement(26440..26640)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00308g"
FT                   /old_locus_tag="DEHA0A00462g"
FT                   /old_locus_tag="DEHA-IPF22"
FT                   /old_locus_tag="DEHA-CDS8997.1"
FT                   /product="DEHA2A00308p"
FT                   /note="some similarities with uniprot|Q9HFS1 Candida
FT                   albicans Glycosyl-phosphatidylinositol protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84289"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM2"
FT                   /protein_id="CAG84289.1"
FT                   /translation="MLSLDLLATTVITFYISSAQAETTNQCVTFPSVAKAASINGFAYN
FT                   IYNNLPECARPCVEEDTGCML"
FT   gene            complement(<26756..>26962)
FT                   /locus_tag="DEHA2A00330g"
FT                   /old_locus_tag="DEHA0A00484g"
FT                   /old_locus_tag="DEHA-IPF23"
FT                   /old_locus_tag="DEHA-CDS7161.1"
FT   CDS_pept        complement(26756..26962)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00330g"
FT                   /old_locus_tag="DEHA0A00484g"
FT                   /old_locus_tag="DEHA-IPF23"
FT                   /old_locus_tag="DEHA-CDS7161.1"
FT                   /product="DEHA2A00330p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM1"
FT                   /protein_id="CAG84290.2"
FT                   /translation="MGDTSWPADIDEDKNNSNISDDNFFFNRKIKCGFFVIYGSSIVRL
FT                   SELYKGCSRILNTFNPDRISNCS"
FT   gene            complement(<27281..>27835)
FT                   /locus_tag="DEHA2A00352g"
FT                   /old_locus_tag="DEHA0A00506g"
FT                   /old_locus_tag="DEHA-IPF24"
FT                   /old_locus_tag="DEHA-CDS5544.1"
FT   CDS_pept        complement(27281..27835)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00352g"
FT                   /old_locus_tag="DEHA0A00506g"
FT                   /old_locus_tag="DEHA-IPF24"
FT                   /old_locus_tag="DEHA-CDS5544.1"
FT                   /product="DEHA2A00352p"
FT                   /note="similar to uniprot|Q9HFZ1 Candida albicans Repressed
FT                   by TUP1 protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84291"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZM0"
FT                   /protein_id="CAG84291.2"
FT                   /translation="MKCLSLVTVYSSFIALARANNWATYPSVAKSASINGFADPIYTKL
FT                   PECGQECVDIPTDNTPCPYWDTGCFCVMPQWAGLIGECFASKCSGDDVASATSLALSLC
FT                   SSVGANMFLVPASITAVLNEAAAGKAQQEATTTDSSASSTSISESSIQSGSESTTENLA
FT                   MMSANYDILSVIVVLLATLFL"
FT   gene            <28170..>30078
FT                   /pseudo
FT                   /locus_tag="DEHA2A00363g"
FT                   /note="similar to uniprot|Q9HFZ1 Candida albicans Repressed
FT                   by TUP1 protein 5"
FT   gene            complement(<30389..>31498)
FT                   /locus_tag="DEHA2A00374g"
FT                   /old_locus_tag="DEHA0A00572g"
FT                   /old_locus_tag="DEHA-IPF30"
FT                   /old_locus_tag="DEHA-CDS3469.1"
FT   CDS_pept        complement(30389..31498)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00374g"
FT                   /old_locus_tag="DEHA0A00572g"
FT                   /old_locus_tag="DEHA-IPF30"
FT                   /old_locus_tag="DEHA-CDS3469.1"
FT                   /product="DEHA2A00374p"
FT                   /note="weakly similar to uniprot|P36081 Saccharomyces
FT                   cerevisiae YKL077w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84295"
FT                   /db_xref="GOA:Q6BZL9"
FT                   /db_xref="InterPro:IPR028000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL9"
FT                   /protein_id="CAG84295.2"
FT                   /translation="MKLSNLFLVFWIETVLSLLLPLHKEDLVKYLEKRASKTTTLEKEV
FT                   WTTITGTKHTTITPFAFDGATVSASPIGDETTPWVSLDSSGVPYKVTPTVKDGKTTSPS
FT                   PTPTNTNFPTPLAAPPVLRCMGDRVADGNPFCIGEGAEFVVDETYWITWDPLYFNPDND
FT                   SEGISKVKIKVRPFPNNESTSPIETSDWLENKDGFYAWTIESSDIDSDMDGYAQIYLSP
FT                   FRTSDTDSEEEDTAIGPVVRLISSKGDAYTKISRVPSDNNDENDSSDKKDDGGSSNKAK
FT                   IIVPAVVVPVFSIFLIAGAVFYYLLKKRKNAINKSSNSIKLGIFGKNKGYVGSRSQRMG
FT                   ESELTETKSQDSSYSNKADGKSDQNTFKG"
FT   gene            <32152..>32877
FT                   /locus_tag="DEHA2A00396g"
FT                   /old_locus_tag="DEHA0A00594g"
FT                   /old_locus_tag="DEHA-IPF31"
FT                   /old_locus_tag="DEHA-CDS4898.1"
FT   CDS_pept        32152..32877
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00396g"
FT                   /old_locus_tag="DEHA0A00594g"
FT                   /old_locus_tag="DEHA-IPF31"
FT                   /old_locus_tag="DEHA-CDS4898.1"
FT                   /product="DEHA2A00396p"
FT                   /note="weakly similar to uniprot|P28319 Saccharomyces
FT                   cerevisiae YKL096w CWP1 cell wall mannoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL8"
FT                   /protein_id="CAG84296.2"
FT                   /translation="MVRIIPLIIGLISSAICVSSSSFEFVLSSLNLDSEIQFDTYSLLK
FT                   YNGEGIVGLYADCDTCYNFTGLITDEGYFEITESSEGVFANSRYLNIDQTTGLFTVNET
FT                   ADTNVYVISTHLLYTNSSVDYTILEVEENKTYHLYFSDIKFDVADLGNSFSSILNTIYP
FT                   NGSTYISYSPTDASETASISSIDNVSPSTKTASASSASSYTTDQSSSSTAGVSYQYKKD
FT                   IGVSGLVTLAFGYVLIYGF"
FT   gene            <33674..>34576
FT                   /locus_tag="DEHA2A00418g"
FT                   /old_locus_tag="DEHA0A00616g"
FT                   /old_locus_tag="DEHA-IPF32"
FT                   /old_locus_tag="DEHA-CDS4236.1"
FT   CDS_pept        33674..34576
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00418g"
FT                   /old_locus_tag="DEHA0A00616g"
FT                   /old_locus_tag="DEHA-IPF32"
FT                   /old_locus_tag="DEHA-CDS4236.1"
FT                   /product="DEHA2A00418p"
FT                   /note="weakly similar to uniprot|P22134 Saccharomyces
FT                   cerevisiae YER142c MAG1 3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84297"
FT                   /db_xref="GOA:Q6BZL7"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL7"
FT                   /protein_id="CAG84297.2"
FT                   /translation="MPNKETRNVRSLRKRVKKEYTEDDDEYYEETPKEKKAKLVKTSSK
FT                   KGAPSSYSGDSKEVLGNNSFEKAIALFEKTDPALSDFIKSCDDPNTLMDVKMNAYQTLV
FT                   KIIISQQLSTSAARSIMTKFIKLFLKEGESTEPDHQFKAHPHFPTPEIVKETSPERLRS
FT                   AGISFRKAGYLLIISEKFSDKNYLLNDDKKLNDMSNEDIARLLIDLKGIGPWAVDIFLL
FT                   LYMKRSDIFPISDAGIRKGLSMLIQNTSGKKGKKLNYLSIEEMEKYSENWKPYRSVASW
FT                   YLMKVSSPERVKGYLKIRE"
FT   gene            complement(<35065..>36033)
FT                   /locus_tag="DEHA2A00440g"
FT                   /old_locus_tag="DEHA0A00638g"
FT                   /old_locus_tag="DEHA-IPF33"
FT                   /old_locus_tag="DEHA-CDS3992.1"
FT   CDS_pept        complement(35065..36033)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00440g"
FT                   /old_locus_tag="DEHA0A00638g"
FT                   /old_locus_tag="DEHA-IPF33"
FT                   /old_locus_tag="DEHA-CDS3992.1"
FT                   /product="DEHA2A00440p"
FT                   /note="weakly similar to uniprot|P41903 Saccharomyces
FT                   cerevisiae YJR019C TES1 Thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84298"
FT                   /db_xref="GOA:Q6BZL6"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL6"
FT                   /protein_id="CAG84298.1"
FT                   /translation="MKPGTRIENRFELIEKSDTVYEGARPLEKFLEQNRSVYGGEFISQ
FT                   AMYAAWKTIPGEEFTPNSLHAYFLKVGNNGSVIRYEVKKTNDGKNFCNRTVECYQTETN
FT                   ALCVVYMMSFSKKNDRNKLRSDHKSLEEGKFSLDFQKKPNFYFDKYVKTIDNINYIEHT
FT                   HEFFHHALPPEFFDTRLPPNYKNVSLSDREFGMFFRVNDDLTVAKDVIKSKFLLLSYIS
FT                   DSFYLPSIYRALGHPIGPGMMKDVNISLDHCVNFHDVNFDPTQWMFMSWSYDRMVNNRV
FT                   LVNCFIYTLDGTMVASIRQEGLSFISKETLLGSDAPGIPKL"
FT   gene            <36268..>37098
FT                   /locus_tag="DEHA2A00462g"
FT                   /old_locus_tag="DEHA0A00671g"
FT                   /old_locus_tag="DEHA-IPF40087"
FT   CDS_pept        36268..37098
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00462g"
FT                   /old_locus_tag="DEHA0A00671g"
FT                   /old_locus_tag="DEHA-IPF40087"
FT                   /product="DEHA2A00462p"
FT                   /note="similar to uniprot|Q05871 Saccharomyces cerevisiae
FT                   YLR284c ECI delta3-cis-delta2-trans-enoyl-CoA isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84299"
FT                   /db_xref="GOA:Q6BZL5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL5"
FT                   /protein_id="CAG84299.2"
FT                   /translation="MSEGKDILYEVREKVTIITLNNPKKLNSLDKPQYILLAKLMEKAD
FT                   KEEGTVLTILQSTGRYFSAGAQLGGKDMLNLDPSVLLSHEYWLNEFVSKNVFLTDVFHN
FT                   HTKVLAAAVNGPIIGVSAAMVALCDLVYVMDETKMHIITPFTALGLVAEGASSSTFFLR
FT                   LGWSKAAEAIILAKPIPGTELNKLGFINKSYHETNFDSVEQFNQKVHDDLVSQFSGLYE
FT                   PSILANKQLLKANRDQLINSASSREVIKTFNNFVQGIPQSRFMEKMQQARENKM"
FT   gene            complement(<38481..>39377)
FT                   /locus_tag="DEHA2A00484g"
FT                   /old_locus_tag="DEHA0A00693g"
FT                   /old_locus_tag="DEHA-IPF38"
FT                   /old_locus_tag="DEHA-CDS4824.1"
FT   CDS_pept        complement(38481..39377)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00484g"
FT                   /old_locus_tag="DEHA0A00693g"
FT                   /old_locus_tag="DEHA-IPF38"
FT                   /old_locus_tag="DEHA-CDS4824.1"
FT                   /product="DEHA2A00484p"
FT                   /note="weakly similar to uniprot|Q0CUF0 Aspergillus terreus
FT                   Predicted protein ATEG_02684"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL4"
FT                   /protein_id="CAG84300.1"
FT                   /translation="MKFDTVILISLAALATSQNANTITESQAEIVVKKQLDSRSFGLKD
FT                   FLSDHMPWSGKKNWKDHEGKQHWNDNDGKEHWKDHDGNDCWNDKDGKKHWKDHEGKEHW
FT                   NDNDGKEHWKDRDGNDCWNDKDGKKHWKDHEGKKHWKDHEGKEHWKDHDGKEHWKDHDG
FT                   NDCWNDKDGKKHWKDHEGKEHWNDKDGKEHWKDHEGNDCWNDKDGKKHWKDHEGKEHWK
FT                   DHEGKKHWKDHEGKEHWNDKDGKEHWKDHDGNDCWNDKDGKKHWKDHEGKEHWKDQDGK
FT                   EHFYKPPIAMKRSNFQI"
FT   gene            complement(<41695..>43455)
FT                   /locus_tag="DEHA2A00506g"
FT                   /old_locus_tag="DEHA0A00759g"
FT                   /old_locus_tag="DEHA-IPF45"
FT                   /old_locus_tag="DEHA-CDS1712.1"
FT   CDS_pept        complement(41695..43455)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00506g"
FT                   /old_locus_tag="DEHA0A00759g"
FT                   /old_locus_tag="DEHA-IPF45"
FT                   /old_locus_tag="DEHA-CDS1712.1"
FT                   /product="DEHA2A00506p"
FT                   /note="weakly similar to uniprot|P53283 Saccharomyces
FT                   cerevisiae YGR138C TPO2 Polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84303"
FT                   /db_xref="GOA:Q6BZL1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL1"
FT                   /protein_id="CAG84303.1"
FT                   /translation="MSMQSSKLRDDSQTFIDDTSINSEKVHAFEGHNADVQPVIRQRSN
FT                   SKIEDRESLSKLISNNKGVERIVSELEEGAGKLGGLEEPLDLKRIETHPDPNSSFNEKD
FT                   PWKYPIDQETGLRLVEFVPGDKKNPLNISKARKWFYTFLLGIICFVVALGSAIVTGDIS
FT                   GPKEYFGVTEEIIILASVTMFVLGFGFGPCLFAPLSEEIGRQPVYVGTLFLGVIFIIPC
FT                   ALAQNIETLIICRLIDGLAFSAPMCLIGGSLADIWEASERGAAMAVFSAAPFLGPVVGP
FT                   IFGGLLGDNAPTWRWIYWCFLIIAGFFYVIFALAVPETHHNTILKRRAKKLRKNTGDDR
FT                   YRAIVELKIKNFKQVCNESLLRPFILLSELIIFLITLYMSVIYGLLYMFFFAYPMVYGE
FT                   GKGWSDSMVGVMFIPIGVGVVISSLIAPFVNRDYNKRAQVYRDKGELPPAELRLIPMMY
FT                   SCWFVPAGLFSFAWSSYPSVSWAGPCFSGLAVGFGFTCLYNPANNYIVDSYQHFAASGL
FT                   AAKTFVRSMWGACVPLFTIQMYHRLGYEWASSLMAFISLACCAIPFGFYYYGARIRTYS
FT                   KYAYSPDSIN"
FT   gene            <44416..>44841
FT                   /locus_tag="DEHA2A00528g"
FT                   /old_locus_tag="DEHA0A00781g"
FT                   /old_locus_tag="DEHA-IPF46"
FT                   /old_locus_tag="DEHA-CDS6262.1"
FT   CDS_pept        44416..44841
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00528g"
FT                   /old_locus_tag="DEHA0A00781g"
FT                   /old_locus_tag="DEHA-IPF46"
FT                   /old_locus_tag="DEHA-CDS6262.1"
FT                   /product="DEHA2A00528p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84304"
FT                   /db_xref="GOA:Q6BZL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZL0"
FT                   /protein_id="CAG84304.1"
FT                   /translation="MKYATTTVTIGGTTSDGAYSNSFPIQTLTAIVPQSADLVVEPYGI
FT                   FIAASQIDDLVPKWSVEKWYSQTATIWPSGKTSNTEGITYVENVPLGVNEYLDENGIYL
FT                   DATKFKGKDTSGGNQRLDKSMLFISLVIVLLLVTLTV"
FT   gene            complement(<45263..>46792)
FT                   /locus_tag="DEHA2A00550g"
FT                   /old_locus_tag="DEHA0A00803g"
FT                   /old_locus_tag="DEHA-IPF48"
FT                   /old_locus_tag="DEHA-CDS2267.1"
FT   CDS_pept        complement(45263..46792)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00550g"
FT                   /old_locus_tag="DEHA0A00803g"
FT                   /old_locus_tag="DEHA-IPF48"
FT                   /old_locus_tag="DEHA-CDS2267.1"
FT                   /product="DEHA2A00550p"
FT                   /note="similar to CA2211|IPF13921 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84305"
FT                   /db_xref="GOA:Q6BZK9"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK9"
FT                   /protein_id="CAG84305.2"
FT                   /translation="MNKKAFSDSNDRVITHTNDDVASAPHYQSQSTSSEAAMNEDEQQL
FT                   TDSEGEDEFIRRHGHIDFQYIKKPKDAVWFIRPHALNYFKDGVLYRTKGERTSAKTELF
FT                   LDLMYVGIISNLAGHATENASGGALLMYVLLFVPAWVVWADIKDFTNYYYTEDLSQKVY
FT                   IIWILILLTLFVNSSSDVLNGIKGAAFTIVPYILCRVSLAISLLIYSLYIPEHRTQMRI
FT                   YSVCIFITSCIWIPVIFISTRAKIGVAIAVLFLEQLSFTVVYHPQTKRLLKLTTSTALN
FT                   IEHEIERFATFVTIAIGEFLYKVVATNPLGTGFSSKFARGTFLLLIAYILFWIYNNGSN
FT                   SKKATHALRNNGWTAITWIYCHLPLVASLVLGADAGGDLTSLDITSLSKHQEESVLERS
FT                   SEEEPNMYALSFFFTGSICVSLLCMCIIGLADKNEDPPNLHIVSRFWRVIWRAPIGIII
FT                   VLLSFAELDSTLLMGIVTILLAVLLVYESIVSTPQDCINYPLARKRSLTLE"
FT   gene            complement(<47242..>48924)
FT                   /locus_tag="DEHA2A00572g"
FT                   /old_locus_tag="DEHA0A00825g"
FT                   /old_locus_tag="DEHA-IPF50"
FT                   /old_locus_tag="DEHA-CDS1880.1"
FT   CDS_pept        complement(47242..48924)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00572g"
FT                   /old_locus_tag="DEHA0A00825g"
FT                   /old_locus_tag="DEHA-IPF50"
FT                   /old_locus_tag="DEHA-CDS1880.1"
FT                   /product="DEHA2A00572p"
FT                   /note="similar to uniprot|P53389 Saccharomyces cerevisiae
FT                   YNR055C HOL1 Putative ion transporter similar to the major
FT                   facilitator superfamily of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84306"
FT                   /db_xref="GOA:Q6BZK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK8"
FT                   /protein_id="CAG84306.2"
FT                   /translation="MSFLKLLFKNNDLGEEIPGTIHLIDVDQVPGISKVDSAKGNQNIM
FT                   LHPRPSSNPNDPLRWSHRKKKSQLFLLTFWAFIQNISSVWTGPVYDTWVDEFNCTYNQL
FT                   NIASGLVFVAIAVGCTTLQPIALKYGKRIVYIGCTILQIIGNIVYSQAHNVETTYIASA
FT                   LVGFAAAPIYSLVEISSTDIFFQHERAENISWLVLALQSGCALGPLAAGFITESLNWRW
FT                   CCYIMVIIFSVLLIIQIFTMEDSTFQREESPEELEENIVMQIRSHETFANSMQRQPSSQ
FT                   NKKRDNHTVHIEPDIQYVDPSIPKRTYLQRLRLIENEFNDPTSIIVIFLKPFYLVSFPI
FT                   VVWCGILQGIQQMWLTLMTCTQSEFYSSAPYNFSSSMVGLSNLGQLVGIVAGMAYGGKF
FT                   VDWLTIQLAKRNNGIMEPEFRLYSMAFPTLINATGILTYCLGPAYKAHWFLSVGVGQCC
FT                   LGFAMASVTSICYTYCSDSYPKLASEGIVFISFLNNALATVFTFTIQSWIDKDGLKLMA
FT                   WLMFMLSLVLNGSFIVWVFYGKRVRRWTKNKYYQFCDDAGNHP"
FT   gene            complement(<49426..>51093)
FT                   /locus_tag="DEHA2A00594g"
FT                   /old_locus_tag="DEHA0A00847g"
FT                   /old_locus_tag="DEHA-IPF51"
FT                   /old_locus_tag="DEHA-CDS1920.1"
FT   CDS_pept        complement(49426..51093)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00594g"
FT                   /old_locus_tag="DEHA0A00847g"
FT                   /old_locus_tag="DEHA-IPF51"
FT                   /old_locus_tag="DEHA-CDS1920.1"
FT                   /product="DEHA2A00594p"
FT                   /note="similar to uniprot|P05066 Saccharomyces cerevisiae
FT                   YOR386W PHR1 DNA photolyase involved in photoreactivation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84307"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK7"
FT                   /protein_id="CAG84307.2"
FT                   /translation="MEPASKKTKLEELSKFGSKYYPYDIDNKTIISKYIKREDLKPINV
FT                   LEAKLNDTRANRNNIDVGDSIAHLFLRDFRTIDNKGLSIASELATTTKTPLITFHIFCL
FT                   EEFDAHSVSPFKLEYMLGSLDVLKKDLREMNIPLVSLQVEKRKDVPTKIAEFLEQNNTS
FT                   HVFCNMEYEVDELRLLSKLVCFLLDKHISFNPVHDSCIVKPGELKTKSKGTQYAVFTPW
FT                   YKAWCNYLKIEDAPFMEYPRPHANESFSDPNKLFDSEIPQVPESKRLTHDQQKEFDTCW
FT                   KCGEHEAWSALSVFLESDKFKKYDESRNEISEESVSRMSCPISSGIISTRSIIRYILEN
FT                   KFVKKIDSGEQGTGWIRQIAWRDFYRHILCNWPYVCMFKPFLLEYDDLNWEYNSDHFYK
FT                   WCQGKTGFPIVDAAMRQLNQTGYLHNRCRMIVASFLSKHLLIDWKYGEYYFMEHLIDGD
FT                   FASNNGGWGFSSSTGVDPQPYFRIFNPWLQSERFDKKGTYIRTWVPELKDIQDEKGIHN
FT                   PYEKGYGHIAEKNGYPKPIVDHKYCRERALNRFKDAKY"
FT   gene            complement(<51402..>52457)
FT                   /locus_tag="DEHA2A00616g"
FT                   /old_locus_tag="DEHA0A00869g"
FT                   /old_locus_tag="DEHA-IPF52"
FT                   /old_locus_tag="DEHA-CDS3661.1"
FT   CDS_pept        complement(51402..52457)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00616g"
FT                   /old_locus_tag="DEHA0A00869g"
FT                   /old_locus_tag="DEHA-IPF52"
FT                   /old_locus_tag="DEHA-CDS3661.1"
FT                   /product="DEHA2A00616p"
FT                   /note="similar to uniprot|Q12525 Saccharomyces cerevisiae
FT                   YLL062C MHT1 S-methylmethionine-homocysteine
FT                   methyltransferase or uniprot|Q08985 Saccharomyces
FT                   cerevisiae YPL273W SAM4 S-adenosylmethionine-homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84308"
FT                   /db_xref="GOA:Q6BZK6"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK6"
FT                   /protein_id="CAG84308.1"
FT                   /translation="MINDINTLINTKPLVIDGALGTQLETKFSKLLQQDNINIQTHPLW
FT                   SALVLLKNPELIQEVHYDYMCSGANIITTSTYQASKRGLLEYAPGIENDDEVNAVYDKA
FT                   IELAVDARSQYLENMGKGMNTLTNKEIFICGSIGPFGAYLANGAEYTGKYGSHITEPQE
FT                   LKKFHYDITSQFISNPKCDIIGFETIPNYSEFQQIVHLMEELLQKTNKPFYISLNFKDP
FT                   KTICDGTPITQVVDYLNERLSNNEKLRSAFIGLGCNCVPLEIATNILLNMSDLNNVHRF
FT                   PLIAYPNAGLNYDLSKGEYSIKSSEKQVWEDSCREWLEKLNVRLVGACCGSGPDEILTI
FT                   REVTDKFAGQR"
FT   gene            <52704..>54347
FT                   /locus_tag="DEHA2A00638g"
FT                   /old_locus_tag="DEHA0A00891g"
FT                   /old_locus_tag="DEHA-IPF57"
FT                   /old_locus_tag="DEHA-CDS1845.1"
FT   CDS_pept        52704..54347
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00638g"
FT                   /old_locus_tag="DEHA0A00891g"
FT                   /old_locus_tag="DEHA-IPF57"
FT                   /old_locus_tag="DEHA-CDS1845.1"
FT                   /product="DEHA2A00638p"
FT                   /note="similar to uniprot|P32487 Saccharomyces cerevisiae
FT                   YNL268W LYP1 Lysine permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84309"
FT                   /db_xref="GOA:Q6BZK5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK5"
FT                   /protein_id="CAG84309.2"
FT                   /translation="MSEVVTNSLEKKLSEVLNHELSLNENDQEEERGKTNVERSLKSRH
FT                   LSMIALGGTIGTGLFISTSVPLNEAGPVNCLIAYIFIASVVYSVAQSLGEMATYIPVAG
FT                   SFTVFASRFVSPSIGAASGWLYWFCWAIGFAIELSVIGQIIEYWTSAVPNAAWIAIFFV
FT                   LLTVANLFPVRFYGEIEFWISSIKVITIMGWILYALIMVCGGGKYGAFGFRYWRNPGPW
FT                   GDGILVDNKNTGRFLGWFSSLINAIFSYQGTELVGVSAGECENPRKTVPSAIKKVFYRI
FT                   AIFFILSLFFMGLLVPYNDPKLNSETTYIASSPFVIAIQNSGTPVLPDIMNAVILTTII
FT                   SAGNSDIYIASRTLYALANDKLAPRIFTLTINGIPYYSVLFSSLLGLLGFLSLSAKGLV
FT                   AFNWLVNISATSGLFAWVFISFSHIRFIKGLKLKGIVRSEELPFVAKGMPIYAWYSVSV
FT                   ITFLIFFQGYEVFVGKFSVAEFFAAYISNIFFVILFVFFQFVWFRNTKFLVPLEEMDID
FT                   TGKMPFFDYEMKNETSSGKQKREKLWNIIA"
FT   gene            <54756..>55436
FT                   /locus_tag="DEHA2A00660g"
FT                   /old_locus_tag="DEHA0A00913g"
FT                   /old_locus_tag="DEHA-IPF58"
FT                   /old_locus_tag="DEHA-CDS5087.1"
FT   CDS_pept        54756..55436
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00660g"
FT                   /old_locus_tag="DEHA0A00913g"
FT                   /old_locus_tag="DEHA-IPF58"
FT                   /old_locus_tag="DEHA-CDS5087.1"
FT                   /product="DEHA2A00660p"
FT                   /note="weakly similar to uniprot|Q9R6H5 Agrobacterium
FT                   tumefaciens TIORF84 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84310"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK4"
FT                   /protein_id="CAG84310.1"
FT                   /translation="MGIKLYELRGKDPKYLWSSNPWKARMCLKLKGIEFESVPLTYPEI
FT                   HAILPGILHKENGCTVPVLVDGENVIQDSFKIAQYLEEKYTGASIFQGNLALHEFIYNW
FT                   IAEIKEPLFKLVILDIANKLDYESKEYYIKKNTALYGDLSTAALKDREVNVKRIQKNLN
FT                   LLLDNLKQNTFLSGETIGWTDISLASFLYMIKLANESVLNEVIASTDQDLFNGWWNNMS
FT                   KLMV"
FT   gene            <55808..>56890
FT                   /locus_tag="DEHA2A00682g"
FT                   /old_locus_tag="DEHA0A00935g"
FT                   /old_locus_tag="DEHA-IPF59"
FT                   /old_locus_tag="DEHA-CDS3572.1"
FT   CDS_pept        55808..56890
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00682g"
FT                   /old_locus_tag="DEHA0A00935g"
FT                   /old_locus_tag="DEHA-IPF59"
FT                   /old_locus_tag="DEHA-CDS3572.1"
FT                   /product="DEHA2A00682p"
FT                   /note="similar to uniprot|P54007 Saccharomyces cerevisiae
FT                   YLR460C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84311"
FT                   /db_xref="GOA:Q6BZK3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK3"
FT                   /protein_id="CAG84311.2"
FT                   /translation="MTTTIAAVLQKSTSQLQVKEVPVAPINSDEILIESKAASINGTDY
FT                   YHIDYDWAPDGAIMGLTVSGIVLKVGKDVKRFGPGDFIASFIHGGDYSNPDKGAYSKFA
FT                   IVQEVYSIKLNELSSSNLQILQSGNIDTFEGACSIPDAIITLGCSLYFTLGGSFSQLQN
FT                   KSLLIYGGSTATGLVASQIAKQFGWTVISVASKKHATLIKGFGADYLIDYHDSNVMQQI
FT                   KNIDPNITMALHTIGGIATLQLTHDSVSDVMPTKIDSLVASNFEAIKNPKSNVEFTMTR
FT                   AFTANGNEARYNNGSVFPAIPGIKEAMLEFIPTIQKSINNNEIKHIPIKIQPNGLNGIN
FT                   DGLKLIREGEISGEKLVIQF"
FT   gene            complement(<57034..>58488)
FT                   /locus_tag="DEHA2A00704g"
FT                   /old_locus_tag="DEHA0A00957g"
FT                   /old_locus_tag="DEHA-IPF60"
FT                   /old_locus_tag="DEHA-CDS2554.1"
FT   CDS_pept        complement(57034..58488)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00704g"
FT                   /old_locus_tag="DEHA0A00957g"
FT                   /old_locus_tag="DEHA-IPF60"
FT                   /old_locus_tag="DEHA-CDS2554.1"
FT                   /product="DEHA2A00704p"
FT                   /note="similar to CA1079|CaLIP1 Candida albicans CaLIP1
FT                   Secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84312"
FT                   /db_xref="GOA:Q6BZK2"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK2"
FT                   /protein_id="CAG84312.2"
FT                   /translation="MYFRTIICISLSAMLMSVHAIPLTVLVPTQDSFYIPPEGFERYSN
FT                   GHILKLRKTPHPLRRAKQQINIKNSWQAMVRSSDSYGAATTIVTTIMEPYNADPEKVVS
FT                   YQIFENSACIDCPPSYGLQLGANETTLTESNEMYFIEIALNKGWFVITPDYEGPKAAFS
FT                   ASIQEGQATLDSIRAVLKSSNTTGISNHAKVAMWGYSGGTIPTTWAAALQPTYASELKA
FT                   NLVGAAFGGLVSNISSTAELLDGGIHVGLTVAAVAGLANEYPDFKEVIMNDIFHNKTDQ
FT                   FNEIYKLCMTPEGPYYSEQKMFSGPERYFKSGWDILKDPVVSKVLNKNILGLDKDHGIP
FT                   DIPLFLYHGEKDQMASIEQAQRVYDNWCDWGIGSFEFAADASVGHHLAALTGLGAAMEW
FT                   LNKRLEGEIPLQGCSKIVRKSNAFYPGIEKSVFDFITSTAKSWFGIRIGPSGLSPALGD
FT                   TGRTASVVTNNGSVVVDQAYIDKINW"
FT   gene            complement(<59288..>61213)
FT                   /locus_tag="DEHA2A00726g"
FT                   /old_locus_tag="DEHA0A00979g"
FT                   /old_locus_tag="DEHA-IPF65"
FT                   /old_locus_tag="DEHA-CDS1379.1"
FT   CDS_pept        complement(59288..61213)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00726g"
FT                   /old_locus_tag="DEHA0A00979g"
FT                   /old_locus_tag="DEHA-IPF65"
FT                   /old_locus_tag="DEHA-CDS1379.1"
FT                   /product="DEHA2A00726p"
FT                   /note="similar to wi|NCU09649.1 Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84313"
FT                   /db_xref="GOA:Q6BZK1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR025733"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="InterPro:IPR041792"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZK1"
FT                   /protein_id="CAG84313.2"
FT                   /translation="MQFKALYKIFIAISYLKTSFAILQVRDLPENKVAPVQHRLAYAGD
FT                   TGMVVSWNTYQQLEAPWVQYGLSPDSLDQTAESSESITYPTSITWNNHVVIKDLQPDTT
FT                   YYYKVANSENNSDIYKFVTAKSPGSPDEFSFSVVVDMGTMGELGLSEEVGKGAEGALEP
FT                   GEQNTMQSLRNGMNEFEFLWHPGDIAYADYWLKEEIQHYLPNTTIADGYKVYEQILNAF
FT                   YEELQPISAFKPYMVGPGNHEADCDNGGTSDKDNDIKYTNSICVPGQTNFTGYRNHFRM
FT                   PGAESGGTGNFWYSFDYGQVHFVQFNTETDFGNGLAGPEDAAPNGPQGSYPNEQIDWLE
FT                   NDLASVNRTKTPWVIAAGHRPWYVVGEGCTDCKTAFESILNKHNVDLVVSGHVHNYERQ
FT                   KPISNGIIDPNGLNDPSAPWYIVNGLGGHYDGLDPLEYPLPNYTEVAQDSAYGWSKFTV
FT                   HNCTHLTHEFVASANNSVLDRATLFKNRTCIVSSTNTTDTTNPEQSSLTNSSIHSTHMY
FT                   TNVSTVIDSIDPKVLDTKTKSNVKVITITSCSNNICSEASVSATPVLTTTTIQGVENIL
FT                   TSYCPISNTGDNKTADTIISAPYSNSSISNASSISPLMVSSVGENSAAKIAAGGVIGFI
FT                   ILALAF"
FT   gene            complement(<63079..>64797)
FT                   /locus_tag="DEHA2A00748g"
FT                   /old_locus_tag="IPF_71"
FT   CDS_pept        complement(63079..64797)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00748g"
FT                   /old_locus_tag="IPF_71"
FT                   /product="DEHA2A00748p"
FT                   /note="similar to uniprot|P48813 Saccharomyces cerevisiae
FT                   YDR508C GNP1 High-affinity glutamine permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65342"
FT                   /db_xref="GOA:B5RSN6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSN6"
FT                   /protein_id="CAR65342.1"
FT                   /translation="MVLGSEKKLKPVISETRRGSSASGSECDNIPSVGVTKWDRFVDSF
FT                   RRQHVQHGDEGKSLQKGISSRHLILMALVTGMGTGLFVGTGNILSTAGPLFLIVGYIIV
FT                   GSFLYPTLQAAGELAVNYSELSGGYNNYPSKFIDESVAFAVTWIYCIEWLSTFALELVT
FT                   ASITIRYWDGDQKINPDVWVTIIFVIVVSLHFVGSKAYGEGEFVIGCLKVLMVTGFLIM
FT                   SIVVNVGGGPEGKFIGGQYWHDPGYYTNFKGLCTVFVTGAFAFSQSEFVALSAAEQPNP
FT                   RRAIPTACKLVFWRILILFLGSLIMVGLLVPMNSPELMGASGGGSNASPFVLAATLHGV
FT                   TVVPHIINAVILLSVCSVASSSLYASSRTLQSLADQGYAPKYFNYIDRSGRPLRSLIAC
FT                   SIVGLFSYIAAYEKQETVFNWLLSISGLAQLFTWDVICISHIRFRQALKYNGISTDSLG
FT                   YTSSTGIWGSVYAIVIHWLILIASFYTALFPVGSSTPDAQSFFQNYLGAIVLVFFYVCH
FT                   KLWSRNWKFYVNICDIDINTDRTIFDEEILNLEKQEFQEKYNNDPWYKKLTTILL"
FT   gene            complement(<66014..>66961)
FT                   /locus_tag="DEHA2A00770g"
FT                   /old_locus_tag="DEHA0A01100g"
FT                   /old_locus_tag="DEHA-IPF77"
FT                   /old_locus_tag="DEHA-CDS4729.1"
FT   CDS_pept        complement(66014..66961)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00770g"
FT                   /old_locus_tag="DEHA0A01100g"
FT                   /old_locus_tag="DEHA-IPF77"
FT                   /old_locus_tag="DEHA-CDS4729.1"
FT                   /product="DEHA2A00770p"
FT                   /note="similar to CA4338|IPF3616 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84318"
FT                   /db_xref="GOA:Q6BZJ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ8"
FT                   /protein_id="CAG84318.1"
FT                   /translation="MMQGQYKIQLRNGVRIFSTFSNYDNHDVFCSGGERKWTRVIFLLH
FT                   GFPDNNSSYNSVWTVILDSVPEDEKVLLLAPSMRGYEPSSQGEQCDYKMSDLAGDVSSW
FT                   IKNISPDGIPVHLVGHDWGAIVAFKTASMYPEMITSMACLAIPYITNIRLWEFAWYFPD
FT                   QIYHSSYMFTMQFGWLYKKRLSDTSSNSYLDGLWRCWSPTWNYTVDEIDSVKRTLQEPG
FT                   VIDASTAYYRCIANPLNISNRRWNVDFKKVPTLLLGGERDGCMNEKLYRLEASKLANNP
FT                   YVKVKTISNVGHFLHREDPTKVGELITDWFSEYP"
FT   gene            <67584..>69506
FT                   /locus_tag="DEHA2A00792g"
FT                   /old_locus_tag="DEHA0A01122g"
FT                   /old_locus_tag="DEHA-IPF79"
FT                   /old_locus_tag="DEHA-CDS1480.1"
FT   CDS_pept        67584..69506
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00792g"
FT                   /old_locus_tag="DEHA0A01122g"
FT                   /old_locus_tag="DEHA-IPF79"
FT                   /old_locus_tag="DEHA-CDS1480.1"
FT                   /product="DEHA2A00792p"
FT                   /note="similar to CA0276|IPF15015 Candida albicans
FT                   IPF15015"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84319"
FT                   /db_xref="GOA:Q6BZJ7"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ7"
FT                   /protein_id="CAG84319.2"
FT                   /translation="MKFGPKTTRKILLVLVLLFTLTGLLWTSKKATVKYPSLDKGKYPT
FT                   LDKIKGFYNDKISAFQKKPNDHLVVYPRSFSSESKEKLEDHFNTYLGGITGNLKVLSYN
FT                   GPKSPLTNKIREDKYHKHEISLYDSVRDIGGDVDKCQPDINKKIKLDVTNSNTFGFSFE
FT                   KIVRKLVQQLKDDPAISELKGFFNEDLEKHLEEGKTGDHWFKFAGTSVWLEQYGVHFMI
FT                   SRMMYSPPGPKKRSVLSLLYGQVYDEDWNEIENIDLIMPSSDSLTNDKSFRSINFPSFL
FT                   PIPFYHDANYLSKRFYGPEDARMLLVKNDNGIEEPLIVFNAYHRKGSDEIKIDEASSSI
FT                   KFEYYRSMFVGWPFQFQLGKQNVDGSSNPKHANNEYTKITELRNIASPRLKVQKNWTPF
FT                   VSNKARQVDGYDKNIYFVYRWQSLEIMKCQLTSITDVSQCTFEYKRVDDLPIDASVGDL
FT                   RGGTELISINNIFPSLDSHFKSDTEVWVGFSRAHIKSCGCGSSMYRPNLAILYKDGNKF
FT                   KISQLSEFFSLDVKVTGWSDPEKVCQSREPDALIPNGISSWDVNSHMSGLEQVHEDYIT
FT                   LILSAGDAVDHKIHIKNLLKAIIGQTSLLSSKEENGYNDDLVLCSLRYSKDFCAAYGKE
FT                   QLKEN"
FT   gene            complement(<69716..>70840)
FT                   /locus_tag="DEHA2A00814g"
FT                   /old_locus_tag="DEHA0A01144g"
FT                   /old_locus_tag="DEHA-IPF80"
FT                   /old_locus_tag="DEHA-CDS3412.1"
FT   CDS_pept        complement(69716..70840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00814g"
FT                   /old_locus_tag="DEHA0A01144g"
FT                   /old_locus_tag="DEHA-IPF80"
FT                   /old_locus_tag="DEHA-CDS3412.1"
FT                   /product="DEHA2A00814p"
FT                   /note="similar to uniprot|P38716 Saccharomyces cerevisiae
FT                   YHR112c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84320"
FT                   /db_xref="GOA:Q6BZJ6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ6"
FT                   /protein_id="CAG84320.1"
FT                   /translation="MTGISTNAIHASDEVNPVRDVIPPINVSTTYKYADNPDDLVKWSD
FT                   MPEESSIIGNIFYSRITHPNSERVEKALESIVGGPSVAYSSGLGAFFAALTYFNPSIVC
FT                   IGKGYHGCHSIIDIFTRLKGLKVIGLDDDLDQLNAGDLICLETPVNPDGTVFDIEYFAQ
FT                   KAHKKGAFLLIDSTFAPPPLQDPFKWGADMVLHSATKYLGGHSDLLAGVLVTNDDKVKN
FT                   QLVTDRLALGTNIANLESYLLLRSLRTFELRITRQAENTEKLVKHLVKNRDSYPKLKKI
FT                   YHSSLQTEAFVKKQLPNGYSPVFCIELDNESSAKEFPSKLRYFHHATSLGGVESLIEWR
FT                   VLSDSTVSPTLLRVSVGAENADDLIADFDEALRS"
FT   gene            <71210..>72382
FT                   /locus_tag="DEHA2A00836g"
FT                   /old_locus_tag="DEHA0A01166g"
FT                   /old_locus_tag="DEHA-IPF82"
FT                   /old_locus_tag="DEHA-CDS3325.1"
FT   CDS_pept        71210..72382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00836g"
FT                   /old_locus_tag="DEHA0A01166g"
FT                   /old_locus_tag="DEHA-IPF82"
FT                   /old_locus_tag="DEHA-CDS3325.1"
FT                   /product="DEHA2A00836p"
FT                   /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
FT                   YOR390w or uniprot|Q08991 Saccharomyces cerevisiae YPL279c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84321"
FT                   /db_xref="GOA:Q6BZJ5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ5"
FT                   /protein_id="CAG84321.2"
FT                   /translation="MSEETSVGPLEFRDGSFQEERRNVHRELESLEAESLSESLPEGFN
FT                   VEKNYTTKRHLRDVYTKTSGIMPVFLSIVSGSIWGVLGRKGLMVLTTYNGSFLSGVIWA
FT                   NFAACVVMGMAVDSVNLWRELVDSRVYVNKGLIGVYVGVTTGFCGTLSSFSSVILEAFN
FT                   KSADTLPGDEYYYPNSAYGIMEFLAVIIAHMCLSLTGFQIGKHLIDLIDPILPILSKRV
FT                   YRTLEIVWISLGLAAFIIIVVLIGVKSDGSWRSWTFSCFFAPFGALSRFFLSKYLNPKV
FT                   KNFPFGTFTANLWGSLLLAVFTLLGRGKLPGNTQSQIVTNVLNCHVLTGLDDGFCGALT
FT                   TVSTFVVELFGLNTSHSYRYGFYSIASSYAVTILVLGTYNWAVGLTNPVC"
FT   gene            <73069..>75036
FT                   /locus_tag="DEHA2A00858g"
FT                   /old_locus_tag="DEHA0A01188g"
FT                   /old_locus_tag="DEHA-IPF83"
FT                   /old_locus_tag="DEHA-CDS1323.1"
FT   CDS_pept        73069..75036
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00858g"
FT                   /old_locus_tag="DEHA0A01188g"
FT                   /old_locus_tag="DEHA-IPF83"
FT                   /old_locus_tag="DEHA-CDS1323.1"
FT                   /product="DEHA2A00858p"
FT                   /note="similar to KLLA0D07414g Kluyveromyces lactis IPF
FT                   4910.1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84322"
FT                   /db_xref="GOA:Q6BZJ4"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ4"
FT                   /protein_id="CAG84322.2"
FT                   /translation="MATAATIDMADEVNPPLTYEPVDSDIPASKIYGTLKPNHNGLENK
FT                   NLYELASKWIDAFNAIVKEIQNDPSEKNLDKLNSVIASHASWKDHLALSWDYRQFHDLD
FT                   NIKDVAKNSFPSFKLKNFEIDTTADHRFDKAVGLQTIDKADETNSIPIQWVQIIVKFEN
FT                   EFGYGNGLIRLISVDEKDAPGGLKAFTIYTALENIKGNEETLGRSRPQGVNHGQNQGRI
FT                   SWLEKREKDFEWGSEKTPTVLIVGGGQGGLNVAARLKTMGIDCLIIEKNSKIGDNWRNR
FT                   YKFLVLHDPVWYDHLAYIKFPDVWPVFTPKDKLGDWFEAYSKSMELSYWVNKTVSGADF
FT                   DPVTGVWSVNIIDNDTGKLTNIKTKHIVMATGHSGEPNIPTFKDQDKFKGTIVHSSQHS
FT                   TGKSFQGENAVVVGCCNSGHDIAQDFYEQGAKPILVQRSTTCVINSEIGLKVTTKGLYE
FT                   EGGPKTETADLILQSMPVKLLNLVMQQQYRQTMILEKDLHESLKKSGFKTDSGYGGTGL
FT                   FGKYYRRGGGYYIDVGCSKLIADDKIKVQQGKNIERFTENGLVFSDGTKIDNLAIVVLA
FT                   TGYSNMRDTARRIFGDKVADKLNPVWGLDDEGEINTMWRDSGHPKFWYMGGNLAVSRYF
FT                   SKRLALKIIAQERGFDKSNS"
FT   gene            complement(<75344..>77266)
FT                   /locus_tag="DEHA2A00880g"
FT                   /old_locus_tag="DEHA0A01210g"
FT                   /old_locus_tag="DEHA-IPF87"
FT                   /old_locus_tag="DEHA-CDS1477.1"
FT   CDS_pept        complement(75344..77266)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00880g"
FT                   /old_locus_tag="DEHA0A01210g"
FT                   /old_locus_tag="DEHA-IPF87"
FT                   /old_locus_tag="DEHA-CDS1477.1"
FT                   /product="DEHA2A00880p"
FT                   /note="similar to uniprot|P47083 Saccharomyces cerevisiae
FT                   YJR002w MPP10 component of the U3 small nucleolar
FT                   ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84323"
FT                   /db_xref="GOA:Q6BZJ3"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ3"
FT                   /protein_id="CAG84323.2"
FT                   /translation="MIIPKVYYLQIKMPQDILSVLKDNPQNVFGLFKAESQENSGYFNE
FT                   LIKTFLDPITKEYSVLDKIYVDGLDSTQVYGQTKIVLEGACEALLFDKIPKLKLEHSLN
FT                   HDSEEEASESDEENMQQQNESDDQEEENENDSDSFDDVEGQNEDDIETLNEDDEESESL
FT                   NGNDASEAETQVPSEDEDVRPPKKDSFGLNDEFFDIDDFNKQILALENTNNAGDEEEID
FT                   FFGDLDEEDDDEEQMEYFDDFYDKPGKVKTSNSLGGRQGENEDEENGDEENEDEGNIEE
FT                   DEELNENEYDNAVGSAMLDLFADEKQKSKDTENLSSYQKQQQQIQAEIAALESELVADK
FT                   KWTMKGEIASKDRPQDSLLDDPESASLDFDRTSKPVPVITQEVTESIEDLIKRRIKEGE
FT                   FDDLPKRIITDISKFHNRQKFELSEQKSSKSLAEIYEDQYNNVDENKEVSEELQKQHDE
FT                   ISELFTKVTHKLDSLCSAHFIPKPHQMKTIDIKVSDAASISMEDAQPLHVSNETTLAPQ
FT                   EIYKIGDDKPAANGSKGRSEVLLKSGLSYSKDELSREDKQRLRRANKRKKSKHFNERKE
FT                   YQEQKQKQDTTPSNSNKRQKVSDVVNTLSNAKNVTIIDKKGELRDAKGNIRKSQKPKGS
FT                   SGFKL"
FT   gene            <77390..>78148
FT                   /locus_tag="DEHA2A00902g"
FT                   /old_locus_tag="DEHA0A01232g"
FT                   /old_locus_tag="DEHA-IPF88"
FT                   /old_locus_tag="DEHA-CDS5011.1"
FT   CDS_pept        77390..78148
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00902g"
FT                   /old_locus_tag="DEHA0A01232g"
FT                   /old_locus_tag="DEHA-IPF88"
FT                   /old_locus_tag="DEHA-CDS5011.1"
FT                   /product="DEHA2A00902p"
FT                   /note="similar to uniprot|P53123 Saccharomyces cerevisiae
FT                   YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84324"
FT                   /db_xref="GOA:Q6BZJ2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ2"
FT                   /protein_id="CAG84324.2"
FT                   /translation="MIRGIVPTTLGNASFIRKLGSRWKSKSVSSSRWLNRQKKDSHTKE
FT                   SKLQNFRSRAAFKLIEIDDKYRLFNRKSKNIVDLGFAPGAWTQVAIERTKSLNINANII
FT                   GVDLINCSPPEGASFIQGNILSKQTHNNIKEFFNNNKNHSECEEKPVDLIISDMMANTS
FT                   GIKDNDHYASMELCDGALILASALLNKNGSMVMKFYTGKEDSLLKEKLQKMFHKVFKMK
FT                   PSACRDESREMYYIGVRKKNNTIDTSDLFS"
FT   gene            complement(<78176..>78272)
FT                   /locus_tag="DEHA2A00924r"
FT                   /old_locus_tag="Deha0A.14"
FT   tRNA            complement(join(78176..78212,78235..78272))
FT                   /locus_tag="DEHA2A00924r"
FT                   /old_locus_tag="Deha0A.14"
FT                   /note="tRNA Arg (ACG) cove"
FT   gene            <79896..>81491
FT                   /locus_tag="DEHA2A00946g"
FT                   /old_locus_tag="DEHA0A01298g"
FT                   /old_locus_tag="DEHA-IPF95"
FT                   /old_locus_tag="DEHA-CDS2104.1"
FT   CDS_pept        79896..81491
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00946g"
FT                   /old_locus_tag="DEHA0A01298g"
FT                   /old_locus_tag="DEHA-IPF95"
FT                   /old_locus_tag="DEHA-CDS2104.1"
FT                   /product="DEHA2A00946p"
FT                   /note="some similarities with uniprot|Q03180 Saccharomyces
FT                   cerevisiae YKL163W PIR3 Protein containing tandem internal
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84326"
FT                   /db_xref="GOA:Q6BZJ0"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZJ0"
FT                   /protein_id="CAG84326.1"
FT                   /translation="MQLTFSLSVLTTLAVLTHAAYVPSQPWSTLTPSGTIDSASASSNY
FT                   DGSFALSIKTLGKGSTGTSAAPAAPTGGSADETEASAVAGAVASDAAVSVPTAPADIGA
FT                   SAAPVESGATASVPTPASDVGASAPTGEAAALRKRSDIVNQLGDGQIQQGGGSGSDSGS
FT                   GSDSGSGSGSSGDSGSGSGSGSGSSSEGSGTPGGASGSGSTPGSGSEGSGAPGGASGSG
FT                   SGSEDSGAPGGASGSDSTPGSGSGSGAPGGASGSGSGSEGSGAPGGASGSGSGSEDSGA
FT                   PGGASGSDSTPGSGSGSASEGSGSPGGASDSGSTPGSGSSSEGSGAPGGAGGNDSPSKT
FT                   ADVMNQIGDGQVQQQQQTGSPNGQAAAQSQEAGVTAVADKTAANVASQVNDGQVQQTGA
FT                   ADSKAVGTENGETCLKSDSLSVTLKDGVLRDSKDRIGAIVAGHQFQFDGPPPQAGTIYA
FT                   AGWSVVPSDYSGSSSESSDSSNSKRSDSPGKLALGSQTTFYKCNSGDFYNLYDQSIGSQ
FT                   CEEVEVTILKAVEC"
FT   gene            complement(<81772..>82110)
FT                   /locus_tag="DEHA2A00968g"
FT                   /old_locus_tag="IPF_96"
FT   CDS_pept        complement(81772..82110)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A00968g"
FT                   /old_locus_tag="IPF_96"
FT                   /product="DEHA2A00968p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84327"
FT                   /db_xref="GOA:Q6BZI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI9"
FT                   /protein_id="CAG84327.1"
FT                   /translation="MDVPHKRGYMKFRLDRYYLTKGYFNLSHYIETIPLDNKDIELYRK
FT                   AKGQLEVIHRHGIIHGDIKTENILCARDGKVYIIDFAFSVTKNEWNTQKSMESDISDLK
FT                   YVFGLDEV"
FT   gene            <83619..>83690
FT                   /locus_tag="DEHA2A00990r"
FT                   /old_locus_tag="Deha0A.1"
FT   tRNA            83619..83690
FT                   /locus_tag="DEHA2A00990r"
FT                   /old_locus_tag="Deha0A.1"
FT                   /note="tRNA Val (CAC) cove score=64.96"
FT   gene            <84276..>84728
FT                   /locus_tag="DEHA2A01012g"
FT                   /old_locus_tag="DEHA0A01397g"
FT                   /old_locus_tag="DEHA-IPF104"
FT                   /old_locus_tag="DEHA-CDS6077.1"
FT   CDS_pept        84276..84728
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01012g"
FT                   /old_locus_tag="DEHA0A01397g"
FT                   /old_locus_tag="DEHA-IPF104"
FT                   /old_locus_tag="DEHA-CDS6077.1"
FT                   /product="DEHA2A01012p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84330"
FT                   /db_xref="GOA:Q6BZI6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI6"
FT                   /protein_id="CAG84330.1"
FT                   /translation="MANTIHYGYVSSPKEVLEQCLNAYNSERLFCQILANNPEFNSCYV
FT                   QHRRGYIKVTVANHYLAKGNFNLFKFIKTVTMPRDTETYVKAKKQLEIIHRNGIIHGDI
FT                   WKANILYTKEGKVFIIDFASSIPENQSTDEINKESDKAALEIIFED"
FT   gene            complement(<85189..>87235)
FT                   /locus_tag="DEHA2A01034g"
FT                   /old_locus_tag="DEHA0A01434"
FT                   /old_locus_tag="DEHA-IPF108"
FT                   /old_locus_tag="DEHA-CDS8102.1"
FT   CDS_pept        complement(join(85189..86973,87047..87235))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01034g"
FT                   /old_locus_tag="DEHA0A01434"
FT                   /old_locus_tag="DEHA-IPF108"
FT                   /old_locus_tag="DEHA-CDS8102.1"
FT                   /product="DEHA2A01034p"
FT                   /note="similar to uniprot|P36070 Saccharomyces cerevisiae
FT                   YKL125w RRN3 RNA polymerase I specific transcription
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84331"
FT                   /db_xref="GOA:Q6BZI5"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI5"
FT                   /protein_id="CAG84331.2"
FT                   /translation="MIMSVHDPLSRKRSLSNPNGQEGSVSKKSKNEDDATMDRNNNTVF
FT                   SEKMYHTYVKSALESLDKNDSLPVDNLTSKISLPISHNQAISVSNFNTVLKILISNVSR
FT                   LDNSSCNNLISAILEYNWLGVKPASDSDGAYFTFIDLYSHFLSVLVSSLPKYLHEVTTK
FT                   LVSEFISININENPSANHHVILNKIIKFIPTSVNSFPATLQKNFPHHLSSSTEELTNFV
FT                   GNLIKILTYCSELQYDIWQLIIECCIKLDVELQNELDDLDDDEIEELINGEEDDEESDS
FT                   DDEDANDDGASDINSDDEDEVVEGEFEYMIDPVTSTVNTRKLSRKLDSIIHLLLTNTSN
FT                   SFTVDELNNGNGVYLFNTITSLFKTHILPTHFTKSIQFTLFHISQYQPELADSFLVLLI
FT                   DVAFNTTEILEKRLKAMQYLSSYIARAKNLSRHQIVFVVSYLIGWLNKYVIERECEITD
FT                   YDNDNKGRSTNNKQGGGMERFKLFYAAFQALLYIFCFRYKVLYKTQGSTESSSDSEWEC
FT                   DLDKFFQRVIIAKFNPLKFCDETVVYIFAKIATKLNVCYCYSIIEHNKRERMLQTNGTK
FT                   NLPSAVGNFKQKQEFLDLEAYFPFDPLVLPTCKVLIGENYIEWSDVNPSNEDEDDDEDS
FT                   GSHPEEGLSDSDNDNMSSDEDD"
FT   gene            <87482..>88384
FT                   /locus_tag="DEHA2A01056g"
FT                   /old_locus_tag="DEHA0A01441g"
FT                   /old_locus_tag="DEHA-IPF109"
FT                   /old_locus_tag="DEHA-CDS4707.1"
FT   CDS_pept        87482..88384
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01056g"
FT                   /old_locus_tag="DEHA0A01441g"
FT                   /old_locus_tag="DEHA-IPF109"
FT                   /old_locus_tag="DEHA-CDS4707.1"
FT                   /product="DEHA2A01056p"
FT                   /note="weakly similar to CA3181|IPF12241 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84332"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI4"
FT                   /protein_id="CAG84332.1"
FT                   /translation="MSDIHTVQLHSIALFNLSDHITRREKSKFGVLLGTTDKATITVTT
FT                   SFELLFDNDLDINTEFLKKRLDQFKAVLPQYSMVGFYQLINDRVPNSATMSVLNQLQVF
FT                   QRLISTHEMPIVFTLINMGSFHNAEDYEPFKSFLSENEPIPLRTSILANETENIATSTI
FT                   VNHPNYFSSEISRDVNDINNDFKLDKYNEELSVSVTQLHAKVESIIEYLQHRPSGSDLK
FT                   NLEQEIKLHNLITYLSSKIVTFQRNHISADHNEQLQTTQLSLLTAQLLALDNLKSQIAK
FT                   NIIRFSIHTNSQSIGPIRH"
FT   gene            complement(<88446..>88527)
FT                   /locus_tag="DEHA2A01078r"
FT                   /old_locus_tag="Deha0A.13"
FT   tRNA            complement(88446..88527)
FT                   /locus_tag="DEHA2A01078r"
FT                   /old_locus_tag="Deha0A.13"
FT                   /note="tRNA Leu (CAA) cove score=68.15"
FT   gene            <89320..>92145
FT                   /locus_tag="DEHA2A01100g"
FT                   /old_locus_tag="DEHA0A01485g"
FT                   /old_locus_tag="DEHA-IPF111"
FT                   /old_locus_tag="DEHA-CDS0530.1"
FT   CDS_pept        89320..92145
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01100g"
FT                   /old_locus_tag="DEHA0A01485g"
FT                   /old_locus_tag="DEHA-IPF111"
FT                   /old_locus_tag="DEHA-CDS0530.1"
FT                   /product="DEHA2A01100p"
FT                   /note="weakly similar to uniprot|Q00816 Saccharomyces
FT                   cerevisiae YDR028C REG1 Regulatory subunit of type 1
FT                   protein phosphatase Glc7p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84333"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI3"
FT                   /protein_id="CAG84333.2"
FT                   /translation="MSSTNNLGDVFTGGATTSQHVEAEDDDHFENTTFKLKRTRSLGLL
FT                   DEFIQPSDAEKAKLGELDSKGESEMSSANNASPSDGRSDNKGELDGDDDAVIDDDEADR
FT                   ESHKLQSPVVLKSPEMLPHDDTDIQYQPSRHVDYLSHQWDVSDISKSWRYVIQKRKDVA
FT                   NSARLENASWRTWAQRRSNLKTISPEVVNWSKDSDVTWLYGPIMKDEENGEADEEDNHK
FT                   RITTATSAVAGDISIPNKQKKGPKPILKRRTVQDMMISHSNLLKLQLATNRMHDKQRQQ
FT                   HESQVRNENQSHNENEPPEFDDYDAISAKLNSQYKNIDSQNNSIVNLQKLNDDKKSESA
FT                   NSNSHQAPKNETNQPEHTSSDNATNIPPNNADVSAGANSTTNTSSPVPKEERRIHFNDE
FT                   VQQCIAVEEYSDEDDDDYYDDDEDDYYYDDDEEDYMYETPHEDQDDENEDDEDDEDDDD
FT                   DEGGFFLKVKSPSSPNAPVPGLSLSASKESTKNISNNDNTEDTDSISTTNSKVHRSIHL
FT                   LPSTTLNYGSSDEESDDDNPYTSSLSHNANNRGYDYYYDYNTVYTCDPDHAIYGLNNKN
FT                   DSKAPDVVDVPENITLGSNFDYEDIENEDFNNEKMPIIDPSIINNNNLNYPTSNNDDNS
FT                   SSKANDFASNSNSNGEKTNDNSKGFEKSNSPEPSDKKASPFNFSDSDSENDSDDSENGL
FT                   SISTRNSSQSLAQSVFTHNMTRSSNNDDEHQYPTYESQPVTGPVSSINPRHSSTSISKQ
FT                   STSSNSLSQSFFGGGLTKQDENDSKALASSFFDTNDDQDEELQDQGEAISSSDMPQLQK
FT                   TLSNTQRKASPLPPHTTSANAFSGNTTPPLEKQPKNTFSFDSESDSEEESSNDIIIPHV
FT                   DNTTPSYASLSQVADKNGIRSPSPDVNSINSPQSNSSNSNSTTLGNQNKNIVGQAKGLA
FT                   THLLGNWKNNE"
FT   gene            complement(<93012..>93647)
FT                   /locus_tag="DEHA2A01122g"
FT                   /old_locus_tag="DEHA0A01507g"
FT                   /old_locus_tag="DEHA-IPF112"
FT                   /old_locus_tag="DEHA-CDS5239.1"
FT   CDS_pept        complement(93012..93647)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01122g"
FT                   /old_locus_tag="DEHA0A01507g"
FT                   /old_locus_tag="DEHA-IPF112"
FT                   /old_locus_tag="DEHA-CDS5239.1"
FT                   /product="DEHA2A01122p"
FT                   /note="similar to uniprot|P36087 Saccharomyces cerevisiae
FT                   YKL070W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84334"
FT                   /db_xref="GOA:Q6BZI2"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI2"
FT                   /protein_id="CAG84334.2"
FT                   /translation="MYIPKYYAQENEESQESLIRANPLGTVISTGESGIIANHIPFYLH
FT                   VDKDTNKKYLQGHLAKVNHQVPLFKEKGEVLVIFQSPSSYISPTYYPTKNETHKVVPTW
FT                   DFASIHCYGVPRLIDDSDWVRSQLDNITAQHETKKPVPWKVSDAPENYVKLMQKAIIGV
FT                   EIEITRIECKFKFEQKMKRHDIDGVIDGLVKDEKPEIASYVTKANEIP"
FT   gene            complement(<94094..>95221)
FT                   /locus_tag="DEHA2A01144g"
FT                   /old_locus_tag="DEHA0A01529g"
FT                   /old_locus_tag="DEHA-IPF113"
FT                   /old_locus_tag="DEHA-CDS3399.1"
FT   CDS_pept        complement(94094..95221)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01144g"
FT                   /old_locus_tag="DEHA0A01529g"
FT                   /old_locus_tag="DEHA-IPF113"
FT                   /old_locus_tag="DEHA-CDS3399.1"
FT                   /product="DEHA2A01144p"
FT                   /note="similar to uniprot|P38716 Saccharomyces cerevisiae
FT                   YHR112c similarity to cystathionine gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84335"
FT                   /db_xref="GOA:Q6BZI1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI1"
FT                   /protein_id="CAG84335.1"
FT                   /translation="MPGISTNSIHAADEVHKVADVMTPIHVTTTYKFDDDPEKLIKDED
FT                   LPENSIIGNVVYARETNPNSERVEKLLDSILDGHTVAYTSGLAAFFAALTYFNPKVASI
FT                   GKGYHGCHGILNIFSRLKGLKQISLEDDLNQLNAGDLICLETPVNPDGTVFDIQYYADK
FT                   AHERGAFLLVDSTFAPPPLQDPFKWGADMVFHSATKYFGGHSDLLAGVLATKDINVKNQ
FT                   LVKDRVDLGSNISNLESFLLIRSLRTYELRILKQAENAEKLIKFLVDNREKYPKLKKIS
FT                   HSSLQTEPFVKKQLSNGYSPVFCIELESEADAKQFPSKLRYFHHATSLGGVESLIEWRV
FT                   LSDSTVSPTLLRLSVGVENIDDLIADVDQGLKSIA"
FT   gene            complement(<95915..>96034)
FT                   /locus_tag="DEHA2A01166g"
FT                   /old_locus_tag="DEHA0A01551g"
FT                   /old_locus_tag="DEHA-IPF114"
FT                   /old_locus_tag="DEHA-CDS8996.1"
FT   CDS_pept        complement(95915..96034)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01166g"
FT                   /old_locus_tag="DEHA0A01551g"
FT                   /old_locus_tag="DEHA-IPF114"
FT                   /old_locus_tag="DEHA-CDS8996.1"
FT                   /product="DEHA2A01166p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZI0"
FT                   /protein_id="CAG84336.1"
FT                   /translation="MELIKVLHEEAWNREKREFLMRAEIKPYCGSRNPAQLNI"
FT   gene            <97126..>97263
FT                   /locus_tag="DEHA2A01188g"
FT                   /old_locus_tag="IPF_45690"
FT   CDS_pept        97126..97263
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01188g"
FT                   /old_locus_tag="IPF_45690"
FT                   /product="DEHA2A01188p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65343"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSN7"
FT                   /protein_id="CAR65343.1"
FT                   /translation="MLFSDEPTTGLDIKALQVLRKFISTIWNHDYLIYSSISTGNHCII
FT                   "
FT   gene            <97913..>98869
FT                   /locus_tag="DEHA2A01210g"
FT                   /old_locus_tag="DEHA0A01595g"
FT                   /old_locus_tag="DEHA-IPF118"
FT                   /old_locus_tag="DEHA-CDS4160.1"
FT   CDS_pept        97913..98869
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01210g"
FT                   /old_locus_tag="DEHA0A01595g"
FT                   /old_locus_tag="DEHA-IPF118"
FT                   /old_locus_tag="DEHA-CDS4160.1"
FT                   /product="DEHA2A01210p"
FT                   /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
FT                   YPL162c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84338"
FT                   /db_xref="GOA:Q6BZH8"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH8"
FT                   /protein_id="CAG84338.2"
FT                   /translation="MKSIPSILLTTFVAISLQTTGNRPKHPDDGDDDGKCELIGTFSLI
FT                   TQAFLGVLCLSSLIVKRFYEYPLRRTWPVWFFDVMKQLIGAFGVHVFNVFLSILKSKKD
FT                   PGVKCARNKDEDDTGDIDPCDWYFLNIVFDCTIGVLVLYFVFNAINRFCRNWLKITQIE
FT                   SGQYGPNSEKPSVRAFLKQLAVYFGSLMITKIFLYGIVECFETELLWITSHILLVWLDE
FT                   YPDEFEIFVVMFVVPVVMNCLQLVLVDNIIQNRIIGKVNGRMHHEYAGQSEADEGHIRD
FT                   EIEEFTRHGDHRHKRSRRHHSLPNNEGIKTYGTFNDV"
FT   gene            complement(<99035..>99217)
FT                   /locus_tag="DEHA2A01232g"
FT                   /old_locus_tag="DEHA0A01617g"
FT                   /old_locus_tag="DEHA-IPF119"
FT                   /old_locus_tag="DEHA-CDS8455.1"
FT   CDS_pept        complement(99035..99217)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01232g"
FT                   /old_locus_tag="DEHA0A01617g"
FT                   /old_locus_tag="DEHA-IPF119"
FT                   /old_locus_tag="DEHA-CDS8455.1"
FT                   /product="DEHA2A01232p"
FT                   /note="similar to uniprot|Q12287 Saccharomyces cerevisiae
FT                   YLL009C COX17 Copper metallochaperone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84339"
FT                   /db_xref="GOA:Q6BZH7"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH7"
FT                   /protein_id="CAG84339.1"
FT                   /translation="MSAGGDNKKEETKPKPCCVCLDEKKKRDECLLFNGQESGKCDDLI
FT                   SKYKACMKGYGFETR"
FT   gene            <99436..>102765
FT                   /locus_tag="DEHA2A01254g"
FT                   /old_locus_tag="DEHA0A01639g"
FT                   /old_locus_tag="DEHA-IPF122"
FT                   /old_locus_tag="DEHA-CDS0311.1"
FT   CDS_pept        99436..102765
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01254g"
FT                   /old_locus_tag="DEHA0A01639g"
FT                   /old_locus_tag="DEHA-IPF122"
FT                   /old_locus_tag="DEHA-CDS0311.1"
FT                   /product="DEHA2A01254p"
FT                   /note="weakly similar to uniprot|Q12071 Saccharomyces
FT                   cerevisiae YDR027c LUV1 interacts with the beta-tubulin
FT                   binding protein RBL2P"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84340"
FT                   /db_xref="GOA:Q6BZH6"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="InterPro:IPR039745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH6"
FT                   /protein_id="CAG84340.2"
FT                   /translation="MSAESSGSNSEQKLSSQSPIRLSTDGSANLNDDLANGSEYSSSSF
FT                   VSLPNHNLHRRSGSAVSFKNSIDADSSFSSSAYFQILNNHNSQEDGKSNDIFSPLGPNS
FT                   IYELTIASDSSRAKRNRAPKNTVIINGGMTTVNNLRNPTLKDIPQIQLSKLKSKVENKE
FT                   LEASLIHGTEEDYKNFDSSYRLLTEDTLQKFIESDNSRHGNLSASSSLSNFPTKNNYLQ
FT                   YNGDDISSIPKVFLDPDFRLDDPRIFKQVIGDCNLFSDNETPDENVKSTLAKNNDLQEE
FT                   LSRYLDIVEVNLIKEISKSSDSFFNTIGDIKEIQSQSENCAVKFHDILDKLKLLEEKEC
FT                   QRGLDILNKVNERKNVEHLESSLLQLKYLISIIDLARKSYENGNHAKSLNEIVVAEHLI
FT                   NGIELEDPDEEKQALYPDLPYPAVDFSRVPAISDLNTEIQDLKQECSKGYISAFIDLLL
FT                   EDLRQHYNNVSYQDTLNRMSTSINKTKKYDAKSVNNSYQSISEDKREKLKEYIRNLAKS
FT                   GHLSQSYANYQDRIITEIKDIIKVNLPSSTRSGVSSADMSNAPSRSSSAPPESNNNLLQ
FT                   PGGGTSGNSLSSNIRCMTPKEFEIMLTKIYTCLSECLRRLTVQQKVLLDFALTAIPPNS
FT                   ESNLDVMSLDITFAINKSIELTQIRLTKIINVRSEQTAEISLDHYLRLYALSSAYLQEC
FT                   ELINPGYVASGAGNSLNDWVKNHIGYFIHKFHSNSLAILANNCDKEVWREITSDDALQE
FT                   HQVLIDEICGYSEYIETDGKSGFSGDSWMEMLNLHETTKEDKRSKSNKQLNGRLIIHDE
FT                   SFMIPNLTLKSLVSVREYLIISKIFSSKGSVVENNLLNYFKLMNSKASQAVLNAGATRT
FT                   AGLKHITTKHIALCIQLVEFNIALLSSLQGISKQSRNASPPPNSHEEISFARILSNYKD
FT                   HENELFSKLVSIMYDRTVNHCATIVTINLSEPLKHPQQCHSYMETLVKETTTVTKVLTK
FT                   YLPEIKCSLILSQIFDNYKKLLVDCFCTQLSQFKDFNEKHSLLKDIDYFRVKLSEIPGY
FT                   GNSGQVIWENVNSLPTIEDTKMEEVMRNNIEGERQQTIDSSHASQRNSSEVNNEENTAT
FT                   DQ"
FT   gene            complement(<102881..>104101)
FT                   /locus_tag="DEHA2A01276g"
FT                   /old_locus_tag="DEHA0A01661g"
FT                   /old_locus_tag="DEHA-IPF123"
FT                   /old_locus_tag="DEHA-CDS3116.1"
FT   CDS_pept        complement(102881..104101)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01276g"
FT                   /old_locus_tag="DEHA0A01661g"
FT                   /old_locus_tag="DEHA-IPF123"
FT                   /old_locus_tag="DEHA-CDS3116.1"
FT                   /product="DEHA2A01276p"
FT                   /note="similar to uniprot|Q06489 Saccharomyces cerevisiae
FT                   YPR118W Methylthioribose-1-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84341"
FT                   /db_xref="GOA:Q6BZH5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZH5"
FT                   /protein_id="CAG84341.2"
FT                   /translation="MSSEAKTLQAIKFDRETKTLDILDQLLIPYATEYISIKSIEDAYQ
FT                   AIKLMQVRGAPAIAIVGAFSIVVDVYNNLKETKEKSRTIGDLVESIHYLITARPTAVNL
FT                   SNACLDIEKLILTEFKKDELVNQHTFDIVYQYSVALYDDDLDNNFKIGDNGLHYIVETL
FT                   KSQSFTGPFSIITICNTGSLATSGHGTALGIIRTVFKKLSKDAGEKFWLEHVYPCETRP
FT                   YNQGARLTTYELNYEGIPSTLVCDSMASSLIATLSKQRKVKSSTAPVKFIIAGADRIVE
FT                   NGDTANKIGTFQLSTIADYFNSRAEKENTIKFIIAAPRTTIDFKTKTGDGIIIEERPSQ
FT                   ELTTLNGPVLTNNGVLEKQTVGIATPGIDVWNPAFDVTPHELIDCIVTEDTNAFVKNSE
FT                   GDFNLKV"
FT   gene            complement(<104219..>105571)
FT                   /locus_tag="DEHA2A01298g"
FT                   /old_locus_tag="DEHA0A01683g"
FT                   /old_locus_tag="DEHA-IPF124"
FT                   /old_locus_tag="DEHA-CDS2726.1"
FT   CDS_pept        complement(104219..105571)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01298g"
FT                   /old_locus_tag="DEHA0A01683g"
FT                   /old_locus_tag="DEHA-IPF124"
FT                   /old_locus_tag="DEHA-CDS2726.1"
FT                   /product="DEHA2A01298p"
FT                   /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
FT                   YMR026c PEX12 required for biogenesis of peroxisomes -
FT                   peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84342"
FT                   /db_xref="GOA:Q6BZH4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH4"
FT                   /protein_id="CAG84342.2"
FT                   /translation="MEYYSSLDASQLDSEIPTLFELISASQLESLLSPSLRYILVHYAS
FT                   KYPYLLLKVANNFEELNLFFRTFIEWYFMSYWQGSFTENFYGLKRVSQTPLSDSKYKSS
FT                   KLTQLVPSMIEDRRSLSGLQRFASIFEITGVSYLSEKFNYWYEIWYPKYVTNQLVPNDP
FT                   TNRADIYRTEFKRRFVKLYPILQSIFRTGNFITTLLYLSGSSKSPTLLTILFKINYSRL
FT                   NQYDYSKHEPKVASKKDTPNKIAPPTLAASIFRILNKNITKPSWRLINFILGTFFPVAI
FT                   FMLKFLEWYSNSNFASKIAKTQGNMLDSLLPPPSSLSRKRRLEDKPKKVYNSGKTCPLC
FT                   KDEISNPAIIETGYVFCYSCIYNYLAQSHKIISEKARLRREEMDSDTEESDNEKEDQNE
FT                   KVDANATQEEKITIDVNKGGRCPITGKKLLGCKWNGLKEEWEIEGIRRLIF"
FT   gene            <105758..>106381
FT                   /locus_tag="DEHA2A01320g"
FT                   /old_locus_tag="DEHA0A01705g"
FT                   /old_locus_tag="DEHA-IPF126"
FT                   /old_locus_tag="DEHA-CDS5382.1"
FT   CDS_pept        105758..106381
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01320g"
FT                   /old_locus_tag="DEHA0A01705g"
FT                   /old_locus_tag="DEHA-IPF126"
FT                   /old_locus_tag="DEHA-CDS5382.1"
FT                   /product="DEHA2A01320p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84343"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH3"
FT                   /protein_id="CAG84343.2"
FT                   /translation="MEEFEGIGSIVTEFNIKGSTLNLFNIKWKTPSSDKELKRFVQIPY
FT                   GPHNKAFPSLPLVVNSSGKLLRYMAQDEMMDKSILEYDESKFDSDFELNESSVSTNLTQ
FT                   FMNEYNINEESRQGVGYNESQVFLADNHKEQILSDIILESNCEESEFVETNSILTSDFT
FT                   QLSSNRWENASKKAKLSSEKEDLVSLKSEPFADLELDDFSALHN"
FT   gene            complement(<106497..>108681)
FT                   /locus_tag="DEHA2A01342g"
FT                   /old_locus_tag="DEHA0A01727g"
FT   CDS_pept        complement(join(106497..108537,108659..108681))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01342g"
FT                   /old_locus_tag="DEHA0A01727g"
FT                   /product="DEHA2A01342p"
FT                   /note="similar to uniprot|P06102 Saccharomyces cerevisiae
FT                   YIL038C NOT3 Subunit of the CCR4-NOT complex,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84344"
FT                   /db_xref="GOA:Q6BZH2"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH2"
FT                   /protein_id="CAG84344.2"
FT                   /translation="MSHRKLQKEVDAVFKKINEGIDLFNYYYSRHQSSNSDSQREKLEG
FT                   DLKKEIKKLQKFRDQIKTWQSNDSIEAAIAPSKLQEHRKLVEEAMECYKDVEKSSKMKS
FT                   YSNQSIMLAALESEDIDLSPEAEEAVKFLESSIEELEDQCEKLEGEYEKISQKKIRKNN
FT                   LTMIEERKQELEGFSNRNKFHIEKMEMVIDFLKKDKISPDAVFAIQEDITFYLESNQEP
FT                   DFIDDDTLYDELTKEASRASTNNNIDEENSQNGDISFQDQSFSNKEDVEEVSVSTPIKK
FT                   SSDQFPTPSSHPRPDNLSQIHADATMTPQRAPLPVPSTPELSSPAIIKSLKPATTPSKP
FT                   VGNLKWAVAAAGSAPSTSSGIGKNGDMDIKPMKEEPLFIQSQNSNVPSNKSPFESQSQL
FT                   QAPSELQYPEPSLESQFSVEKKSNDPNYRFVEVLQNSSVSNTELELFSDLNLIRLPPGI
FT                   QDLAISFTATRKVSTNDSKILINTNAYNPYITPIQKPFLPSAIQATFNHHLPNNTQEQR
FT                   IKAPLHLLKFQSYWNRIRAENQFDQFVKEIQLLSAQNNADNVPVINELTMVLFYGYYYG
FT                   FTPIENLIAESCLFKLNWKPYGSRSEIQNNLRATNHIQDKSPFDKVLFESKHYYYWFKC
FT                   VRNSPTPQVYANEYVEHGDYQVFDLITWETYIKYDYRLELKLCQLEPSKTLF"
FT   gene            complement(<108940..>110991)
FT                   /locus_tag="DEHA2A01364g"
FT                   /old_locus_tag="DEHA0A01749g"
FT                   /old_locus_tag="DEHA-IPF130"
FT                   /old_locus_tag="DEHA-CDS1282.1"
FT   CDS_pept        complement(108940..110991)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01364g"
FT                   /old_locus_tag="DEHA0A01749g"
FT                   /old_locus_tag="DEHA-IPF130"
FT                   /old_locus_tag="DEHA-CDS1282.1"
FT                   /product="DEHA2A01364p"
FT                   /note="highly similar to uniprot|P16474 Saccharomyces
FT                   cerevisiae YJL034w KAR2 nuclear fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84345"
FT                   /db_xref="GOA:Q6BZH1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042050"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZH1"
FT                   /protein_id="CAG84345.1"
FT                   /translation="MLKVNSRFWISGFTLAYVLLAVILPLLTPNQGQALAAEGETDNDT
FT                   ESYGTVIGIDLGTTYSCVGVMKNGKVEILANDQGNRITPSYVAFTPEERLIGDAAKNQA
FT                   SSNVENTVFDIKRLIGLKYNDKMVQKEIKHLPYKIDKKDGKPVVKVEFNDETKTFSPEE
FT                   ISGMILTKMKSIAEEYMGKKITHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPT
FT                   AAAIAYGLDKTEGEKQIIVYDLGGGTFDVSLLSIEGGVFEVLATAGDTHLGGEDFDFKV
FT                   VRYLSSVFKKKHNIDISGNSKAISKLKRETEKAKRTLSSQMSTRIEIDSFVDGIDFSET
FT                   LSRAKFEELNIESFKKTLKPVQQVLKDAGFKKSDVDDIVLVGGSTRIPKVQELLEKFFD
FT                   GKKASKGINPDEAVAYGAAVQAGVLSGEEGVHDIVLLDVNPLTLGIETTGGVMTTLINR
FT                   NTAIPTKKSQIFSTAADNQPTVLIQVFEGERALAKDNNKLGKFELTSIPPAPRGVPQIE
FT                   VTFSLDANGILKVEAMDKGTGKSESITITNDKGRLSKEDIDRMVEEAEKYAEQDSELKA
FT                   KIESRNSLENYAHMLKGQVKDESENGLGSKLNDDDKETLDDAIKETLEFIEDNYDSATS
FT                   EEFEEQKQKLIDVASPITSKLYGGGAGGADEAQFGDDDSDDEFVHDEL"
FT   gene            <111175..>111366
FT                   /locus_tag="DEHA2A01386g"
FT                   /old_locus_tag="DEHA0A01771g"
FT                   /old_locus_tag="DEHA-IPF131"
FT                   /old_locus_tag="DEHA-CDS9005.1"
FT   CDS_pept        111175..111366
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01386g"
FT                   /old_locus_tag="DEHA0A01771g"
FT                   /old_locus_tag="DEHA-IPF131"
FT                   /old_locus_tag="DEHA-CDS9005.1"
FT                   /product="DEHA2A01386p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84346"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZH0"
FT                   /protein_id="CAG84346.2"
FT                   /translation="MMGSDVRGVEVLSRQPPGPIATGHLVYRCWCKEFDNGMTSAGSVA
FT                   SSKSVSYNIIMKIYKISI"
FT   gene            <111817..>112947
FT                   /locus_tag="DEHA2A01408g"
FT                   /old_locus_tag="DEHA0A01793g"
FT                   /old_locus_tag="DEHA-IPF133"
FT                   /old_locus_tag="DEHA-CDS3389.1"
FT   CDS_pept        111817..112947
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01408g"
FT                   /old_locus_tag="DEHA0A01793g"
FT                   /old_locus_tag="DEHA-IPF133"
FT                   /old_locus_tag="DEHA-CDS3389.1"
FT                   /product="DEHA2A01408p"
FT                   /note="highly similar to uniprot|Q08911 Saccharomyces
FT                   cerevisiae YOR388c FDH1 NAD(+)-dependent formate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84347"
FT                   /db_xref="GOA:Q6BZG9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR033689"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG9"
FT                   /protein_id="CAG84347.1"
FT                   /translation="MSKGKVLLVLYKGNEHAQQEQKLLGCLENELGIREFIESQGYELV
FT                   CTDDKDPEPSSTVDKELQDAEIVITTPFFPAYITRERINKAPKLKMCITAGVGSDHVDL
FT                   DAANERKIAVTEVTGSNVVSVAEHVLMTMLVLVRNFVPAHEQVIKGEWDIAGAAKDEYD
FT                   LEDKVIATVGAGRIGYRVLERLIAFNPKKLLYYDYQDLPKEAIDKLNQASKLFNGKDNI
FT                   VERVENLEDMVGQADLVTINCPLHEKSKGLFNKDLISKMKDGAWLVNTARGAICVAEDV
FT                   AAAVKSGKLRGYGGDVWYPQPAPKDHPWRQMQNKYGAGNAMTPHVSGTSLDAQARYADG
FT                   VKSILNSYFSGKHDYLPKDVIVIDGDYATKSYGQRK"
FT   gene            complement(<113216..>113812)
FT                   /locus_tag="DEHA2A01430g"
FT                   /old_locus_tag="DEHA0A01815g"
FT                   /old_locus_tag="DEHA-IPF135"
FT                   /old_locus_tag="DEHA-CDS5374.1"
FT   CDS_pept        complement(113216..113812)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01430g"
FT                   /old_locus_tag="DEHA0A01815g"
FT                   /old_locus_tag="DEHA-IPF135"
FT                   /old_locus_tag="DEHA-CDS5374.1"
FT                   /product="DEHA2A01430p"
FT                   /note="weakly similar to CA3446|IPF7324 Candida albicans
FT                   IPF7324"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84348"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG8"
FT                   /protein_id="CAG84348.2"
FT                   /translation="MNRIFNNKAVHQFSQGLSKRTYSTSRSASTKSGAGIYLGGAAALV
FT                   SAIAWTSIDTIDNEVDKKKIQEGKNIAENTGSNQKEDEAKKEAVGRGNVKTKIPAESST
FT                   PTTQSEAAANDEAEQTKESLSGSKDEKSQKGSDESEIKWGNKFLKPISSGACGGEFKDA
FT                   FSVLFSSSDLKSSDTFKKLDALRRCLKEHPEISND"
FT   gene            complement(<117638..>119542)
FT                   /locus_tag="DEHA2A01452g"
FT                   /old_locus_tag="IPF_10877"
FT   CDS_pept        complement(117638..119542)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01452g"
FT                   /old_locus_tag="IPF_10877"
FT                   /product="DEHA2A01452p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65344"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSN8"
FT                   /protein_id="CAR65344.1"
FT                   /translation="MKFENVAILFSIAAAVVANEEGAKHRRSLGDKGNSNSLTSIYRRD
FT                   VEGHKLGWRGIGWSKLSSRAVTDDGTVGVESTDGSDGSDGSDGSTAGVENTEGNVDGVV
FT                   QSTEESDQDAEGSDDGKGVESTEESDENAEGSGTTAVESTGVESTGIESTRVESTGIES
FT                   TGVESTQGSDDGTASAGRVGNGGEDDTPDDKGCNRYGRGSDGKKCDYHGPKPKPGDPDD
FT                   EEDDKQCNRHGKNRHGDKCDYHPPGGDDDDDNDDDDNDDDDNDDDDDAPDDKGCNRYGR
FT                   GHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNRHGDKCDYHPPGGDDNDDDDDAPDD
FT                   KGCNRYGRGHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNRHGDKCDYHPPGGDDND
FT                   DDDDAPDDKGCNRYGRGHDGKDCDYHGPKPKPGCPDDKEDDKQCNRHGKNRHGDKCDYH
FT                   GKDKHPRPPSKTVTQYTTLTDYITYCPEPTTITLTTCKDKKCEPKTVTITEPTTLTITG
FT                   ECVVPVPVPTETGDSNDWNGNNWGYWGYCDPVTVTEYATKYIKQSPKTKTKTETTTITA
FT                   IGYDNMPTVIPTPMPTPMPTPIPTPTDDMTSSAEPTESDTLTATYTPPIVIKRALFGL"
FT   gene            <121932..>123290
FT                   /locus_tag="DEHA2A01474g"
FT                   /old_locus_tag="DEHA0A01903g"
FT                   /old_locus_tag="DEHA-IPF10872"
FT                   /old_locus_tag="DEHA-CDS2707.1"
FT   CDS_pept        121932..123290
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01474g"
FT                   /old_locus_tag="DEHA0A01903g"
FT                   /old_locus_tag="DEHA-IPF10872"
FT                   /old_locus_tag="DEHA-CDS2707.1"
FT                   /product="DEHA2A01474p"
FT                   /note="similar to uniprot|P07278 Saccharomyces cerevisiae
FT                   YIL033C BCY1 Regulatory subunit of the cyclic AMP-
FT                   dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84354"
FT                   /db_xref="GOA:Q6BZG7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZG7"
FT                   /protein_id="CAG84354.2"
FT                   /translation="MTDNQYATEELNQLQKELVAKNPIDVLQFCANYFNSKLELQRSQL
FT                   WQQQNKAKAAGINLFPSIDNVFNSDGGAIMTTNKRQPSFKSPFGDNDPTSIDHHHDDDP
FT                   KEAPGASKQQNKAELFKGGFGVGKSTPSKPLQELDPNDPSHSASQDTDAAPPVPKSKIP
FT                   VAFNANRRTSVSAEAMNPNKFKSDSWKPPINDLTAAQKVELSKTLGSNFLFRQLDVSSK
FT                   KTVIEALGKKEFKNGDEIIKQGDEGDYFYIIEKGTVDFYVNGNQVNSSGEGSSFGELAL
FT                   MYNSPRAATAVAASDTGVTCWALDRQTFRRILLERTFNRRLMYEDFLKDVKVLSSLSSQ
FT                   ERSKLADALSTEIYHKGDKIVKEGEQGENFYFIESGSCQVSKDGKGVLTKLSKGDYFGE
FT                   VALLNDLPRQATVEALDTVIVATLGKSGFSRLLGPAVDILKSQDPTANQGSSN"
FT   gene            <123448..>123942
FT                   /locus_tag="DEHA2A01496g"
FT                   /old_locus_tag="DEHA0A01925g"
FT                   /old_locus_tag="DEHA-IPF10869"
FT                   /old_locus_tag="DEHA-CDS5820.1"
FT   CDS_pept        123448..123942
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01496g"
FT                   /old_locus_tag="DEHA0A01925g"
FT                   /old_locus_tag="DEHA-IPF10869"
FT                   /old_locus_tag="DEHA-CDS5820.1"
FT                   /product="DEHA2A01496p"
FT                   /note="similar to uniprot|P40030 Saccharomyces cerevisiae
FT                   YER044C ERG28 Endoplasmic reticulum membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84355"
FT                   /db_xref="GOA:Q6BZG6"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG6"
FT                   /protein_id="CAG84355.2"
FT                   /translation="MKISSMKTTNVYGEPPLNIKMIPYFQSFLPTTTSQGGYLPHWLLF
FT                   ISVVSIFNSLQTYQSPDLTLTRRVYESAPTNEVTKLSARTFGTWTFITSIVRFYGAYYL
FT                   VGNKQIYELCMWSFAVAGGHFISEWLYFGNCKLGKGLAGPLIVSSTSLLWMYLQKDFYL
FT                   N"
FT   gene            <124793..>125977
FT                   /locus_tag="DEHA2A01518g"
FT                   /old_locus_tag="DEHA0A01947g"
FT                   /old_locus_tag="DEHA-IPF10867"
FT                   /old_locus_tag="DEHA-CDS3222.1"
FT   CDS_pept        124793..125977
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01518g"
FT                   /old_locus_tag="DEHA0A01947g"
FT                   /old_locus_tag="DEHA-IPF10867"
FT                   /old_locus_tag="DEHA-CDS3222.1"
FT                   /product="DEHA2A01518p"
FT                   /note="similar to uniprot|O74885 Schizosaccharomyces pombe
FT                   SPCC576 Putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84356"
FT                   /db_xref="GOA:Q6BZG5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG5"
FT                   /protein_id="CAG84356.2"
FT                   /translation="MTQASILEVTPLADQPFGCMVSLPDYCDNDPSKLNEDDFKKLFTA
FT                   VHTHLVVVVKDQAKLSPKSQYELTKRFDPTIPEPKQEGFAGYGHGKEFRHEQSVLRKDG
FT                   TTVKSQPQVQILGQGTFEANEPGNENGEAISLTHPSHTTFHHTPLTQDDIKNQHKTRFY
FT                   RWHIDSALYDLLPPVVTTLLGIKVPPASEMQTISYEDSDEELKLASGATCFFSGQQAYD
FT                   RLSDEEKQFAVNTTVEYPPHPYIFISPAGATSDGLTMVSEGKELAFDKMPEWEPEKIKR
FT                   LPMVWTNPVTNKHHLQVHGCCLYKLHTKSPDGTTKTLELEDARKKVHSMMRPAISPSKV
FT                   LAHAWNEGDLVLFYNRGVLHSVTGELKGVKNGKDERRLMHQCNIASGIEPVLVQ"
FT   gene            <126129..>128279
FT                   /locus_tag="DEHA2A01540g"
FT                   /old_locus_tag="DEHA0A01969g"
FT                   /old_locus_tag="DEHA-IPF10866"
FT                   /old_locus_tag="DEHA-CDS1082.1"
FT   CDS_pept        126129..128279
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01540g"
FT                   /old_locus_tag="DEHA0A01969g"
FT                   /old_locus_tag="DEHA-IPF10866"
FT                   /old_locus_tag="DEHA-CDS1082.1"
FT                   /product="DEHA2A01540p"
FT                   /note="highly similar to uniprot|P38795 Saccharomyces
FT                   cerevisiae YHR074W QNS1 Glutamine-dependent NAD(+)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84357"
FT                   /db_xref="GOA:Q6BZG4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG4"
FT                   /protein_id="CAG84357.2"
FT                   /translation="MGHYITLATCNLNQWALDFEGNRDRIITSIIEAKKLGATLRVGPE
FT                   LEICGYGCLDHFLENDLYDHSWEMYGHILTNPNTQDILLDVGMPIIHKSIKYNCRLLSY
FT                   NGKILLIRPKLYLANDGNYREMRYFTPWNRPKYYESFQLPKNISSVTGQSNVTFGDCVI
FT                   QTLETTLGAETCEELFTPQSPHISMALDGVEIFTNSSGSHHELRKLDTRLQLITGATKK
FT                   CGGVYLYANQKGCDGDRLYYDGCACIIVNGKVVAQASQFSLRDVEVVSATIDLDDVRSY
FT                   RNQKSSAFQSVSQSDSTVYHHIPTDIELSPNSNVFNPNVKPSPYRDIRYHLPEEEIALG
FT                   PACWLWDYLRRSKCAGYFLPLSGGIDSCATAVIVHSMCRLVVKSCEEGDKQVISDIQSL
FT                   THDPEFVPKTPQEVAGRLFYTSFMGTENSSKETRSRAKELSEKVGSHHIDMNMDSLVSA
FT                   VVSVFEVATGKKPIFKIFGGSQTENLALQNIQARLRMVLSYLFAQLLPWTRNISGGLLV
FT                   LGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIDWADKNFELPILHDFLTATP
FT                   TAELEPITQNYVQSDEVDMGMTYDELSRFGRLRKVDKCGPMAMFIKLYHEWSQPPLNLT
FT                   AEQVAEKVKRFWFFYAINRHKMTTMTPSYHAEQYSPDDNRFDLRPFLINPRFPWASKKI
FT                   DEAVDIINQRTEEIKRANLSVD"
FT   gene            complement(<128661..>129833)
FT                   /locus_tag="DEHA2A01562g"
FT                   /old_locus_tag="DEHA0A01991g"
FT                   /old_locus_tag="DEHA-IPF10865"
FT                   /old_locus_tag="DEHA-CDS3258.1"
FT   CDS_pept        complement(128661..129833)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01562g"
FT                   /old_locus_tag="DEHA0A01991g"
FT                   /old_locus_tag="DEHA-IPF10865"
FT                   /old_locus_tag="DEHA-CDS3258.1"
FT                   /product="DEHA2A01562p"
FT                   /note="weakly similar to uniprot|P38796 Saccharomyces
FT                   cerevisiae YHR075C PPE1 Protein with carboxyl methyl
FT                   esterase activity that may have a role in demethylation of
FT                   the phosphoprotein phosphatase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84358"
FT                   /db_xref="GOA:Q6BZG3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR016812"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZG3"
FT                   /protein_id="CAG84358.2"
FT                   /translation="MSGLHKQFLKKIKEQERAFGLSSLSEDPDESESNSNYFSPTPQPP
FT                   NELRTDINEERHGHIRETYNDTKRDVFPIADIYTDPRSGVRFQTYFKPPSSSNAPIFIC
FT                   HHGAGSSSMTFCKLAQSLDNEYGKNNEYPGLFTYDMRGHGDSSTTIPPDYSLATITNDC
FT                   EFIIDEFHAKHALRSSIYLLGHSLGGSVLTSYLVANPDNAYKFKGLIVLDIVEETAIKA
FT                   LSAMPQFVRKRPTTFGDYQEAIDWHIKESHLLHSEESALVSVPDLLRECPNGLIWKTNL
FT                   QETEPFWETWFTGLSENFINCGKTQHIAKLLVLSGHETLDTNLIIGQMQGKYQLIVFNN
FT                   TQNTGHFIQEDIPTQISISLVDFVRRNDSPNEYMKKEFGFVPKWGGKIHD"
FT   gene            <129949..>130914
FT                   /locus_tag="DEHA2A01584g"
FT                   /old_locus_tag="DEHA0A02013g"
FT                   /old_locus_tag="DEHA-IPF10864"
FT                   /old_locus_tag="DEHA-CDS4004.1"
FT   CDS_pept        129949..130914
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01584g"
FT                   /old_locus_tag="DEHA0A02013g"
FT                   /old_locus_tag="DEHA-IPF10864"
FT                   /old_locus_tag="DEHA-CDS4004.1"
FT                   /product="DEHA2A01584p"
FT                   /note="similar to uniprot|P47058 Saccharomyces cerevisiae
FT                   YJL035c TAD2 tRNA-specific adenosine deaminase 2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84359"
FT                   /db_xref="GOA:Q6BZG2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG2"
FT                   /protein_id="CAG84359.2"
FT                   /translation="MSDMIPTFRNMAIALFIGYRAMINNETPVACILVSRSTNQILSIG
FT                   YNDTNRSLNGTRHAEFIAIDKVMSQIPVHDRSDIAKIQGFFGDVILYVTVEPCIMCASA
FT                   LKQIGIGYVVYGCGNDRFGGNGTILSIHQDKINKAYQSYGGVLRTEAVQLLRNFYIQEN
FT                   DSAPNPKIKKNKELENKEYPPNLDFKEYLSPEEFTEFFGDERFAASYDNRGRELTPVLN
FT                   HGYTLRDILHIEDLLAVSELKEMYQEKDFEDKLENDLQNFYGLFYDIDEEGKVDFNKII
FT                   TKIDQIAQINPADPADPVNQVIQVDGFTTDLDCKKRKLNK"
FT   gene            <131290..>132834
FT                   /locus_tag="DEHA2A01606g"
FT                   /old_locus_tag="DEHA0A02035g"
FT                   /old_locus_tag="DEHA-IPF10863"
FT                   /old_locus_tag="DEHA-CDS2231.1"
FT   CDS_pept        131290..132834
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01606g"
FT                   /old_locus_tag="DEHA0A02035g"
FT                   /old_locus_tag="DEHA-IPF10863"
FT                   /old_locus_tag="DEHA-CDS2231.1"
FT                   /product="DEHA2A01606p"
FT                   /note="similar to uniprot|Q04673 Saccharomyces cerevisiae
FT                   YLR005W SSL1 Component of RNA polymerase transcription
FT                   factor TFIIH"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84360"
FT                   /db_xref="GOA:Q6BZG1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZG1"
FT                   /protein_id="CAG84360.2"
FT                   /translation="MDESDEEYIAPQHTAADTPSGVPSNEASQKESSVPADGVSKRTRS
FT                   SGMTHQPRSGAVGDLKSSNGGYAWEDEYQRPWDIVKDDEDGRSLETIIQTMIENRKKKI
FT                   MRNPTTPFQRGIIRTLVVIIDGSSVMSEKDLRPTRFSMMLSLLQEFVVEYFDQNPISQL
FT                   GIIMMRNGVSNLISEVNGSPQYHLDKIRQLKSRQHNKYEPKGDPSLQNALEMARSLLMY
FT                   NFGTNLNDTKNSKEILIIFGALFTSDPGDIHKTINSLVKDEIKVKVIGLSAQVAICQEL
FT                   VNKTNNPGKSNTFWSAGGNNYGVIMNEIHFRELLMDCVIPLPVTTNAVIDENNSKEVPI
FT                   IKMGFPSKIQPVITSSTSNLSVDFPQLCACHPTQDSLESKNNDPTATLGTRSVIGYECP
FT                   QCNNKVCHLPTICPICGLMLILSTHLARSYHHLVPLGDYKEVPVSESYSSTYCYGCLLK
FT                   FPSGIKNTDVNEDGKTKMDSLTSSRYRCGKCQNDFCIDCDVFVHESLHNCPGCENK"
FT   gene            complement(<132972..>135875)
FT                   /locus_tag="DEHA2A01628g"
FT                   /old_locus_tag="DEHA0A02057g"
FT                   /old_locus_tag="DEHA-IPF10860"
FT                   /old_locus_tag="DEHA-CDS0494.1"
FT   CDS_pept        complement(132972..135875)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01628g"
FT                   /old_locus_tag="DEHA0A02057g"
FT                   /old_locus_tag="DEHA-IPF10860"
FT                   /old_locus_tag="DEHA-CDS0494.1"
FT                   /product="DEHA2A01628p"
FT                   /note="similar to uniprot|P27692 Saccharomyces cerevisiae
FT                   YML010w SPT5 transcription elongation protein singleton"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84361"
FT                   /db_xref="GOA:Q6BZG0"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR017071"
FT                   /db_xref="InterPro:IPR022581"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="InterPro:IPR039385"
FT                   /db_xref="InterPro:IPR039659"
FT                   /db_xref="InterPro:IPR041973"
FT                   /db_xref="InterPro:IPR041975"
FT                   /db_xref="InterPro:IPR041976"
FT                   /db_xref="InterPro:IPR041977"
FT                   /db_xref="InterPro:IPR041978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZG0"
FT                   /protein_id="CAG84361.2"
FT                   /translation="MSEEENRITTSSDDVIKHEHPDNSTAGGAYEVQDRDQNDIDEEEE
FT                   EKEENKRSAEEEYSIGSKRSLEDSEEGESKVPTENDQALINNSGEGAEQQDNGDEANDD
FT                   ENDDENDEDEDEDEDEEEVSSNKRKRRRGANQFIDIEAEVDDEEEDEMDEDDEEAELLR
FT                   EQFIADDSRVETMDGKDSAGEHQDDRLHRQFDRRRQEAEDQDAEVLAETLKQRYRKTHT
FT                   VYRGDTTASGTVSQKLLMPSINDPAIYAIRCTPGREKDLVRKLYEKKRTLARSNPLEIL
FT                   TVFQRDSFKGYIYIEAKKPEAIERALTGMVNIYAKQRLLVPVREYPDLLKQVKSSDVEI
FT                   VPGIYVRITRGKYKNDLAIVDNLSENGLDVRCKLVPRLDYGKNDDFDKDGKRIRSKTKP
FT                   IPRLFSEQEARMYDGEYLQSGRGPRAFIYRGEEYNEGFLFKDFKLQFIQTKDVHPKLEE
FT                   LDRFQTGDPEEDGLDLAAIAASLKNKNNSEGAGRSSAFQPGDKVEIRRGEQAKTIGKVL
FT                   STSLNEITILVTDSGDPKFVNQRLTVPANDLRKLFSAGDHVRVIEGKHSDETGLVIKID
FT                   NDSVILLSDQTKQDVRVFANYLIKATDASSNTDVTGGKYDLNDLVQLNVSTVGVIVKAE
FT                   KSSFEVLTSEGRLMSVNPAGIASKLELSRREQIATDRNGSTVKIGDTVKEVLGDKKREG
FT                   AILHIYKNSLFIKSNEILENLGVFVTNCMNVSTITTKDSIVSKSLGPDLNRMNPNLKLP
FT                   NPIANAGLKTRVGGRDKLIYKDVLVNSGNYKGLMGKVTEADEVYARIELHTKSKKIKVT
FT                   KNSLSVLVRGEAIPYLRFIGASSGPGNSNPSGNFGGASFNQPAKTPAFSSGGKSSWGSG
FT                   GATPSVGGGATAWGSGGAQSSWGGGKTPAYNSGNASTWGGNAGGASAWGNNNGNASTWG
FT                   SNSKNGGSSTWGGNSTWGNSNKGGKSSWGNGSAWGGK"
FT   gene            <136911..>137471
FT                   /locus_tag="DEHA2A01650g"
FT                   /old_locus_tag="DEHA0A02079g"
FT                   /old_locus_tag="DEHA-IPF10858"
FT                   /old_locus_tag="DEHA-CDS5511.1"
FT   CDS_pept        136911..137471
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01650g"
FT                   /old_locus_tag="DEHA0A02079g"
FT                   /old_locus_tag="DEHA-IPF10858"
FT                   /old_locus_tag="DEHA-CDS5511.1"
FT                   /product="DEHA2A01650p"
FT                   /note="highly similar to uniprot|P49435 Saccharomyces
FT                   cerevisiae YML022w APT1 adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84362"
FT                   /db_xref="GOA:Q6BZF9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZF9"
FT                   /protein_id="CAG84362.1"
FT                   /translation="MSQVEISELAKEIRASLKQFPNFPSEGILFEDFLPVFTKPDLFQK
FT                   LVRAFQLHVGEQKVDYVVGLESRGFLFGPTLALALGAGFVPVRKAGKLPGPVFTAEFQK
FT                   EYGSDKFQIQKDVIEEGAKVLIVDDILATGGSASSAGELVKQTGGDIVEYLFVMELDFL
FT                   NGRDKLDKPAFTLLSGQAEKLQN"
FT   gene            complement(<137654..>137978)
FT                   /locus_tag="DEHA2A01672g"
FT   CDS_pept        complement(join(137654..137907,137957..137978))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01672g"
FT                   /product="DEHA2A01672p"
FT                   /note="similar to uniprot|Q02647 Saccharomyces cerevisiae
FT                   YDR424c DYN2 dynein light chain 1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84363"
FT                   /db_xref="GOA:Q6BZF8"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="InterPro:IPR037177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZF8"
FT                   /protein_id="CAG84363.1"
FT                   /translation="MSEKEQEPILKASDLPEEMQTRIFELSNEAVSNYKIEKDIATYLK
FT                   KELDQLYGATWHVIVGKSFGSYVTHEQGFFTYFYIGQLAFLIFKSG"
FT   gene            <138549..>139235
FT                   /locus_tag="DEHA2A01694g"
FT                   /old_locus_tag="DEHA0A02123g"
FT                   /old_locus_tag="DEHA-IPF10855"
FT                   /old_locus_tag="DEHA-CDS5048.1"
FT   CDS_pept        138549..139235
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01694g"
FT                   /old_locus_tag="DEHA0A02123g"
FT                   /old_locus_tag="DEHA-IPF10855"
FT                   /old_locus_tag="DEHA-CDS5048.1"
FT                   /product="DEHA2A01694p"
FT                   /note="similar to uniprot|P43543 Saccharomyces cerevisiae
FT                   YNL335W DDI3 and similar to uniprot|P43543 Saccharomyces
FT                   cerevisiae YFL061W DDI2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84364"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF7"
FT                   /protein_id="CAG84364.2"
FT                   /translation="MSKYGFVKIARDIKTAVGKINEPTAQSVVELPDSPLGKFMLDYAT
FT                   KELPEKVLFHSLRVYQYSIAIINDHFDKWALDSEVLFVTCLLHDIGTTEKNMKATKMSF
FT                   EFYGGMITRDLILEHTNGNQDYAEAVSEAVIRHQDLGDTGFITTLGLILQISTILDNVG
FT                   LNTDLIHPDTLAAVNKEYPRHGWLNCFADHIDNENTKKPWGHTSSLGVPDFRNNVLANK
FT                   VKYEKL"
FT   gene            <139401..>144725
FT                   /locus_tag="DEHA2A01716g"
FT                   /old_locus_tag="DEHA0A02145g"
FT                   /old_locus_tag="DEHA-IPF10854"
FT                   /old_locus_tag="DEHA-CDS0054.1"
FT   CDS_pept        139401..144725
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01716g"
FT                   /old_locus_tag="DEHA0A02145g"
FT                   /old_locus_tag="DEHA-IPF10854"
FT                   /old_locus_tag="DEHA-CDS0054.1"
FT                   /product="DEHA2A01716p"
FT                   /note="similar to CA4547|CaSRB9 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84365"
FT                   /db_xref="GOA:Q6BZF6"
FT                   /db_xref="InterPro:IPR009401"
FT                   /db_xref="InterPro:IPR021643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZF6"
FT                   /protein_id="CAG84365.2"
FT                   /translation="MPEAIDASSIATNYYKLAHLCSVTYLIYTTNGATNDSTLLELELL
FT                   IRHSHPKCLVTYYNKYLYYFQFNHVDEHVDLTKEYPQLQLKYSNQVSADLLANPPKVAS
FT                   DKDNHSTGNEYLAYACLSFLKAVKKLVLFNLSRNEAVQLFGNYAVVKEQGLSNFILHID
FT                   PILLPNGDLLISISEKCHLQLFDSSIVDISEIEAVDLNFVLYIIPSGIRCHLYDNVNVA
FT                   SNFTTDPPKNSEVLMQLIKYSTGFDLNQLNSLVWVKLVPNLQHLNNQTSKISKFIHPVD
FT                   NKKFILWPWRLCLLQFGLSEKDTATSPHVLTCDPISLISDFIDFNISHHQQANITGQLN
FT                   PNHQHNQSFNYSIPSALSTGMSSTGANENKGDLNMVGDIPGSVSDIFGIQSSDTNDFFN
FT                   GPNFQPAQNPSDVKLDSQEPVKKNSDDEDVEMDDLFGDASEDEKAKTEVSTNELNEEKN
FT                   FEDLFNDGLNQENQVDESDKVAKSIDEEVLKEESVKSEDLKEDKDLKMQPSSGTIPNTF
FT                   IDIPKDQMTIPSLKNLKQTPQIYNDPGAPMPVIPTPIFPQFGINSTLPGSAQSVNPPTS
FT                   AAATDNEANEGARSIFSPILFNPIIKSNIDTKYGKGGKFYVDKEVSAGPDIDSKRKTLR
FT                   ATSVSGFELPSRREDSIGIESITDDNDRRQVFEFPEEQGNERMKDEGHENHAAENDNII
FT                   KKMEELEEEDDNDDDDDDDDDDDENEDEDEESDEDDDLNLENNDMNMKRSPPLKLNTLN
FT                   DPYVAQSNQAVVNFNDSNYNAKQILPNSYNASSMNTGGFSSPASLGFSSSRTNVPPKND
FT                   SPFGLNNLAREDRNGTTSPTGDNSDQPTKRQEQSDSPMVVDMEVEKKSTSKEAENTPSG
FT                   MTTPNSRGSISESSNCLPLILRGVNVASIPTSFILNNVIVSNKISTISTNFDMDVDDET
FT                   EWSDYELCKNNEMTVKLNNLDEFLKCLGPNLIFDMGLNKLQNSLEMKLSNNERDDEEYD
FT                   NIEGKAPSRQFENKLCDIFPFCYKVNLNEFTTEAYVNELKGETTTIQDELDNQLSFLDD
FT                   ITNEDILNPKTQLKKLNSIEWDAIYSDSSSNEDNSKKYQGMVHNVGQSSLVNTLEDGTI
FT                   FPLANDKARVLKHNDTIINLNSIGIKFWKYLNFSPLNGPKNFQLLLISEHDHNMLHHNY
FT                   NIEFLNSLVYNYKECCFGNISKINLQSSDSRPDMEGIDNGLLMVHKKDEDQVYGNMYKQ
FT                   VNRKLNALVEMIKSDLINKTNKFEFDRPLLLLFINFDKSVNSLLQISKLIRNFKLFLSH
FT                   HQLPLVEVFAHIIPWSLIIKQSGSQRRLKYLSNFRLSKLSMNLYNQCPNERTIGKPVKD
FT                   PTKHLFTQLVKEPPSNLNFKFMNNGSNGNGKTTFNDDIFLHLAYERSIDKNWFSAAWSD
FT                   PLGVVVSTKSWNCSPNLQKTNNKNVHSLESISDEIWTISTALFKKLNDEIIKRTSGLGG
FT                   KKFLVLTRINSIIPDDELIHWKRLSMKHKDVSLIVLSVNKSPKLLFSGPIGPSQQEDKS
FT                   NYDPNTNRTSTNMDNSSSTNAANPTCGVGATSNAPDFFKTFGSNNPSPNNNAGSMSISP
FT                   SNNVGINFHSPQQFLNAPGNFLLPQDFVSSTGGSTNINANPHSNASQYNPDEIIHDPTE
FT                   ELTAVIPKAPLPSFNSPTRLGMKIGYLIKETGVSTHEDTKQYLVYEINLLSCSNYWNLN
FT                   AIMKILLNQYKKLITLNDILCVGEIDGSITDDRAEKDSNIIPEMTPPLNYTASGLIPWH
FT                   IAAVTKSLDYLIHIDVEE"
FT   gene            <144875..>146635
FT                   /locus_tag="DEHA2A01738g"
FT                   /old_locus_tag="DEHA0A02167g"
FT                   /old_locus_tag="DEHA-IPF10849"
FT                   /old_locus_tag="DEHA-CDS2040.1"
FT   CDS_pept        144875..146635
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01738g"
FT                   /old_locus_tag="DEHA0A02167g"
FT                   /old_locus_tag="DEHA-IPF10849"
FT                   /old_locus_tag="DEHA-CDS2040.1"
FT                   /product="DEHA2A01738p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF5"
FT                   /protein_id="CAG84366.2"
FT                   /translation="MEGIELDSTHELLNRYKVKEGRNEDITIYSDEDSIFNSPSIELGR
FT                   SAVKNTKNSSPFKKFGTGRSSSLSPSKKVRNDYQDHLHRMRGNSNTGSPLKRNNYDLSE
FT                   YNDFDDIKGMPGLNIDSLSGSDNTMDKEIQRILDMSSLKLPELQDDQGKDKTELLIKET
FT                   HKLINTVPASITSSMEGEAYQKMLTTSINKLIKQVESMKRDLENRDNEAKSHRIQLSNL
FT                   EMKMGLYQRENNDLKKELNQVKKRSVIPQNESRENDLLRTKLIKYRNLYTEADRENQEL
FT                   KSKHNGEPVKESASQQMPVREQPRPTGQADAAEMPSGINPIDRKSLSQDVYKQRLVELQ
FT                   NQLSDIIDDVKDEPPQPEIRPVSQPKSQPHETSKSNEMADAHSQPSLRMLAIFEDLVRA
FT                   MKNESDESKHVEKPIETQTTPNETSPNESVEQESMENLRNPIDPVLEKILASLDKNNQM
FT                   YNRLLDVLNPDANGQPIRISEASTAPMLDEAHYPDPKEREKDIVFQCYVCCPQNHKLHA
FT                   KRPCKRCSAASSEASGSAGNSVTHSAGNSASDSTSDTHVRDSGPNRMVDFSDPKDNKTI
FT                   NLMGEYKWTI"
FT   gene            <147554..>149080
FT                   /locus_tag="DEHA2A01760g"
FT                   /old_locus_tag="DEHA0A02189g"
FT                   /old_locus_tag="DEHA-IPF10846"
FT                   /old_locus_tag="DEHA-CDS2271.1"
FT   CDS_pept        147554..149080
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01760g"
FT                   /old_locus_tag="DEHA0A02189g"
FT                   /old_locus_tag="DEHA-IPF10846"
FT                   /old_locus_tag="DEHA-CDS2271.1"
FT                   /product="DEHA2A01760p"
FT                   /note="weakly similar to uniprot|P24869 Saccharomyces
FT                   cerevisiae YPR119W CLB2 Involved in mitotic induction"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84367"
FT                   /db_xref="GOA:Q6BZF4"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF4"
FT                   /protein_id="CAG84367.1"
FT                   /translation="MPQTVNNENEYRLTRSKAMQNQSLRGNEGGPKTHAQTQMEAQSQK
FT                   GGRGEAVMGDGNGDTKDGLYNLSQHSSEEVLAGTRSYLGDVSNQYGSSGVKPNMGSKRR
FT                   PLGGDNAPLQQHQRIMLKPNNSSTNTNHLLASQPKDTVTTTTATINDNTNGNITTNNHT
FT                   SASSSNSSTQNLAVPARMPQKRQATESSTNLVEKLHISGPHSNHVSYKKSRIIDYEWQD
FT                   LDEEDIDDPLMVSEYVNDIFPYLSELEHKTLPDSQYLFKQKHLKPKMRSILVDWLVEMH
FT                   TRFRLLPETLFLAINIMDRFMSLEIVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYAYF
FT                   TDGSYTEDEILQAEKYILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEITI
FT                   IDYKFIGMLPSLCSASAMYIARLILGKTPVWNGNLIHYSGGYRVSDMKDCIELLVQYLI
FT                   APVEHDEFFKKYATRKFMKASILCRSWAKKIVSENKDIFANDLFINKAEN"
FT   gene            <149414..>152071
FT                   /locus_tag="DEHA2A01782g"
FT                   /old_locus_tag="DEHA0A02211g"
FT                   /old_locus_tag="DEHA-IPF10845"
FT                   /old_locus_tag="DEHA-CDS0634.1"
FT   CDS_pept        149414..152071
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01782g"
FT                   /old_locus_tag="DEHA0A02211g"
FT                   /old_locus_tag="DEHA-IPF10845"
FT                   /old_locus_tag="DEHA-CDS0634.1"
FT                   /product="DEHA2A01782p"
FT                   /note="weakly similar to uniprot|P38850 Saccharomyces
FT                   cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84368"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR031906"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF3"
FT                   /protein_id="CAG84368.2"
FT                   /translation="MFQGSAFLVVVSDAFTDEEVNDVESMLKQNNAKVFVKEEHDNEVN
FT                   YLGTEAVSNTHIDHIICKSVEFIEYNLAQTSMVPITTPEWVFDSVSRAKISNPKVYSPD
FT                   PKLFLKDTFVCVADNLPVGDKEAIYGGVRAFGGQYLDDLTRYTTHLIAMDMNNDKSVIA
FT                   TSAINTTQENGDKIDIKIVLPHWIDDCLKMGKKLHEEPYMLPSPSILKTTSEGIDSPVI
FT                   TEDDVLPIDSSKSSFLDNKLFYISPDYKISHRLTSAIGALIKKHGGKVTTQFDSKMVDI
FT                   YIGQYRAGDAYITSCKSNRIIVGNLQWLYSIIVSNKWKLPINSNLLHYPIPLTSLPDFQ
FT                   NLKISVTNYSGDARFYLSKLITILGGTFTKTLTRDNDFLVAAKPEGKKYEAAKVKWRSE
FT                   DNNNIKIVNHLWLEECFANWKLMEYDRPQYQFLGNNANGVEKLLCKTKLKQNVLESWYN
FT                   QENIASEKENVADSMSEDESTQPKSRLKSNTKTNNTKKSPSTNGSVTDENIEQEEEIQD
FT                   EQKDDDEQEKIKAKEDETRLSTKEKTKKSSLPSEMCKEDDEAVLPATPITGRSGRSAKQ
FT                   KAVNKLHSDMNDLNDYQQMSKSSRKMKSYMEELEKSSSAKRKAEIENKDTNTIETPVKA
FT                   KKRKTESPRPDTDTKIVAVITGCENEITLTRQDTQNLNHIGVKVLSDYSTKQGINTLIA
FT                   PRILRTAKFLRSLSQVDKIIHPNYLIDVLKKLNSSQDADGDQVSKEFSINDYSLDKVIP
FT                   IKAINQELGVTNAKENGLANLLNTTNRGLIFQDLKINLSSNLVGGVQVISEILESHGLA
FT                   EAKSIKSVTAANTKSLLTNDDGKTIMIAHKSKDAKLITSFKKNVQNGVIVEWDWCVKSI
FT                   FKMKLEEFDSYQLL"
FT   gene            complement(<152242..>153759)
FT                   /locus_tag="DEHA2A01804g"
FT                   /old_locus_tag="DEHA0A02233g"
FT                   /old_locus_tag="DEHA-IPF10843"
FT                   /old_locus_tag="DEHA-CDS2295.1"
FT   CDS_pept        complement(152242..153759)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01804g"
FT                   /old_locus_tag="DEHA0A02233g"
FT                   /old_locus_tag="DEHA-IPF10843"
FT                   /old_locus_tag="DEHA-CDS2295.1"
FT                   /product="DEHA2A01804p"
FT                   /note="similar to uniprot|Q05785 Saccharomyces cerevisiae
FT                   YLR206w ENT2 clathrin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84369"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF2"
FT                   /protein_id="CAG84369.2"
FT                   /translation="MSKSFVRSIKNVTNGYSSGQVLVRNATSNDPSGPTTFDMEEIASR
FT                   TYQSQTDFLEIMDMLDRRLNDKGKNWRHVAKSLTVLDYLVRYGSEKCVLWSKDNLYIIK
FT                   TLREFIHFDEADNDQGAVIRVKAKELVSLLRDDERLQHERELAARAQNGPGHRPGRERR
FT                   NRRGSRRNTVNSNSSRPVTGDDDDEMQKALEMSRITAEEEARRKNQIPDDDDLQAALKL
FT                   SMEEEEMRKLKNQQNDNLLDLDEQQAQPQYYLATGYQQPQYYMMPQQTQTQQQYDMFGN
FT                   PIQNAMNTGLYQQQHYQQQEPMQQQPSFTGFNGPQQQQQQPQELQPLKTGSNNPFALQS
FT                   ESAQQQPASQSLNDIASQQQQQQQDLYQQQQQQQQQQPQFFTQPTSQLKPQTTSSSKFD
FT                   DSTHADLNNLLAQGTGIDTFGNTGATRIPHQHTKTQQFINSSGTGYKQNYDEAKLSSNA
FT                   TGNPFLNTGIGYQQQSQINPAYTGYGFGNANTQQQQRRNDGPSLIDI"
FT   gene            complement(<153981..>154127)
FT                   /locus_tag="DEHA2A01826g"
FT                   /old_locus_tag="IPF_10840"
FT   CDS_pept        complement(153981..154127)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01826g"
FT                   /old_locus_tag="IPF_10840"
FT                   /product="DEHA2A01826p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65345"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSN9"
FT                   /protein_id="CAR65345.1"
FT                   /translation="MTVAQVGPGRGSGGMGVSLPSDSPAGTGGYERGGMGPILVWPGSL
FT                   ASV"
FT   gene            <154694..>156421
FT                   /locus_tag="DEHA2A01848g"
FT                   /old_locus_tag="DEHA0A02255g"
FT                   /old_locus_tag="DEHA-IPF10837"
FT                   /old_locus_tag="DEHA-CDS2168.1"
FT   CDS_pept        154694..156421
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01848g"
FT                   /old_locus_tag="DEHA0A02255g"
FT                   /old_locus_tag="DEHA-IPF10837"
FT                   /old_locus_tag="DEHA-CDS2168.1"
FT                   /product="DEHA2A01848p"
FT                   /note="similar to CA0284|IPF14657 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84370"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF1"
FT                   /protein_id="CAG84370.2"
FT                   /translation="MSEVRRCRRCKRKRLDDEPPEVRQYKTCAKCRIIERQKKKSRKPL
FT                   AEETMIYGMKQFQQQNQNANFIHDDIFMDDDVFSGGVRNSARRYEGDGVVNPSQQQQQQ
FT                   QQQFYQFQPQQASHVAMPTASLAPVAPLHQVQHQVQQQQVQQQQHVQQQQAHRAHQQHM
FT                   RNMPVQVSMPETVSQQPINCEICSTKLDRNDELNMNYRLCLECYSNPFRQDNVYGNYNE
FT                   FLMAITTHKYKDIRNYIYIKETDKTFSDHLVYQNRPISSERSYREFILENIQIIYLDPI
FT                   IASLGCKFNRVSSNVSETNSLPPVFNPVINQYQYKNTKPIRSYHKYYKESACDANIYMT
FT                   FDFSTNILTVKLNQKVFNNSSNYPSKFIDLVHSILKSLATQDSKANVGYNYHTALIIFD
FT                   ELIKNKYSYPPDIQQFLSTCNSSDFARDFINFEETTEVDATGKKDSLPAQKDDADEPVP
FT                   DQVHGDARQATHAGVDDEEEDEEEEEDEEEEEDDDDEDEEGEEDEDDDDDDDDREPQQG
FT                   PNASQGVQSRDVTDTPSETPIPTSEPQTQINPTINLDSTQNGLYPKPTGENLDPAFVQ"
FT   gene            <156585..>157931
FT                   /locus_tag="DEHA2A01870g"
FT                   /old_locus_tag="DEHA0A02277g"
FT                   /old_locus_tag="DEHA-IPF10835"
FT                   /old_locus_tag="DEHA-CDS2761.1"
FT   CDS_pept        156585..157931
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01870g"
FT                   /old_locus_tag="DEHA0A02277g"
FT                   /old_locus_tag="DEHA-IPF10835"
FT                   /old_locus_tag="DEHA-CDS2761.1"
FT                   /product="DEHA2A01870p"
FT                   /note="similar to uniprot|P36091 Saccharomyces cerevisiae
FT                   YKL046C DCW1 Mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84371"
FT                   /db_xref="GOA:Q6BZF0"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZF0"
FT                   /protein_id="CAG84371.1"
FT                   /translation="MKLTIVLSAVIGLVSTVQGIWLDTNNVTNLKEVSAIFAEGLLDYY
FT                   DGNEYGGTIGMFTWPYYWWEAGGAWGSLIDYTYYMENDTFVPLIKQALEYQTGDDLNYI
FT                   PLNQSTTEGNDDQGFWGLAVMAATEKNFSNPDNKDKHWLALTQAVFNTMTARWDHKECH
FT                   GGLRWQIFQWNSGYDYKNSVSNGCLFNIGARLARYTSNDTYMEWAEKVWDWMYGIGLLT
FT                   EGEHWYVYDGVTVGGNCTDITKLQWSYNQALMLSGCAFLYNYTEDEMWYNRTMRLLSGA
FT                   QVFFKDDIMYEAACQGSNNCNQDQRSFKAYFSRLLGLTSVMVLDTEPVITEWLVASANA
FT                   AAKNSCTGGSDWHTCGLNWQNGTWDGYYGLGEQMCALEVVTNLRVHDLPPPYTANNGGS
FT                   SKGNPAGGYAVTNTNSSPLNLDKGDTAGASIITVIIAASLVGSGVWLIL"
FT   gene            <158128..>159876
FT                   /locus_tag="DEHA2A01892g"
FT                   /old_locus_tag="DEHA0A02299g"
FT                   /old_locus_tag="DEHA-IPF10834"
FT                   /old_locus_tag="DEHA-CDS1718.1"
FT   CDS_pept        158128..159876
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01892g"
FT                   /old_locus_tag="DEHA0A02299g"
FT                   /old_locus_tag="DEHA-IPF10834"
FT                   /old_locus_tag="DEHA-CDS1718.1"
FT                   /product="DEHA2A01892p"
FT                   /note="weakly similar to uniprot|P47057 Saccharomyces
FT                   cerevisiae YJL036W SNX4 Sorting NeXin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84372"
FT                   /db_xref="GOA:Q6BZE9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZE9"
FT                   /protein_id="CAG84372.2"
FT                   /translation="MSSDDQFTSIQWDRDELGPNKETKVNKQETITEDDEHHNNDNEDK
FT                   DNDTTKSNEPENIQEDDETKDDNEPTDSLILSKTGDENISNIESQNEGDHIVGEPDVNQ
FT                   EPSSDSQTEAYEINVVVTSPLRDLDSSSKPYISYLLTTATNHPSVMKLSTVKKEQGKEV
FT                   VEITARRRYGDFRFLFDCLSNDHPEVMMPPLPSKSNFKYLTGDTFSTEFVHKRLHSLDR
FT                   FVRFITCHKVLSQSSIFHLFVSDSADWSTFQKNLKISKVGVQESDADKGNSSMTSNVVN
FT                   KVVNEDLLTETIMNFLTPSKHKRETNKEILEISDKLKKLYENLIKLDKIFTKLNKKNHD
FT                   LSVDYEQFSQQIMKLSVIQNSSDETNEPTTPEINEQKQFATNFKVFASSLSYFSDNWSN
FT                   LHKYIDESFLVSLKDCAKYIISLTNLIELQHNKKIDLQVLQDYLNKAKSELQGLGGSHN
FT                   APPNPIITHNNGGIVNNTTQLIRDTLSTSATPNIGSSVTESKVTKLQNRITELENEISV
FT                   QSQLVLDLTNKIINEEYPNWDKFNKIELKESLLGLCNEEISFYKGLVDNWSDIELKLLK
FT                   RLDELK"
FT   gene            <160242..>161975
FT                   /locus_tag="DEHA2A01914g"
FT                   /old_locus_tag="DEHA0A02321g"
FT                   /old_locus_tag="DEHA-IPF10832"
FT                   /old_locus_tag="DEHA-CDS2031.1"
FT   CDS_pept        160242..161975
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01914g"
FT                   /old_locus_tag="DEHA0A02321g"
FT                   /old_locus_tag="DEHA-IPF10832"
FT                   /old_locus_tag="DEHA-CDS2031.1"
FT                   /product="DEHA2A01914p"
FT                   /note="similar to uniprot|P32857 Saccharomyces cerevisiae
FT                   YKL039W PTM1 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84373"
FT                   /db_xref="GOA:Q6BZE8"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZE8"
FT                   /protein_id="CAG84373.2"
FT                   /translation="MQLIYHKKLSVITGLFILSLINLVSGYVTKFNELNSQVCSGIYSK
FT                   HDWGGSFKPSIEIKLLSYGKDKYDSKSKDQKEKEDISVSYVIFEYKDLGNIGYDLGDGK
FT                   YRYICDDYAINDLGICEKKQKGKFIIQSTSPNSTIMTSSFNHLGEANIHYNVSRSGYYC
FT                   ISTVSMNDKSYSGTMNFQNAFGHLSASEIPKLPAYGILTIFYAIALALYGFQFYKKRNQ
FT                   NQILPLQRYLLAMLGFLTFDTIVVWSYYDLVNRTRNPSAGFVTFYMFFLSFMNAMKISF
FT                   SFFLLLCISLGYGVVVLKLKKSVMLKCKILAGCHFVATMVYLVSNYYNGSAYTTSSGSS
FT                   RSMNNSGAGDFLGLLPLIPVTITLTAYYLAVLISIKKTTANLHKQRQIIKLQLYQNLFR
FT                   IIFSSVILTFGGLILSSFIYLSMSTTEMIEEHWKGAFFIFDFWPSVVFYGVFMGVAWLW
FT                   RPTETSYMLAISQQLSTEETADNEDGEADIGQGYHRGHEFELDDLSLISHSDNENQPPA
FT                   DHDSFELSRDENPPPQYSETDDDNKKSKKKEEPSETGNTLFELGEESDDENKDDDRLNS
FT                   K"
FT   gene            complement(<162046..>163263)
FT                   /locus_tag="DEHA2A01936g"
FT                   /old_locus_tag="DEHA0A02343g"
FT                   /old_locus_tag="DEHA-IPF10830"
FT                   /old_locus_tag="DEHA-CDS3155.1"
FT   CDS_pept        complement(162046..163263)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01936g"
FT                   /old_locus_tag="DEHA0A02343g"
FT                   /old_locus_tag="DEHA-IPF10830"
FT                   /old_locus_tag="DEHA-CDS3155.1"
FT                   /product="DEHA2A01936p"
FT                   /note="similar to uniprot|Q04062 Saccharomyces cerevisiae
FT                   YDR427W RPN9 Non-ATPase regulatory subunit of the 26S
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84374"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035298"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZE7"
FT                   /protein_id="CAG84374.2"
FT                   /translation="MSAMDVDRDVYTVLSTLRSETESNELINIFYQLEDYFERKLYHQL
FT                   TLTLNEFYENPESKNNRLRIKIYDLFISQFSQKLNSIQVVDFLLASFEDDKEECLNKLL
FT                   QLKETFVKQLRNNYTNKSEIEETINNDESIIYIDLQIARYYLILNNLEKSETILEHLNP
FT                   KFESTFENEFSSKINSAFYLTKCQLYKINENYNLFYLNGLLYLSSIKNKSLSIEEQQML
FT                   CYDLCIAALLGDKIYNFGELLLHDILNCFKDSQYDWLYNLIHNLNSGNLKNFNKWLAIG
FT                   FQKSPFLKTFEVFLKQKVIIMSLLELISMKSTTNKQLNFKEISEFTGTPVNDVEHLIIK
FT                   CFSLNLIKGYINQIDEVLVVTWLQPRILNLDQVNVLYNHLCKWNGQVEGLAKEVHKNGG
FT                   SIWAGL"
FT   gene            <164313..>165410
FT                   /locus_tag="DEHA2A01958g"
FT                   /old_locus_tag="IPF_10829"
FT   CDS_pept        164313..165410
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01958g"
FT                   /old_locus_tag="IPF_10829"
FT                   /product="DEHA2A01958p"
FT                   /note="similar to uniprot|Q9C454 Emericella nidulans
FT                   Transmembrane protein UsgS"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65346"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP0"
FT                   /protein_id="CAR65346.1"
FT                   /translation="MASPILISNPSSSVSVLAIVRGVQLALLGGYRSLQNRQLYEIDVC
FT                   CLALRLIQMSIIIQIILWTPAYFCRFATYILSYLFNRNLAIDFDGDYLLSILNMNYMMI
FT                   SSIRFFEPRLDGIFLMTLSFMDSKSDQQYYANLMRLSFEHNEDLESHISILTSIKRKYN
FT                   NSIQFRKFVKTNTKTILSTLSIYLMCNKSSKLESILIVVLTFQNFDDKIGTVSSLILSV
FT                   ILSIIPKHHSLQFITTFGGSCSLMQDLLNPYFTRISLNKLEKNQWVRSREGLLLGFSIC
FT                   YFLIIRKLPWLGLLIYGIAEASTAYLVTKISNPPPEQPKQLINWCSTQLIWSVEEQRRI
FT                   LDGNFIFDKNFKPFPGSFFFYPPPN"
FT   gene            complement(<165403..>167667)
FT                   /locus_tag="DEHA2A01980g"
FT                   /old_locus_tag="IPF_10825"
FT   CDS_pept        complement(165403..167667)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A01980g"
FT                   /old_locus_tag="IPF_10825"
FT                   /product="DEHA2A01980p"
FT                   /note="weakly similar to CA3944|IPF4750 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65347"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="InterPro:IPR024764"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP1"
FT                   /protein_id="CAR65347.1"
FT                   /translation="MIKNIPIGRANVAAGITDPLQWSENSQLAVNNGSQLTILDPKLPL
FT                   IHQSITSSTYGDGSSSFTMLDPKKLFDISSILDSESIDGLNLRNLDNIIIESANEKFSF
FT                   GRITEPLITSHYWSPLNPTSKDCYLGVLFNTSELLIFQRSNFRPSNYAVKINVFHELLS
FT                   KLHLTDESFSNGEISMNYEQYLSLKVQCFRFNQITGNNETRLFLSLGLANNNISICELC
FT                   DGLPVFLNIDTGETIFKHSWSPWLIKAGKYHSYLVVTTSMNSVILYELTFDPNSNSINS
FT                   SEHVCLQKSSRFLISQCAFHPIGNAMLLMITNTKKLKVFTIDTLNKVHEANHDLSTSSL
FT                   VTGTFNVSENEAVLDINIAFETGQFELVSFDLKTRSIQAKTPHNSLTKFVSKNLHKYQL
FT                   YNSKQHDVEESENNATTPFLNNVVEGNFINYCTRLNSNGLVSVIYRIYPKNVLNYTILS
FT                   KFEFNIGFIPIREVYTQMEGTRLSCTSLSYLNQLWFNKYNEIPKFPKLISDNKQDEINS
FT                   FIESIQSFRKNNFIDISGAAIDINNIADLRKYLIVNFVENDTIKNLQYLFNFNTIVSKS
FT                   LSILTSKFPDTNNISEVERQIDREQKQIERIIIKHLCKLIISFVNQYNPEITSNLDQFI
FT                   VINYYLLMSETDTTFESKFPIETEIKLTTRFFEESFRVSVNDIIDDNTTDMTTSTTNHK
FT                   WSRCKLTFLPILELKNKVDELKMFNYIIYEHMPKESWIINTLMETLDFCIYSGNKKYEI
FT                   S"
FT   gene            complement(<167761..>167844)
FT                   /locus_tag="DEHA2A02002r"
FT                   /old_locus_tag="Deha0A.12"
FT   tRNA            complement(167761..167844)
FT                   /locus_tag="DEHA2A02002r"
FT                   /old_locus_tag="Deha0A.12"
FT                   /note="tRNA Leu (TAA) cove score=67.29"
FT   gene            complement(<167989..>169953)
FT                   /locus_tag="DEHA2A02024g"
FT                   /old_locus_tag="DEHA0A02453g"
FT                   /old_locus_tag="DEHA-IPF10823"
FT                   /old_locus_tag="DEHA-CDS1325.1"
FT   CDS_pept        complement(167989..169953)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02024g"
FT                   /old_locus_tag="DEHA0A02453g"
FT                   /old_locus_tag="DEHA-IPF10823"
FT                   /old_locus_tag="DEHA-CDS1325.1"
FT                   /product="DEHA2A02024p"
FT                   /note="weakly similar to uniprot|P38069 Saccharomyces
FT                   cerevisiae YBR015C MNN2 Alpha-1 2-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84379"
FT                   /db_xref="GOA:Q6BZE2"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZE2"
FT                   /protein_id="CAG84379.2"
FT                   /translation="MVALNNMFGMSKLYVKHSKRILLVCLILVSIHVFYLVHRNKWASN
FT                   SVSIKNEGYRLIKYFENSESGLMVVEKSYKVSRSEAGRAENEDEGINNNRFNIETIEGY
FT                   KYDKQQAIDQQQKILQENASVEEKMEFETRFVERLVSFFSDLFVLIEACGPDIDKVNND
FT                   EHYQASKEANKFPNRDGRMPTYGGHLRENYLEEPIRTKELLESYLQLSKEEIFALTKSQ
FT                   SKFMESMPNEYPSEMVELSKYNQFLKGDGIVYLGGGKYNQLVMLSLKLLRSHGSQLPVE
FT                   VIIPKRSDFDIDFCNRVLPNMNAKCKVMSDYLPEKIMKTIGGFQFKTVALLISSFENVL
FT                   YLDADNLPIKNIDLLFTNKPYVDKHLVMWPDLWRRSTSPIFYDIAQIATDDKKRLRNSY
FT                   FLGDTRGTSDKISYHDSEGTIPEASSETGQILINKKVHFKTLVLSMYYNFYGPDFYYPL
FT                   LSQGAAGEGDKETFIAAAHKLDLPYYQVQEFNREFGPINHDTLKHEYFGMGQYDPIIDY
FT                   IQSSQQEKYFNSVNPTYGKSNTDVENSNYDYHLYHSSSLLFLHANWPKYYVRDLLLGNA
FT                   NGRGPKDKDGNRRRLYDKNLIQELNGYDFELHIMEELKWCFCNLININLADVPNPKDPV
FT                   RGDICKEIHGQIEFLQQNK"
FT   gene            <171295..>173172
FT                   /locus_tag="DEHA2A02046g"
FT                   /old_locus_tag="DEHA0A02475g"
FT                   /old_locus_tag="DEHA-IPF10816"
FT                   /old_locus_tag="DEHA-CDS1488.1"
FT   CDS_pept        171295..173172
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02046g"
FT                   /old_locus_tag="DEHA0A02475g"
FT                   /old_locus_tag="DEHA-IPF10816"
FT                   /old_locus_tag="DEHA-CDS1488.1"
FT                   /product="DEHA2A02046p"
FT                   /note="weakly similar to uniprot|Q04053 Saccharomyces
FT                   cerevisiae YDR425w SNX41"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84380"
FT                   /db_xref="GOA:Q6BZE1"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZE1"
FT                   /protein_id="CAG84380.2"
FT                   /translation="MNPNDNNLFGDIEQDNNPSFYGNQSFLRDPYGKSKQTCPPSVTSN
FT                   GDPSITNDDNNSAHNNDLVSNSIVLSKKIEQMVNDPNLQINVISSERMINSSVVAYSIE
FT                   LSSFDDNRMIVKRRYSEFKSLRDNLQILFPTLVIPPIPEKHTLFTYLINSIDNSKELNI
FT                   IETRKRCFANFLKDIIFDSNVALKSCVLVHKFLDPNYELCWNNAVNEPPVSLIPNNLLL
FT                   ANPVNPTDQNGLYSLLPIVNGFELNSNIDNISSLHKLNEDLHKLNEQVHVFELRKEQNE
FT                   RRHPSEPTTSLFTEIPISLIDFEKNFHQNIKVLTELNKLNSRSVKNFKSIINTLIELGG
FT                   NLNNFSLQIHELNTDSNALSSLIEKFGSTIDSNFLGYEAFLMNDIIPEWQEPISQLVQY
FT                   YLTSLQLIKFYKFKIIQYKLVYKLKFNKYQELANISTNFESQSKLKDLRNLDIDSPSIN
FT                   EAIKKIELNQKRLKNRKISSKKSWYGLFGGNSKPTFNLREDLPASTIPSEGTGIRRERT
FT                   PLVSDENMSYPVNPSANLENTNIDINSHYKHKINQIEKELTKLDQLIDLTNTDISTLTQ
FT                   ELNLNFNDFLVRVEKKWLVIMLEFIKNGKQLFKDNLQNWNECKVFINDL"
FT   gene            complement(<173853..>174068)
FT                   /locus_tag="DEHA2A02068g"
FT                   /old_locus_tag="IPF_45642"
FT   CDS_pept        complement(173853..174068)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02068g"
FT                   /old_locus_tag="IPF_45642"
FT                   /product="DEHA2A02068p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65348"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP2"
FT                   /protein_id="CAR65348.1"
FT                   /translation="MTDSQITRCSILPVKDINTSLHPYISGTANGCETYSDRGYIESVI
FT                   SIGSIATGQMFQSEEIKFVTQAYSSR"
FT   gene            <174270..>175322
FT                   /locus_tag="DEHA2A02090g"
FT                   /old_locus_tag="DEHA0A02497g"
FT                   /old_locus_tag="DEHA-IPF10813"
FT                   /old_locus_tag="DEHA-CDS3367.1"
FT   CDS_pept        174270..175322
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02090g"
FT                   /old_locus_tag="DEHA0A02497g"
FT                   /old_locus_tag="DEHA-IPF10813"
FT                   /old_locus_tag="DEHA-CDS3367.1"
FT                   /product="DEHA2A02090p"
FT                   /note="similar to uniprot|P25379 Saccharomyces cerevisiae
FT                   YCL064c CHA1 L-serine/L-threonine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84381"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZE0"
FT                   /protein_id="CAG84381.2"
FT                   /translation="MSLPVETLRDSQPFIKTSLVEVTKDLPNKPPCRVFLKNEYEQPCG
FT                   SFKLRGISNLIYRSIQKAKKEKIDKTLYVFASSGGNAGLAAAYSARYFRIGCTVVLPTT
FT                   SKPEIIEKLQSYGAKTIMHGKNINEADGYLKNMMRNIDLNIYPIYCHPFDNPLIWEGHS
FT                   SLVDEVYQEQLSYNDSQKVKGIVCSVGGGGLYNGIMKGLEQNKTNKDTSLMLVETNQAP
FT                   TLLETIKAGEVFTLDSVNSLATSLACSYLSEQSLDNYYNSKFKTYVDSIDDLDAIQGLI
FT                   DFYSNSGVVVEPACGTALSLVYNRMDILTKHYTNLSPDDIIIVVACGGSCTNLEGVENF
FT                   KKMLNTTCKL"
FT   gene            <175605..>178067
FT                   /locus_tag="DEHA2A02112g"
FT                   /old_locus_tag="DEHA0A02519g"
FT                   /old_locus_tag="DEHA-IPF10812"
FT                   /old_locus_tag="DEHA-CDS0778.1"
FT   CDS_pept        175605..178067
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02112g"
FT                   /old_locus_tag="DEHA0A02519g"
FT                   /old_locus_tag="DEHA-IPF10812"
FT                   /old_locus_tag="DEHA-CDS0778.1"
FT                   /product="DEHA2A02112p"
FT                   /note="similar to uniprot|P22516 Saccharomyces cerevisiae
FT                   YPL008w CHL1 Conserved nuclear protein required to
FT                   establish sister-chromatid pairing during S-phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84382"
FT                   /db_xref="GOA:Q6BZD9"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZD9"
FT                   /protein_id="CAG84382.2"
FT                   /translation="MGNLEANDVGNNSRKYNHPFEPYDIQIQLMDAIYDAIDNYKIGLF
FT                   ESPTGTGKTLSLICSSMTWLREYKKNSTFRETEDSESEDEPEWVKQAYQKTIANRTKVR
FT                   AQEYERLLDDLSENYDVSKVSVLPEKKVKRQKPEQEQDENFIPADYYSDSELDSKYEND
FT                   KLTSEINELLSRVDGPKETVEPVNDCPVKIFFSSRTHSQLSQFSHQLNMTEFESSLDNI
FT                   PERIKFSPLASRKQLCIHPKISKLSNVSSINDACIDLQQSSKNSCEYIPKLHNTQSEEI
FT                   VKKFSDLSFTKIHDIEDLGKLGNKLKICPYYSVRKGIDVTEIIALPYQMLLQDSTRSAL
FT                   NLNIDDSIIIIDEAHNLLDVISSIYSVSITSNELSDITKSLKFYLNKFIKRLNSGNRIN
FT                   IMKLIKLCQVLEKFISSNSKDGKIKHGDEIITSDIFEGTTGDLVNIHKIEQFLNKSKIA
FT                   YKIESYMQKLNDSESIKNRSNPLLFKITKFLKCLTNPSKEGKFFWDKTNDSVSINYMLL
FT                   DPSEIFRDIVKRARCVLLCGGTMEPMNDYTNYLFPYIPPEQIKKFSCGHIIPQENLEVF
FT                   PIGNYNDISFEFSFDKRNNSKMIIELGHAILNIIESTPDGIVIFFPSYKYLNVVMNVWR
FT                   QNKIIESLTKVKAIFQEPEDSSKVEKVLNDYSSTNKSEKHSALLLSVVGGKMSEGINFS
FT                   DELARGVIMIGLPFPNIFSAELIAKRKFIEESTIAKGGTKSQAMVNAKNFYENICMRAV
FT                   NQSIGRSIRHKNDYSIIYLFDQRYGSDKIQDKLSGWVKQKLFTRGRCTDFNQVIKETQD
FT                   FFRQKLLG"
FT   gene            complement(<178085..>178846)
FT                   /locus_tag="DEHA2A02134g"
FT                   /old_locus_tag="DEHA0A02541g"
FT                   /old_locus_tag="DEHA-IPF10811"
FT                   /old_locus_tag="DEHA-CDS4760.1"
FT   CDS_pept        complement(178085..178846)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02134g"
FT                   /old_locus_tag="DEHA0A02541g"
FT                   /old_locus_tag="DEHA-IPF10811"
FT                   /old_locus_tag="DEHA-CDS4760.1"
FT                   /product="DEHA2A02134p"
FT                   /note="similar to CA3941|IPF4754 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84383"
FT                   /db_xref="GOA:Q6BZD8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD8"
FT                   /protein_id="CAG84383.2"
FT                   /translation="MPPKKSKNDSKVLKTDSKLLKKFKFPDNFNNLSINYSKQFFKPQP
FT                   ETLISDQIIIVEKFFSNELCNELIKSFESSPDLKMETTPLIKSKDYAARFNDRGFSVDF
FT                   DASRNLWSYLQKILLRDVEYEDDDDNDVKSIFNDAIALNSQLRIYRYRKGHHFGQHYDE
FT                   SVICPLTEDKNNQKGITKWTLLIYLTGDDEFKGGGTIFYPDYSSAKHLNVHPSKGMALL
FT                   HKHGDDCLRHEAELVEDGVKWVLRSDVVYPS"
FT   gene            complement(<178960..>181830)
FT                   /locus_tag="DEHA2A02156g"
FT                   /old_locus_tag="DEHA0A02563g"
FT                   /old_locus_tag="DEHA-IPF10810"
FT                   /old_locus_tag="DEHA-CDS0509.1"
FT   CDS_pept        complement(178960..181830)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02156g"
FT                   /old_locus_tag="DEHA0A02563g"
FT                   /old_locus_tag="DEHA-IPF10810"
FT                   /old_locus_tag="DEHA-CDS0509.1"
FT                   /product="DEHA2A02156p"
FT                   /note="similar to uniprot|P34077 Saccharomyces cerevisiae
FT                   YFR002w NIC96 nuclear pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84384"
FT                   /db_xref="GOA:Q6BZD7"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD7"
FT                   /protein_id="CAG84384.2"
FT                   /translation="MSFFGQCNGLSGSSGSSGTGGTNLATGGVNESLQMGNRSDAGAIP
FT                   SSGNVSGTIPSSNAHTSSRLLQDLLESANNLPKPNNSDLGSIHLTLNGLKKKSNQLRKR
FT                   NDNEGQNFTKAHYLLASSGVSAEEIENELNSIEVPVKPLESQTVSNAVNNNIDSYLNDK
FT                   KDENILAAIEQSLVSASKDFNQFINENVSIDWKVRRDELRKSFGIGSPQKNTSHKVSKP
FT                   TKSVTWNKSIPGNYNVLTPLSTNKSTSFLKNLTREKFENNAQIVYQLNEARLNNSFFPI
FT                   ALSFEELNKSYSDLKSRQISEAWKILIELTNEKTNKINQEQKFFETYQTADHTNSMKFR
FT                   KQVIQRSKNYLEQQFYNYMDEIYTKDDKKKQFSTSINIDKVSYFIDRIIMKNNTGFVDQ
FT                   TLNVNGVPIWALIFYLLRSGLYNDALELASQNKDLFNKFDKNFPVYIKKFVENDCINLP
FT                   MELNERLNAEFNQQFAFINDDLKGNFDPFKYSVYKLIGKCDLSKKKLPDEINLSIEDWL
FT                   WFHLSIINEFSFDLNSSSLIFENYSLENLQKKVIQLGPKKFNSSSNNPLYLKTLIMVGL
FT                   YELAVEYAFDSINECDAVHLAIGLCYYGLLKVSSFNNKDELIFINSSNEYEINFSRLLG
FT                   SYTRFFKISDPMVACQYLILIAMSKGGDSKEEISKCHEALRELILISREFNMLLGELNQ
FT                   NNGNKIPGILEKQRSLINLSNLEQFQKQIIETSAIRCEEEGRIFDALLLYQLCQDFDTV
FT                   VSLINKLLGETLSTTELDKPLINYGNYENINGEIQSENTIDNNIILLSQHIMKLFYNNS
FT                   FILDRISPSKKETCDLLLPIIHIRDLFMNKNWNDVIIEINKLGLLPVNKSNGLIEIRKM
FT                   AEFVHNTLDDTLIKVIPSLLIMVMTSVSQLNYSILTKRYQTSSNEREELSNLKTIAKNC
FT                   MIYAGMVQYKMPRETYSLLISLESSL"
FT   gene            <182788..>183429
FT                   /locus_tag="DEHA2A02178g"
FT                   /old_locus_tag="DEHA0A02585g"
FT                   /old_locus_tag="DEHA-IPF10809"
FT                   /old_locus_tag="DEHA-CDS5219.1"
FT   CDS_pept        182788..183429
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02178g"
FT                   /old_locus_tag="DEHA0A02585g"
FT                   /old_locus_tag="DEHA-IPF10809"
FT                   /old_locus_tag="DEHA-CDS5219.1"
FT                   /product="DEHA2A02178p"
FT                   /note="similar to uniprot|P36018 Saccharomyces cerevisiae
FT                   YKR014c YPT52 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84385"
FT                   /db_xref="GOA:Q6BZD6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD6"
FT                   /protein_id="CAG84385.2"
FT                   /translation="MATSKSPPYKIVILGDSSVGKTSLVHRFTTNKFDEHTANTIGAAF
FT                   ITKEHHSNNNPEKKVKFEIWDTAGQERYRSLTPMYYRNAKTALVCFDLSNMEETFDKAK
FT                   YWIEQLQINANDQDIKIKLIGNKNDIDSSSDPSDYISSLASTMKFYKTSAKTGEGIDEL
FT                   FDEVVDDIDEEFFTEYYKNQDNEANNSQRPGMINVFNSRFGDTTNNNKCC"
FT   gene            complement(<183487..>185289)
FT                   /locus_tag="DEHA2A02200g"
FT                   /old_locus_tag="DEHA0A02607g"
FT                   /old_locus_tag="DEHA-IPF10808"
FT                   /old_locus_tag="DEHA-CDS1620.1"
FT   CDS_pept        complement(183487..185289)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02200g"
FT                   /old_locus_tag="DEHA0A02607g"
FT                   /old_locus_tag="DEHA-IPF10808"
FT                   /old_locus_tag="DEHA-CDS1620.1"
FT                   /product="DEHA2A02200p"
FT                   /note="similar to uniprot|P53632 Saccharomyces cerevisiae
FT                   YOL115W TRF4 DNA polymerase sigma"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84386"
FT                   /db_xref="GOA:Q6BZD5"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD5"
FT                   /protein_id="CAG84386.2"
FT                   /translation="MMVSKRKRESPPVKLKSKKQRKKTSKSGGIIPIENKYEALPSSDN
FT                   ESDSSLKFDFKSNSREPEMVFVESDDEEEGVVIVSDDDKPEDSEEPASKKQKFVNNELA
FT                   KNQDFIEFGFSSSEEDAPERNDYDDYSDDGVLSDDESGTIHTQTTTKSLYPWIKDHDHS
FT                   KQKEIADWFTMEIKDFVNYISPSEAEIMTRNRVVNQLKQQIGQFWPATELHVFGSCATD
FT                   LYLPGSDIDMVVVSETGDYEHRSRLYQLSSFLRNKKLAKNIEVIAKAKVPIIKFVDPTS
FT                   NIHIDISFERTNGIDAAKKIRRWLSSTPGLRELVLIVKQFLRSRKLNNVHVGGLGGYST
FT                   IILCYHFLKLHPRLSTKNMAVLDNLGSLLIEFFELYGRNFSYDNLIIAIDTETDLPKYL
FT                   LKRKHPVLNTSRNPFSIIIQDPSDPANNITRSSYNLRDLKKAFGGAFQLLVDKCYELNG
FT                   ASYKSRIGQSILGDIIKYRGKERDFNDDRHKVTNDALINHENEEGNDDDESDGANGNNK
FT                   YYFSDMTVESEEDTTFAQEIKPEDPNKKKVADFMSINVPSEDEEDDPKEKKEEDTETQD
FT                   SDKQKNNLDKDIKRDYWRQKGLGL"
FT   gene            complement(<185407..>187611)
FT                   /locus_tag="DEHA2A02222g"
FT                   /old_locus_tag="DEHA0A02629g"
FT                   /old_locus_tag="DEHA-IPF10804"
FT                   /old_locus_tag="DEHA-CDS1011.1"
FT   CDS_pept        complement(185407..187611)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02222g"
FT                   /old_locus_tag="DEHA0A02629g"
FT                   /old_locus_tag="DEHA-IPF10804"
FT                   /old_locus_tag="DEHA-CDS1011.1"
FT                   /product="DEHA2A02222p"
FT                   /note="weakly similar to uniprot|P47042 Saccharomyces
FT                   cerevisiae YJL057c IKS1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84387"
FT                   /db_xref="GOA:Q6BZD4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD4"
FT                   /protein_id="CAG84387.2"
FT                   /translation="MSIVPYNSSNEIVYHDPNHGILVLHDNQDNTLQLVSTANEGQNNK
FT                   IDLVRSEDRSSGTRYGNNNPHSHIKCPSCGFAWSEHSNIGETSKRSKSDASNELMDSLK
FT                   SGPDSRKAMMKNFPEGFMHHDYFKLLGKLPYNQKPRVRSASTLPENIFNQGYFKRFFKK
FT                   VPPFMLGSGAHSQVYKVVHVLNDIKLGTYAVKRISIGDKIELLEQVLNEVLILYELSIQ
FT                   GANENNLIRYNHVWLELGDIQDSKTYFLPDKQKNSEFDNSIPYVFILQQYCDGGHLEDL
FT                   IEKVFLRELHLSAKEQLDLERQRRRSVRKNSNQKLEDMDPESKENKKFWLGCIEIWKFF
FT                   RDVAKGVHYLHLHGILHRDLKPSNCLLDNKYDNNPIDNRIYGCENELNGELSKLPKVLV
FT                   SDFGEGQFINKHNIPADDVSIKDVNKDEDERRGNTGTLEFTAPELWLFSNFDPSLGSER
FT                   QYFINEFTYESDIYSLGLILCWLCAGILPFSHMIKGELDPQLIRDKILEWYFDLNATKF
FT                   HEWFVSSVQIKPGTNEFDESCVSDFEKLIYLMIKGDDSKEPENSPPNRLLSGDVIKFLE
FT                   AMKWKRFIAENEIIQDNPEEETNKFGLIPAINPSQPEEAIDPDFIYQSDDITSEDDDVH
FT                   DIASSEYDDDYSVQVPTRDAFISSAVTKSNIFNFCMILGYMLNILLFDIIEYNIFYTYK
FT                   LMVKILVLVLFSTDLLLLESKFARVSCLILAFSLSMALAI"
FT   gene            complement(<187836..>192938)
FT                   /locus_tag="DEHA2A02244g"
FT                   /old_locus_tag="IPF_10802"
FT   CDS_pept        complement(187836..192938)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02244g"
FT                   /old_locus_tag="IPF_10802"
FT                   /product="DEHA2A02244p"
FT                   /note="some similarities with uniprot|P29539 Saccharomyces
FT                   cerevisiae YBR275C RIF1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65349"
FT                   /db_xref="InterPro:IPR022031"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP3"
FT                   /protein_id="CAR65349.1"
FT                   /translation="MWVDSDTQINGSSSSGSPIIVEKPHNHLGIVDSTSESSFAKSGTH
FT                   PIDTSHGIQKRDSFTPRTRSTHTNSEVARGLNENDKDNETTSEMTSDSSIIDMNISEDK
FT                   LESGDLDVSDGNLAKIPKGELSTREEKNYINIPPLADEFMNDQAYMDMELNSSPIKPTS
FT                   KKVRYREELSSSPIKKKKSVAFSDDLVSELPSSPAAVHCGSRLPVLEHTPKKSILKINS
FT                   LNQTSSPCNPNDTSLWVKSSNNINIKNSPSNPEFWLSGTIIQLAPNSPDLPQLIDGCIN
FT                   VLRDKKFSKKFEVYATLNHICRCNTSDSLLKLLTIPSKSNSPQKINSKSSMKTNSTSFM
FT                   DNTYIHTLSAFIQRDVKQIELKLFCENEEKENNYSPSKNDPFSIRIISQALKVINFIML
FT                   DQELNNFVSIEDAKWFYVHCCKTIVKPTISKTLIIPYLSILKDCKFNNKKKKLIFNNQN
FT                   ENANISELILQSLLNMRKFVSSSLVVEEFVTLKNLVSNFPVMMANNFKHWFEFFLMNLC
FT                   DLSSPLYSKVIGMGISVLLEVARNYLDNKNVLFSVRRLLASPLPSTVKSITSDSTISVS
FT                   PEAPTTKSDENLVIHFIISTLETLIGNGQYKSAMDIWVGVTLLSSDSGSGYENWPFLSD
FT                   WLRVHKSCFNVNNNSAKMIALNSWKAVIFNVCHNDLDSIRCLIDSSPNSKSSKSKPQAI
FT                   NNILKPKIKLLIHPLLNISAVENQKEIIDSSHNLFLSIIYTLLNPSVLNSSRYVHVYWD
FT                   KIIQSVFINFYFKKELSNTYMNELGLKILTRLIKPSVSTNEKPFNEMRCLSNESISLND
FT                   ISPVSPKWIFSKFDRILQNINIVFKLEGLTIDSKLEFFNNFLNSLKSITKKEIKPSDAT
FT                   QDIIDNLPNVLSVLFKHNKLSYSSIQKLMLNLNDTFDASNLIEKNGTRSNATNIYILII
FT                   NNCLSDMEELQAFDFLESIHLAIRDSKNLIFLLELVKLQEYNTHAGLKNFIVSALNSRK
FT                   INAASNLELELAGNLFQIISKDYESIAKKLIQSIVLLSATEFERVSGILDIQLWTIPIF
FT                   KYFVELVHNAPHPHLKQIPLNLIISRFENDEEFFEILKFLIDKRFDLELYNLRKNIMKK
FT                   FKALEGFRQFEFRSVWNSYLSNIVESGNFKLLDDFLVSSYEVGLDVRSHIQNKWDRLPL
FT                   LKKAWLTDNSKLYFDSELLNQTGPASPGDSKNSEVSGKEDNTQIIAAPDCSKDLQMDDM
FT                   ETIESIENIAIPKSFSNSNKDSKTNRYEKRNMSSGSDISQLEIDNSTKSKANRKRSKSV
FT                   AKPKPKKKTNIKVKKENTPAPEVNPNFDIHSFTAMLNAKLSPATPIKKARRNAKSNLNK
FT                   SSPDNGSNSESCISPSGNEETIDLDHIKSEVQIPSSFNDDDISQLEASSMSQNSINEFD
FT                   LVEDEPSSPPETLDRTRKSISPSSNDYSKVIQNGFSSRESSDSSDDIENTDDQESTNYK
FT                   RKTCYDEDEISGRKKQKQNEFPSDEKNDNGTSAPESGISMTDESTGNSNLDNHIVHVSS
FT                   SDQFRKDVNDSIENDEIQCSATSDQTAPPTFDTQDFRATSTALAEPSNTETSSSIQLSD
FT                   SYNSMIPNSPPVHVGDRSEDFTPESDSKSNNFLSTIGEDDEIDSQNLKEKEDSDNGPQD
FT                   EGSTTNENSELQPCEAANNLTSYIENMSDVEISRIPQSEKYQLETKLMTFILRMRNIDS
FT                   VES"
FT   gene            complement(<193093..>195342)
FT                   /locus_tag="DEHA2A02266g"
FT                   /old_locus_tag="DEHA0A02673g"
FT                   /old_locus_tag="DEHA-IPF10798"
FT                   /old_locus_tag="DEHA-CDS0975.1"
FT   CDS_pept        complement(193093..195342)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02266g"
FT                   /old_locus_tag="DEHA0A02673g"
FT                   /old_locus_tag="DEHA-IPF10798"
FT                   /old_locus_tag="DEHA-CDS0975.1"
FT                   /product="DEHA2A02266p"
FT                   /note="similar to CA4051|IPF10231.exon1 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84389"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD2"
FT                   /protein_id="CAG84389.2"
FT                   /translation="MATEDNRLAQPIELCSNALIDLINQFVPDDDSNYLLKTFEFEKFT
FT                   GKHQIFEDIIKEYDFDYKIDVPMTEVDDTDDEVANNLKNEIGNFNVGLDEKTRDFILTM
FT                   SFQKAAQEFLTKQLEELKNTANEDEVKADKVIETGKFNISRDELRSYNRLSVLVDFQMH
FT                   LVIETYPSIKSSFYSLLSQISQTLFNMSTNAISTFWYYLETRKKLIQDKIFDKQVTSDR
FT                   ISFLEICNTLTDRFFEKNIQGKRDLCKKDTFNDTFQYRVRMFIANIFNFEDNTGLNKYF
FT                   STSNRIVKDFSTNSRSRDDSFIKDVIQINKLFRDPYYFLKPANHKQLTRISDTLKKVYE
FT                   YLMEEENSWSSVAPKIDQFAVPTPKSETEERHLKEKYANKLYFPEHYSLAQFDEKKRGD
FT                   SFDQLKKQDYSFMSKQFDDSKVRQTCLIQIYFICHLYYELNAANKKVFLKSLNGPANIK
FT                   HFTDDSPPDSLVSLFFKIKREIPKRYRSIDSQFSFLLQHMAIDETFWWGWLIYGKDPNT
FT                   GKSLFVDKVLTASELAVAQEKTETIIPFKEKRYFNNYATPQLSRKMKVERGISILAKDS
FT                   ETSDNDRFQEGIDLLTEKISDAKDKQELDQLVDERNVLTWKHLKKQRNSNWLKFGNLLN
FT                   KQMLSAELNMPEVSEKAAESTEQPETKEKTEDAGDNNNGNIVEKIAEESQSNIEEIEKE
FT                   GMVRDSEILHDESNTESNPQSNELDSNDESSGIKRSRDADDTITEEEPATKKTKN"
FT   gene            complement(<195593..>196300)
FT                   /locus_tag="DEHA2A02288g"
FT                   /old_locus_tag="DEHA0A02695g"
FT                   /old_locus_tag="DEHA-IPF10796"
FT                   /old_locus_tag="DEHA-CDS4427.1"
FT   CDS_pept        complement(195593..196300)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02288g"
FT                   /old_locus_tag="DEHA0A02695g"
FT                   /old_locus_tag="DEHA-IPF10796"
FT                   /old_locus_tag="DEHA-CDS4427.1"
FT                   /product="DEHA2A02288p"
FT                   /note="weakly similar to uniprot|Q12322 Saccharomyces
FT                   cerevisiae YOL114C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84390"
FT                   /db_xref="GOA:Q6BZD1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD1"
FT                   /protein_id="CAG84390.1"
FT                   /translation="MVCIIAIFLGHKSNKWVLVPSNRLYNIIMYRMKLLQLPVKGIRFY
FT                   PISLNCIRNVNPVTPGIVRAFSTAPDSEFSTEEISKAKEWMENFSSTQVPDNIFEISYS
FT                   RSSGPGGQKVNKTSSKATIALGPDQWLNPQFCFWIPKPIRSQINENKIRYETKSGGILV
FT                   QSDSTRNRDTNTDECFRKLIQEIKDNTFFAGETSEEDKKRWQEIKDDRKEKRLFNKKRQ
FT                   SDKKKHRSKNFDV"
FT   gene            complement(<196452..>197009)
FT                   /locus_tag="DEHA2A02310g"
FT                   /old_locus_tag="DEHA0A02717g"
FT                   /old_locus_tag="DEHA-IPF10795"
FT                   /old_locus_tag="DEHA-CDS5818.1"
FT   CDS_pept        complement(196452..197009)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02310g"
FT                   /old_locus_tag="DEHA0A02717g"
FT                   /old_locus_tag="DEHA-IPF10795"
FT                   /old_locus_tag="DEHA-CDS5818.1"
FT                   /product="DEHA2A02310p"
FT                   /note="weakly similar to uniprot|P38013 Saccharomyces
FT                   cerevisiae YLR109W AHP1 Thiol-specific peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84391"
FT                   /db_xref="GOA:Q6BZD0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZD0"
FT                   /protein_id="CAG84391.2"
FT                   /translation="MLSQLTRNIARPQFVRTFRTSMPSFVAVGDKIPSTTLFESSPGNN
FT                   VNLAEETSNGKSVIIGVPGAFSPACSSSHVPGFLSKLRDFNNKGYQKFFIVSVNDAFVM
FT                   KAWGSSLLGNIDGDQISFLADPQAEFVSALDLKFDATKAFGNERSKRYALLVEDGKVTE
FT                   TFVEPDNISVDVSDAEKVLSQI"
FT   gene            <197214..>197795
FT                   /locus_tag="DEHA2A02332g"
FT                   /old_locus_tag="IPF_10793"
FT   CDS_pept        197214..197795
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02332g"
FT                   /old_locus_tag="IPF_10793"
FT                   /product="DEHA2A02332p"
FT                   /note="similar to uniprot|Q12517 Saccharomyces cerevisiae
FT                   YOL149w DCP1 Decapping enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84392"
FT                   /db_xref="GOA:Q6BZC9"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC9"
FT                   /protein_id="CAG84392.1"
FT                   /translation="MSGKVSSQRSSQRQTPEGDQEEITAQKALELYRNALNFNVISRYD
FT                   EFIKQLLYHTSHCVIYKFNDETQEWVKTDYQGTLALYLRDFKVPQNQGFPPTYQDLQNL
FT                   FCYGLLLLNRNNPECFSLGLLPNKIIKHFFPQGLNNMNILEMDVELNDNLIIVKDLVGD
FT                   IYGLWVFNEDDRMKLYKLLEFCLTNDSSML"
FT   gene            <198425..>200905
FT                   /locus_tag="DEHA2A02354g"
FT                   /old_locus_tag="IPF_10792"
FT   CDS_pept        198425..200905
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02354g"
FT                   /old_locus_tag="IPF_10792"
FT                   /product="DEHA2A02354p"
FT                   /note="weakly similar to uniprot|P50875 Saccharomyces
FT                   cerevisiae YOL148C SPT20 Subunit of the SAGA
FT                   transcriptional regulatory complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65350"
FT                   /db_xref="GOA:B5RSP4"
FT                   /db_xref="InterPro:IPR021950"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP4"
FT                   /protein_id="CAR65350.1"
FT                   /translation="MINTGANNVSSAPHNRTNPSVQAQTQAHLQHSKLSVQQQQLLRQR
FT                   QQQQLQQQQQQQQVTQQRQPRPNLQNYHFASTSPEVLKKYAKYPPSLSFHIYESHYRLS
FT                   NSQDSNIIPKSSPMIKSFLQHVMREEIPFEMSELIKDFAIRSYDGCLILQVYDHRNMIP
FT                   AGAPNSSNASSTSASTANNTDSSNPSGSTSANINTVANTTTDTSGPASKSSSPSQNGTN
FT                   NMVSSTTTTTIESTKVISKPKAYRTLLRPTQLSLYYDLLYHTDSALTKFTDPLSLQMES
FT                   EILTLTNRKVDLSVPLNPYLCEDYLKPEIEYPRKEWDEKNQDWKLIHSHRDEVQNPPRK
FT                   LHQDELIMHKSSDYEEIMFLLSNKYKRSDDTSDKKLVVVGSSSLVSTGTTNKNGKEDSV
FT                   DPEDKGKNSETKNGSTTVVNSNTTSNSTTGQFMRLRYIEEIRKRREAQKAQQEAVAAQA
FT                   TNNGANLLAQSNNAAAINASKETVPDNKGSFAPQDTNILRPGSQPPAAPANSQLQRQQQ
FT                   MMAEKAQTLRARQFQAQQQAQQQARQQLQQQQLQQQTNKRQKTDHVQQQPPQPPQSQQQ
FT                   QQQPQQPYNSISSTPQMGMSQPASSMGTPVMNGNMPTPQQRFQQAQQQALSQQPSQSGP
FT                   SQPQSQGQLNASPAGQTPGTAQNQPNQTQIQQQQIFQNTLNPQEQQTFRQLQSRMNAFA
FT                   MMGNSGIAPNRAQLTQQQQQQAIQQAKLIQQQLLQKFPVYFQRLRQFQLLQQQRRQQQQ
FT                   QQPQPPSQSPQPMGNIPSSLPQNSQFNQHQNVGGKTVPGAMSPQQQQMINQQMLQQMAN
FT                   NMNQQGKKKMYKKK"
FT   gene            complement(<201195..>202655)
FT                   /locus_tag="DEHA2A02376g"
FT                   /old_locus_tag="DEHA0A02783g"
FT                   /old_locus_tag="DEHA-IPF10790"
FT                   /old_locus_tag="DEHA-CDS2435.1"
FT   CDS_pept        complement(201195..202655)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02376g"
FT                   /old_locus_tag="DEHA0A02783g"
FT                   /old_locus_tag="DEHA-IPF10790"
FT                   /old_locus_tag="DEHA-CDS2435.1"
FT                   /product="DEHA2A02376p"
FT                   /note="weakly similar to CA2124|IPF10490 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84394"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC7"
FT                   /protein_id="CAG84394.2"
FT                   /translation="MSTYNTQGITPPDDEVKNEVSSLDERLIDYDVNKLIYVRRGSQRD
FT                   SRRVIGRDNLNFDNSHLSKEHACFQYRNGALYVKDCGSTFGTTVNDKFIVANRWHVLES
FT                   CDTIGLIVSKPSTWIAKIVEKFPDHDDIPLEEFSNPPIGLKLRFDYLDDKLKFCVVKDD
FT                   RDHESVSEVVPNDVSMNETYDTDAYYFDNCLEVGEKHPHECACAERSCTEGNDDEVEPE
FT                   SKLNNNPKDTDKSNDFITHEEVSHLDCKDIECSADLDVHEPHLEISITQEVVDAKSENS
FT                   DDDESCSFGHFTSELISDSDIGSDSDSLSGFSSSDSDSSSISSSSSSSNSSSSISDESE
FT                   PELDTSIIIANINSDDDCADHDCTDHDGWSCQNFSSFTNSNSEESTIYGLPHAIVPVLD
FT                   RTGDYLDPCITSESSNAEGRKKRSFDEYQDDIQSSDEEHESKKVKLPSTEDKFAFKSIA
FT                   KEVVKGALYALATITALGVYGSTIDNQE"
FT   gene            complement(<203073..>203993)
FT                   /locus_tag="DEHA2A02398g"
FT                   /old_locus_tag="DEHA0A02805g"
FT                   /old_locus_tag="DEHA-IPF10788"
FT                   /old_locus_tag="DEHA-CDS4159.1"
FT   CDS_pept        complement(203073..203993)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02398g"
FT                   /old_locus_tag="DEHA0A02805g"
FT                   /old_locus_tag="DEHA-IPF10788"
FT                   /old_locus_tag="DEHA-CDS4159.1"
FT                   /product="DEHA2A02398p"
FT                   /note="similar to uniprot|Q8NIR4 Neurospora crassa G15D1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84395"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC6"
FT                   /protein_id="CAG84395.1"
FT                   /translation="MAIEGLTPEQLETFQREGVLCIPNFLNSEQIQQLADRSHALLNNF
FT                   DLKDHPKTQFKTNDNDHIGDQYFFDSANKISFFFDVDAFDKESGELRFPKDKAINKVGH
FT                   GLHMKDELFHKITFDSKVKAIARSLNYTDPRVLQSMCIFKQPQMGGHDARDNSVPSHTD
FT                   GTFLYTEPQSAVGFWFALEDCTEENGCLSYNPGSHKRFPITKRFAKVNGGKNGCNFISV
FT                   EYDTSKKIPDDSPNDYKLVECPVGSLVLIHNSVLHKSEKNTSTKSRYAYTFHVIDGTAK
FT                   YDKLNWLQVPPSEEGGTEFSKLYEE"
FT   gene            <204881..>205900
FT                   /locus_tag="DEHA2A02420g"
FT                   /old_locus_tag="IPF_10786"
FT   CDS_pept        204881..205900
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02420g"
FT                   /old_locus_tag="IPF_10786"
FT                   /product="DEHA2A02420p"
FT                   /note="highly similar to uniprot|Q07748 Saccharomyces
FT                   cerevisiae YDL244w THI13"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84396"
FT                   /db_xref="GOA:Q6BZC5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC5"
FT                   /protein_id="CAG84396.1"
FT                   /translation="MSTEKISFLLNWQPTPYHIPIYIAQTKGFYKEEGVDISILEPSNP
FT                   SDVTELIGSGKIDMGLKAMVHTLAAKARGFPVTSVGSLLDEPFTGVLYLEGSGITSDFT
FT                   SLKGKKIGYVGEFGKIQIDELTKHYGMTPDDYTPVRCGMNVAKYIIEGKIDAGIGIECI
FT                   QQVELEDYLRKQGRPISDAKMLRIDKLAELGCCCFCTILYICNDEFLKANPEKVKKFLK
FT                   ATKRATDYILAHPKQAWEEYSDFKPQMTSELNSKMFERCFAYFSDSLYNVHRDWKKVTA
FT                   YGKRLEILPPDYESNYSNEYLSWPEPKEVEDPTGAQNLMLKHQEECKSCGGYRRLAVN"
FT   gene            complement(<205983..>206909)
FT                   /locus_tag="DEHA2A02442g"
FT                   /old_locus_tag="IPF_10785"
FT   CDS_pept        complement(205983..206909)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02442g"
FT                   /old_locus_tag="IPF_10785"
FT                   /product="DEHA2A02442p"
FT                   /note="similar to uniprot|P23833 Saccharomyces cerevisiae
FT                   YBR037C SCO1 Copper-binding protein of the mitochondrial
FT                   inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65351"
FT                   /db_xref="GOA:B5RSP5"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP5"
FT                   /protein_id="CAR65351.1"
FT                   /translation="MLSRILLRPRLLTVHSLRTNSLCYSRRLLSNSVYRLNENKPTSSE
FT                   ASEDAATPRKRPLSRVAIGGVQEPDKKFAGGNSVEFAAWKAIVLLLVLGGGVTYWFSTE
FT                   KERLRIQKETEAKRGYGKPLIGGNFNLIDTEENAFTQENLKNDQKKFSIIYFGFTHCPD
FT                   VCPDELDKLGVMLDELKEKDNIELQPIFITCDPARDSPEIIKEYLSDFHPSIIGLTGPY
FT                   ENVKNACKKYRVYFSTPPDVKPGQDYLVDHSIFFYLMDSEGNFVDVIGREAEAEEGAEK
FT                   IRTHIDAFVPAAEREARKESWLSFLYK"
FT   gene            <207077..>208918
FT                   /locus_tag="DEHA2A02464g"
FT                   /old_locus_tag="DEHA0A02871g"
FT                   /old_locus_tag="DEHA-IPF10784"
FT                   /old_locus_tag="DEHA-CDS1550.1"
FT   CDS_pept        207077..208918
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02464g"
FT                   /old_locus_tag="DEHA0A02871g"
FT                   /old_locus_tag="DEHA-IPF10784"
FT                   /old_locus_tag="DEHA-CDS1550.1"
FT                   /product="DEHA2A02464p"
FT                   /note="weakly similar to uniprot|P38732 Saccharomyces
FT                   cerevisiae YHL039W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84398"
FT                   /db_xref="GOA:Q6BZC3"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR017119"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC3"
FT                   /protein_id="CAG84398.2"
FT                   /translation="MTVSDLLKWAQEKGTFISSDVEFKELSQGNIGAIYTGNSNGESKS
FT                   SDDFDLQLPIDLAITLNRAIESFNESGHGDFRDIAKKTSNVNSLLKMFLARERASTRLN
FT                   SSYFKPYLSLLPNLSDINSPYCWTPQEKALIKGTNLGNSLKDNVGQLVEEWWQVINLLP
FT                   QELPKPEEHFINMKFYYENKFYNDDDMYNYFIVDEPKNRDNWTSFPCYLWASLILKSRS
FT                   FPAHLLRGHVKNSEIKEDEAMLLPIIDLLNHNMNAKVDWSVSSSNSCTYFNFRSNSAVP
FT                   GEQLYNNYGMKGNEELLLAYGFCLEDNSADSAALKIKVPLEMLPELESQGVKLPTASDY
FT                   TTSVIRNTEEAKPDTNTDYSQYENGLLFFITKDHLPDNLIKLFQFLVKNKWEDKLTLRT
FT                   QLAGLNQLRQAIETKSDILKTLSIPDKNDTNLNNIRIYILSQKKIFAATIKKIKHLEKD
FT                   LLAEFKLHLITLKNVYKKDLKFQQSLLISLGISSYDAIIESQFQDQCWLLYLMRCYNRD
FT                   EYIKTDKDEEDNYLPEWIHHSFIKLAKETEVTAAEIVSYKEIYQSLIPRLAEIVPEIYG
FT                   RGKWGVDEMIISAKLLDLIGFVRGKDQECILVEPFDK"
FT   gene            complement(<209099..>209677)
FT                   /locus_tag="DEHA2A02486g"
FT                   /old_locus_tag="DEHA0A02893g"
FT                   /old_locus_tag="DEHA-IPF10783"
FT                   /old_locus_tag="DEHA-CDS5435.1"
FT   CDS_pept        complement(209099..209677)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02486g"
FT                   /old_locus_tag="DEHA0A02893g"
FT                   /old_locus_tag="DEHA-IPF10783"
FT                   /old_locus_tag="DEHA-CDS5435.1"
FT                   /product="DEHA2A02486p"
FT                   /note="similar to uniprot|P38264 Saccharomyces cerevisiae
FT                   YBR106W PHO88 Probable membrane protein involved in
FT                   phosphate transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84399"
FT                   /db_xref="GOA:Q6BZC2"
FT                   /db_xref="InterPro:IPR012098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC2"
FT                   /protein_id="CAG84399.1"
FT                   /translation="MNPAITNLGVMLVMMQVSRRLDLEDPDILFYVRAAYLSCQAIALA
FT                   IYAITRAKICAKNDLTTLKYVEPANAMSGETEPKAVVTTVREYDLKQVNTQIRSIFTSL
FT                   AMMGFMHIYMKYTNPLVMQSISSVKSALEANIVKIHLFGTPATGDLKRPFKAAPGLMQA
FT                   LSGASTDVKTDKHSIENAEISGAGGIKED"
FT   gene            complement(<209895..>212624)
FT                   /locus_tag="DEHA2A02508g"
FT                   /old_locus_tag="DEHA0A02915g"
FT                   /old_locus_tag="DEHA-IPF10782"
FT                   /old_locus_tag="DEHA-CDS0624.1"
FT   CDS_pept        complement(209895..212624)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02508g"
FT                   /old_locus_tag="DEHA0A02915g"
FT                   /old_locus_tag="DEHA-IPF10782"
FT                   /old_locus_tag="DEHA-CDS0624.1"
FT                   /product="DEHA2A02508p"
FT                   /note="similar to uniprot|Q7SE42 Neurospora crassa
FT                   NCU02134"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84400"
FT                   /db_xref="GOA:Q6BZC1"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR016685"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC1"
FT                   /protein_id="CAG84400.2"
FT                   /translation="MTQVFIAKVKNVLSGDTVILVPSKTSQFPVPERMLTLSYVRSGDS
FT                   YQSKEYLRQLLIGKDIKFRVLFKTPNVGKEFGDIQAPIFKSLVEHLLEKGHVKLKDNIQ
FT                   DDSEYVDDLRNLESKAKQSQVGLWSVTSASEDKIETIDLNEGIIGKSQNTPITTIVEKV
FT                   ISGDRVMARIIVNKNQHITTPLLLAGIKCPRTDDATESASVTKVAQEAKAFVEEKLLTT
FT                   KAVIKVSVIGESQAGVPIALIHHPSGNNVHAKLLENGFGEVVDWQSSLVGSSTMGELRK
FT                   AEQTAKALGKGLYSNTKVSRSSAPVTQSSKGLKPGSTITNASIAKVIGADTLIVRLPSS
FT                   DEELTVQLASIRGPKPSDSTVTSNHQQQLALVNTAREFVRQHVIGKTGTVYIDGYKDAN
FT                   KELGFDARFLISFKINGTNDLSEMIVNSGMGTVIKHNKATAHERSLNWDKLVELEEEQK
FT                   KLAKKGVFFNGDINKVLTVGTRIVDASENYTKAKTFFNGFKQKGRIANGYYVEFIPSVN
FT                   RVKLYNPKEGLKLTLILGGLSNNKNEALGDDGLKYMNKKFLQRSIEFDIYDMDKIGGFI
FT                   GNLYLNASSLQPIQVSLLEQGLVSVHDLAVNSNPFSNELINAEESAKSSKKGLWANYDA
FT                   SKVQEELDSQNAKLSELKLDSAKPKFFDVEVTDIDSTGTISYHQLDQSTVNTFATFKKQ
FT                   FADFHSQTPSASNTSIDLPHNLSKPPKKGDLVSAKFSENGKYYRGKVLNYDKTTRNFEV
FT                   KHLDFGNVDKVPLSSLRVLPAKFSLTQLPKFAHTCVLQNLRLPPTRPTDYLTDALYALE
FT                   DLTFDKKLVISALPSSVPNVDYSVVLYDSEESLKDPTYTINKQLISEGWAVVEATGVSP
FT                   NLKEYLESVQKVQQQARSAHLGCWEFGDVSFDDEDTLI"
FT   gene            <212830..>213333
FT                   /locus_tag="DEHA2A02530g"
FT                   /old_locus_tag="DEHA0A02937g"
FT                   /old_locus_tag="DEHA-IPF10779"
FT                   /old_locus_tag="DEHA-CDS5776.1"
FT   CDS_pept        212830..213333
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02530g"
FT                   /old_locus_tag="DEHA0A02937g"
FT                   /old_locus_tag="DEHA-IPF10779"
FT                   /old_locus_tag="DEHA-CDS5776.1"
FT                   /product="DEHA2A02530p"
FT                   /note="highly similar to uniprot|Q02159 Saccharomyces
FT                   cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84401"
FT                   /db_xref="GOA:Q6BZC0"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZC0"
FT                   /protein_id="CAG84401.1"
FT                   /translation="MAPRSTAQKRLLKEYQQLARDPPPGIVAGPISEDDLFKWECLLAG
FT                   PPDTPYENGVFPASLTFPKDYPLSPPTLTFDPPLLHPNIYADGTVCISILHAPGEDPNQ
FT                   YERPEERWSPVQSIEKILLSVMSMLAEPNPESGANIDACKLWRDNRVEYDRQIRDHVRK
FT                   TLGL"
FT   gene            <213612..>215081
FT                   /locus_tag="DEHA2A02552g"
FT                   /old_locus_tag="DEHA0A02959g"
FT                   /old_locus_tag="DEHA-IPF10778"
FT                   /old_locus_tag="DEHA-CDS2418.1"
FT   CDS_pept        213612..215081
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02552g"
FT                   /old_locus_tag="DEHA0A02959g"
FT                   /old_locus_tag="DEHA-IPF10778"
FT                   /old_locus_tag="DEHA-CDS2418.1"
FT                   /product="DEHA2A02552p"
FT                   /note="similar to uniprot|P50264 Saccharomyces cerevisiae
FT                   YMR020W FMS1 Polyamine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84402"
FT                   /db_xref="GOA:Q6BZB9"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB9"
FT                   /protein_id="CAG84402.2"
FT                   /translation="MTQSIEVEVCIIGGGVSGLKAAHTLLNHSGSKYSSKDLILLEAQD
FT                   RLGGRIFTDRKSSKLGISYDLGASWFHDSLNNVVLEESIKDGTFNVMEDGYYDDKDIRV
FT                   FASDEDGPLDVNNMKLHRVAEDLEKFIELYYFDDLNKADMSLNEIVELFMEKHSSRLTT
FT                   EQKRYCSTILRYLELWYGITWDKISAKYSIMDHQGRNLFNKKGYDFLINKLASGIPEDR
FT                   ILHSHPVTNIIRNNKKGNERVAVESSNGPTVYCNYLVVTVPQSILSLSPSHTHGITWIP
FT                   PLPSNITDALENIHFGALGKVIFEFESCWWDINEDRFEILADSTDDSSLSSPISSSPES
FT                   FKFPVFAVNCAAVYKESVRGASLCILTQSPLTDYLESHPQQAWSYFKPMLSKLKLNDLQ
FT                   VSDPINTITSNWTNNPYIRGSYSAVETGDDPLDIITQLSGEHDCGLIDKNIRFAGEHTT
FT                   SDGSGCVHGAYMSGQREAMWILNDCGAFSTQ"
FT   gene            <215234..>215668
FT                   /locus_tag="DEHA2A02574g"
FT                   /old_locus_tag="DEHA0A02981g"
FT                   /old_locus_tag="DEHA-IPF10776"
FT                   /old_locus_tag="DEHA-CDS6199.1"
FT   CDS_pept        215234..215668
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02574g"
FT                   /old_locus_tag="DEHA0A02981g"
FT                   /old_locus_tag="DEHA-IPF10776"
FT                   /old_locus_tag="DEHA-CDS6199.1"
FT                   /product="DEHA2A02574p"
FT                   /note="similar to uniprot|Q08971 Saccharomyces cerevisiae
FT                   YPL225w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84403"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB8"
FT                   /protein_id="CAG84403.1"
FT                   /translation="MGKFKAEEAENLEDIEKQFAVKAVMQAETYWGLLEKIPGSKLKLT
FT                   KYDDRIYDQLLEDFPEFKDPSAAAVIEEAYMKSPSGKAKWRAFCDKFKDIEDYNFGTLL
FT                   RSKATDEYSQEGTIFAVRIQFYAVEIARNRYGLNDWIANK"
FT   gene            <216014..>218206
FT                   /locus_tag="DEHA2A02596g"
FT                   /old_locus_tag="DEHA0A03003g"
FT                   /old_locus_tag="DEHA-IPF10775"
FT                   /old_locus_tag="DEHA-CDS1002.1"
FT   CDS_pept        216014..218206
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02596g"
FT                   /old_locus_tag="DEHA0A03003g"
FT                   /old_locus_tag="DEHA-IPF10775"
FT                   /old_locus_tag="DEHA-CDS1002.1"
FT                   /product="DEHA2A02596p"
FT                   /note="some similarities with uniprot|Q05040 Saccharomyces
FT                   cerevisiae YMR029C FAR8 Protein involved in G1 cell cycle
FT                   arrest in response to pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84404"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB7"
FT                   /protein_id="CAG84404.2"
FT                   /translation="MNNPKMQSNNTNSNSNNVNMNNNGSSKLPQWQQQQQQPLANYTLP
FT                   GVINYLTSEFTDLERFKIMTNLEKSEMKYKIVQLQGELNTLRYITEKQKSRIDVLEKEN
FT                   QKLHRQLKHEGRDSQSGSETKKEGTIKEDDIEIPEIDLLEIQKSRTQLTKSMRQVLHLL
FT                   KTPHANNMNPLNLNNPADESNEYDDLIKNDKSDAFCFSEKGDTRIPDYSGRSRKYNKES
FT                   IFSQYLNDIPFDSENQGSTEKIQDDSCQNNLTGIGDINATSIQYLAQPSEEKEVFPSSN
FT                   YKAEESDAETVIMDDSDGEELELTKTKSNLAKKPVTNSSSANYSPVKSEFPSESNNVTE
FT                   DTYSVKPNALITTNDPKYGSCRMFTSCLNNTIVYLNYDHDSDENLVLLNVWSTSLNKLV
FT                   VSKEFTDTIVERPTNIIDIYCVSHDESNSTIYLLIIYKSGTVDHIKLNENSQISKSCIL
FT                   NLAPTTLNSSKLIEFRHKSSPESRNFGLVVTGLQNPASIPFIKVYNLMVDAMNSIIETE
FT                   IGSYVKSFFKLQNLQESDMFEVVHWFKNDDTTSITDTSSQKPNKGKSHKRTVSCTDVSL
FT                   SPYEIILKLGYQLIRFNFVSKKYYTLIDEQHGDTTKDVCFNDHLAIFVEVKEDIYKLRV
FT                   YDLVKKTTISQTNFNGSLAQNSSLILVSDQKKYAIARLDRTHIQFYDLNFSLLHHINIS
FT                   PLPNTLLYANGEIVLATVSNNSVENLAIYDLNTFTA"
FT   gene            <218483..>218794
FT                   /locus_tag="DEHA2A02618g"
FT                   /old_locus_tag="DEHA0A03025g"
FT                   /old_locus_tag="DEHA-IPF10773"
FT                   /old_locus_tag="DEHA-CDS7123.1"
FT   CDS_pept        218483..218794
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02618g"
FT                   /old_locus_tag="DEHA0A03025g"
FT                   /old_locus_tag="DEHA-IPF10773"
FT                   /old_locus_tag="DEHA-CDS7123.1"
FT                   /product="DEHA2A02618p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB6"
FT                   /protein_id="CAG84405.2"
FT                   /translation="MSSSNIDTIGQSNEGSTALSNTLSPSKPEVDDDNYDDDPQAFSLI
FT                   RFFGVCYVFRSKSRCNGKVNVGSVAATLGTSLCIRFCLWPYYLGTMSSCCDVRPIWGC"
FT   gene            <219192..>219725
FT                   /locus_tag="DEHA2A02640g"
FT                   /old_locus_tag="DEHA0A03047g"
FT                   /old_locus_tag="DEHA-IPF10772"
FT                   /old_locus_tag="DEHA-CDS5630.1"
FT   CDS_pept        219192..219725
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02640g"
FT                   /old_locus_tag="DEHA0A03047g"
FT                   /old_locus_tag="DEHA-IPF10772"
FT                   /old_locus_tag="DEHA-CDS5630.1"
FT                   /product="DEHA2A02640p"
FT                   /note="some similarities with uniprot|Q07824 Saccharomyces
FT                   cerevisiae YLL028w TPO1 Proton-motive-force-dependent
FT                   multidrug transporter of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84406"
FT                   /db_xref="GOA:Q6BZB5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB5"
FT                   /protein_id="CAG84406.1"
FT                   /translation="MGEYGFTRGVAELPYLSMLVDIFIGSFVCTLFEKRFNKAMAKNNG
FT                   KPIPEERLSPMIFGSIFFAIGLFLLAWSGSYPEHVHWIVPTIGSSFIGFGLITIFLPCM
FT                   NYIIDCYLMFAASAMAANTFLRSMFGGAFPLFARQMFVNMKIQWVGILLGCVSVVLLPV
FT                   PFLFYSYGRKIREK"
FT   gene            complement(<220031..>221584)
FT                   /locus_tag="DEHA2A02662g"
FT                   /old_locus_tag="DEHA0A03069g"
FT                   /old_locus_tag="DEHA-IPF10771"
FT                   /old_locus_tag="DEHA-CDS2207.1"
FT   CDS_pept        complement(220031..221584)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02662g"
FT                   /old_locus_tag="DEHA0A03069g"
FT                   /old_locus_tag="DEHA-IPF10771"
FT                   /old_locus_tag="DEHA-CDS2207.1"
FT                   /product="DEHA2A02662p"
FT                   /note="weakly similar to uniprot|P15365 Saccharomyces
FT                   cerevisiae YJR152W DAL5 Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84407"
FT                   /db_xref="GOA:Q6BZB4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB4"
FT                   /protein_id="CAG84407.2"
FT                   /translation="MKDKGSSIVEEVSLDKQEVSENHENEHKDFDKLIDKAGIFLAERE
FT                   GIYGEIQEGEEKRIVRKLDWRLLPMLFFTATLGAVDKQCISTAAIYGFTEDNNLSGSEY
FT                   SWLGSIIFIGSLVGMWPMTFILQKFRLGMVLVVASLLWSALTLLFCAGHNFAGFAALRF
FT                   LLGFIECAIVPGCTLMVTRFYIKKEQAPRLAYVFAFASSVINGFLSWLVGNFNDNIPKW
FT                   KYLYLMVGSISFTWSCFIFFYLPDTPMNTKFLTDREKYFLIKKVVKNQTGIESNDWKWE
FT                   QMVEALLEPKSYIIMLFNIGINITNGGLSAFSSIIINNLGFSAMESSLMSMPTGVIATL
FT                   ATIGFTYATTKFPNKRCLICVISLFIPLIGAILLYTIDQSKIGPQLFGLYLAYFYFAPY
FT                   VIMMSLAQANTAGNTKKSVVYSMNYLGYAAGALIGPQTFRAEEAPKYTGGFTGMMVSFC
FT                   VCILLSILYWFICVLNNRNKKAMVECDQNIEIQIAVASEETDLMYDLTDKQQATFLYTT
FT                   "
FT   gene            <222644..>224326
FT                   /locus_tag="DEHA2A02684g"
FT                   /old_locus_tag="DEHA0A03091g"
FT                   /old_locus_tag="DEHA-IPF10768"
FT                   /old_locus_tag="DEHA-CDS1581.1"
FT   CDS_pept        222644..224326
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02684g"
FT                   /old_locus_tag="DEHA0A03091g"
FT                   /old_locus_tag="DEHA-IPF10768"
FT                   /old_locus_tag="DEHA-CDS1581.1"
FT                   /product="DEHA2A02684p"
FT                   /note="weakly similar to uniprot|P26370 Saccharomyces
FT                   cerevisiae YDL170W UGA3 Transcriptional activator necessary
FT                   for gamma-aminobutyrate (GABA)-dependent induction of GABA
FT                   genes (such as UGA1 UGA2 UGA4)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84408"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB3"
FT                   /protein_id="CAG84408.2"
FT                   /translation="MLAKGLIFGRSERNRKKLKARKDSTENNRDDVNIDKSLDVQSIQK
FT                   APLKGKSLFLNTTINDLKSIYEVPDEQLATNSDPTSIYHSFETYTFDNQYDKKSFKVMD
FT                   TDIQLISKPDNIWGAYNDFNFEDYLNPFCDDTSYFPLVNDLSFFPFNYDTMDYNLFEYF
FT                   VKKICPVCICYSERGIPSEADTPINSQSDKINPYLKYIVPLGMKSELLFKTIVAIAANE
FT                   LNIVQYRSFYEDIARNSMSYVLEELPKLIHKGKVTNSNNWDEILPTILMLCFADISTEC
FT                   GRIWILHLNGAKEFIRYLIDSQVEGELSKFVVRYFISHEIMGQTAWSDQPNNLLWDPFF
FT                   EDLKYDYDTNIDLVLGCSPYLISLINSITMLGDYTETLDFGLKHTRDSIQPDILKQRDR
FT                   LELELVNLEQKLTVEEINESAVYVRQIARVKKIAAILYLFIRVDQELYFTLGKSFYRQC
FT                   HLRLKNMRPWVLEAIDIMNNMNTSSMSLLWPLFIVGVVSYDDEDHRHFVLHRLQEMEMS
FT                   RKLASVRMAKHTIETLWKEKDLGCSLLNWKDMMRGRADTISLA"
FT   gene            <224694..>228644
FT                   /locus_tag="DEHA2A02706g"
FT                   /old_locus_tag="DEHA0A03113g"
FT                   /old_locus_tag="DEHA-IPF10767"
FT                   /old_locus_tag="DEHA-CDS0167.1"
FT   CDS_pept        224694..228644
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02706g"
FT                   /old_locus_tag="DEHA0A03113g"
FT                   /old_locus_tag="DEHA-IPF10767"
FT                   /old_locus_tag="DEHA-CDS0167.1"
FT                   /product="DEHA2A02706p"
FT                   /note="similar to uniprot|P28273 Saccharomyces cerevisiae
FT                   YKL215C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84409"
FT                   /db_xref="GOA:Q6BZB2"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB2"
FT                   /protein_id="CAG84409.2"
FT                   /translation="MTASDRVVIAIDRGGTFTDVIYKYKGIEKTFKLLSVDPSNYQDSN
FT                   IEGIRRVLEKVTDRKIPRGSQLDTSIVSSIRLGTTVATNALLERKGARCALVTTKGFKD
FT                   LLHIGDQSRPDLFALDITKPGVLYEKVIEAEERVTLPAFTVDPNRYDCQDLFDGEKYVR
FT                   GQTKEIFEILEPLDEVKLREELSLLKKDGIDSIAIVFIHGFNFQAHEKAAGKIAQELGF
FT                   RNISLSHKVLPVIKAVTRGHSTTVDAYLTPIVKEYISNFLSGLKPDYNDHTKIEFMQSD
FT                   GGLCSYEKFSGLRSLLSGPAGGVVGQAMTCYDQNNKIPVIGFDMGGTSTDVSRYAGDFE
FT                   FSFESITAGIKIAAPQIDVNTVAAGGGSILFYRNGTFFVGPESASAHPGPACYRKGGPL
FT                   TITDANLFIGRLLPKYFPHIFGDAEDQPLDFEVTKQKFEALTKVINRENPDSPKTPQGV
FT                   ALGFLEVANFQMAKPIRELTGSKGHDISGHSLASFGGAGGQHAASIAQLLKINRILIHK
FT                   HSSILSAYGILVADLVSEKQQPCSEIIDSQSVNILLKKCDKLKEEAIEELLMESVAPST
FT                   ISCKLYFNMGYEGSDTRFMVLQPEMNQFLELFYEIHQRELGFNDRSRNVIVSDIRVRVT
FT                   GNTADNEREISPYDELESTEITEVSKNKAEETVLIYFEGGYQNSEVYFLENLTTGSVVN
FT                   GPALILDSTQTILVSPQCQATVLSRHIVMDLKSNKIECISSKVVDPIKLAIFANRFMSI
FT                   ADDMSRTLQKISVSANIKERMDYSCALFDNEGNLTANAPNVPVHLGSMSSAIRYQLEYW
FT                   KDDLHEGDILCTNSPSVGGTHLPDLTIISPVFYDSKLQFVVASRAHHSEIGGSAPGSSS
FT                   SYARDIVDEGVNIKTWKIVQNGKFDDDGLLKHFVEEPKSHGVCGTRNIDDNISDLKAQI
FT                   AANQRGINLLLELFKEYGSDVVLFYMRSVKKTAELAVRSFFKDFFQQNRDKIPLKAEDY
FT                   LDDGSKICVSIDVDGDDGSASFDFTGTSLESYSNLNAPKSVTYSAVIYVLRCLISLDIP
FT                   LNQGCLNPCTLYVPENTLINPSEFAAVCAGNGMTSQRTTDVLFKAFGVTSATGGCMNGI
FT                   NFGTGGENEKGELIKGFGYTETIGQGSCAGIIEKDGKRVGFDGFSGTQTNMTNTRITDP
FT                   EVLEQRYPCLLRTFTIRQNSGGKGKWNGGNGLIREIQFNSPVHVSLVTQRRVYSPWGIY
FT                   GGECGKKGENYLGRNRSNGIIQWIHLPSLAEIEIRKCDILRILTPGGGGFGKPADSDEY
FT                   WRIGDCSPNSFEHIPLSLGSVGSLKEGSNTSQ"
FT   gene            complement(<229097..>231232)
FT                   /locus_tag="DEHA2A02728g"
FT                   /old_locus_tag="DEHA0A03135g"
FT                   /old_locus_tag="DEHA-IPF10764"
FT                   /old_locus_tag="DEHA-CDS1098.1"
FT   CDS_pept        complement(229097..231232)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02728g"
FT                   /old_locus_tag="DEHA0A03135g"
FT                   /old_locus_tag="DEHA-IPF10764"
FT                   /old_locus_tag="DEHA-CDS1098.1"
FT                   /product="DEHA2A02728p"
FT                   /note="some similarities with CA1173|IPF14254 Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84410"
FT                   /db_xref="GOA:Q6BZB1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB1"
FT                   /protein_id="CAG84410.2"
FT                   /translation="MNQGDGSTNGSDLWDALSFFDKPNQSTPIGFDVEKDSNFFFDITP
FT                   WEQESASKETIDTDTKKSKNKINKLNVSVDKCANKDKPAGSSTGNKQKEDREIQANADT
FT                   RKVAKKSKEKKRDRRLRSRFGCEKCRNKRVKCDEKRPSCGRCLSRGVQCKYKILLQFRE
FT                   DYESKGKKFGREGVWNKTGSFEKTVKELVSSSKDTHYLDIQNTSALAFVNFTIKDIVQG
FT                   RRWIPPSIQPSLIPVDIRTSANDNSIGFALNYYIDVISPIFNPVGFKGFNKQYIINMSS
FT                   KQVLIEPGLNSKWLIQYSQNRNSVFYLVLALGFLYLSKNNTHSLDLKDSRSKWFTSSLV
FT                   FKHKGMQMISEKMSRFQTTPKSNLHLSTEFLLSLVLLMLYEVADNCNEKWGSYLKICKN
FT                   VICSEYFEQPKNDIEAYLLQFSLELLNYQETMGRTACKDKNSFFLLHEDDDEEEQAPTL
FT                   YSPSPTCVRISWMGCDRNLVNVISDITDLSFERFNNICLEDYTILSNELKNRLITMDLG
FT                   VNIDDYLLDAPVTDFSNISASGSNSVYIDSTLDIEDFCFLLSCEVKRLAGLIYWECCLL
FT                   NAKPENRYIQTMLIKAYKILTFIIIQNDFKWISTLLWSLFIVSAEISVQSNDCDTLRYL
FT                   TLKMLNRIQPKSLGNVDMIREIILGIWKGRDIRNCDENSFGYTKKPGIANERISILGSR
FT                   NDWEIFVANESYKISLA"
FT   gene            complement(<232229..>233509)
FT                   /locus_tag="DEHA2A02750g"
FT                   /old_locus_tag="DEHA0A03157g"
FT                   /old_locus_tag="DEHA-IPF10761"
FT                   /old_locus_tag="DEHA-CDS2935.1"
FT   CDS_pept        complement(232229..233509)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02750g"
FT                   /old_locus_tag="DEHA0A03157g"
FT                   /old_locus_tag="DEHA-IPF10761"
FT                   /old_locus_tag="DEHA-CDS2935.1"
FT                   /product="DEHA2A02750p"
FT                   /note="similar to uniprot|P78573 Aspergillus fumigatus
FT                   Fructosyl amine: oxygen oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84411"
FT                   /db_xref="GOA:Q6BZB0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZB0"
FT                   /protein_id="CAG84411.2"
FT                   /translation="MDKPGKILIIGAGTFGLSTALHLLRQGEKDVILVDPYAVPSPFSA
FT                   GNDVNKIIQTTSDDDFYSKLALEALEMWREDNVFNKAFAETGIIYAATGKEQRESIDYR
FT                   YEYLLGRKDKVVKLNSVEDYEKYVPNKEGSKSYPNKFQKWYGYYQEKNCGWAFARLALE
FT                   NCVEECRKLGAKFVIDSAEELLFSEDGACVGVHTSNGNIIEADRTIICAGANSFKFLNF
FT                   EQQLLAKCYTLGHIKLTDDEAALLKGMPVVLNLDGGFVFEPDLNNEIKFCNEFPGYVNI
FT                   VNEDSVPSFKDSIPKEAEDQMRAFLRQVFPEFAEREFSLARICWCTDTPDRHFLICEHP
FT                   GHKNLVLGTGDSGQGFKYMPNVGKYISQVALKGENSLDKDKKELWRWRPDMGKKRDLKD
FT                   LQGRYGGSNEVKDLKNVKQWSNGKSHL"
FT   gene            <234126..>235718
FT                   /locus_tag="DEHA2A02772g"
FT                   /old_locus_tag="IPF_10758"
FT   CDS_pept        234126..235718
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02772g"
FT                   /old_locus_tag="IPF_10758"
FT                   /product="DEHA2A02772p"
FT                   /note="weakly similar to uniprot|P25621 Saccharomyces
FT                   cerevisiae YCR028C FEN2 Plasma membrane H+-pantothenate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65352"
FT                   /db_xref="GOA:B5RSP6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP6"
FT                   /protein_id="CAR65352.1"
FT                   /translation="MITKTDKKESNIDIESVDLQQSEAPDQHHPNFFELELTRKQKLAL
FT                   FWSKKSPRAKEKRQKFFFWNPPGRSAYEKNLVFKLDCIILSYCCLSFFVKYLDQSNVNN
FT                   AYVSGMKEALDMEGNMFNWLNQGFLLTYGIFGLFGSLLITKISPHIVLPLFEVIWSVLC
FT                   LLVITCDTYPKLVAIRCLQGAFSGIVYPACHYILGTWYTPAELTARTAIFVSSGSLGTM
FT                   FGGYIQSGIHKSLDGKAGLPGWKWIFVIDFLITIPVATFGYFILPGEPSKPRASRFLND
FT                   QDFEFCCKRIEVVENVETVNKFDFSVVKRAIFSWQLYVFVIAYVLSQLTEECTNYWNIV
FT                   LQDQGFNIYNRNTYPTVQSAVKVVSSLIAGLYSGIRGKKWEIYVIICFFWISGLATLVK
FT                   YDVPFGAQFYANSVLGVCAAYSVIIISWANEMCKEDDQLRATVLGSLNFIFVVLDVPYA
FT                   TRVFDTNNAPRFRLGMTIGLTFCCFLFLFNGVLVMFDRYQNRIRDLFDDKFNKDIEVEE
FT                   IISKDPEKSIISH"
FT   gene            complement(<236128..>237384)
FT                   /locus_tag="DEHA2A02794g"
FT                   /old_locus_tag="DEHA0A03223g"
FT                   /old_locus_tag="DEHA-IPF10756"
FT                   /old_locus_tag="DEHA-CDS3002.1"
FT   CDS_pept        complement(236128..237384)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02794g"
FT                   /old_locus_tag="DEHA0A03223g"
FT                   /old_locus_tag="DEHA-IPF10756"
FT                   /old_locus_tag="DEHA-CDS3002.1"
FT                   /product="DEHA2A02794p"
FT                   /note="similar to uniprot|Q92204 Aspergillus terreus
FT                   Fructosyl amino acid oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84414"
FT                   /db_xref="GOA:Q6BZA7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZA7"
FT                   /protein_id="CAG84414.1"
FT                   /translation="MLGKESKILIIGGGTWGLSTALYLLRDNYTDVTIIDAEEIPSSRS
FT                   AGNDINKIIRIGYTSEFHSRLELEAAELWRNDPLFKPFFHEVGYLVCTSEEAPLEELNL
FT                   IRRIRLDMNRKDWEELNTKEDIISGAPILHKGTLPGWRGYLQRNEGGWVHAANTMRAVA
FT                   NEIRRLGGKFVTDEISSLLFEAGSVKGCRSFTGKEYFADKTILSTGASSVKLLDFKNQL
FT                   MAKCWTLGHIKLSTEESERFKDIPVIRSLEGGFFFQPDENNEMKICNEFPGYTHYISEQ
FT                   KEPNTSVPEYINTVPVEAEKGIRKLLKETIPDFRDKPIVMSKICWCTDTPDRYYLIDEY
FT                   PESNGSLILATGDSGHGFQLIPTIGKYISKLAVLGKDGLDKEQQYRWRWRPETVKDRIQ
FT                   NRYGGEGHVKDLKDIKDWI"
FT   gene            <238263..>238478
FT                   /locus_tag="DEHA2A02816g"
FT                   /old_locus_tag="DEHA0A03245g"
FT                   /old_locus_tag="DEHA-IPF10755"
FT                   /old_locus_tag="DEHA-CDS7624.1"
FT   CDS_pept        238263..238478
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02816g"
FT                   /old_locus_tag="DEHA0A03245g"
FT                   /old_locus_tag="DEHA-IPF10755"
FT                   /old_locus_tag="DEHA-CDS7624.1"
FT                   /product="DEHA2A02816p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84415"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZA6"
FT                   /protein_id="CAG84415.1"
FT                   /translation="MFVFLYAKILKMENKSHEASIEHNEVLDDVHSRNTVGLMSLGDNK
FT                   ANIKGIPKGALTKHLGRSLCKHSKGT"
FT   gene            <238587..>239287
FT                   /pseudo
FT                   /locus_tag="DEHA2A02827g"
FT                   /old_locus_tag="DEHA0A03267g"
FT                   /old_locus_tag="DEHA-IPF10754"
FT                   /old_locus_tag="DEHA-CDS7882.1"
FT                   /old_locus_tag="DEHA0A03289g"
FT                   /old_locus_tag="DEHA-IPF10753"
FT                   /old_locus_tag="DEHA-CDS7645.1"
FT                   /note="some similarities with uniprot|P38156 Saccharomyces
FT                   cerevisiae YBR298C MAL31 Maltose permease no start
FT                   frameshift pseudogene"
FT   gene            <239828..>243244
FT                   /locus_tag="DEHA2A02838g"
FT                   /old_locus_tag="DEHA0A03311g"
FT                   /old_locus_tag="DEHA-IPF10751"
FT                   /old_locus_tag="DEHA-CDS0286.1"
FT   CDS_pept        239828..243244
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02838g"
FT                   /old_locus_tag="DEHA0A03311g"
FT                   /old_locus_tag="DEHA-IPF10751"
FT                   /old_locus_tag="DEHA-CDS0286.1"
FT                   /product="DEHA2A02838p"
FT                   /note="similar to uniprot|Q08972 Saccharomyces cerevisiae
FT                   YPL226w NEW1 This gene encodes a protein with an Q/N-rich
FT                   amino terminal domain that acts as a prion"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84418"
FT                   /db_xref="GOA:Q6BZA3"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZA3"
FT                   /protein_id="CAG84418.1"
FT                   /translation="MAPQSFDEFLKQQAQQSKGPAVNRGLNNKVYSNRGSTPFQDSYGS
FT                   TPNGSLPGSGSATPNPNSSTASLTSLNTALSKLNVGDTPIQENLWNIEQASKISEVKVE
FT                   AEAIANIVSESSLSVINEWKLNDIIKSLSKPKNSPLVRESAMIIIQQLVMKFGGQTPSE
FT                   AYLLQFFSICYDMCADKDKNCVKAAKTAADSLYGIFPVEAAGSIVINTLLSYLSSSAKW
FT                   NSKMAALDTFDKLIDDVPADLLELKFVNTVPVLTDLSTDFKPELAKHGLKVMMKFVKVL
FT                   DSLDLQNKFELIVETLSDPKKVPECIKNLSSVTFVAEVTEPVLSLLVPILDKSLNMSST
FT                   SNDQLRQTVTVTENLTRLVNNKREIEVYIPILLPGVQKVVNNASLPEVRELAGKALSVL
FT                   QDAKDEQSDGMFHGRINLTQAREFYTENMDDELKSVAQTLHVDSDEIISNYLAFILQAD
FT                   ANVNDWKRLTDYLNMAITDSDNELKEKYVNKVLANLRDLFTAVSTRVYDDEEGAIEIVN
FT                   ADFSLAYGSRMLLNKTNLRLIKGHRYGLCGRNGAGKSTLMRAISKGQLEGFPTPDQLKT
FT                   CFVEHKLQGSEADMDLVGFIASDPELEGVGRDEISKALLAVGFPQERLDQQVGSLSGGW
FT                   KMKLELARAMLMKADVLLLDEPTNHLDVANVKWLEDYLIENTNITSLIVSHDSGFLDKV
FT                   CTDIIHYENKKLAYYKGNLSEFVKAKPEGKSYYTLSDSNVKMAFPPPGILTGVKSNTRA
FT                   VARMANVTFTYPGAAKPSLENVSCSLSLSSRVAILGPNGAGKSTLIKLLTAELNPNEGK
FT                   VEKHPNLRIGYIAQHALQHVEQHKEKTANQYLQWRYRFGDDREVLLKESRKISEDEKEQ
FT                   MAKEIDIQDGRGPRTIEAVVGRQKLKKSYQYEVKWKWWLPKYNSWVPKEVLLEHGFNKL
FT                   LQKFDDHEASREGLGYRELTPTVIRKHFEGVGLDGDIADHTPMGSLSGGQLVKVVIAGA
FT                   MWNNPHLLVLDEPTNYLDRDSLGGLAIAIRDWAGGVVMISHNNEFVGALCPEQWHVENG
FT                   EVVQKGTAAVDNKRFEDGDSASPSPAPTPTKKRADDDDSPANIKIRARKKKMTRNEKKA
FT                   QTERRRLRYIDWLNSAKGTPRYPDTDDEDED"
FT   gene            <243553..>244421
FT                   /locus_tag="DEHA2A02860g"
FT                   /old_locus_tag="DEHA0A03333g"
FT   CDS_pept        join(243553..243596,243713..244421)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02860g"
FT                   /old_locus_tag="DEHA0A03333g"
FT                   /product="DEHA2A02860p"
FT                   /note="highly similar to uniprot|P23639 Saccharomyces
FT                   cerevisiae YML092C PRE8 20S proteasome beta-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84419"
FT                   /db_xref="GOA:Q6BZA2"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZA2"
FT                   /protein_id="CAG84419.2"
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVKQGVTTIGIKSANGVVI
FT                   ATERKANSNLLKAESNNKVELITPDIGMSYSGMGPDFRVLVDKARKLAHTNYKRIYNEY
FT                   PPVKVMVQEIAKVMQESTQSGGIRPFGVSLLVGGYDKHSNSFQLYQVDPSGSYFPWKAT
FT                   AIGKTSVSAKTFLEKRWNENLELEDAIHVSLLALKESVDGELTGENLDIAIVSDSQEHL
FT                   LGFKGTNVEGPRFRKLSAEEINDRLDAL"
FT   gene            <244646..>247324
FT                   /locus_tag="DEHA2A02882g"
FT                   /old_locus_tag="IPF_10747"
FT   CDS_pept        244646..247324
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02882g"
FT                   /old_locus_tag="IPF_10747"
FT                   /product="DEHA2A02882p"
FT                   /note="similar to uniprot|Q04500 Saccharomyces cerevisiae
FT                   YML093W UTP14 Nucleolar protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65353"
FT                   /db_xref="GOA:B5RSP7"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP7"
FT                   /protein_id="CAR65353.1"
FT                   /translation="MARKNTKNKSSSRKRSSQKVLDAFQIAERAENRSEDDSDNRPGDE
FT                   DDLEVHDGIMDASKFLANKSKDDEGLSDEELDSDEALGSDDDYDILTSKFSQTIRDKEK
FT                   KRKLNEKKRKRGEYRDSESEDEEEDEGYASIDESQLVTLSQAWDMDEKDAKSLQKSNDN
FT                   NDLVLDDAWESESSEEESEEESEEESDDDEDIFKSASENENDDEVDLANTVSQLQSQLK
FT                   KPAKERKRLIAEATDENEFNLPTKGVTLSLQDMISAVDPSVSKDAILIDNEDNSKQKAL
FT                   ATPLPKRIQERNERQIAYEITNEDISKWEDTVQQNRQAEVLKFPLNPEIKHNDTATTFR
FT                   SSNEPSTELEKKIQGILKDSALTDDRKEATFEEIAAAKLSSEELKKRTNELRLMRELMF
FT                   RDEKRAKRIKKIKSKTYHKIKKKERLRTQEMVEGSDMESDNEDHDMKRAKERMLLKHKT
FT                   QSKWAKSMIKSGLSKDASNRDDLEEMLRQGEKLRSKQLGYEDGDQSDQDVSDIEDEYAK
FT                   DDETNETDDINRNKLGKGVLAMDFMKSADKRHKQENLKELELLKKLENGGDLDEFQEDA
FT                   TSINVTKNQGRRVYTPSASSMKSDINEVNQKTLNELRDDESNNLENRLSKKFKVVDNSI
FT                   SNKKPNNLSKDVEEEKKSKASDEAEDVNPWLAGNDSEEAMQKSRKIHKVDKTSSKLSKS
FT                   AQKISKNKKRSASQRDDEDTIIDMHETLKARDIHDDDNENSNDEDKDDGLMFKQKNLIK
FT                   QAFAGDDVVREFEKEKRQVVKDEGDKVEDVTLPGWGDWAGGKKKAKKIVRKIDGVVQKD
FT                   KRKDKNLKDVIINERVNKKNLKYQSSGVPFPYESREQYERALRMPVGQEWTSRETHQKL
FT                   TMPRIITKQGTVIDPLKAPFK"
FT   gene            complement(<247416..>249089)
FT                   /locus_tag="DEHA2A02904g"
FT                   /old_locus_tag="DEHA0A03377g"
FT                   /old_locus_tag="DEHA-IPF10746"
FT                   /old_locus_tag="DEHA-CDS1901.1"
FT   CDS_pept        complement(247416..249089)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02904g"
FT                   /old_locus_tag="DEHA0A03377g"
FT                   /old_locus_tag="DEHA-IPF10746"
FT                   /old_locus_tag="DEHA-CDS1901.1"
FT                   /product="DEHA2A02904p"
FT                   /note="similar to uniprot|P54783 Saccharomyces cerevisiae
FT                   YML086c ALO1 D-arabinono-1 4-lactone oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84421"
FT                   /db_xref="GOA:Q6BZA0"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR030654"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZA0"
FT                   /protein_id="CAG84421.2"
FT                   /translation="MRSDIPETLQNFVSTKTVHQTWAKTFFCKPQAIFQPRTVDEIREL
FT                   VDQARINGKTIMTVGSGHSPSDMTMTKEWLCNLDRFNQVLKKEEFSGPTRNGEGEEVKF
FT                   VDLTVQAGCRIYELNRYLKENELAIQNLGSISDQSMAGVISTGTHGSTQYHGLVSQQVV
FT                   SIEIMNSAGKLITCSSMENTQLFKAAMLSLGKIGIITHVTLRTIPKYTIKSKQEIIKFD
FT                   TLLKNWDTVWLDSEFIRVWWFPYSGNCVCWRASKSSEPLSKPRDSWYGTWFGRKFYESL
FT                   LWISVHICPHLTPLIEKFVFKNQYGDVETLGHGDVAVQNSVEGLNMDCLFSQFVNEWST
FT                   PLSSGQDVLIKLNDVIQTAREQNRFYVHAPIEVRCSNLTYSEKPFVDENDEPSLYPNKK
FT                   WLAKRDRLSPGPIPGNNLRPYLDNSSNLRYDGDGANVTNDQLTLFINATMYRPFHTNVN
FT                   SQEWYQLFEDIMTNASGRPHWAKNFIGVNGAHRTDQDLRKQLEFGGKTSYSMKGFNPIL
FT                   KKWFGENLVEYNKVRESMDPDNVFLSGKDWAVRNGILIDV"
FT   gene            <249361..>250707
FT                   /locus_tag="DEHA2A02926g"
FT                   /old_locus_tag="DEHA0A03399g"
FT                   /old_locus_tag="DEHA-IPF10743"
FT                   /old_locus_tag="DEHA-CDS2740.1"
FT   CDS_pept        249361..250707
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02926g"
FT                   /old_locus_tag="DEHA0A03399g"
FT                   /old_locus_tag="DEHA-IPF10743"
FT                   /old_locus_tag="DEHA-CDS2740.1"
FT                   /product="DEHA2A02926p"
FT                   /note="similar to uniprot|P54839 Saccharomyces cerevisiae
FT                   YML126C ERG13 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84422"
FT                   /db_xref="GOA:Q6BZ99"
FT                   /db_xref="InterPro:IPR000590"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ99"
FT                   /protein_id="CAG84422.1"
FT                   /translation="MTKPQNVGIKGIEVYVPSQCVNQTELEKFDGIAAGKYTIGLGQTN
FT                   MSYVNDREDIYSLSLTVLSKLIKNFGVDTNQVGRLEVGTETLLDKSKSVKSVLMQLFEG
FT                   NNDIEGIDTINACYGGTSAVINTVNWIESSSWDGRDGIVVCGDIAIYSKGAARPTGGAG
FT                   AVALLIGPDAPIVFESTRGSFMEHAYDFYKPDFTSEYPIVDGHFSLACYVKAVDQCYKN
FT                   YSKKVTKDDNKTVGVFDHFDYNAFHVPTCKLVTKSYARLLYNDYKADPSKFKDLIDEET
FT                   KKSIDSLTYDQSLVDKNLEKIFVGLAKEQTKTRVQPCLNVPTNTGNMYSASAWASLSSL
FT                   LYYVGSEQLQNKRIGVFSYGSGLASTLLSVVVKGDISKITKNLDFDHKLSEGRVTRTPE
FT                   QYLEAIELREKAHLQKSFKPSGSIETLARGTYYLTEIDDKYRRQYNKKD"
FT   gene            complement(<251532..>251783)
FT                   /locus_tag="DEHA2A02948g"
FT                   /old_locus_tag="DEHA0A03421g"
FT                   /old_locus_tag="DEHA-IPF10741"
FT                   /old_locus_tag="DEHA-CDS7434.1"
FT   CDS_pept        complement(251532..251783)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02948g"
FT                   /old_locus_tag="DEHA0A03421g"
FT                   /old_locus_tag="DEHA-IPF10741"
FT                   /old_locus_tag="DEHA-CDS7434.1"
FT                   /product="DEHA2A02948p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ98"
FT                   /protein_id="CAG84423.1"
FT                   /translation="MVRYILMVNSKQIEWNLEQLLVPVTCGNDCEIFHVPKWKQATIEK
FT                   ELFCGSNVRDCLGSQSIATKIFAIFRALQMAQHILYVK"
FT   gene            <251876..>254434
FT                   /locus_tag="DEHA2A02970g"
FT                   /old_locus_tag="IPF_10740"
FT   CDS_pept        251876..254434
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02970g"
FT                   /old_locus_tag="IPF_10740"
FT                   /product="DEHA2A02970p"
FT                   /note="some similarities with uniprot|Q03104 Saccharomyces
FT                   cerevisiae YML128C MSC1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65354"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSP8"
FT                   /protein_id="CAR65354.1"
FT                   /translation="MKVFNFALIGLLAGNLVAATDGLSTWKEKDVKHFLKDRQIDFSEK
FT                   ESFQELSRKAEEEFEKLKNIHRDTVRDDSQQHILATNPKDELTNIFPAHINWNYLFESN
FT                   AEHARSVKNWIFESWSTEGLKDFLTNNKIKFDKNYSKQDLIDLAQKEYDNIAEGHDVSG
FT                   YYPGDWIYQGWSVDRLKQWLQDHELEFDSKDNRESLLSKVKHNNYIASLSNIDNKNSLL
FT                   DSLDLAQANIFDKAGEIKDDFFDTWSYGQLREWLYYHGFISTRPDVYVEELDADKLKKI
FT                   AKSQQNYLVSDIKKWSEKAKKTADPYLSKGADKKKTLDNVINDTFLIGVEKWSKDRLKE
FT                   FLRSRNVKFSQFASKHQLVDLVKKSKDVKLALKQNANPASWLVENWSTDRIREWLENKG
FT                   ENVKGTREDLINGISNYVSQHSLAPSDTFDFSANLYKPDLDDYKKSFKESLNKFNEDVK
FT                   DSGGKAKEALDSAVDSSVADRTMLTAYSIGAEYYKQAAKTLREKYSESKFSIDDALSQA
FT                   KDASYEYANRFVDDASSKYADNKPVVEEQVKSAGIAASEFANSLSNSLTEQLKSGKAKL
FT                   NDVTNDPQEHLKSVNEIVEKSIRDKKPIAEQAAKDAYRVAQDYLASANDAIVKNYGEYK
FT                   PAAEDAMNTIYGSAKDYANSANEALEKGYGQYRPKAVEAAEKAKEYADAINEAVGKNFQ
FT                   EYEGKLQDAYKAASDAATAAYAEYKPIVDSTAKNAYDTAKQYAGSANEAIQSTYAETIP
FT                   KVENAAKSGWEYLLVSYSNADLRSYLQSFGYNFNLLSTLTRQQLVNLANEQSDIFFGSD
FT                   TKWDKSIVDVLKDTSDGFQEMIGIKPKEESIWSKVKNSLF"
FT   gene            <254775..>256253
FT                   /locus_tag="DEHA2A02992g"
FT   CDS_pept        join(254775..254799,254929..256253)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A02992g"
FT                   /product="DEHA2A02992p"
FT                   /note="highly similar to uniprot|P09733 Saccharomyces
FT                   cerevisiae YML085c TUB1 alpha-1 tubulin or uniprot|P09734
FT                   Saccharomyces cerevisiae YML124c TUB3 alpha-3 tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84425"
FT                   /db_xref="GOA:Q6BZ96"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ96"
FT                   /protein_id="CAG84425.1"
FT                   /translation="MREVISINVGQAGCQIGNACWELYSKEHGIRPDGYLEDSSDSRPK
FT                   GGEEGFSTFFSETGSGKYVPRALYVDLEPNVIDEVRTGAYKDLFHPEQLIAGKEDAANN
FT                   YARGHYTVGREMLDDILDRVRRMSDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSIDY
FT                   GKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCRRNLDIA
FT                   RPNFDSLNSLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPVFSKN
FT                   RANHESNSVSEITSSCFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQNSVAQIKAK
FT                   TTVQMVDWCPTGFKIGICYQPPTAIPGSELASAKRAVCMLSNTTAIAEAWRRIDRKFDL
FT                   MYSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGTDSYPEEEEEY"
FT   gene            <256577..>257491
FT                   /locus_tag="DEHA2A03014g"
FT                   /old_locus_tag="DEHA0A03487g"
FT                   /old_locus_tag="DEHA-IPF10738"
FT                   /old_locus_tag="DEHA-CDS4181.1"
FT   CDS_pept        256577..257491
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03014g"
FT                   /old_locus_tag="DEHA0A03487g"
FT                   /old_locus_tag="DEHA-IPF10738"
FT                   /old_locus_tag="DEHA-CDS4181.1"
FT                   /product="DEHA2A03014p"
FT                   /note="similar to uniprot|Q12746 Saccharomyces cerevisiae
FT                   YML125C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84426"
FT                   /db_xref="GOA:Q6BZ95"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ95"
FT                   /protein_id="CAG84426.2"
FT                   /translation="MEDKRELLKQPLHGIYIPILLMLVGTLIFGVEYLPYTIAIIVVVC
FT                   SVKFYESYSKRSSMDTLKWKEFELIDKTIVSRNSAIYRFKLKNDDEVLNITPGHNVACC
FT                   MEIDGKDEIRYYSPISNQFDTGFFDILVKSYPTGKISKRFAMLREGQTVKFRGPVGRLE
FT                   YKTNMAKEIGLIAGGSGITPILQVITEIITNPEDQTKISLIFANETHNDILLKSEIDEI
FT                   AKRYPNFDVHYTLTHAPTGWEGSTGFVTKEMVQKHMPSPDAQNKLFICGPPEMKRSLID
FT                   ISAELGWEKGVMKSATEDQVFCF"
FT   gene            <257910..>258968
FT                   /locus_tag="DEHA2A03036g"
FT                   /old_locus_tag="DEHA0A03509g"
FT                   /old_locus_tag="DEHA-IPF10737"
FT                   /old_locus_tag="DEHA-CDS3641.1"
FT   CDS_pept        257910..258968
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03036g"
FT                   /old_locus_tag="DEHA0A03509g"
FT                   /old_locus_tag="DEHA-IPF10737"
FT                   /old_locus_tag="DEHA-CDS3641.1"
FT                   /product="DEHA2A03036p"
FT                   /note="similar to uniprot|Q06494 Saccharomyces cerevisiae
FT                   YPR127w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84427"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ94"
FT                   /protein_id="CAG84427.2"
FT                   /translation="MANTNYQTVKLDDKFGYGTMSLTWTPNPPPFEQSIETIKYVTTSD
FT                   IGTKLLNGGEFYGMEDKELNLKLIKQFLESNDPKLNSELVISIKGGLKEDLAPDGSKEG
FT                   VSKSIENIISYFPQDKAVRPTLIFEAARVDPTVPIAQTVSYIADYVKQGKIDGISLSEV
FT                   GAQSIAKASDEFPISCVEVEFSLLCQDILSNGVLEECSKRNIPIIAYSPIGRGILTDST
FT                   VDNADTFLSSLDKNDFRRLFDKFNPENFEHNMVLVKELHKFAHTKKNTSLESLSLSWIL
FT                   KISGISNFEGIKQVTKILPIPSGSTKERINKNFGEIVDLTDDDLAEIQKICKSHEIKGL
FT                   RYNKHMEALNFA"
FT   gene            <259163..>259867
FT                   /locus_tag="DEHA2A03058g"
FT                   /old_locus_tag="DEHA0A03531g"
FT                   /old_locus_tag="DEHA-IPF10735"
FT                   /old_locus_tag="DEHA-CDS4983.1"
FT   CDS_pept        259163..259867
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03058g"
FT                   /old_locus_tag="DEHA0A03531g"
FT                   /old_locus_tag="DEHA-IPF10735"
FT                   /old_locus_tag="DEHA-CDS4983.1"
FT                   /product="DEHA2A03058p"
FT                   /note="similar to uniprot|Q09176 Schizosaccharomyces pombe
FT                   Splicing factor U2AF 23 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84428"
FT                   /db_xref="GOA:Q6BZ93"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ93"
FT                   /protein_id="CAG84428.2"
FT                   /translation="MSYREDRIICTFYTKIGACRHGEKCSRKHVKPSSSDTILLPNLYQ
FT                   NPKLNKNDGEELNPKQVQEYFDHFYKDIFLKFALFGEVYSMVVCENDNNHLNGNVYVKF
FT                   ANEDSAYNAVMLLNQEWFGGRPVHCELSPVESFHDANCRAYESSTCNRGDHCNFMHIHK
FT                   PTPQLKSSLFKSQEKSTLTKQLQLLRGELTGSSENENVQQDAAGEQISKPAETTSTETV
FT                   EKLFASSIPSHI"
FT   gene            <260034..>261479
FT                   /locus_tag="DEHA2A03080g"
FT                   /old_locus_tag="DEHA0A03553g"
FT                   /old_locus_tag="DEHA-IPF10733"
FT                   /old_locus_tag="DEHA-CDS2468.1"
FT   CDS_pept        260034..261479
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03080g"
FT                   /old_locus_tag="DEHA0A03553g"
FT                   /old_locus_tag="DEHA-IPF10733"
FT                   /old_locus_tag="DEHA-CDS2468.1"
FT                   /product="DEHA2A03080p"
FT                   /note="similar to uniprot|Q08970 Saccharomyces cerevisiae
FT                   YPL224C MMT2 Putative metal transporter involved in
FT                   mitochondrial iron accumulation or uniprot|Q03218
FT                   Saccharomyces cerevisiae YMR177W MMT1 Putative metal
FT                   transporter involved in mitochondrial iron accumulation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84429"
FT                   /db_xref="GOA:Q6BZ92"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ92"
FT                   /protein_id="CAG84429.2"
FT                   /translation="MLKIGLISRSKPSLITLNLRYDNCAFSAGSGFSLRNFSTAYIIRE
FT                   PQITIPKVYQQYLARRNMSTKKDSDSSNHSHGTIDGESKHQHGDEHSHEHSLLGHSHSH
FT                   SRHQPNEFLSVNTDTIKHNPAVRITWIGLLVNVVMAVSKGIGGVYFHSQSLIADAIHSI
FT                   SDMFADFLTLATVNVAQKVGSPTHYPLGYGKIETIGSVLVSGVLLFAGVSVGWSSLLQV
FT                   FEFALPAYMFEYVSMIQIGHSHSHAGLGSGEVGGHSHSHVSDGVSDSSIVANSRPIPNI
FT                   NAAWLAGGSVIVKEMLYRKTMQIAVETNSKVLVANAWHHRVDSLTAVVALLTVAGGNIF
FT                   NVAWLDSIGGLCVSMLIIKAGWDSFKTSIVELIDKGEDAESEVFSKVHDIITDEIKNVA
FT                   NNEFKIEKLSVLNSGAITNVYMTLSTSKEFRLKELNQIESNLVTAIKADYEFVRNIFIL
FT                   FKDSEQQKISQDRSTEHSHENKK"
FT   gene            complement(<261553..>265524)
FT                   /locus_tag="DEHA2A03102g"
FT                   /old_locus_tag="IPF_10732"
FT   CDS_pept        complement(261553..265524)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03102g"
FT                   /old_locus_tag="IPF_10732"
FT                   /product="DEHA2A03102p"
FT                   /note="weakly similar to uniprot|Q03690 Saccharomyces
FT                   cerevisiae YMR012W CLU1 translation initiation factor eIF3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65355"
FT                   /db_xref="GOA:B5RSP9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR027523"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RSP9"
FT                   /protein_id="CAR65355.1"
FT                   /translation="MSSDEASSEALAQEDIKQITLRIKLPACISNEEDLEVPSLLSETL
FT                   ADIRETLNLSAATQNLTNFNVFYQDINLSENFDDLVPLNDILTELGVGEIDSLNLVLKE
FT                   KPYNLAAIYDHLNKFREVIGLHFLDKYSSEVGVLSGVSKFGDIDLQDVKETEPETQDDK
FT                   DKETDETKSTKEDSNQTEEKKSEIVFTAEEKQQIGKITDELISGNTPSLVEFGTFDNIS
FT                   GSIKTPIKSLTVSQWSPVPSFQKLKGDLLYITLQTLENETLNITCHLSGFFVNKSSTIN
FT                   FNPAIKMNENGKVHKDYLLINLVDSLSPSFSKTIQENELVLSRSSKHPESFLIPSNSLM
FT                   SSPWIVNPSKFANQPDASRSQLPLISNGVDGSGFVKEWNEDFQAIRELPNSTINERILR
FT                   EKLLMKSLHEFNKVATETAMNVIKGNLTPLNPNEPKDYHIYLRNGIFYSLGVNATGAFD
FT                   CTGGNEAARYTSSKDLAAIKLLNRIDAKGIYNLVTCIVDYMGQRVICQAPVPGILDSSH
FT                   EDENEEEPTDKVCYGLSTDGSKIFSDSSFENVLKPIAEAFHLKPHPVTLLDNVKSQGDL
FT                   ITSKDIKGVKGTDERKYIIDLYRATPLDIEFIESNWDESKETSYPHRETALRHEAVEEW
FT                   WKRKVSVLFKAETERLEKEGKLESKDGEKPQIVLPSDQITINTDAFTTIDESSDDQNEV
FT                   REVSKFIKEHLIEEFLEENSKQISPFDGNHLTSMLHKQGINLRYLGHIAEQACVRKDEH
FT                   LKKITEARKVNEEEISKRKEESEKKATEGKDQDKEEEKANDNEKNKEDDKEEVSNGEFE
FT                   PIVANFDSLYRISVQEMVARSVKHLLRKISADIPVYLIPAFVSHFHNCLLGSEINSSPE
FT                   CIIDETLKGFYNATELEFTKLNSNKVIALVANEVLIRFRYELPTDWISTLIRPFQLFRE
FT                   IAIKYGIQWKSQEYAFTNEEFEKVKDKLAVETQVFEAKTSKHKKNKKQQSQLITKSVDR
FT                   TTIFVTDDIVNFVPIVKDSTYRSSLVDEIFETARAQIFKGETETGINLLNNLLSVYEQI
FT                   YGRVHPETSKFYGLLSQYYAELGLKSEACNIARKACILAERTTGFDSYESITAYINSAF
FT                   FESTNDDYINALNLYNKAINDWTLVYGDGHPSSVNTYANLAELLSEHKLFQQANKLFEK
FT                   AISISTKLNGEESQICGMLRYRYGGTLLGGGDFKSALDQFKSANDIFTKFIGPDDQLSK
FT                   KSLSFVTNISTYLAYNEHQKSEQKKALAQQASASNGKVKAKSAVEQQLKSSKKGKKNDA
FT                   TQPNPEIASKSVDDILQYIEGKNPKKQLKKKSNNKKSKK"
FT   gene            <266100..>268001
FT                   /locus_tag="DEHA2A03124g"
FT                   /old_locus_tag="IPF_10731"
FT   CDS_pept        266100..268001
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03124g"
FT                   /old_locus_tag="IPF_10731"
FT                   /product="DEHA2A03124p"
FT                   /note="weakly similar to uniprot|Q04511 Saccharomyces
FT                   cerevisiae YML088W UFO1 F-box receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65356"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ0"
FT                   /protein_id="CAR65356.1"
FT                   /translation="MEHGNGVEVDGLGNTIKHVAQSVESSKYITFNDLPNEILIQVFSN
FT                   LDPIQLCSVRLVCKHWNYAVSDKSTWIKSFGLKFGTRQTFPSVSNSKLWISEYLYRLQM
FT                   YKKWKKAIATHKNYQLLNNEYGLVDFALTNFAQDKLLTFARISGDISMCNLNNGKNQTF
FT                   IPGNYLLTQITCYAVNWTYLMVGKLNGELYLKNLITSTSSGSNRSSLIKFEDGENSRND
FT                   TITGCCLNYHFDKRKESIDCISSSIKGSLKCWNLGGKLIKKIELNEPIITVKSDFKNYI
FT                   IAQGQKKTFIIHIRTFEIVSIEMGMSIEEFENSFVDVDYGDSNVVICYESTIKVINFKN
FT                   LGNVRLKEVILPDDVSILESKFQTVPYSKLHNRDSEIAGSDGLMCANILSDDTVIVWNI
FT                   RDSATQIVPQCTITPIFNKHHPAIPNDRTYATSIALNNSVIAIGGYNGFTNLYNIFTGD
FT                   FIRECSIKFPKRLSHMYQHIIPIKDIQLNDSPTSSNGIIICGDAIQYFQFGEPKQQTTT
FT                   TTKKRLNVGPSNKQVVHQNIKDEIDDYENLQEAKHRRELLFAKYNGDKYDDNDDELSIA
FT                   IALSESFQNSNGSKAESVDDDEDAQLKLAIELSKSTETEPVDNDDIEQILKLSLIDQ"
FT   gene            <268209..>272084
FT                   /locus_tag="DEHA2A03146g"
FT                   /old_locus_tag="DEHA0A03619g"
FT                   /old_locus_tag="DEHA-IPF10729"
FT                   /old_locus_tag="DEHA-CDS0182.1"
FT   CDS_pept        268209..272084
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03146g"
FT                   /old_locus_tag="DEHA0A03619g"
FT                   /old_locus_tag="DEHA-IPF10729"
FT                   /old_locus_tag="DEHA-CDS0182.1"
FT                   /product="DEHA2A03146p"
FT                   /note="weakly similar to uniprot|Q02773 Saccharomyces
FT                   cerevisiae YML091C RPM2 Protein component of mitochondrial
FT                   RNase P"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84432"
FT                   /db_xref="InterPro:IPR013888"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ89"
FT                   /protein_id="CAG84432.2"
FT                   /translation="MVFCNFVKRVKYSEKIQFFQSSYPYLKNQNALSQFHQFYNSKWFN
FT                   EDPHPSATPRNFLGIDTGHYGLYFTIFNHDSDKNKRKQHRSSLKYDYDQLAEGNSQHRL
FT                   FDNFTKFIISQANQDIYNNISYLKTVSRDFLSTLSIIRPKFSVNTTRRFSTVAIRNHQN
FT                   NQHHQHQINETAYEELIEDKEEDFESNLLHTQISNIEAIYAKQGPTELNLIYPLYQTLK
FT                   RNCLQLPSIHLYNIVLKSIVERKLDNDARTFENIESRLTNLLTVYQDILVGSSEQVKPN
FT                   KETYEIVLNELLRGSLQTIELGNMSDCPQSVYNESFIKSQEFSQIGIELFMSINKIENL
FT                   DLSMILPQLFSILNVHSNLITKDLFVKILNLNDNVNSESGIYYIGLIGLSRYFSKLQFF
FT                   QSKEEFYNFIVSTYQSYKNNSQAFEKLTLYEYDVYSILVSSLVKSDNFPLATKFLDDIL
FT                   VDYKSSLHSFKSSSISKKQISNLLSAYLDSIMSNNYSRENLNKSYNLLMKFNELSYIPE
FT                   LSVTLYNNMINQFVNQYHILENEKYELAKTSPEKIEALSKLQASYYRIMWNLYSYLAIR
FT                   KDYHHPSDMDSISLILNNKTFNCREYLLSLSIDLGDHEKVFQIIKEILLKNHLIQDTNV
FT                   LKKLNNYLYSGSTNNGFNAYYFELMSNIIENQAVHYANNSKLLNNYVSETINYLLLQNN
FT                   EYNVKLLLKSVMVNETFSDFDLQSDNIYGVSQISKFLIQYINSGIEKVDEPTIFKILHF
FT                   QSLLINEFENTENHYIQLDSEMNEFKGLLKTHFISSMSYYMTIPGFRVTNDIIDACTCC
FT                   DFEISSPYSEVAKNHEVDLDYDLNLAFLLNINYNTGIERFIDFFNKGYKFTYSTWKIII
FT                   NQNFVLTTLEKNTRIGIDEFVNTILQSNFEMHEKNNLLDALIKIENEKVNIHLFKVLLK
FT                   FPSIINNNLLKTFMQAIYASPNQYLATILNENFEYLIEHTDKREWINGYFKYLIKNKNY
FT                   NQINKIVESGYPIHDLSLKSSIDIEILQSIFETFIASKKFNEFNTVFKNYFSTPESNRI
FT                   LMNNMNLINVLIKYYTLNGSFNLVLQKFKPIADQSKDTRNLIEFVEFMQTLSGESRPIE
FT                   ISSFNDSNELAINLMKAADLHSMNEMFQQNKKFNKNSLFGLMMNNYIKAATINDSLSTS
FT                   QLSLVNNFQKSLKFMKLIRFTNISIDNLNLIIKFLAVTKSVDKLSILTNKIIGDNKIAD
FT                   LVNFYFLEFLFTNPTDKLIILQTLRDAFTYLRDPINTYIVNQFCQEQKIDLQDNDFRMV
FT                   LNDSALC"
FT   gene            <272262..>273227
FT                   /locus_tag="DEHA2A03168g"
FT                   /old_locus_tag="DEHA0A03641g"
FT                   /old_locus_tag="DEHA-IPF10728"
FT                   /old_locus_tag="DEHA-CDS4003.1"
FT   CDS_pept        272262..273227
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03168g"
FT                   /old_locus_tag="DEHA0A03641g"
FT                   /old_locus_tag="DEHA-IPF10728"
FT                   /old_locus_tag="DEHA-CDS4003.1"
FT                   /product="DEHA2A03168p"
FT                   /note="similar to CA1925|IPF18587 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84433"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ88"
FT                   /protein_id="CAG84433.2"
FT                   /translation="MPQTHSTAINSYNSNHSSYDQLRPSFSPKIVDQFLVDLGLGSIKD
FT                   NKIVYDNKKKILELAAGTGKFTRNLVDHGWSDQLIVVEPSEGMLKTFDKKFPEIRKFQG
FT                   SSYDIPLPDSSVDSVIIAQGFHWFSDESSLIEINRVLKSTGTLGCIWNFDAPSISQNLH
FT                   HPLPETKILYDNIAPEVESKLSVSNSNNVSLKIKEFFALHPWCVEVSEYIYSFDIKVPQ
FT                   YRHGKWKELLCKENKYFSPISKEIFLLYISRVKPEDVYKYWETRSFITDLNADERLEIQ
FT                   KKVESLVRNVVTENDKTKLNGDNYLEKSMGTHSIVTKVIK"
FT   gene            complement(<273293..>275488)
FT                   /locus_tag="DEHA2A03190g"
FT                   /old_locus_tag="DEHA0A03663g"
FT                   /old_locus_tag="DEHA-IPF10727"
FT                   /old_locus_tag="DEHA-CDS1023.1"
FT   CDS_pept        complement(273293..275488)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03190g"
FT                   /old_locus_tag="DEHA0A03663g"
FT                   /old_locus_tag="DEHA-IPF10727"
FT                   /old_locus_tag="DEHA-CDS1023.1"
FT                   /product="DEHA2A03190p"
FT                   /note="some similarities with uniprot|P53745 Saccharomyces
FT                   cerevisiae YNR059W MNT4 Putative alpha-1 3-
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84434"
FT                   /db_xref="GOA:Q6BZ87"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ87"
FT                   /protein_id="CAG84434.2"
FT                   /translation="MRFSIKRLSTYITTIFGLLFIYLFVNFSNFRIRYSDYMIHYSLTK
FT                   ENFKQSDDITRNSIHYTNYEFSLMEEFSKMHDPATFKKNGLSERCGVFFDFFDKKDKDW
FT                   KLRTFDDATFDKNIVHKNSYFKDELNKLYKTKKNSADPHPDIVTRKENVTINNMFLKRV
FT                   RETKITENLMADSTTLLRIYGQCFINGPNVGHNEELQETFNRYSRKMFPFFTNKLPVFE
FT                   GINDEIIEKSFPNMQNGYNGENYEFDGKNVVDFIKRSSNGKGIVISASSSHVKDLVKLI
FT                   QLLRAMNNEFPIQIVYKGDLNNRAKSNIINAATGEFKDIIDPKNKASSHPESIEASILN
FT                   NTEKYGSKFPKQDLWFVNIRETIKRNYKYSFPGYTNKILALLFTSFKEVILMDADTIPL
FT                   VPLQDFFETQEYKETSTMFFKDRSLRDLNDYLETNYFTKLCPTSVNSMDSLFDVKPITN
FT                   HTLSNPYMTGYRHYQEAGVVMIDKSKHFLGILMMFPLAVWKEPVRSSIWGEKEMYWLGM
FT                   SIAGDENYQFNKYSAASIGEIVTNPKHKHYPDSDASEICSSHPGHVDKYGRLLWINSGF
FT                   KYCKKNTHFRDRNKFPFETFLVEEIANLYDSPLKIKHGIVPPDLPILRRPGSPFELRNE
FT                   NLIKDDWKERTKDMDELSDEESIKHKQKEKVNPQKGWNKNSICSSYQYCAYDIIDSHPH
FT                   NDGSVEKGHKFVFDDELVSEYDYLGSIWINGRTKSSV"
FT   gene            complement(<275688..>276878)
FT                   /locus_tag="DEHA2A03212g"
FT                   /old_locus_tag="DEHA0A03685g"
FT                   /old_locus_tag="DEHA-IPF10724"
FT                   /old_locus_tag="DEHA-CDS3212.1"
FT   CDS_pept        complement(275688..276878)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03212g"
FT                   /old_locus_tag="DEHA0A03685g"
FT                   /old_locus_tag="DEHA-IPF10724"
FT                   /old_locus_tag="DEHA-CDS3212.1"
FT                   /product="DEHA2A03212p"
FT                   /note="highly similar to uniprot|P38219 Saccharomyces
FT                   cerevisiae YBR025c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84435"
FT                   /db_xref="GOA:Q6BZ86"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ86"
FT                   /protein_id="CAG84435.1"
FT                   /translation="MAPKKKVVQEKPILLGRPGNNLKSGIVGLANVGKSTFFQAITRCP
FT                   LGNPANYPFATIEPEEARVIVPSSRFNKLVDIYKPKSEVPAYMTIYDIAGLTKGAHAGE
FT                   GLGNNFLANIRAVDAIFQVVRCFEDADIIHINDEVNPAADLEIVHDELRLKDIEFATKH
FT                   LEGIDKITKRGGQSLEVKQKKEEAELVKKIIQLLEDGGRVANQKWTTKEVEIINSMFLL
FT                   TAKPTIYLVNLSERDYVRKKNKHLLKIKEWVDAHSPGDLIVPISVSLEEKLAGMETDDE
FT                   RDAYCKELGAQSALPKIIVSMRQKLDLISFFTGGPDEVREWTIRRWYTAPQAAGTIHTD
FT                   LERTFILAQVIKYDDLIEYGDEKSVQAAGKLMQKGKDYFVEDGDIIFVKAADGKAR"
FT   gene            <277116..>277448
FT                   /locus_tag="DEHA2A03234g"
FT                   /old_locus_tag="DEHA0A03707g"
FT                   /old_locus_tag="DEHA-IPF10722"
FT                   /old_locus_tag="DEHA-CDS7345.1"
FT   CDS_pept        277116..277448
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03234g"
FT                   /old_locus_tag="DEHA0A03707g"
FT                   /old_locus_tag="DEHA-IPF10722"
FT                   /old_locus_tag="DEHA-CDS7345.1"
FT                   /product="DEHA2A03234p"
FT                   /note="similar to uniprot|P36532 Saccharomyces cerevisiae
FT                   YBR268W MRPL37 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84436"
FT                   /db_xref="InterPro:IPR013870"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ85"
FT                   /protein_id="CAG84436.1"
FT                   /translation="MLSRVGISRSPLILGVFNVRTLMVSSMLRNNEVKSSCKAGTVLNL
FT                   KMRKSGDEPVALEDHEYPEWLWDCLDKEKLDQKLKETDFMKWRRKQITKANTAKINNNN
FT                   FLAKMK"
FT   gene            complement(<277897..>279186)
FT                   /locus_tag="DEHA2A03256g"
FT                   /old_locus_tag="DEHA0A03729g"
FT                   /old_locus_tag="DEHA-IPF10721"
FT                   /old_locus_tag="DEHA-CDS2910.1"
FT   CDS_pept        complement(277897..279186)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03256g"
FT                   /old_locus_tag="DEHA0A03729g"
FT                   /old_locus_tag="DEHA-IPF10721"
FT                   /old_locus_tag="DEHA-CDS2910.1"
FT                   /product="DEHA2A03256p"
FT                   /note="similar to uniprot|P32329 Saccharomyces cerevisiae
FT                   YLR120C YPS1 Aspartic protease or uniprot|Q12303
FT                   Saccharomyces cerevisiae YLR121C YPS3 Aspartic protease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84437"
FT                   /db_xref="GOA:Q6BZ84"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ84"
FT                   /protein_id="CAG84437.2"
FT                   /translation="MFSVNRLFQVWGLFQLAAFAVASDGFVKVDFDVYQGLNLSAALSS
FT                   YSQISRRDGSYDVSLVNERLFYVSKLQIGTPESEVSVLIDTGSSDLWVMSTKNPQCQDN
FT                   GGSIDCEKYGTYNESASSTFHDNKTDFSIQYVDQSYAKGTWGTDTISLNEALKLENASF
FT                   AVADDSDSDVGVFGIGFKGLESNPEQYSNLPITMKEQGFIKKIAYSLYLTSAESESGSI
FT                   LFGAIDHAKYDGELAVIDISKINGDYGYLQIPLTSVSVDVKSNVDSQPSDNTVPSTGSS
FT                   LRSFNNSGAQPIEANNSQALLDSGTTLTYLPDSLVQQVLEQADKNASYSPSAGGYIVSC
FT                   TLRQPDNSMTFRFNDEKDIKVPFSDLVMQSGQDPNTGKAICLLGLLPSQDVILGDNFLR
FT                   SSYTVFNLDDKTISLAQLKQTNDEDIEVIN"
FT   gene            complement(<279954..>282461)
FT                   /locus_tag="DEHA2A03278g"
FT                   /old_locus_tag="DEHA0A03751g"
FT                   /old_locus_tag="DEHA-IPF10719"
FT                   /old_locus_tag="DEHA-CDS0741.1"
FT   CDS_pept        complement(279954..282461)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03278g"
FT                   /old_locus_tag="DEHA0A03751g"
FT                   /old_locus_tag="DEHA-IPF10719"
FT                   /old_locus_tag="DEHA-CDS0741.1"
FT                   /product="DEHA2A03278p"
FT                   /note="similar to uniprot|O13585 Saccharomyces cerevisiae
FT                   YPR089w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84438"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR037986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ83"
FT                   /protein_id="CAG84438.2"
FT                   /translation="MDAWADSSAGMVSLTSPEAGIKGGSHILNYSDPLLAKVIEFKKEL
FT                   QAEVETNIESEESDGKPIVEMMIAACDGDLVTFESVARLHPELINTLYPSENSGISSLI
FT                   YAICFDQYAIAESILTHHNGDPDLHDTLVNNYTPLMWAVYFNQLDMVKLLLNHQADPYI
FT                   SPKDDDKTAITLVTPGKTHIYEFFKNHNLLQNQQNSSLDSDDYYESGFQYQDNSLVDDL
FT                   SNQIKLQSIAATAGYLEDEDHEQPSEDLDEEQRLANDPLLTSLKEFDYEKLSPDQYIKF
FT                   TDSDIPSLLDYIFDLRTKNLSYQHDTKVPAAILFQLLRYSYLKVDSAELSEFLFDCFTA
FT                   RLRSVTNTKSGVFNMATADDNSNSTGSGDIVLLSYWLSVIQFLHFYLTKSGFYSKFPKF
FT                   LQELINLVQSLIATLSFSINSRLNLLIDDCILDFTNLVDVSNVLYAKDWNFFKGKRKFH
FT                   PSTYEDIFDMLYPPSQTELMKPSPIRYIQVLNALDYVLKLHQVNTLIKFQTFSEVFYYI
FT                   NSIIFNRIISQSKYCTRSKAIQIRLNISTLEDWLRSHNYKNYKPDKIGQLSKMLGPEHN
FT                   SIHLSNLLEESNDIKNPHSLSFYYNSLYHIGKTQLQPTIELLQWLQCMSSLTDEESLII
FT                   TINQFDYLNYYQLYKIMHKLYKYEVNEPKLPKALSNLVKNLQNQKGESQVSQRNLHYMT
FT                   QSNFLSKEVYIYLNPNYVFAVALPNLNELINSYGSGIGGVKTLRAKKYQPSLPLSIIDD
FT                   VDDILTQNKNDVNDTFDYDQDNEAAYDDDDEEEEESERSAKNVSVSQKSSSFKGDELFK
FT                   EVQLPGSLAHKNWGDDDIESNPW"
FT   gene            <282668..>283537
FT                   /locus_tag="DEHA2A03300g"
FT                   /old_locus_tag="DEHA0A03773g"
FT                   /old_locus_tag="DEHA-IPF10718"
FT                   /old_locus_tag="DEHA-CDS4332.1"
FT   CDS_pept        282668..283537
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03300g"
FT                   /old_locus_tag="DEHA0A03773g"
FT                   /old_locus_tag="DEHA-IPF10718"
FT                   /old_locus_tag="DEHA-CDS4332.1"
FT                   /product="DEHA2A03300p"
FT                   /note="some similarities with uniprot|Q06815 Saccharomyces
FT                   cerevisiae YPR079w MRL1 Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84439"
FT                   /db_xref="GOA:Q6BZ82"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR028927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ82"
FT                   /protein_id="CAG84439.2"
FT                   /translation="MSRLYQRLGLFAIFLVVCLGLYLIKQSEPNGTLTENGAHLFDTVA
FT                   HLSLHDNSAKGKVGANVASKQTAEENKKMQEKHKADLALELEPCTVMSPLSHHFIDLSS
FT                   LSSKGNEGRAMPWASKGYDSGLNFTLGVCSSPFKKTHDANDEVKDITNSSAVGGYYIDP
FT                   KTGKYVSIGEYSSKPVVRGKKITLSYTGGSYCENMYNKETGEKVRKSTILTFTCDREML
FT                   AKASVSYVGSFNDCSYIFEVRSHHACPTAAKADNLAVIWIFFFILLAALLVYFSGGLIY
FT                   KQIKLQKS"
FT   gene            complement(<283697..>286522)
FT                   /locus_tag="DEHA2A03322g"
FT                   /old_locus_tag="DEHA0A03795g"
FT                   /old_locus_tag="DEHA-IPF10717"
FT                   /old_locus_tag="DEHA-CDS0528.1"
FT   CDS_pept        complement(283697..286522)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03322g"
FT                   /old_locus_tag="DEHA0A03795g"
FT                   /old_locus_tag="DEHA-IPF10717"
FT                   /old_locus_tag="DEHA-CDS0528.1"
FT                   /product="DEHA2A03322p"
FT                   /note="similar to uniprot|P32074 Saccharomyces cerevisiae
FT                   YNL287W SEC21 Gamma subunit of coatomer"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84440"
FT                   /db_xref="GOA:Q6BZ81"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="InterPro:IPR032154"
FT                   /db_xref="InterPro:IPR037067"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ81"
FT                   /protein_id="CAG84440.1"
FT                   /translation="MSTQSYKKQDPYSISSSGLPDKMTVFQECLQQFNASPVNAKKCRQ
FT                   LLAKLLRLIYHGEQFPSQESTTLFFSISKLFQHKDLSLRQLVYLAIKELSATSQDILMV
FT                   TSSIMKDIQSGDLIYKPNAIRTLSKVLDPSTVSASERLFKNCIVDKNPTVSSAALISSY
FT                   NLLPIAKDVVKRFTNETLETVNSFKQFPANQFQLHEYYGSSTTNLPSTSYMYQYHALGL
FT                   LYQLRNHDKMALMKLITSLSEGSSLKNSLSVIQLIRYINKILTDDESLLQHLLPILSGF
FT                   LKHKSDMVGLEACKTLVGLQHLIKDDDFMKIIDTLQKLLSVPRTATRFAAIRLINRISI
FT                   KHPEKIMVVNLELENLINDSNRSISTLAITTLLKTMGSNTIESNTGGENVDRLISKMTS
FT                   LMDEITEDFKIVIIEAIENLALKFPSKHKKLVAFLTDLLRDDGSLQLKSSIVDALFDLI
FT                   KFLPDVSAKQLILMNLCEFIEDCEFTELSVRILHLLGDEGPTTTNPSYYIRHIYNRLVL
FT                   ENSIVRSSAVISLAKFAVVCKGEVSRNIQILLNRCLIDVDDEVRDRASISLRFIENSKE
FT                   ELIVTDSKYDLSILENKLTNYLNDESNFDKKFDISEIPMISTEEQRSIEYNNKINKLES
FT                   SSTTEVSEKDNHKNKSSKKESDNDKQTGDDSASGLLKQQAYAQELSTVPEFADYGKLSK
FT                   STSTPIYLTDKENEFVVTVVKHFFIESQKLVLQYNITNTLTHLVLQDVSVIAQPDNELY
FT                   QEDFIISLQELRPEQTGNVYVSFSAPSIDDEELISAFGNTLSYTNREIIDEEGNIDESD
FT                   EGWSDEYQIEDLEISPGDFISPLYNSNFTSIFDQLPSEESFVVNLTNAKTLENAAIKLK
FT                   SNLNMMPLDGSDYVPSDATSHVLKLLGKDLWGGKVGVSVRLALAGGKVVAKLQVKSETE
FT                   NLTKVVADGTS"
FT   gene            <286723..>286974
FT                   /locus_tag="DEHA2A03344g"
FT                   /old_locus_tag="DEHA0A03817g"
FT                   /old_locus_tag="DEHA-IPF10715"
FT                   /old_locus_tag="DEHA-CDS7712.1"
FT   CDS_pept        286723..286974
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03344g"
FT                   /old_locus_tag="DEHA0A03817g"
FT                   /old_locus_tag="DEHA-IPF10715"
FT                   /old_locus_tag="DEHA-CDS7712.1"
FT                   /product="DEHA2A03344p"
FT                   /note="similar to uniprot|O14464 Saccharomyces cerevisiae
FT                   YPL183wa"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84441"
FT                   /db_xref="GOA:Q6BZ80"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ80"
FT                   /protein_id="CAG84441.2"
FT                   /translation="MFALSSIIKRQVVGPTVGRALFNATPKLTVPAVNNSPLSLNSIRG
FT                   FKVRTSVKKFCKDCYMVRRKGRVYVYCKSNGKHKQRQG"
FT   gene            complement(<287076..>289055)
FT                   /locus_tag="DEHA2A03366g"
FT                   /old_locus_tag="DEHA0A03839g"
FT                   /old_locus_tag="DEHA-IPF10714"
FT                   /old_locus_tag="DEHA-CDS1295.1"
FT   CDS_pept        complement(287076..289055)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03366g"
FT                   /old_locus_tag="DEHA0A03839g"
FT                   /old_locus_tag="DEHA-IPF10714"
FT                   /old_locus_tag="DEHA-CDS1295.1"
FT                   /product="DEHA2A03366p"
FT                   /note="similar to CA1933|IPF18586 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84442"
FT                   /db_xref="GOA:Q6BZ79"
FT                   /db_xref="InterPro:IPR018857"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ79"
FT                   /protein_id="CAG84442.2"
FT                   /translation="MSLSNIPSMSNNNGRGRTKVATGTTQPNKKSHTKLKSHNRSYSHN
FT                   KVLNKLSTSSTPLVPTMGSRPNLNRSKSTDGLIRPTNRYGALKKNSRSFTKLASLQPLT
FT                   KTISNQSIKSNKSTGSLKGMNTAHHLSGLKTSGRKGKAILKLNDNDNDNNDYEDMENDS
FT                   SHNDNAAENINRNENSRDERALSTSFTNYENENDKQEIKGPSQLPLERSSSAQSSSDDL
FT                   VTNSNMYGGSLLLSQSTGLTRKINSAYNNNSSASPILTHKTADTHESSMGSTNSESVSG
FT                   ISFKANPMDNVNKSQNNVAEPVITNKNVIQDNSYQPNQTIFSNLQRNNQAQSNSNKVTD
FT                   QNGSSSNNAISNDQSLQSYLQQANQPQHNIETRTQQRLWLQRENSLMDVVNVDPNRSNF
FT                   SSLSLNNMMFAHSYNQSQQNIRDISQTSNQVTGPVTPQSETTPYEMSHNNSVNAITANN
FT                   APQPGNDQSNSMSNINGLLTMVQNSHQNSIQSRTEFERLNREYLNVRRHLNPIGESLNR
FT                   VEQIMKNTKEIKVAKKNSHKKSSSVSSIHSNSTNANTFKEFSPSFQEKEQEISSTLNKL
FT                   WQEALILTSSSTSSTNSIRVNPPQPSQQPIQTQMQRSHNPRVPSYGQSPYSNLRSPQTP
FT                   TTRAVKLAAQAQAANTKRLNESHN"
FT   gene            complement(<289221..>292644)
FT                   /locus_tag="DEHA2A03388g"
FT   CDS_pept        complement(join(289221..292577,292627..292644))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03388g"
FT                   /product="DEHA2A03388p"
FT                   /note="similar to uniprot|P53010 Saccharomyces cerevisiae
FT                   YGL094C PAN2 Essential subunit of the Pan2p-Pan3p poly(A)-
FT                   ribonuclease complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84443"
FT                   /db_xref="GOA:Q6BZ78"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028881"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR030843"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ78"
FT                   /protein_id="CAG84443.2"
FT                   /translation="MEGWGEISRIAATASSSVIDNSKITSLQFDNQQNLLWCGDSKGTT
FT                   RSFTPQSTSIPMPYPALHLSQYSKFKTSLGTSPVKQYLNHQKGILSLSHNCVNFNNRRG
FT                   LTQLSLNSESLKEPGFNNLSCMTFNSNTNNDLVIAGDSLFKVDLLKPNMTTSFNHTGKV
FT                   SMIDNTLNYLTLGKSNGEIEIFDPVSNQTVKSFYGHNGLLSDIDVQGNYVASCGYSLRP
FT                   RRNQASQSSYMIDPLVNIYDLRMMRSLPPIPFSAGASFVKFHPKLPNIMIIASSLGQLQ
FT                   FVDIYDQSNVYLYQADLSNVNASTPTTSSNTYLANLEVSGNGEFITFSDGFQNLHLWSF
FT                   KNNNSKNFINFPSYLEQPDFSPPFQQNHINVDDVVPLSSIGMPYYKDLLLSNYASDLHF
FT                   TKELSKLPNHLDPELLQNQYSQVLPYNTLKYGKRNLNKFYVPLQNNVSTKQKLFPKFIS
FT                   EKNGHDSFDNENSNIFEYKLSNKFEVPNCYSNLKIQYSKFGVEDFDFSFYNRTKYSGLE
FT                   NHLDNSYINSLLQLYKYSPVFQNFIIKHLLKEWLPNDLTTIIQNGNPQGSSILNELGYI
FT                   FDMMNKSHGKNCKTSNFSNVLSQNQVAQMQELINKDDCKNLNAFEIRAIIGKFNKFLLS
FT                   TCNNDLLNQFNTSLSEITNIGYEIEIKSNGCNINNVNYNSQLTVDLMSPPINKLSILIS
FT                   ANSTSATKKNLNILNYLDYSMNQFKTIKCQQCNNSFPHLLEIRQSLVHLPPVISINVNF
FT                   TGQEFNLIQNFPNWLVPEFYTYGMNNKVSFKLHSNDNLSNKYELLGYVCEINVGSEFLK
FT                   GKHNLVSYIKIESKWYLFNDFLVMPIPESEVFDLSYHWKKPIIVMYQLANHADFGSFQQ
FT                   QSFAQLPDLNDSILYRDHFAGGIRDSIKREYELLTKDEAPNAGTLIAIDAEFVALNPEE
FT                   LEVHYGGVRNLIKPRNLSLARISVLRGDNGPKQGVPFIDDYIIHTCFIDDYLTSFSGIE
FT                   PGDLDPSSSTKTLTTLQTSYRKLWLLLNLGCIFVGHGLQNDFRCINLHVPKNQIRDTAD
FT                   FFYLPELKRKLSLKFLAYILLKEKVQTGNHDSIEDANTALLLYKKYLELTAIGEFESTL
FT                   HRIYMDGQQLRFRVPDS"
FT   gene            <293041..>293364
FT                   /locus_tag="DEHA2A03410g"
FT                   /old_locus_tag="IPF_10710"
FT   CDS_pept        293041..293364
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03410g"
FT                   /old_locus_tag="IPF_10710"
FT                   /product="DEHA2A03410p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65357"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ1"
FT                   /protein_id="CAR65357.1"
FT                   /translation="MSYFVKQCKMSVLCLLTRETVSKVPLHIFYSCPYKYTDFLDYGLD
FT                   PLSVSKRRLYVFAYKRKLTIFNSSNANMDMSKEHSGKFRTIFGCILQVTYWYKRNQLLQ
FT                   NVL"
FT   gene            <294173..>294571
FT                   /locus_tag="DEHA2A03432g"
FT                   /old_locus_tag="IPF_10708"
FT   CDS_pept        294173..294571
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03432g"
FT                   /old_locus_tag="IPF_10708"
FT                   /product="DEHA2A03432p"
FT                   /note="weakly similar to CA2078|IPF13352 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65358"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ2"
FT                   /protein_id="CAR65358.1"
FT                   /translation="MLKTLFPSWYKKPIIPAEEIPKKFITNEDKQAVQYTMNDKDSFVD
FT                   INYKNLSYAEVAALSKSKPMVSKVKKTSKPAKHTNTNYKILTNLGHDDDLADSIVLPEK
FT                   FKSDIHYKKSKQFKQPSPRNKRNNAVAV"
FT   gene            <295094..>296677
FT                   /locus_tag="DEHA2A03454g"
FT                   /old_locus_tag="IPF_10706"
FT   CDS_pept        295094..296677
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03454g"
FT                   /old_locus_tag="IPF_10706"
FT                   /product="DEHA2A03454p"
FT                   /note="highly similar to uniprot|P20447 Saccharomyces
FT                   cerevisiae YGL078C DBP3 Putative ATP-dependent RNA helicase
FT                   of the DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84444"
FT                   /db_xref="GOA:Q6BZ77"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ77"
FT                   /protein_id="CAG84444.1"
FT                   /translation="MSKDHKDKKRKHSDEATEEVEKKTKVSKKEKKDKKEKKEKKDKKE
FT                   KKDKSEKKDKSEKKEKKEKKESEDVPTKSSAVVSTGYSQSPALTKLPQSEIDSFLQENE
FT                   VTVEDPHNLGLRPLLGFDQIDLDSRIASVISKFPTPTPIQAVSWPYLLSGKDVIGVAET
FT                   GSGKTFAFGVPAINNILTHDKKGLKVLCISPTRELALQIYDNLVDLTANTPLKCVAVYG
FT                   GVSKHEQVSSLRNASVVVATPGRLIDLLNDGALSLDSIEYLVLDEADRMLEKGFEQDIK
FT                   SVMQQTNHANRQTLMFTATWPKEVRELASTFMNSPVKVSIGDRNELSANKRITQIVEVI
FT                   EPYDKEKKLLSLLRKYQSGSNKDDKVLIFALYKKEATRIENLLVRNSFKVSAVHGDLSQ
FT                   QQRTSALGAFKAGKTTLLLATDVAARGLDIPNVKVVINLTFPLTVEDYVHRIGRTGRAG
FT                   QTGIAHTLFTEHEKHLSGALMNVLRGANQPVPDELLKFGGHTKKKAHSAYGAFFKDVDM
FT                   TKTAKKIKFD"
FT   gene            <297033..>298718
FT                   /locus_tag="DEHA2A03476g"
FT                   /old_locus_tag="IPF_10703"
FT   CDS_pept        297033..298718
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03476g"
FT                   /old_locus_tag="IPF_10703"
FT                   /product="DEHA2A03476p"
FT                   /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
FT                   YML130C ERO1 Glycoprotein required for oxidative protein
FT                   folding in the endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65359"
FT                   /db_xref="GOA:B5RSQ3"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="InterPro:IPR037192"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ3"
FT                   /protein_id="CAR65359.1"
FT                   /translation="MKFSMVATMVFLSQLLLVSGSISLAKFSPFDSPDFCSQIITPTCN
FT                   TTFSYIDRLNEQIRPYLTSLVETPYFRYFKLNFDKQCKFWDTQHFCATENCAVEILPPS
FT                   QYNWSNISNDNLKPSKLGQIKRPESTGLADDSASGAETCEDFDYCHIDDDHQCVYVNLL
FT                   DNPERFTGYGGSQSYDVWKAIYSENCFPNTNPMSMKDVNAEPEQCVEKKLFYRLISGMH
FT                   ASIAVHLSNEYLSPGSGNFEPNLKVFMERVGSFNDRLSNIYFNFALISESIVKLSNFPK
FT                   LLDTIDHGDDFNQHFLSNSDQNYKQLLSNIVPELSSNLLYNSSTLFNPEVVSPTLKDEF
FT                   RARFKNVSAIMDCVGCDRCRMWGKLQTIGYGTAFKILFEGDNIDKLKFRRIELVALFNT
FT                   FDRLSKSIEAINNFKQMYLAHLEDVKKGLVKPGDYEKADAKENGGLDFPFLSSVNFGQD
FT                   TDKSTKEKTSNSEDLKPAGTSAAKKQPMTFKEEFNKALLEVIDAFFFVITSYKRLPKTI
FT                   YNISLFKLNHWWNIFIGREEYNQYMEYQLLQNKEQNDYINLFSN"
FT   gene            complement(<299028..>299561)
FT                   /locus_tag="DEHA2A03498g"
FT                   /old_locus_tag="DEHA0A03927g"
FT                   /old_locus_tag="DEHA-IPF10702"
FT                   /old_locus_tag="DEHA-CDS5629.1"
FT   CDS_pept        complement(299028..299561)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03498g"
FT                   /old_locus_tag="DEHA0A03927g"
FT                   /old_locus_tag="DEHA-IPF10702"
FT                   /old_locus_tag="DEHA-CDS5629.1"
FT                   /product="DEHA2A03498p"
FT                   /note="similar to uniprot|Q12127 Saccharomyces cerevisiae
FT                   YLR110C CCW12 Cell wall protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84446"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ75"
FT                   /protein_id="CAG84446.1"
FT                   /translation="MQYQLLSVAALVASVAAQTTEYAIDTVTENHTTDVTITQCSSHKC
FT                   DTTVQQQTQTTITTTVDGVKTVLTTVCPLTESGAAAPTSAAGENNEVAPESASESDSYV
FT                   DVTVTPTVTASTGVEATVTSQATFTSVYNSNGTASSSLEAANTADVSAYEGKANGQQAM
FT                   VGLAGLAALAAVLL"
FT   gene            complement(<300113..>302968)
FT                   /locus_tag="DEHA2A03520g"
FT                   /old_locus_tag="DEHA0A03949g"
FT                   /old_locus_tag="DEHA-IPF10700"
FT                   /old_locus_tag="DEHA-CDS0518.1"
FT   CDS_pept        complement(300113..302968)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03520g"
FT                   /old_locus_tag="DEHA0A03949g"
FT                   /old_locus_tag="DEHA-IPF10700"
FT                   /old_locus_tag="DEHA-CDS0518.1"
FT                   /product="DEHA2A03520p"
FT                   /note="similar to uniprot|P05085 Saccharomyces cerevisiae
FT                   YML099C ARG81 Zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84447"
FT                   /db_xref="GOA:Q6BZ74"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ74"
FT                   /protein_id="CAG84447.2"
FT                   /translation="MVSIVTNKGDSTKGEEIIEKRSSTEIEEEEASGKTKVNGGEYPGK
FT                   QKRSKTFTGCFTCRSRKIRCDLTKPHCRNCSKTGLVCAGYDIKLRWSQPLQFSNKKGNS
FT                   KSSSVVFNKKNEGDDENANPEFFQRRSVGFVKWDKPYETYDEMDRVLGILHNSGNDNMV
FT                   NAENKTKLLGPFGVFKSSKKRAGTEDLKLTKRKNAGPNYLNAYAASTNPKQTADIEKST
FT                   PIATGDDSAPHDQLWLSNELRDDALLTAAALNGDSQFLDFMNNLSPTNNQMLTTGSNTN
FT                   SRASPNINNYNFSGNQNDFLNLVFHRHNNFYGNNYANNNANSDSNTPVPVTDNQSSTNT
FT                   AMSNLLNENDGSKTIDPSNQHLYYSNYNTYYYNNPYQLNENLEIQLHASKMPNPTEEES
FT                   TDIIEGDHTNTTQMPASIMCIVQRPLQPKLGFDLTIPSINNSTTMGLPTTALQVQPLTR
FT                   YLLNYYNTQVADLMTVIPLTENPWKTVYFPRALMAIGELSALGKTSNAKNALLNALLAV
FT                   SAFNLQSKFPKNSDPMKYYLNLGIRLRNQASLFVKSLLGSNIDSKSGIESCVLNEKYKD
FT                   VLCAVMSMISVDLVWGTMQDTNLYIRWCGKVITAKMVNKKKLSSRARILHRIFSSLKLI
FT                   QDSTCLDLDNIKDDYETINESGYDVNGDKFFNTLRQNSKSSGKGKIEFIVNNVEQSNIA
FT                   GNNQMKNTSPLFVNKKLINTKKNDENFATDALYGLPNSLILLFSETVQLLRTKIYHQEI
FT                   YQDLPINFQQAVNNLEEKLLNWRLDWKLFETDNKDVNDIKAQSERQEEPDEESTRKQDE
FT                   VDKKFTSPMHEATYHHILSFYYALTIYFNRLINAVPPEEVQPKVEKTLEHLNAIQALIA
FT                   KDEAAIIPLFWQGFIAGCEATSNDLQMGFKKWGADIAQYLGSYWGARQIMLEVWRRKRM
FT                   NEPRDDWVSVIRDWEMNLMLN"
FT   gene            <303396..>305180
FT                   /locus_tag="DEHA2A03542g"
FT                   /old_locus_tag="IPF_10699"
FT   CDS_pept        303396..305180
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03542g"
FT                   /old_locus_tag="IPF_10699"
FT                   /product="DEHA2A03542p"
FT                   /note="similar to uniprot|P43550 Saccharomyces cerevisiae
FT                   YFL053w DAK2 Dihydroxyacetone kinase 2 or uniprot|P54838
FT                   Saccharomyces cerevisiae YML070w DAK1 dihydroxyacetone
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65360"
FT                   /db_xref="GOA:B5RSQ4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ4"
FT                   /protein_id="CAR65360.1"
FT                   /translation="MTLAKHWKFNKDEDIVLSNLKGLCHSNPAVGLIPSEKVIYNLNSD
FT                   TSKKVTLISGGGAGHEPLHGGFVGENLLDAAVSGAIFASPSTKQIMAAVKTKSNKDKGT
FT                   LIIVKNYTGDVLHFGLVVERAKSEGYNIDILPVSDDVAVGRRQNEMVGRRGLAGTALIH
FT                   KVLGASSSDGSDLKSIAELGHLVNDNLVTIGASLDRTSVPGKAGEEVEFTGPDEAELGL
FT                   GIHNEPGHKMSPIPNIDDLVKDMFNKLLSPEDKDRHYVDFDLKNDEYILVINNIGGTSS
FT                   FELYAIAEHVVSNLPLSKRPKRILISDFVTSLNSPGFSITLLNLSNIAKSNSKYSESKV
FT                   LGYLDLPTDAPGWKPKSFDAKQWSNESKYIDSPMIHEQRVTSSLKMDSGLFEKALTSAL
FT                   QKLLKAEPDITHYDTLVGDGDCGETLAKGANAILDALKNDKSFKDNLSDPASTLSTITE
FT                   IVEDNMGGTSGGIYSIFLTALVKHIQDAQEITTEALGKAFHGALYDGLFKYTKARTGGR
FT                   TLVDTLQPFVDSFSKFGNVQEAVKAAKKGCEATKDLQAKFGRASYVSDEEFKDGEIPDP
FT                   GAIGLLAIIEGYAEALSK"
FT   gene            <305302..>307182
FT                   /locus_tag="DEHA2A03564g"
FT                   /old_locus_tag="DEHA0A03993g"
FT                   /old_locus_tag="DEHA-IPF10698"
FT                   /old_locus_tag="DEHA-CDS1484.1"
FT   CDS_pept        305302..307182
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03564g"
FT                   /old_locus_tag="DEHA0A03993g"
FT                   /old_locus_tag="DEHA-IPF10698"
FT                   /old_locus_tag="DEHA-CDS1484.1"
FT                   /product="DEHA2A03564p"
FT                   /note="some similarities with uniprot|Q8YN46 Anabaena sp
FT                   all4724 All4724 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84449"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ72"
FT                   /protein_id="CAG84449.2"
FT                   /translation="MSEFKSYDIYKEDFFEAIVIGGGTCGLAVSARLCEDYPGSIYTED
FT                   EHQRFRWLKQRGNKVNLINHNVSSKTKFKPVPKGSAYTSPKKFHPSEILVLDGVSNKFL
FT                   GQWDNQFARCQIPYLRSPMFFHPDPVNVDGLVTYSHFVKRDSPKDLMKIENVVGKEYSK
FT                   HQQKKLLNKNSKKKQFKDPIPTQKFGQFSDKPGLIDINMRDWKDYYRPSTPLFRDFCQD
FT                   IINRYQLHDVVRKDEVESIEYCFINIIDEGEAGMGFIIKTPSKVFGCKICVLASGHAGE
FT                   INYPISPFETKSQFPEGSCHTTHIFSGTVKFPHDRIIEKVSQRKGTSIVIVGGGLTSAQ
FT                   MAHVAILSGVEKVYLVLRGALKIKHFDFHLDWVTKYKNVKKSAFYVKDTDEERYDMIQE
FT                   AREGGSINPEYYKKLKMHIKSGKLEIFKHSTVEDKEWNAGSKLWDLTINSRSETKNTID
FT                   ESDIFYGTNLSNIDYIYYATGISANIKSLPCLKPIIEAYNIETVKGFPCLTDNLQWNDE
FT                   IPLFVVGKNASLRMGPSSANLDGARLGAERIGWYIQELKSQGKFDWNSKECKYCSYTES
FT                   VDDSDDSLDDKLDKLSTNSDKESEIELTSFETQLKLACGELNWFSLLQEV"
FT   gene            complement(<307210..>309375)
FT                   /locus_tag="DEHA2A03586g"
FT                   /old_locus_tag="DEHA0A04015g"
FT                   /old_locus_tag="DEHA-IPF10697"
FT                   /old_locus_tag="DEHA-CDS1064.1"
FT   CDS_pept        complement(307210..309375)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03586g"
FT                   /old_locus_tag="DEHA0A04015g"
FT                   /old_locus_tag="DEHA-IPF10697"
FT                   /old_locus_tag="DEHA-CDS1064.1"
FT                   /product="DEHA2A03586p"
FT                   /note="some similarities with uniprot|P40971 Saccharomyces
FT                   cerevisiae YDR034C LYS14 Transcriptional activator involved
FT                   in regulation of genes of the lysine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84450"
FT                   /db_xref="GOA:Q6BZ71"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ71"
FT                   /protein_id="CAG84450.2"
FT                   /translation="MSTRILKFDNEKKKKKRDYSKNGCRECKRRKIKCDEAKPACWQCK
FT                   RLKKSCSYPEVGERVLRASRKLMDNYDSYRAPEGSMPFNTCGHHTTVDTHINPNIRDNQ
FT                   QQTAAYIQPQSNIRELYPPRLAPPSMLNLLNDTHQRIDRDGNGTSSTVEIPERKSQSSS
FT                   STISNDPNNFQNLSEERSGSSYATPATGHPIDNNNMLLLTSDGFYDNPEDLNLLATDLN
FT                   DIVNSFMFEANFDTKMHDNDFQSVDTFFDELISKDKEPDGELNMNTNTNEEFDEPIPRH
FT                   IPIDFIKVKTKREEKYLTGFYDIFAEIILPFNSYDDKVKAFFNPLRDILLKCASGEPFL
FT                   LAGILASGAKACFEKTNLPEDEEAFFKYLSKCLKMLEPSLKNRDDKDKKLWASNIDSVL
FT                   ITVLLLTGINALSSKQEWRPHLRGAKDILLRYSSNSLKYPRLRNSKLMIFCKFMFASYE
FT                   TLAGLSSKFGGTLKESEVDLLICAGDPHEIKALRDLGIVRDDGFNLLCGYHNSCIPHLR
FT                   DLIKILNKARSKGNKFKPDDTFEYIRLISEFHAQTNIEFVTKKYFLQPSDFKDGIIPDN
FT                   LLLETVMINNVEHVISWMDICHQIYALASLMIIITHCFQLSYKSAQVQSLICKLMEPMV
FT                   FLESYSEDLSSKKVCVMMLQWPMYIAGINCISEEHKQLIMKCFNISTEAGSRSADLTLK
FT                   KIKKIWDLHTNNREWNVDDDDIDIVTY"
FT   gene            complement(<310101..>312029)
FT                   /locus_tag="DEHA2A03608g"
FT                   /old_locus_tag="DEHA0A04037g"
FT                   /old_locus_tag="DEHA-IPF10694"
FT                   /old_locus_tag="DEHA-CDS1390.1"
FT   CDS_pept        complement(310101..312029)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03608g"
FT                   /old_locus_tag="DEHA0A04037g"
FT                   /old_locus_tag="DEHA-IPF10694"
FT                   /old_locus_tag="DEHA-CDS1390.1"
FT                   /product="DEHA2A03608p"
FT                   /note="some similarities with uniprot|P10961 Saccharomyces
FT                   cerevisiae YGL073W HSF1 Trimeric heat shock transcription
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84451"
FT                   /db_xref="GOA:Q6BZ70"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR027729"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ70"
FT                   /protein_id="CAG84451.2"
FT                   /translation="MVRMSSYDDDPIIEIFDNDNSDDIQVINRDNTQYDQNLMNSTGNT
FT                   PHNYYNDIYDNSQHEHTQQNRQHQPQEQLSSLSSISQSQAETHSNQQEPSGLTPILSSN
FT                   DYNQLTTVSQPKYTTSLPPLAPLSESVIPNNLNIPPTLSLPKASESQDKKTNTVTTTTK
FT                   KRKEASSSKTRPAFVMKIWSMVNDPANHDYIRWNDNGKTFQVFHREEFMKLILPKYFKH
FT                   NNFASFVRQLNMYGWHKVQDISNGTLNKDDKSNDEIWQFENPYFIRGREDLLDKIVRNK
FT                   TISQESDHLEAGNLNFQSVLNELDQIKVNQFAIGEDLRRVRNDNKTLWQENFLTRERHQ
FT                   QQAQTLEKILKFLAAVYGNSAGKLLEVDNGSIGLDDFNSNNQMTTYNYQQPPQAHNQAP
FT                   HQPIQVPSMTDQPSQPPSPFNRPRLMLMDQAYQKSPSNNPSPRETAQRNSNSGSIEEII
FT                   RSYENTPNDSPNSNVNKIYQQLMNNEPGVSSPRHYFPELNSQNNSYFGVPNTPGQQYIK
FT                   SGTPLGSSNNTSEVMNGLEQNIFKQGQSIQQVQDWIQKLAAQQQQQQQQQQQLQNLQSL
FT                   HQNHKQNSDDYEKPDIDEFDVNEFLDNSNASNSQASNSVNSDSNDASSNKRSIDEVNDG
FT                   NAKRKKQ"
FT   gene            complement(<312400..>313908)
FT                   /locus_tag="DEHA2A03630g"
FT                   /old_locus_tag="DEHA0A04059g"
FT                   /old_locus_tag="DEHA-IPF10693"
FT                   /old_locus_tag="DEHA-CDS2321.1"
FT   CDS_pept        complement(312400..313908)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03630g"
FT                   /old_locus_tag="DEHA0A04059g"
FT                   /old_locus_tag="DEHA-IPF10693"
FT                   /old_locus_tag="DEHA-CDS2321.1"
FT                   /product="DEHA2A03630p"
FT                   /note="some similarities with uniprot|P35192 Saccharomyces
FT                   cerevisiae YMR021C MAC1 Copper-sensing transcription factor
FT                   involved in regulation of genes required for high affinity
FT                   copper transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84452"
FT                   /db_xref="GOA:Q6BZ69"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ69"
FT                   /protein_id="CAG84452.2"
FT                   /translation="MILIDDVKYSCIECIRGHRSSSCRHHTRPLLQVRSKGRPNVHANG
FT                   NPNHRIAVFAEEIDKNDNSGTGHGKGNCENKKIPVVILKASPKHVIDLNNGQIIGPYQD
FT                   DITIDESSKPPLPIINSNSFINTTSCCLNGISKPKKSCGCCSNKTNKNINKSKILKTYL
FT                   KKHMKPENERKFIDYSKSIQIKNENDDEDEISGNEHSVIIDNDNNKDNDKINSGNDNLL
FT                   FDVVKIPSCSIPGSCGCDSNCACEGCFVHGNVSMNNLNNNQFSNLMNYANNNEIKMPHE
FT                   IMSNYANKLSEMTNSQVENNISRGVTNSDTDINNVFANDILDTHNGTQNVHSLSQLGNI
FT                   QNGDSLISNANTTSNNQTPNNYTNLVNDHMYTLQTDLAQQQPTNQNHSQKPIQRPLQGY
FT                   TQGEHQVEKYIESNVCSCSNDCDCFNCETHGIINGMKLDDLFNHMMPGDYKDLINSIGD
FT                   GTNTSNNSTDTPIIHSSSENVSSNSSESLDVNSGNGKTSNCCRK"
FT   gene            <314772..>317837
FT                   /locus_tag="DEHA2A03652g"
FT                   /old_locus_tag="DEHA0A04081g"
FT                   /old_locus_tag="DEHA-IPF10689"
FT                   /old_locus_tag="DEHA-CDS0418.1"
FT   CDS_pept        314772..317837
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03652g"
FT                   /old_locus_tag="DEHA0A04081g"
FT                   /old_locus_tag="DEHA-IPF10689"
FT                   /old_locus_tag="DEHA-CDS0418.1"
FT                   /product="DEHA2A03652p"
FT                   /note="similar to uniprot|P40825 Saccharomyces cerevisiae
FT                   YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84453"
FT                   /db_xref="GOA:Q6BZ68"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ68"
FT                   /protein_id="CAG84453.2"
FT                   /translation="MKVAYLLTQWTLWYSEICSIHPNLVNVIETKLTHTRPLKKLSIFL
FT                   YGVHQRVISSQIKFMLKTLVHKRIMSTSSNNWPASRVRSTFLDYFKVKQNHTFVPSSSV
FT                   VPHNDPTLLFANAGMNQYKPIFLGTVDPASDFSTLKRAVNSQKCIRAGGKHNDLEDVGR
FT                   DSYHHTFFEMLGNWSFGDYFKKEAISWSWELLTEVYKLEQDRLYVTYFGGDEKQGLQPD
FT                   LEAKNFWLAVGVAEDHILPGNLEDNFWEMGDQGPCGPCSEIHYDRIGGRNASSLVNMDD
FT                   PNVLEVWNIVFMQYNREPDSSLRSLPAKHIDTGLGFERLVSILQNKSSNYDTDVFQPIF
FT                   NKIREITGVRPYTGKFGSEDRDGIDTAYRVIADHVRTLTFAITDGGVPNNEGRGYVLRR
FT                   ILRRGSRYVRKYMNYPIGSFFQQLVPVVVEQNSEIFPEILKNQQDLTEILNEEELSFAK
FT                   TLDRGEKLFEQYAIIASKTPEQTLSGKDVWRLYDTYGFPVDLTRLMAEEAGLKIDEEGF
FT                   EKAKEESREASKATNNKAGVSLIKLDVHALSELDGNDKVPKTDDSFKYDIENIKANVVA
FT                   IYNGSSFVDSISEAGSQAGILLDKTPFYAESGGQEYDTGKLVIDGVAEFSVSNVQVYGG
FT                   YVLHTGSLLEGSLKLEDEIIATYDELRRWPIRNNHTGTHVLNFALREVLGDNVDQKGSL
FT                   VAPEKLRFDFSHKQGLTPDELLKVETISNDYIKENKQVYAKDIRLNDAKEIDGLRAVFG
FT                   ETYPDPVRVVSIGTSVEDLLKDPKNSEWHKVSIELCGGTHVAKTGDIKDLVIIEESGIA
FT                   KGIRRIVAVTGTEAHQVQKVASDFDKELDHTMGLASGPIKETKAKELGVSLKKLSISVL
FT                   DKRSLNDKFNKLDKSIKDQLKAVQKEESKKVLEVVNTWLNAEDAKDYLVSFVPISANAK
FT                   AITEAINLLKKQHKSKSIYLITGSDKVAHGCYVSDEAIAKGIDATNLATAVSSKVGGKA
FT                   GGKGNVVQGMGDKPQGIDEAINELKKLFAEKL"
FT   gene            <318173..>319852
FT                   /locus_tag="DEHA2A03674g"
FT                   /old_locus_tag="IPF_10688"
FT   CDS_pept        318173..319852
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03674g"
FT                   /old_locus_tag="IPF_10688"
FT                   /product="DEHA2A03674p"
FT                   /note="similar to uniprot|P32945 Saccharomyces cerevisiae
FT                   YPL179W PPQ1 Putative protein serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65361"
FT                   /db_xref="GOA:B5RSQ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ5"
FT                   /protein_id="CAR65361.1"
FT                   /translation="MGNSPSKNDPSPTNSSANQTLNQSTSSNGELESDESIPPLSGLSG
FT                   NKLNGSSKTSAIKIVNKNDNKFNSNYYNTNSNTPSSIYKKNGVQISPKKNSKSNGNHDL
FT                   ALDLEIGVSMAKLLSNSSPSAPGSNKLSLPSQQEYSSSFDSEKSEVSTVSPVFTTLGEY
FT                   KDEDSLSSLGSSGPNDNFGVVKGDLDLDTIVEISLESTPEPRKVPDKSIDQPKKHLDTQ
FT                   ISSTSSTSSLQSPVENSNVKRPQVNVDEIIDRLLEIGLKRPNNSSANSSRKNKDKLPLT
FT                   SQEIKYVLNKSRSIFLDQPTLLRLSPPVKIVGDIHGQFHDLIRIFNSCGYPPYTNYLFL
FT                   GDYVDRGYKSLETILLLLCYKIKYPENFFMLRGNHESANITKIYGFYDECKRRLPSISG
FT                   NHKLWKTFVDVFNALPIAATINDKIFCIHGGLSPDLADLKQIENIKRPTDIPDNGLLAD
FT                   LLWSDPDPSIKNFSPTNWPKNDRGVSYCFGKKHVDYFCLKFKMDLIVRGHMVVEDGYEF
FT                   FDKRKLVTVFSAPNYCGEFDNYGAIMSVDKSLCCSFELIKPQ"
FT   gene            complement(<320246..>324679)
FT                   /locus_tag="DEHA2A03696g"
FT                   /old_locus_tag="DEHA0A04125g"
FT                   /old_locus_tag="DEHA-IPF10686"
FT                   /old_locus_tag="DEHA-CDS0116.1"
FT   CDS_pept        complement(320246..324679)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03696g"
FT                   /old_locus_tag="DEHA0A04125g"
FT                   /old_locus_tag="DEHA-IPF10686"
FT                   /old_locus_tag="DEHA-CDS0116.1"
FT                   /product="DEHA2A03696p"
FT                   /note="similar to uniprot|P32568 Saccharomyces cerevisiae
FT                   YDR011W SNQ2 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84455"
FT                   /db_xref="GOA:Q6BZ66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ66"
FT                   /protein_id="CAG84455.2"
FT                   /translation="MGVDSISNANDGATISSSINEYYGADQEAVEQNDRLELVRSITSG
FT                   NSRDVLDRLETLSREMSRRTTRDGRIEIDPNNFDLHKILSSFIETSKSQGIKLRNSGVS
FT                   FKDLTVYGVDESFSVAVTVYDLMKGPIGGIQRAMAKRKIQDRKIVSNVNGYARSGEMVL
FT                   VLGRPGAGCSSLLKAIGGTDLDLFTGVDGDIRYDGITQKEMLKNFKNDLVYVPELDVHF
FT                   PHLTVEQTLRFAIACKTPELRVNDVSREKFIDALKEILATVFGLRHTYHTKVGNDFVRG
FT                   VSGGERKRVSIAEALACRGSIYCWDNATRGLDASTALEYAHAIRTSTNLLKNTAFVAIY
FT                   QASENIYETFDKVTVLYKGRQVYFGPVMEAKKYFEDMGYECPARQSTAEFLTAVTDPIG
FT                   RYAKPGMGNKVPSTAEEFEDYWLKSEQYRILQQEIQEYNDSINEDETRKGYYHSLKQEK
FT                   MKYSRTNSKFTINYLQQLKLCTTRGFQRLWGDKAYTITQLVAAISQGLIAGSLYYNTPD
FT                   SVSGAFSRGGVIFFAALYVSLMGLAEVSASFNSRSILMKQKNYSMYHPSADALASVVTS
FT                   IPVTLVVTFLFVLIIYFLSNLAADAGKFFTCVLFVFLLSLTMSGLFEAVASLNKTISGA
FT                   NAIAGVLVLASLMYSSYMIQRPSMHPWFKWISYINPVLYAFEAIIATEFHGRKMECDGM
FT                   YLTPSGPGYENLSQGSQVCAFKGSVPGQSWVSGDNYLKVAFTYSFSHVWRNFGIMIGFL
FT                   VFFTCVKALGVEFIRPISGGGDRLMFLRGKVPDSIVLPQDKGQTPGDLETSSSSSNTLE
FT                   KTNVNSEDKLKIFKNLKSRDVFVWKDVNYVVKYDGGDRKLLDSVSGYCIPGTLTALMGE
FT                   SGAGKTTLLNTLAQRIDVGVVTGDMLVNGKPLDLSFRRRTGYVQQQDIHVESLTVRESL
FT                   IFSARLRRINDADDAEKLDYVEKIIKALDMEDYADALVGKTGDGLNVEQKKKLSIGVEL
FT                   VAKPSLLLFLDEPTSGLDSQSAWAVVKLLRELSNAGQSILCTIHQPSATLFEEFDRLLL
FT                   LKKGGQTVYFGDIGDHSNAIVSYFEGNGARKCDDHENPAEYILEAIGAGATASVTQDWF
FT                   ETWCNSPEKRASDIERDRLIEELSKQVEDVHDPKEIKQLRSTYAVPYWYQFIIVVRRNA
FT                   LTFWRNPEYIMSKIMLMTMAGLFIGFTFFGLKHSVTGMQNGMFAGFLAVVVSAPVINQI
FT                   QEHAIKGRDLFEGREKLSNTYHWSLMVIAQCINELPYLIFGSTIMFVSLYFPTQADPSP
FT                   SHSGMFYLTQGIFLQGFVVTFGLLILYIAPDLESAAVLTSFFYTFVVAFSGVVQPVNLM
FT                   PGFWTFMNKASPYTYFIQNLITAFLHGRKVHCSDVELAYFNPPSGQTCQQFAGDFVKAR
FT                   GGYLSEPQATKECGYCTYSIADEYLSSVGAEFSNRWRNIGFYCVYIAFNLCFVLALYWL
FT                   FRFRKGSIFSIFKRNN"
FT   gene            complement(<325007..>326467)
FT                   /locus_tag="DEHA2A03718g"
FT                   /old_locus_tag="DEHA0A04147g"
FT                   /old_locus_tag="DEHA-IPF10684"
FT                   /old_locus_tag="DEHA-CDS2770.1"
FT   CDS_pept        complement(325007..326467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03718g"
FT                   /old_locus_tag="DEHA0A04147g"
FT                   /old_locus_tag="DEHA-IPF10684"
FT                   /old_locus_tag="DEHA-CDS2770.1"
FT                   /product="DEHA2A03718p"
FT                   /note="some similarities with uniprot|P20052 Saccharomyces
FT                   cerevisiae YOL001W PHO80 Cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84456"
FT                   /db_xref="GOA:Q6BZ65"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ65"
FT                   /protein_id="CAG84456.2"
FT                   /translation="MSLLQRVSPFSSPHDRGYLHRTTTTRSISLLSTPKRSPDITMGCA
FT                   EEENKMTEDQMMEEGAMGRVMPDSFLSQYMKQPQRKNSLSGHEIYFKSIDKHRTDKTYD
FT                   IYEKYLVKSKSGPARKNEDEAYEKLHQKRNVEEDIIPIIRKRRDEQRTKNKGNEEAIRP
FT                   AGTVTATESPADTNSYPETKLKQVTKKLAKEFMECTIDDLINLLSRMLRSLISLNDKSV
FT                   PASISNPQEKSSSSNSVLTRYHSRAPPGISIHTYLTRLTKFNNFTAATLLTTIYYIDLL
FT                   SHHYQPFFTLNSWTVHRFLLVATMLAQKSMEDFFYTNEHYAKVGGVAISELNCLELDFL
FT                   NRVDWRCVPAKQLENGKSSIKFAKDVLDLYYAQLIQLMGKNISPDDEVIYFANEDTSYY
FT                   EAGEHDVVDDDVEKDDNIEEEDEDDDDDDDEDDDDDDDDDDNDHEAEYATSNTNPSINH
FT                   EKYDSMGFSVDNSSSPHLKRRFPVNFTD"
FT   gene            <327078..>328597
FT                   /locus_tag="DEHA2A03740g"
FT   CDS_pept        join(327078..327125,327686..328597)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03740g"
FT                   /product="DEHA2A03740p"
FT                   /note="some similarities with uniprot|P43634 Saccharomyces
FT                   cerevisiae YLR098C CHA4 Zinc-finger protein with Zn[2]-
FT                   Cys[6] fungal-type binuclear cluster domain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84457"
FT                   /db_xref="GOA:Q6BZ64"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ64"
FT                   /protein_id="CAG84457.2"
FT                   /translation="MRSSLSKHFWVAVGRLLQIVSSKKDRVKFLMVIASNMIAAVNPDL
FT                   RRKNYSHTYVKSLEYRVAKLEQVLKKLQDCPLENHFPISNSLNLSDLVNKDEIYQTLSE
FT                   YNETSSSVDQSNSTDYGSLSGYDDMIIKTVSASYSESTNSLNDTIKLRKNSGIAVYGSF
FT                   HFYSHDSFLTKFFGVKYDNNTNPQTYTYFSEELVYSIVALSSKISSIQQVESESYEYYN
FT                   KARRLVFDKLNVPKITTIQTLLYLAFYDLGEGYNSSAWLLNVIAFRIGRHRISMNPQNW
FT                   HIKSKEILSAQDIEIRKPIYWGCYTADYLISLLLRRPF"
FT   gene            complement(<327229..>327310)
FT                   /locus_tag="DEHA2A03762r"
FT                   /old_locus_tag="Deha0A.11"
FT   tRNA            complement(327229..327310)
FT                   /locus_tag="DEHA2A03762r"
FT                   /old_locus_tag="Deha0A.11"
FT                   /note="tRNA Leu (CAA) cove score=68.15"
FT   gene            <329749..>330254
FT                   /pseudo
FT                   /locus_tag="DEHA2A03762g"
FT                   /old_locus_tag="DEHA0A04235g"
FT                   /old_locus_tag="DEHA-IPF10677"
FT                   /old_locus_tag="DEHA-CDS7796.1"
FT                   /old_locus_tag="DEHA0A04246g"
FT                   /old_locus_tag="DEHA-IPF10676"
FT                   /old_locus_tag="DEHA-CDS8702.1"
FT                   /note="similar to uniprot|Q5JJU5 Oryza sativa P0458E05 5-
FT                   oxoprolinase-like no start frameshift pseudogene"
FT   gene            <331322..>331432
FT                   /locus_tag="DEHA2A03784g"
FT                   /old_locus_tag="DEHA0A04268g"
FT                   /old_locus_tag="DEHA-IPF10675"
FT                   /old_locus_tag="DEHA-CDS8306.1"
FT   CDS_pept        331322..331432
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03784g"
FT                   /old_locus_tag="DEHA0A04268g"
FT                   /old_locus_tag="DEHA-IPF10675"
FT                   /old_locus_tag="DEHA-CDS8306.1"
FT                   /product="DEHA2A03784p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ61"
FT                   /protein_id="CAG84460.1"
FT                   /translation="MSSGQQGYEVSALCKINREMKKMHLGHPSHVLALMK"
FT   gene            <331502..>333376
FT                   /locus_tag="DEHA2A03806g"
FT                   /old_locus_tag="DEHA0A04290g"
FT                   /old_locus_tag="DEHA-IPF10674"
FT                   /old_locus_tag="DEHA-CDS1421.1"
FT   CDS_pept        331502..333376
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A03806g"
FT                   /old_locus_tag="DEHA0A04290g"
FT                   /old_locus_tag="DEHA-IPF10674"
FT                   /old_locus_tag="DEHA-CDS1421.1"
FT                   /product="DEHA2A03806p"
FT                   /note="weakly similar to uniprot|P39980 Saccharomyces
FT                   cerevisiae YEL065W SIT1 Ferrioxamine B transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84461"
FT                   /db_xref="GOA:Q6BZ60"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ60"
FT                   /protein_id="CAG84461.2"
FT                   /translation="MDNKSTKESELDFSLRSKELNSREASDISLNKGNGNSENSLDEVK
FT                   EHNKFVYSGAWNKKLLYVAYAVLIITAFVESFANNSTSSLDSYATSSFNEHALIATVAV
FT                   VYKITAICAYPILAKIADLLGRAEGFTLSMILYSLAYVLYASCQNVDTYVCAEIFFAIG
FT                   RNGYRIFQLIFIADTSSLINRGILSQLPNAIGAIPSLYAGSYVQDAFLEHSTWRWGYGS
FT                   FAIILAAFCFPLGGIMFYLDRRAKQNGQKKVYQILENIPKDAKWYEKAYQILFVELDLI
FT                   GGVLLLCGFALFFVPFTVTGKSSSYKWHEPKLIVMLVIGFVIFCCFLVWNTKFAKKPFV
FT                   PTQALKSKTVVIIVVLVALDLCENSSFATYFKTVLQVAGYYSAGAATRIDNSKKVTVDI
FT                   FNVFGGLLMKYTKRSKIYALIGIPMLVLGHGLLVWFMRRGDGEMASYALLVMAEVFIGF
FT                   GRGMYQCALQVTIQAIAGIEGIAMSTAFFLAFQSIGSLIGSAISGGIWNTVVLSKLNLY
FT                   LPEDDKDLAKKIYKSITVAMSYEKGSDIRDGINRAYAETIQIIGWTGLGIIAPMLILMF
FT                   FIKEVKLSEAKDIYSVSISEEEIKIKEEKEIEIKEEKESLKKNTSRGQ"
FT   repeat_region   333868..334322
FT                   /locus_tag="DEHA2A03828t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  334323..334456
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A03850t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   mobile_element  334771..336721
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A03872t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   repeat_region   336797..337253
FT                   /locus_tag="DEHA2A03894t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  337262..339886
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A03916t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   repeat_region   340072..340359
FT                   /locus_tag="DEHA2A03938t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   repeat_region   340360..340647
FT                   /locus_tag="DEHA2A03960t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  340648..341262
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A03982t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gap             341622..341721
FT                   /estimated_length=unknown
FT                   /note="gap of 100 nt"
FT   mobile_element  342386..343748
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A04224t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   repeat_region   complement(343744..344200)
FT                   /locus_tag="DEHA2A04246t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  345111..346473
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A04268t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            <345111..>346413
FT                   /pseudo
FT                   /locus_tag="DEHA2A04290g"
FT                   /old_locus_tag="IPF_45572"
FT                   /note="uniprot|Q8TFJ9 Debaryomyces hansenii Polyprotein of
FT                   Tdh5 retrotransposon pseudogene"
FT   repeat_region   complement(346469..346925)
FT                   /locus_tag="DEHA2A04301t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  347836..350254
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2A04312t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            complement(<350648..>352978)
FT                   /locus_tag="DEHA2A04334g"
FT                   /old_locus_tag="DEHA0A04378g"
FT                   /old_locus_tag="DEHA-IPF6566"
FT                   /old_locus_tag="DEHA-CDS0906.1"
FT   CDS_pept        complement(350648..352978)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04334g"
FT                   /old_locus_tag="DEHA0A04378g"
FT                   /old_locus_tag="DEHA-IPF6566"
FT                   /old_locus_tag="DEHA-CDS0906.1"
FT                   /product="DEHA2A04334p"
FT                   /note="similar to uniprot|Q12149 Saccharomyces cerevisiae
FT                   YOR001W RRP6 Exonuclease component of the nuclear exosome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84465"
FT                   /db_xref="GOA:Q6BZ59"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ59"
FT                   /protein_id="CAG84465.2"
FT                   /translation="MSDIPSVSTFDDILPNVVQTVRNSSSLAAQDINFYKSLDSDLSKK
FT                   IDESAKSLLDISNKLIHCSFDDVKDVPFGKDNISSHANWNPIANVLDNIFEKIDIAFDQ
FT                   AQNANSRKANAEAKGFTYLEDSNTINDSSNKHQGKRMVKPQINFRNKVDNSETHPFKPK
FT                   ISSKPNELKSFDESTKLIVPMKQEESNDIDPEYYVQPYEFEIDSQPYPDSILTKKEPIP
FT                   SKPWSKTSAIWVDSVDVLNEMISLLSEQSEIAIDLEHHDYRSYYGIVCLMQISSRDQDW
FT                   IIDTLKLRDDLESLNKVFTNPDIVKVFHGAFMDIIWLQRDLGLYIVSLFDTYHASKKLG
FT                   FPKFSLAYLLETFANFKTSKKYQLADWRIRPLSPPMLAYARSDTHFLLNIYDQLRNKLI
FT                   DAGANRLQEVLYESRQVAKRRFEYTKFRPLSTSGGKVSCPVMANNPKEPFSSILLQYNV
FT                   PYHKKPLIEALYNWRDALAKRDDESVRYIMSNQLLVSLSSLSQPVDVQKVLGVSNYISD
FT                   YVRQNAKDLANLIENTLKSMADSDWELVDKWNDISKAADNDKMNISDDDLDKIISRSKA
FT                   FEDIYAHNKNVLFFDGTELLSNKSALFSELLNNNNDSFSVEYDVEKNKVINHTSGDYKD
FT                   RLDYASKNLQPNPIIISPEISHRNEQHDEPKKPYIDETHAGKSSTVLKDEEMDPNEVIT
FT                   LRKTQKQKTPKAEIKQTAENDAFDYNNANKILLDSSIRNSSRKEKPKKRSFDPYGKDAE
FT                   GPKGAKKARRPNTGKTSTFSTKK"
FT   gene            <353154..>354371
FT                   /locus_tag="DEHA2A04356g"
FT                   /old_locus_tag="DEHA0A04400g"
FT                   /old_locus_tag="DEHA-IPF6567"
FT                   /old_locus_tag="DEHA-CDS3323.1"
FT   CDS_pept        353154..354371
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04356g"
FT                   /old_locus_tag="DEHA0A04400g"
FT                   /old_locus_tag="DEHA-IPF6567"
FT                   /old_locus_tag="DEHA-CDS3323.1"
FT                   /product="DEHA2A04356p"
FT                   /note="similar to uniprot|P38344 Saccharomyces cerevisiae
FT                   YBR267W REI1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84466"
FT                   /db_xref="GOA:Q6BZ58"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR040025"
FT                   /db_xref="InterPro:IPR041661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ58"
FT                   /protein_id="CAG84466.1"
FT                   /translation="MQYTCNSCNLAFPAPEDQRVHMKSDWHRYNLKRRVAELPPIDENL
FT                   FNSKVSSLSITENGADNNNEEKMKNKAQLTKKEIRRREKEVLQAKKKQILETAREAMIA
FT                   KMKEQNRDNDSPSESIQEDELISIRDMKLDDNNSDTKNESTPEQQEEHLMKEKLSNSVE
FT                   IPVTTCLFCHAKQKANFDDIESNIQHMFVMHGLYIPERKYLVDVEGLIKYLGEKIGLGN
FT                   ICLCCSYQGKNIEAVREHMLNKRHMRLPYETEDEKLEVSEFYDFSSTYDDDAVDNKPVN
FT                   EEDWEDVSEDEEEADDYSDEELSPADSALYPNGHELVLPSGVVVGHRSLARYYRQNLAP
FT                   ERVLSEGQGTVIAAETRHMLNIKDREVLATQKRAWGREKKREDVNDRRAAKFVNNQPHY
FT                   RDQLLQ"
FT   gene            complement(<354431..>357064)
FT                   /locus_tag="DEHA2A04378g"
FT                   /old_locus_tag="DEHA0A04422g"
FT                   /old_locus_tag="DEHA-IPF6569"
FT                   /old_locus_tag="DEHA-CDS0655.1"
FT   CDS_pept        complement(354431..357064)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04378g"
FT                   /old_locus_tag="DEHA0A04422g"
FT                   /old_locus_tag="DEHA-IPF6569"
FT                   /old_locus_tag="DEHA-CDS0655.1"
FT                   /product="DEHA2A04378p"
FT                   /note="similar to uniprot|P40367 Saccharomyces cerevisiae
FT                   YJL062W LAS21 Integral plasma membrane protein involved in
FT                   the synthesis of the glycosylphosphatidylinositol (GPI)
FT                   core structure"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84467"
FT                   /db_xref="GOA:Q6BZ57"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ57"
FT                   /protein_id="CAG84467.2"
FT                   /translation="MGSSKWGVLFGLLILHVIGYSIFLKGFFPSKVVVPGFNEFHTGQS
FT                   PFMEHNEAKFDKLILMVVDAMRSDFLYSDHSHMKFVHQLINENCALPFTSYSNPPTVTL
FT                   PRLKGITTGGTPSFLDAILNIADDKDNSQSLLNQDSWLHQFQNNSKVFNFFGDDTWLKL
FT                   FPPEKFFNQYEGTNSFFVNDFTDVDNNVTRHLNDDLFNSKWDALILHYLGLDHIGHKGG
FT                   PNSIFMRGKQEEMDGIIEKLYKETIDSNTLLVVMGDHGMNEIGNHGGSSMGETNPGLLF
FT                   ASPKFKMLKKNLKSPLAYNNDYKYYNYINQIDLVPTLATLLNFPIPKNNLGIVIKDILG
FT                   LWKPEAQKSILMENSEQFMNIYEAKHANDTDIINEWKKSQDSGSIDVHYDFLSKIQGLL
FT                   TSAATEYKYVDIYIGLSILVAMAIVAFGLFNWYFLVQATINPKYNWYFIGISIVYSIHF
FT                   HASSLIEEEYQIWWFFSIICLFALYFNNHLKSLKYFWLILVGLRIIRSWSITGQKFTTP
FT                   YTFSAYLLQNVDLLWVLNIATYFLTAILIYSQGSLIHCVTLREYESLRENVKDFGSLVT
FT                   FIVTFVTCSISFSFKLCQYFNDGKRVPDWLLAFLNWTCESYGITIDPKEKNQLHELNIH
FT                   LSKILFYCIGVLIIVRIVLGKIRKLHYGLLTDLSNVLTLFLLHQSRPEIVPIFLIFSLV
FT                   KFSAAKLLANNEIVLRKNIDQLMIIITLFSLCMQNLSFFSMGNTNSLATVDLSNSYNGF
FT                   KSYDVFLVGVLTYCSNFAGPIFWSLASLQLIFENNVVCFDTKKSSKDLVNLKFLKYQIL
FT                   YVKSLAGFLFYSMAGLSLVASCFNLRFHLFIWSVFSPKLLFFASWTLLTNILIDTISSL
FT                   SILALC"
FT   gene            <357485..>358992
FT                   /locus_tag="DEHA2A04400g"
FT                   /old_locus_tag="DEHA0A04444g"
FT   CDS_pept        join(357485..357562,357613..358992)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04400g"
FT                   /old_locus_tag="DEHA0A04444g"
FT                   /product="DEHA2A04400p"
FT                   /note="similar to orf19.3405 Candida albicans,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84468"
FT                   /db_xref="GOA:Q6BZ56"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ56"
FT                   /protein_id="CAG84468.2"
FT                   /translation="MSVTSKANMITRSRKGCLSCKKLKIKCNEAKPSCEYCESTKRQCQ
FT                   YPDMEIMQTNFGVDSRRTRRRRNDDKNLMREMRLNATTKLLQINLLELQLLKFFHEQCT
FT                   QFFSFCGVDKNIEYVWSHSVPTIFSQSSLVRNAIYSFSALTLWPFYNIDESLCLDKISK
FT                   LLKYDEAVLSGQNGIASGIINKGISVDVTDSLTQASLFEVTTEYFISTLRENQLAITRH
FT                   YEGPDIELRTFGSINEAAELTITSILIFSYMCLHPDGVLPIVVFNDDTQVDFISLSKNI
FT                   GSIMASARGTLVDTKFGGLFARHSKYRNTNVPRDRYRITRILFDKLDEYFYDVSHTVEI
FT                   DSISALEYETLKVTIDALNNCLYQADVCNFPIAMFSWILFVSDQYYGLVKNKQPFATKI
FT                   LFVYACLNLIFDFAFIRSRSSFTKFAHWYKEHMDPDEFDQNLYHVAIDHEHQFTVDNFS
FT                   TIRDFDPVSFSDNLDNVLNKDDIYEWL"
FT   gene            <359862..>361586
FT                   /locus_tag="DEHA2A04422g"
FT                   /old_locus_tag="DEHA0A04466g"
FT                   /old_locus_tag="DEHA-IPF6572"
FT                   /old_locus_tag="DEHA-CDS1943.1"
FT   CDS_pept        359862..361586
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04422g"
FT                   /old_locus_tag="DEHA0A04466g"
FT                   /old_locus_tag="DEHA-IPF6572"
FT                   /old_locus_tag="DEHA-CDS1943.1"
FT                   /product="DEHA2A04422p"
FT                   /note="similar to uniprot|O74248 Candida albicans GPT1
FT                   Putative polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84469"
FT                   /db_xref="GOA:Q6BZ55"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ55"
FT                   /protein_id="CAG84469.2"
FT                   /translation="MGENFKSSNKIHPVVSNILVDDLHITSILSNQNITINVDHEIDKD
FT                   EALILALGYKQEFKREFSLWTLFAVSFSVLGLLPSIAACFDYQQLVVGMSPVPWILAII
FT                   FISSVALSMAEVASAFPTSSGTPYAVSQLAPPRWAPVLTWLTCCSNWLCQITAAPSVNN
FT                   SCAWLILALKTYNSNDGYSPSYGEVYGLTTGIQIVHGIISSMPTRWLATFNSMGTITNI
FT                   LFLVIVFVMILGGNDRQDHFNDITKFNSNDTAWKFYNQTDWPMGIAVLQSFLGVIWAMS
FT                   GYDSPFHLSEECSNANVAAPRAIILTATCGGGIGFLFMIAIAYTLVSIDQIAEDPQGLG
FT                   QPFVTYLTQILSKKAVNAATALTIISSFFMGCSCMLAASRVTYAYARDGFFPLSRYWKI
FT                   VNKKTQTPINAVWVNLFIGQLLLLLQFAGDTAIGAIFSVGGISGFVSFTMPTLLKITYA
FT                   NKSFKRGPWHLGRWSRPIGFVSVAFVTVMIPILCFPTVRGDDLTLDQMNWTVIVYFGPM
FT                   LLSLLWFVIDAHKWYKGPRPNINDEDIVYGNSTIIDGYDNEKRNHNEVISSKDNDFI"
FT   gene            complement(<362507..>362977)
FT                   /locus_tag="DEHA2A04444g"
FT                   /old_locus_tag="DEHA0A04488g"
FT                   /old_locus_tag="DEHA-IPF6574"
FT                   /old_locus_tag="DEHA-CDS5958.1"
FT   CDS_pept        complement(362507..362977)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04444g"
FT                   /old_locus_tag="DEHA0A04488g"
FT                   /old_locus_tag="DEHA-IPF6574"
FT                   /old_locus_tag="DEHA-CDS5958.1"
FT                   /product="DEHA2A04444p"
FT                   /note="similar to CA0973|IPF12662 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84470"
FT                   /db_xref="GOA:Q6BZ54"
FT                   /db_xref="InterPro:IPR020999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ54"
FT                   /protein_id="CAG84470.1"
FT                   /translation="MYVKEINEEINKRLYYPNRYGNNGSTGWGSYKWLLWLLILIPLLI
FT                   VVVLFCLRKRKNKGKVHVMDNNQYYQTQQAGGYYNQGQGYPNQQDNQYPPANPDAGGYG
FT                   GYNQQQGYTEQPGYNGQPGYSEQPGYNGSKVDDINPDEFQRPDGPPPAHYKS"
FT   gene            <363218..>365494
FT                   /locus_tag="DEHA2A04466g"
FT                   /old_locus_tag="DEHA0A04510g"
FT                   /old_locus_tag="DEHA-IPF6575"
FT                   /old_locus_tag="DEHA-CDS0950.1"
FT   CDS_pept        363218..365494
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04466g"
FT                   /old_locus_tag="DEHA0A04510g"
FT                   /old_locus_tag="DEHA-IPF6575"
FT                   /old_locus_tag="DEHA-CDS0950.1"
FT                   /product="DEHA2A04466p"
FT                   /note="some similarities with CA2446|IPF2582 Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84471"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ53"
FT                   /protein_id="CAG84471.2"
FT                   /translation="MSFHLVPPPESKLKKNSKKNSNEKIPKKTIIPTNLKIHGNPRPQL
FT                   RTSKSSNSSVSSYSDYTPESKNKNAEVNADELSKSLLGLKKSTSSLSLSRMQKKNKNNE
FT                   SQGSHTPVSPRTSGRSKAQSTGAHSNGRSSPMSNRSNSSTLSNLKARRSRSASPSVSQS
FT                   SSKHQPNVNAANANYMDLDYISRKLDNSDLQRNVSHGRNIIENNNKKKIDAIDFKPIID
FT                   LSIVNSYETMKEHMYFPTFQVLKYRNFLNILRDHHQNDPISFASVRNHSLINFIASYKV
FT                   GQRIPENVDIKQHDLRFYETLLGTELLRSRTIFRQLIRRDSAKIKNKSMIINCEELVQL
FT                   NLSNYVRFVFNMPDEIPVPLEQLDSIQRTHYKYKELFKKIGHVLYLMNREVGGDENPES
FT                   GKTYILQTIRKVSYEYILLEKYLFHIFSKLGDNSLIHSRNLKVLFDKFNNRMQSNNNES
FT                   IKVLHYNAYFSSQYSWYLSITAPFIRVFEMNSYSEDFELVNNHGNYYRNLNDTKKISFK
FT                   DSDVDLYDKYFKKLGLDDYLKYRSLTPEKLVALHESIDKSSQKLNNSKKIETDDGLSST
FT                   SHKPMNFEYYTESLATISSETFHLIQSRDLALQLTPKNYSVILTEFYRILQKDGVLEVP
FT                   FIQLSRNKIMESFSQQHDFSKDEGFMNLNLLEHFNMIPDFLQAILKELSNIFGEGNVKY
FT                   HVSLLNSIGELNCFLAKHICFQLFEMFGRLDEYSAKFTNVDDTNSRDINEDGMYYYIYI
FT                   RAHKK"
FT   gene            <365665..>367437
FT                   /locus_tag="DEHA2A04488g"
FT                   /old_locus_tag="DEHA0A04532g"
FT                   /old_locus_tag="DEHA-IPF6578"
FT                   /old_locus_tag="DEHA-CDS1687.1"
FT   CDS_pept        365665..367437
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04488g"
FT                   /old_locus_tag="DEHA0A04532g"
FT                   /old_locus_tag="DEHA-IPF6578"
FT                   /old_locus_tag="DEHA-CDS1687.1"
FT                   /product="DEHA2A04488p"
FT                   /note="similar to uniprot|P33734 Saccharomyces cerevisiae
FT                   YBR248C HIS7 Imidazole glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84472"
FT                   /db_xref="GOA:Q6BZ52"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014640"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ52"
FT                   /protein_id="CAG84472.2"
FT                   /translation="MKTVYVIDVESGNLQSLFNAIKRIGGYDVKFIHDAKEFADYNDSI
FT                   EKLIFPGVGNYAHFIKQLHDRELVDPITKYIESGRALMGICVGLQAFFESSEESDNSEY
FT                   QGLGYLKFGLSKFNKSDPVFTQRKQLKAVPHIGWNSVNTIKANNTTLSKTTSFFGINTV
FT                   NKYYFVHSYAAILKDEQQEKVISEAISNGWDIAFARYGSEIFLAAVSYKNFFATQFHPE
FT                   KSGVAGLKVIKSFLEGSRFSEVTTSDAQPVDNIENTLSGLTRRIIACLDVRSNDDGDLV
FT                   VTKGDQYNVRESSGDSDESKVRNLGKPVELATRYYNQGADEVTFLNITSFRNSPLKDLP
FT                   MLKVLSTAAETIFVPLTVGGGIKDLVDPISGEKVPAAKVASLYFRSGADKVSIGSDAVT
FT                   IAENYYANNKHKTGTTSIETISATFGSQAVVISVDPKRKYVSSPSETTMETIHIQDPSK
FT                   YGPAGEKYCYYQVTSQGGRVTHELGALELCLACEDLGAGEILLNSIDHDGSNKGFNLEL
FT                   LRQVKEKASIPVIASSGAGKPEHFQEVFDMDCGIDAALGAGLFHRGEYEVNDVKRYLQK
FT                   ECSMDVRLDDTVEL"
FT   gene            <367586..>370390
FT                   /locus_tag="DEHA2A04510g"
FT                   /old_locus_tag="DEHA0A04554g"
FT                   /old_locus_tag="DEHA-IPF6581"
FT                   /old_locus_tag="DEHA-CDS0544.1"
FT   CDS_pept        367586..370390
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04510g"
FT                   /old_locus_tag="DEHA0A04554g"
FT                   /old_locus_tag="DEHA-IPF6581"
FT                   /old_locus_tag="DEHA-CDS0544.1"
FT                   /product="DEHA2A04510p"
FT                   /note="similar to uniprot|P32383 Saccharomyces cerevisiae
FT                   YPL268W PLC1 Phosphoinositide-specific phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84473"
FT                   /db_xref="GOA:Q6BZ51"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ51"
FT                   /protein_id="CAG84473.2"
FT                   /translation="MLSSKNDHSVDENSDLLELSDSISPSDISNHSFYGNFKRSSSLPI
FT                   QSNLPTLFNNLRANDRKESSNSGTSPGRSWLRKLMSPSNKLNDLGSMENTKPGWAGKNA
FT                   NSKSLGDNTNSEEDSYDISLDNERETSAYPFKDIDQVKIPPVFFKEGLSLLKVSHKSKK
FT                   RTFFQIGEKDFQFSLKNAYASASTTASSGLYRLLTPTSSYQPKNKSYEFSIDDIKAISY
FT                   QKDASNYRKELHVSKEFESQWLTIIYFDKKKKKLKTIHVIADTEHDLKKLLSVLSGLKK
FT                   LRNNLAKNYLLDLNDIDETQRNMFIGRSQEENEKEIRKFLSFNDILKYSKRLNINMNPT
FT                   YLRTIFNFVCADSSVDRGLDFDQFKQFVSILKTRHDITHIWNSTCGENKSMTFDIFKNF
FT                   MTDVQKESFTEEYLRKIFRKFCIEDKNYWIPENFNNFLLSKYSTSMYNAATNESYFDHP
FT                   LNEYFISSSHNTYLMGRQVAGDSSIEGYIKALQRGCRCVEVDIWDGYIDGMDDNDKTNN
FT                   EPIVSHGRTFTSSISLNNVFKTIKKYAFITSPFPLIISLEINCSIDNQLKVVRTLKEVL
FT                   GDTLITQPIDDKFTLPTPLQLKHKILLKVKKTSPFSDLIASENGNYVSSTTTTTTSFSE
FT                   DNGSGGVKRRSSFSIRRRKARKITDTLSDLGIYLQGVKFRNFSLPESKTFNHCFSLSEK
FT                   SINTMLKDDIKCTSIDKHNRKYFMRVYPSNIRLKSSNFLPMKYWSHGVQMVATNWQTYD
FT                   LGQQINESLFESTNRRGYVLKPEDLRKPLLKSSNRSIVAKRTIKTKFDIEIISAHQLPK
FT                   PKGSVSAINPFINFDITGASDIVWDRGSAPLRTSIIPENGFNPIWNEKFSGTITTFDDF
FT                   VFVRFLINASSSISEVEEIQPIGILVCKLFDLKKGYRYLPINDLLGEELIYSTLFVKIN
FT                   YYEL"
FT   gene            <370571..>371926
FT                   /locus_tag="DEHA2A04532g"
FT                   /old_locus_tag="DEHA0A04576g"
FT                   /old_locus_tag="DEHA-IPF6582"
FT                   /old_locus_tag="DEHA-CDS2722.1"
FT   CDS_pept        370571..371926
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04532g"
FT                   /old_locus_tag="DEHA0A04576g"
FT                   /old_locus_tag="DEHA-IPF6582"
FT                   /old_locus_tag="DEHA-CDS2722.1"
FT                   /product="DEHA2A04532p"
FT                   /note="similar to uniprot|P38333 Saccharomyces cerevisiae
FT                   YBR247C ENP1 Protein associated with U3 and U14 snoRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84474"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ50"
FT                   /protein_id="CAG84474.1"
FT                   /translation="MGKITVSETKGKVRHNPLYKDIESQGGNLKSAPTSSRSNQKNTEK
FT                   NEEHFLDAAASRRILQLAKEQQEELEDEENAGKTRPSFLDTYRSQKDEEDEEEDEEEEE
FT                   EYSEFEEDEIAEEEIEVDEKDAALFEKYFASNGPGNGSINLADKIMAKIQEKETIKENN
FT                   SRPVDAVLLPPKVISAYEKIGQILSTYTHGKLPKLFKVLPSLRNWEDVLFVTNPEKWTP
FT                   HAVYEATKLFVSNLQANEAQKFVEMVLLERFRTSIEDSEDHSLNYHIYRALKKSLYKPG
FT                   AFFKGFLFPLVDSHCSVREATIAASVLAKISVPVLHSSVALTQLVQRDFKPSTTVFIRV
FT                   LIEKKYALPYQTLDELVFYFMRFRKAAQANDSMIDEEKEEPQLPVVWHKAFLSFAQRYK
FT                   NDITDDQRDFLLETVRQRFHHAIGLEIRRELLAGKPRTPPQPVKEAIMIDAF"
FT   gene            complement(<372031..>373809)
FT                   /locus_tag="DEHA2A04554g"
FT                   /old_locus_tag="DEHA0A04598g"
FT                   /old_locus_tag="DEHA-IPF6585"
FT                   /old_locus_tag="DEHA-CDS1799.1"
FT   CDS_pept        complement(372031..373809)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04554g"
FT                   /old_locus_tag="DEHA0A04598g"
FT                   /old_locus_tag="DEHA-IPF6585"
FT                   /old_locus_tag="DEHA-CDS1799.1"
FT                   /product="DEHA2A04554p"
FT                   /note="highly similar to CA4294|CaERC1 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84475"
FT                   /db_xref="GOA:Q6BZ49"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ49"
FT                   /protein_id="CAG84475.2"
FT                   /translation="MSFNERTHQFTHSNSQRRASVVYGSIGKGGLFTPSDFIRPHGDNA
FT                   GISFDDDQGVAPHTPDESSQLLDRPAVLSSRKNRRQSSVTREIVEQERSFLRDSNIKVP
FT                   SKGSEDDVIDTFEEAIISKKLSTTTASIELKSLVISSIPLIVTFLLQNSLSTVSVFTVG
FT                   HLGAVELAAVSMGSMTANITGYATIQGIATALDTLCPQAFGAKKYSLVGVYLQKCTALI
FT                   FTVMAPVLVIWLFFGYGLITLILPDKETAKYAAVYLQYIAPGIPAYILFECGKRFLQAQ
FT                   GIYHISTVVLLFAAPSNLLMNWLFVKHLGYIGAPIAVAINYWLMAIGLFVAVVYFVKPE
FT                   STPTGLHPLVCWSGLNIRDSFRAWDKLIYLAIPGLIMLEAEFLAFEILTLLASYLGTVA
FT                   LAAQSIGTTMASLTYQVPFAIGIASSTRIANFLGAGLSSPAKTATRVSLCFGLVISTFN
FT                   FLVLFCFQTQIAELFTNDKKVIKTVEGVMWLIALMQISDAMNANSAGCLRGQGQTKIGG
FT                   IVNLVSYYVVGLPLSIYLTFYSNFGGTLHGLWIGSTVALTIIGVVQSYYSLFADFDKLC
FT                   AEARERTSDEGPGFAV"
FT   gene            complement(<374040..>374978)
FT                   /locus_tag="DEHA2A04576g"
FT                   /old_locus_tag="DEHA0A04620g"
FT                   /old_locus_tag="DEHA-IPF6586"
FT                   /old_locus_tag="DEHA-CDS4099.1"
FT   CDS_pept        complement(374040..374978)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04576g"
FT                   /old_locus_tag="DEHA0A04620g"
FT                   /old_locus_tag="DEHA-IPF6586"
FT                   /old_locus_tag="DEHA-CDS4099.1"
FT                   /product="DEHA2A04576p"
FT                   /note="similar to uniprot|P53829 Saccharomyces cerevisiae
FT                   YNL288W CAF40 Evolutionarily conserved subunit of the CCR4-
FT                   NOT complex involved in controlling mRNA initiation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84476"
FT                   /db_xref="GOA:Q6BZ48"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ48"
FT                   /protein_id="CAG84476.1"
FT                   /translation="MYSAAAQPQSQASIPQGHQSDGNIASKNKALNDEQIYQWISELVT
FT                   GTNRERALLELGKKREQYDDLALVLWNSFGVMTVLLEEIISVYPFLNPPILTASVSNRV
FT                   CNALALLQCVASNVQTRGLFLSANLPLYLYPFLSTNARQRSFEYLRLTSLGVIGALVKN
FT                   DTPEVINFLLTTEIVPLCLNIMEISSELSKTVAIFILQKILLDDQGLSYICTTYERFHT
FT                   VASVLSKMIDQLSATTNTQTPQQPSNSSGRLLKHVVRCYMRLSDNLEARKALANILPEP
FT                   LRDGTFSLILQDDVATKRCLAQLLSNINDQQ"
FT   gene            complement(<375126..>375199)
FT                   /locus_tag="DEHA2A04598r"
FT                   /old_locus_tag="Deha0A.10"
FT   tRNA            complement(375126..375199)
FT                   /locus_tag="DEHA2A04598r"
FT                   /old_locus_tag="Deha0A.10"
FT                   /note="tRNA Asn (GTT) cove score=74.40"
FT   gene            complement(<375374..>376870)
FT                   /locus_tag="DEHA2A04620g"
FT                   /old_locus_tag="DEHA0A04653g"
FT                   /old_locus_tag="DEHA-IPF6588"
FT                   /old_locus_tag="DEHA-CDS2583.1"
FT   CDS_pept        complement(375374..376870)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04620g"
FT                   /old_locus_tag="DEHA0A04653g"
FT                   /old_locus_tag="DEHA-IPF6588"
FT                   /old_locus_tag="DEHA-CDS2583.1"
FT                   /product="DEHA2A04620p"
FT                   /note="similar to uniprot|P21827 Saccharomyces cerevisiae
FT                   YGL097W SRM1 Nucleotide exchange factor for Gsp1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84477"
FT                   /db_xref="GOA:Q6BZ47"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ47"
FT                   /protein_id="CAG84477.2"
FT                   /translation="MVALERKRKISGSEQPNGTKKFKSATSSFVLHSYSKLPDLNSIPL
FT                   AKTQPLDVFVWGTGSMCELGLGPSAKTKEVKRPRLNPFLTSEHLGDSKIVDFAAGGMHT
FT                   LALDSDNRVWSWGGNDSGVLGRDTSKVKEVLKDMDADDSEDDDDGDLNEAESTPGLVEN
FT                   LPKLKGAKIVQLAATDNLSAVLYDNGDVYAWGCFRCNEGLLGFLRDEIKLQKTPLKIKQ
FT                   LKNVVQLARGKDHLLALDSKGIVYAWGNGQQFQLGRRVLERHRYNGLEPKQFGLYNIKY
FT                   IASGDFHCFAIDHDDQVYAWGLNQFGQCALTDSDGKLEDGSLITSPTIIPELSKKGITH
FT                   LCAGEHHSMALTGDGSVLSWGRYDMKEVGIPKDKLPESTFKDAHGNARSVPTPTKLQFG
FT                   LKSDNGVKCKTIACGSHHSFAVTDDGFVYAWGFGDTYAPGLGPLEEDVEKPTRIVNTAT
FT                   KYHDIQQINAGGQFSISGGVKIDDEDKAEDRIEKYEEIDG"
FT   gene            complement(<377160..>380198)
FT                   /locus_tag="DEHA2A04642g"
FT                   /old_locus_tag="DEHA0A04675g"
FT                   /old_locus_tag="DEHA-IPF6589"
FT                   /old_locus_tag="DEHA-CDS0433.1"
FT   CDS_pept        complement(377160..380198)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04642g"
FT                   /old_locus_tag="DEHA0A04675g"
FT                   /old_locus_tag="DEHA-IPF6589"
FT                   /old_locus_tag="DEHA-CDS0433.1"
FT                   /product="DEHA2A04642p"
FT                   /note="similar to uniprot|P14180 Saccharomyces cerevisiae
FT                   YBR038W CHS2 Chitin synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84478"
FT                   /db_xref="GOA:Q6BZ46"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ46"
FT                   /protein_id="CAG84478.2"
FT                   /translation="MSNPFDEDEGPFADPQHPSLPHAAFTSDRSSPRRYNRIEDDDDDE
FT                   ASEELMMFPQSTQQSPYRQSPNIFARSVASANRNQGNPLGNAPNLQFGEGTTPRSQFTS
FT                   RESPKRQRKAEVFIDSDDDEREVADPFSGSPRRSQFGKSVNSSARSERFLEPPQPIFSP
FT                   ETFAEANPHDEDQETITDDKSRNSYDYDSYQKAHELEQRSLYSDSTAYSGPSYTSGEAE
FT                   ESEYFGASIDGEMMHNIDNGYVPTGDKTVTRRKVRLVGGKTGNLVLENPIPNELKKVLT
FT                   RTESPFGEFTNMTYTACTSEPDEFVSDGFTIRAAKYGRETEIVICITMYNEDEFSFSRT
FT                   MHGVMKNVAHLCSRHKSSVWGKDGWKKIQVIIVADGRNKVNSSVLQLLTATGCYQENLA
FT                   RPYVNNKKVNAHLFEYTTQISIDENLKFKGDEKCLAPVQVMFCLKEKNQKKINSHRWLF
FT                   NAFCPVLDPNVVILLDVGTKPDSRAVYNLWKAFDRDSNVAGAAGEIKAIKGKGWINLTN
FT                   PLVASQNFEYKMSNILDKPLESLFGYISVLPGALSAYRYIALKNHEDGTGPLASYFKGD
FT                   DLLNELNDSKKNSKTNFFEANMYLAEDRILCWELVSKRNENWVLKFVKSATGETDVPES
FT                   IPEFLSQRRRWINGAFFAALYALRHFNSIWLTDHSFSRKFFLHVEFIYQFVSLLFSFFS
FT                   LSNFYLTFYFLTGSLVDNKNIGNNGGFWIFTLFNYLCICCLTSLFIVSIGNRPQASRRI
FT                   FKTLVILLTVCALYALIVGFYFVFSTIESYGMGDSSTYVFISIVVSLLSTYGLYTLMSI
FT                   LYLDPWHMLTCSVQYFLMIPSYTCTLQIFAFCNTHDVSWGTKGDNNPQEDKDNQYIIHK
FT                   NEKGEFEAVVVDVNIEEVYLETLYNIRARRSNKKVLTARPPPPQLEGEDYAKDVRSRVV
FT                   LIWLLVNLIFIMTMLQVYEPGATDKNIYLAFILWTVAALAFFRAVGSFGYLIQQSARFM
FT                   VETKSKWSHKREGYAAPNTNALN"
FT   gene            <380946..>382949
FT                   /locus_tag="DEHA2A04664g"
FT                   /old_locus_tag="DEHA0A04697g"
FT                   /old_locus_tag="DEHA-IPF6591"
FT                   /old_locus_tag="DEHA-CDS1280.1"
FT   CDS_pept        380946..382949
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04664g"
FT                   /old_locus_tag="DEHA0A04697g"
FT                   /old_locus_tag="DEHA-IPF6591"
FT                   /old_locus_tag="DEHA-CDS1280.1"
FT                   /product="DEHA2A04664p"
FT                   /note="similar to CA1833|IPF14094.repeat5 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ45"
FT                   /protein_id="CAG84479.2"
FT                   /translation="MEGNNSNTPFYSHGNNSTSSTLQFTTGTNTTSQISSVGFNNLKKV
FT                   GTNSSQASTSSTITNRNNPITRLFTKNRSNSTVNPQVIQFDDGMNDHNNSDEDDTSTAS
FT                   TTDPRKPSGSGMFKFSKKNKLKFSSKNGASKPDLTIQTGGHLGLRVPKKILSSSSLDDS
FT                   SSPTGHGLKVPKKILNPSHMDESPNMNSKRKNSVTSPASTFHNFFHRSHNNSQPSKDLQ
FT                   HVISKDDLISSQQTINNNPNRTAMSLSSNNSNSFITDINFALVYNFTDPDYSVEEYVNS
FT                   NEHTSFLDIHKKLMVPTDQYLSNKLHKYQTQEVGLGIISDTDGDSEYLSKYLLDFGKNN
FT                   VAFFNNLISIMKPLFQPSQQKRLSNKIFHPYLGMTLEDVSNYIKDNYLGESSNTPSTES
FT                   HFLERTPGSKLSKSKSKTKFYTSSSTSTLSLGENFNDILDDFKIREISQDLLTFFIKCM
FT                   ITFDKDFTIYESKTKNRIPVQKAKNNPSPLSIASISEWNRIGEQWSYFNERIRYYVMGI
FT                   FHPLQKYLHDIAIQKFNNDPKSVVEVEIENIFLLAFRDVIIIPFLISRNQEYHRLPSSS
FT                   QKVISEANNIDSPSPIPSYTFSLETVDDTEEILKLQEEQTLKANTKLLKNLVNCFGVLL
FT                   AHTHDEIGNADGEQHIRNNIFSETFTWLSKLT"
FT   gene            <383107..>383786
FT                   /locus_tag="DEHA2A04686g"
FT                   /old_locus_tag="DEHA0A04719g"
FT   CDS_pept        join(383107..383226,383286..383786)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04686g"
FT                   /old_locus_tag="DEHA0A04719g"
FT                   /product="DEHA2A04686p"
FT                   /note="similar to uniprot|P40359 Saccharomyces cerevisiae
FT                   YJL072C PSF2 Subunit of the GINS complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84480"
FT                   /db_xref="GOA:Q6BZ44"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ44"
FT                   /protein_id="CAG84480.2"
FT                   /translation="MVLPAHLQNSLMPSEVSFLAENEYITILPRYSMKKLELIGTKVPT
FT                   LRGMRREKIPIWIAVILKSQDKCNIVPPEWLNLIYLKEKYEEELKQPHKFSVLPWNWLE
FT                   ISKILLNKAADDLSDPTHQLRSIIQDLREIRLVKSRKGLKELNESNIQLDGLSLLEINE
FT                   LRPFVLTVMNKLRQLHESVNTKTDRGTGNDQDDDMYHDVSDNE"
FT   gene            <383931..>385658
FT                   /locus_tag="DEHA2A04708g"
FT                   /old_locus_tag="DEHA0A04741g"
FT                   /old_locus_tag="DEHA-IPF6593"
FT                   /old_locus_tag="DEHA-CDS1800.1"
FT   CDS_pept        383931..385658
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04708g"
FT                   /old_locus_tag="DEHA0A04741g"
FT                   /old_locus_tag="DEHA-IPF6593"
FT                   /old_locus_tag="DEHA-CDS1800.1"
FT                   /product="DEHA2A04708p"
FT                   /note="similar to uniprot|P40360 Saccharomyces cerevisiae
FT                   YJL071W ARG2 Acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84481"
FT                   /db_xref="GOA:Q6BZ43"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ43"
FT                   /protein_id="CAG84481.2"
FT                   /translation="MSKLRNLNRQFISNLKTHETVTNAKRNLILSILKSTTTKREARNY
FT                   LNKYQNQFDFSDITFNNGVPSNSLEKRDSQRELFINRFLNKQNPFTNIYDDETKLQKIP
FT                   LRLALFKIKFQSISLENWKGMAETFKRLIHLGISPIIMLDYDHLPANTFRNNELYMLNQ
FT                   TNKIMNILGKPTEENDLKTIIMRSLFTKKTINDKDLAIDNLESVLIPLYQGVIPIIQPI
FT                   VYNASTCMQEFIDSNDLLFSLCSSLLTTKNVLSIEKVVMIDPIGGIPSIERNQTSHVFI
FT                   NLSQEYSDIVSELYIGFIKPEYRIFHMNNLKAMNKTLTLVSDKTGNDETTGIITTPDIM
FT                   SVNNDQLNPIIYNVLTDRSIISSSLPTSHNRTPELSTSILKKGVDVNILDALNYPKAFT
FT                   LNNLVQDGSVNKSKLVDLIDDSFGKKLDTEKYFDRINDSLATVVIVGDYDGAAIITWET
FT                   CSKTNEKIAYLDKFAIASVNQGLPGLADIIFKIILQSHPNELIWRSRKNNPVNKWYFER
FT                   CCGTLSNPGSQWKIFYTGDIFNKKIDKLKKQGIPGGVNIHGKMHQYSDITENIPPSFL"
FT   gene            <385678..>386706
FT                   /locus_tag="DEHA2A04730g"
FT                   /old_locus_tag="DEHA0A04752g"
FT                   /old_locus_tag="DEHA-IPF6594"
FT                   /old_locus_tag="DEHA-CDS3363.1"
FT   CDS_pept        385678..386706
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04730g"
FT                   /old_locus_tag="DEHA0A04752g"
FT                   /old_locus_tag="DEHA-IPF6594"
FT                   /old_locus_tag="DEHA-CDS3363.1"
FT                   /product="DEHA2A04730p"
FT                   /note="similar to uniprot|Q03419 Saccharomyces cerevisiae
FT                   YDR492w or uniprot|Q12442 Saccharomyces cerevisiae YOL002C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84482"
FT                   /db_xref="GOA:Q6BZ42"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ42"
FT                   /protein_id="CAG84482.2"
FT                   /translation="MNADSNFIIFCNCFLLRSPIMTSILRQRGSCTDVRSSGDATPIET
FT                   IPRLHYYHEIDEWQQDNHFIRSGYVKETSSFSNCFNSLFYLHNESINIHTHLLPSFFAF
FT                   SVIIYYVNYELPIYDNYLGVWEKLNFLQFGMAVTACLLISSTYHCVKSHSDTVSKLGNK
FT                   FDYFGIVILITCSLNSIVLFSFYDEPFWKFTFIIIFLGLATTCTVLTLDPRFATNVYRP
FT                   LRSLMFILFGLSGILPLIAAVKLYGYSAAVERSCAGWLVLEGISYISGAVLYAMRVPER
FT                   FTHVDEDETSLLDKPLSGKFDIFGHSHQIFHVMVLVGAFCHWMSLVGCYHYLHEVILPN
FT                   AI"
FT   gene            <386760..>387533
FT                   /locus_tag="DEHA2A04752g"
FT                   /old_locus_tag="DEHA0A04774g"
FT                   /old_locus_tag="DEHA-IPF6595"
FT                   /old_locus_tag="DEHA-CDS4721.1"
FT   CDS_pept        386760..387533
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04752g"
FT                   /old_locus_tag="DEHA0A04774g"
FT                   /old_locus_tag="DEHA-IPF6595"
FT                   /old_locus_tag="DEHA-CDS4721.1"
FT                   /product="DEHA2A04752p"
FT                   /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
FT                   YOR238w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84483"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ41"
FT                   /protein_id="CAG84483.2"
FT                   /translation="MSRHLIILPCHSIWTPGATLGESRDEWSLVSFQIEGYDHLCFKDH
FT                   ILKSLNILEQDKDATLIISGGQTKQESGPISEALSYYQLATKLTNDIELVQRINTEEFA
FT                   RDSFENVLFSLCRYFELHEAYPEKITIVGFEFKRQRFLENHLKQALSFSRNVNYVGNAP
FT                   TPKDLDEEGQINYFQDLEQQEYKHAVSHFEKDWYSIRSPLLDKKMKRDPFSRYHGYCQS
FT                   NPKLAKFLVAISDQENQEENLRSNESIQSLLTDFT"
FT   gene            complement(<387565..>388671)
FT                   /locus_tag="DEHA2A04774g"
FT                   /old_locus_tag="DEHA0A04796g"
FT                   /old_locus_tag="DEHA-IPF6597"
FT                   /old_locus_tag="DEHA-CDS3487.1"
FT   CDS_pept        complement(387565..388671)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04774g"
FT                   /old_locus_tag="DEHA0A04796g"
FT                   /old_locus_tag="DEHA-IPF6597"
FT                   /old_locus_tag="DEHA-CDS3487.1"
FT                   /product="DEHA2A04774p"
FT                   /note="similar to uniprot|P32449 Saccharomyces cerevisiae
FT                   YBR249c ARO4"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84484"
FT                   /db_xref="GOA:Q6BZ40"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ40"
FT                   /protein_id="CAG84484.1"
FT                   /translation="MSKTPIPDEYDDTRILGYDPLIPPALLQHEIRASKESLDVVIRGR
FT                   IESSEIISGKDDRCLVIVGPCSIHDTEAALEYATRLKKLSLELENDLVIVMRAYLEKPR
FT                   TTVGWKGLINDPDVDNSFDINRGLRISRQLYSDLTGKTGLPIGSEMLDTISPQYFSDFL
FT                   SFGAIGARTTESQLHRELASGLSFPIGFKNGTDGNLGVALDAVQASSKGHHFMGVTKNG
FT                   TAAITTTKGNENCFIILRGGKKITNYDPESVAAAKEAINKSTDPNIKLMVDCSHDNSQK
FT                   DYRNQPKVMESVVDQISKGENALIGVMIESHINEGKQSMPGPKEDKSALKYGVSITDGC
FT                   VGWETTVELLHNLSKAVQERRQINKSKA"
FT   gene            <389247..>390491
FT                   /locus_tag="DEHA2A04796g"
FT                   /old_locus_tag="DEHA0A04818g"
FT                   /old_locus_tag="DEHA-IPF6601"
FT                   /old_locus_tag="DEHA-CDS3056.1"
FT   CDS_pept        389247..390491
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04796g"
FT                   /old_locus_tag="DEHA0A04818g"
FT                   /old_locus_tag="DEHA-IPF6601"
FT                   /old_locus_tag="DEHA-CDS3056.1"
FT                   /product="DEHA2A04796p"
FT                   /note="similar to uniprot|P47040 Saccharomyces cerevisiae
FT                   YJL059w YHC3 basic amino acid transporter activity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84485"
FT                   /db_xref="GOA:Q6BZ39"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ39"
FT                   /protein_id="CAG84485.2"
FT                   /translation="MQLLIPESRIVFASFFIFGLLNNILYVVILSAAIDLVGSATPKAT
FT                   VLLADIIPSFTIKVMAPFFVGLISYRTRIWMLVGLSSFGMLVISLTSDESINAKIVGIC
FT                   MASLSSGLGEVTFLQLTHFYQREYSISGFSSGTGGAGLLGSFVFMLLTNMLGMKVWVVL
FT                   LLFAVLPLGFLMAFYVMLPKARGGGGDEPGYEALDSLDERSDPSSNASFSSSQTVSLKG
FT                   HVVSTIKNILPLIRPYMLPLCLVYVSEYIINQGISPTLLFPLDELPHWLFSSYRDIYVV
FT                   YGFMYQLGVFVSRSSISFGIRIKRLYLLSVLQFANVVITVYQSVHDKPFSSVWLLLALI
FT                   FYEGLLGGFSYVNTFMSVSEEVSKSKREFSMGCVGISDTFGILLAGCINWSLEPHLCSL
FT                   QVNRGRDWCLNGGSA"
FT   gene            <390629..>391990
FT                   /locus_tag="DEHA2A04818g"
FT                   /old_locus_tag="DEHA0A04840g"
FT                   /old_locus_tag="DEHA-IPF6603"
FT                   /old_locus_tag="DEHA-CDS2703.1"
FT   CDS_pept        390629..391990
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04818g"
FT                   /old_locus_tag="DEHA0A04840g"
FT                   /old_locus_tag="DEHA-IPF6603"
FT                   /old_locus_tag="DEHA-CDS2703.1"
FT                   /product="DEHA2A04818p"
FT                   /note="similar to uniprot|P47039 Saccharomyces cerevisiae
FT                   YJL060W BNA3 Arylformamidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84486"
FT                   /db_xref="GOA:Q6BZ38"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ38"
FT                   /protein_id="CAG84486.2"
FT                   /translation="MFVRLLKSNRKFNIRTKTTMSNFDPATLHNPYFNQKSGQKDIWTL
FT                   INETAAEAQKESGKSIVNLGQGFFSYNPPDFAIEAVNKATSQPQFNQYASARGNPNLLN
FT                   ELSSLYTKEFNRKVGTDEIQITTGANEGMFSIFFGYLTPGDEVIVFQPFFDQYIPNIEM
FT                   CGGKVKYVQLKFPEKFNGESVSGDDWEVDWEGLTNAITDKTKLIVINTPHNPIGKVFTE
FT                   EELYKIGKIAIGNNLILVSDEVYENLYYSKSFTRPATLSSLPELAERTLTIGSAGKSFA
FT                   ATGWRVGWVHGPASLIKYVTAAHTRICFSTPAPLQQAVADGLKQAASNKYFEITRQEYV
FT                   KKYELFTKVFDELNLPYTSAQGGYFLLVNLSKVKIPNDFEYPADISDKGTNDFKLAYWL
FT                   IKEIGVVGIPPTEFLYPADRQGNGLENCLRFAVCKDNSILEEAVEKLRLLKEYL"
FT   gene            complement(<392025..>393245)
FT                   /locus_tag="DEHA2A04840g"
FT                   /old_locus_tag="DEHA0A04862g"
FT                   /old_locus_tag="DEHA-IPF6605"
FT                   /old_locus_tag="DEHA-CDS3120.1"
FT   CDS_pept        complement(392025..393245)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04840g"
FT                   /old_locus_tag="DEHA0A04862g"
FT                   /old_locus_tag="DEHA-IPF6605"
FT                   /old_locus_tag="DEHA-CDS3120.1"
FT                   /product="DEHA2A04840p"
FT                   /note="similar to uniprot|P38347 Saccharomyces cerevisiae
FT                   YBR271W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84487"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ37"
FT                   /protein_id="CAG84487.1"
FT                   /translation="MDFDPLSLFTPSVTKEDYSEISLSRSLDDYSDNKVLIDFEDNLFQ
FT                   PLHVLDLPLLQLKPPAEVLLMFLKLLSPDEVYNFTKPESVNDEDKKIDTWKTFENKEIT
FT                   EELLNTALEWLANFCPRFSNKLKLSYIPFLSTSLKRNYESQYNAWLTRIISSQLPWVTD
FT                   SEFKRIISKEASLRLAENCGRTAQPEIVRKIGLPNLSKYLKGTEYIKLKEPSLTSDNLG
FT                   LKTWGSSLILANRLINKNNDEYLTGPVLELGSGTGLVGIISSILGYETYLTDLIEIIPN
FT                   LQDNVQINSIDANVDELNWCDPSSFIAKYGHDKKFNTIVLSDPIYSSKHPYWVVDMVEK
FT                   FINSKNNNARVLIQIPLRPKFEDERSLLWELMNKNFTEIEHEIESGFDDFGEMGFCFKK
FT                   FIRKTSI"
FT   gene            complement(<393627..>394034)
FT                   /locus_tag="DEHA2A04862g"
FT                   /old_locus_tag="DEHA0A04884g"
FT                   /old_locus_tag="DEHA-IPF6606"
FT                   /old_locus_tag="DEHA-CDS6394.1"
FT   CDS_pept        complement(393627..394034)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04862g"
FT                   /old_locus_tag="DEHA0A04884g"
FT                   /old_locus_tag="DEHA-IPF6606"
FT                   /old_locus_tag="DEHA-CDS6394.1"
FT                   /product="DEHA2A04862p"
FT                   /note="similar to uniprot|P38345 Saccharomyces cerevisiae
FT                   YBR269C FMP21"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84488"
FT                   /db_xref="GOA:Q6BZ36"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ36"
FT                   /protein_id="CAG84488.2"
FT                   /translation="MLQKIRPVFRQQILMPLRVDIRCYSKFSTEYTPSPPKLPKEQQEE
FT                   FEALQKIANSQAAIDQYNEQMETTGSANSDSVDTSAPPKTDIGGFHPEYFKTIPEFEGD
FT                   VNPVTGERGGPKQDPLKHGDEWSFNGRVTDF"
FT   gene            <394613..>395782
FT                   /locus_tag="DEHA2A04884g"
FT                   /old_locus_tag="DEHA0A04906g"
FT                   /old_locus_tag="DEHA-IPF6607"
FT                   /old_locus_tag="DEHA-CDS3270.1"
FT   CDS_pept        394613..395782
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04884g"
FT                   /old_locus_tag="DEHA0A04906g"
FT                   /old_locus_tag="DEHA-IPF6607"
FT                   /old_locus_tag="DEHA-CDS3270.1"
FT                   /product="DEHA2A04884p"
FT                   /note="weakly similar to uniprot|P53830 Saccharomyces
FT                   cerevisiae YNL286W CUS2 Protein that binds to U2 snRNA and
FT                   Prp11p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84489"
FT                   /db_xref="GOA:Q6BZ35"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034393"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ35"
FT                   /protein_id="CAG84489.2"
FT                   /translation="MSDFPDAPPLPSLMSKDPDILKTVDERLSYDKSSSQWFFEVNNDN
FT                   KSTEYYYNFILERWIPTAEIEDNGRKRSREDETIHDEEEENKLAIKNLKKQKLKEMKEQ
FT                   MNKSKADGNKNKSTFENTGVYVSQLPGDITKDELMVTFSKYGLISEDYKTGEPRIKIYH
FT                   NDGQRDDQRDALIIYHSKESVSLAIEMLDDSSIRPPSDKDQTKIKVQPAEFKKSDSDTT
FT                   NDKKKTLTYEEKKLLNKKKEMMKKKLSSWDDDEGTIQAGDSDKTNNIKKRIWDKIVVIE
FT                   KMFRIEELKSDPLLEMDLKEDIQDECNKLNIGNDVTKITIYDVSGIITVKFNNGDSSLK
FT                   CIESFSGRYYDGLTLKAYLYQGEKFQKTSQDKENEGERLDSFGNWLEKK"
FT   gene            <396142..>396212
FT                   /locus_tag="DEHA2A04906r"
FT                   /old_locus_tag="Deha0A.2"
FT   tRNA            396142..396212
FT                   /locus_tag="DEHA2A04906r"
FT                   /old_locus_tag="Deha0A.2"
FT                   /note="tRNA Gly (GCC) cove score=62.33"
FT   gene            complement(<396327..>398843)
FT                   /locus_tag="DEHA2A04928g"
FT                   /old_locus_tag="DEHA0A04950g"
FT                   /old_locus_tag="DEHA-IPF6609"
FT                   /old_locus_tag="DEHA-CDS0733.1"
FT   CDS_pept        complement(396327..398843)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04928g"
FT                   /old_locus_tag="DEHA0A04950g"
FT                   /old_locus_tag="DEHA-IPF6609"
FT                   /old_locus_tag="DEHA-CDS0733.1"
FT                   /product="DEHA2A04928p"
FT                   /note="similar to CA3823|IPF10651 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84490"
FT                   /db_xref="GOA:Q6BZ34"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ34"
FT                   /protein_id="CAG84490.2"
FT                   /translation="MAGTDSTGKFISEITQQQIFHTFLESLSVDSKSKLLSQNKLVCRN
FT                   NLDLFFANENLVRCCTINPEYTNFRLLDNKYDDFKIRSLEMNSSGSLMAIIGDTELVVV
FT                   SLPTSLTASNSSLLQVKSYRIHGIEGQIKKVIWQSIVANDCCLVVLNDKSEIKSYDLSL
FT                   SSYEPQLSIDLGKDDAFKGEVARSISFGSSANLSGSLTLYVATSSSNIFAIYPFIHKLG
FT                   KIATTESNVRDLLDESTSLITAVQERFPSKDLVQSSHQSVLNHASMKQYAYISSLYKQF
FT                   ETSFAPRREYRQLLSTNPLELSVLSQELPENFLPIVQGPVTITKDKTLKDLTCIGSNDN
FT                   ISILVSISISAGNETFLSYHSQLKPLIMKWSDVNDQTLKKEEVTPNNNRQSQVNEKEKN
FT                   HEKGYIRPKRGFGYIDEVELSNEEEEKIPHINSNEFESKNREIEILFWKDEFTELSTLA
FT                   IDQIPVSASQDIALSTLNSEGSKISIKIGNSIIYFDCGKWCEELVLDVSNGHIPQNLDV
FT                   SSKYTLVVDGVQEISSFALIKDTMNETGDFLIILKTQKDNNLEVKQISENTTPNPDPEI
FT                   IEIDTIIEKVNHESILIKEPFDELLSELDILKRVNPETLGKSLYMNKELAGVPIYGTNT
FT                   EILKNLNHLSTETIQQISKFTSFAIHLNLRVTTQIDELKFQINNLQRIQKLGLDDGILD
FT                   SKNEKANDLIARQNKINDRIQKLQDKIFDANQKLRYSKSLPLSDAEKLWFKEINSVNAQ
FT                   VSQDTDNAKCLNSVVENMTSQVSKIVNSIKEGEKQTEETQKFENKLKNLQEHHNILKLK
FT                   QWLQEENDLIVLVKEKLDESFEQLKI"
FT   gene            complement(<399014..>400399)
FT                   /locus_tag="DEHA2A04950g"
FT                   /old_locus_tag="DEHA0A04972g"
FT                   /old_locus_tag="DEHA-IPF6611"
FT                   /old_locus_tag="DEHA-CDS2634.1"
FT   CDS_pept        complement(399014..400399)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04950g"
FT                   /old_locus_tag="DEHA0A04972g"
FT                   /old_locus_tag="DEHA-IPF6611"
FT                   /old_locus_tag="DEHA-CDS2634.1"
FT                   /product="DEHA2A04950p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ33"
FT                   /protein_id="CAG84491.2"
FT                   /translation="MRTRRSFATLRKATSNVSLVGDSASVGTNYSAAKLWRFHRHFASR
FT                   SNGTEISPVRRTYRKRDRFKAVFTGWGTRYSVYQNDVASSIFDVEPDQIDVHEDTEHGN
FT                   SDDSLFSVMQQARSNTFFNRIKSGRNSYSQNEIGSESLRPDSVLKMAGSKRLSSRYIKE
FT                   RILHRLARKPPTANGSSETMFEIPPELTKTIASCVLDNRSFVSTEDSLSGNLDLKVNLS
FT                   SLDYKTQSTPRKETPPDGSLEFTPRYHHEFHIEPPPKNLPKHLHAKWERSQMFKNTART
FT                   YDHEKWKSKQSLVNQENNTDDEKPNTDLSITTKSTTKDCDNVSSNLFENVTKLFTPNNS
FT                   SKVSSCTPSSSKSVFDTTKLFLPATPKIGNLSTVFSLKNRKLSHNSLSSRFTSVASSFQ
FT                   STSTISSSATACKVSTITNKNFNYPENYSLYSQDTFCYKKTNKYVNNIEDRPQDETFSE
FT                   FSF"
FT   gene            <400963..>402126
FT                   /locus_tag="DEHA2A04972g"
FT                   /old_locus_tag="DEHA0A04994g"
FT                   /old_locus_tag="DEHA-IPF6613"
FT                   /old_locus_tag="DEHA-CDS3291.1"
FT   CDS_pept        400963..402126
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04972g"
FT                   /old_locus_tag="DEHA0A04994g"
FT                   /old_locus_tag="DEHA-IPF6613"
FT                   /old_locus_tag="DEHA-CDS3291.1"
FT                   /product="DEHA2A04972p"
FT                   /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
FT                   YGL213C SKI8 essential for protection against viral
FT                   cytopathology"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84492"
FT                   /db_xref="GOA:Q6BZ32"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ32"
FT                   /protein_id="CAG84492.2"
FT                   /translation="MGKQYISTASASDAHKSDILGLSVTDRYTITVSSDGYANFWDNKK
FT                   YELQEPNEIVVKQFVNKMGVHHVVAYESILPASHVKIVLIAFASFDGSISFKYFINDEL
FT                   SSLTDAEIPFGANSANWSPCFYKDPESKQDYFIVTQANGSALVYYLNIESSKDSADIGI
FT                   KLEKFGDLNNANSSLFPNSVAVSPGVDKKVAVGYTNGDVLLYDLTTLKPIYTFRSTDLQ
FT                   VSNKSTSASSIPRVLAFSPGGSLLAVARDNQSAGSITLYDVKYGENVGSLTTPSHSSKT
FT                   TIGGFAHDGWIMGLSFDESGEILASCAFDNCVRIWNIETREREATINISPSDLEGTNDN
FT                   ELDNSIASGVQFIKKGIRAGANGDSNEGLCVVSFDRAVRWYREAGGI"
FT   gene            complement(<402169..>402951)
FT                   /locus_tag="DEHA2A04994g"
FT                   /old_locus_tag="DEHA0A05016g"
FT                   /old_locus_tag="DEHA-IPF6614"
FT                   /old_locus_tag="DEHA-CDS4693.1"
FT   CDS_pept        complement(402169..402951)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A04994g"
FT                   /old_locus_tag="DEHA0A05016g"
FT                   /old_locus_tag="DEHA-IPF6614"
FT                   /old_locus_tag="DEHA-CDS4693.1"
FT                   /product="DEHA2A04994p"
FT                   /note="similar to uniprot|Q5WJ75 Bacillus clausii ABC1041
FT                   2- deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84493"
FT                   /db_xref="GOA:Q6BZ31"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ31"
FT                   /protein_id="CAG84493.2"
FT                   /translation="MLSLFSLEGQVALITGGTNGIGLGMAKGLADANIDQIILTYRSEK
FT                   PLENTIKVLQEVNPKVKISSIEADFGTGNEDDLVAKIATEAFKKSVSGKIDILINNAGI
FT                   NNRFPFDEFPQDKFDEVLRVNLNIPVKLTKAIGCKMLETKTKGKIVFTASLCSFQGGVD
FT                   STAYAITKGGIKQFTAALSNDWSSKGIRVNSIAPGYISTNLTEQIDPKRRETLISRIPI
FT                   GRWGNMDDFQGPAVFLCSEASRYVTGETLVVDGGWLGY"
FT   gene            <403138..>405516
FT                   /locus_tag="DEHA2A05016g"
FT                   /old_locus_tag="DEHA0A05038g"
FT                   /old_locus_tag="DEHA-IPF6615"
FT                   /old_locus_tag="DEHA-CDS0910.1"
FT   CDS_pept        403138..405516
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05016g"
FT                   /old_locus_tag="DEHA0A05038g"
FT                   /old_locus_tag="DEHA-IPF6615"
FT                   /old_locus_tag="DEHA-CDS0910.1"
FT                   /product="DEHA2A05016p"
FT                   /note="some similarities with uniprot|Q12748 Saccharomyces
FT                   cerevisiae YLR381W CTF3 Outer kinetochore protein that
FT                   forms a complex with Mcm16p and Mcm22p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84494"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ30"
FT                   /protein_id="CAG84494.2"
FT                   /translation="MEIGEDIFDRNKRNLEVVSEKLNQLIDREVVNKQTLLEDLSSLVA
FT                   KTGVDEAQLNSLLDLVFDLKTPTFLKSTQKRFIIKNLLIPNGNYKLSKHIAYRIISSIG
FT                   VPQIYYKNGKESKSKKLSTGIQICLLEWLICSYHLFGSKVFNNLSMITILVNYLSYEFS
FT                   RPYVANLIFLSVSNNNRMFKTYFMPNTTHNIAPFKPWHVQCVVDLFNKFPMDEHLKSLL
FT                   ILFKSQYPSIDFTNFARNDSYHLNNLGTLNPRIFVYPNFNYLDKLRDIQAINGGILTKE
FT                   QLGQEQIINDNLRYYDNFSASVKKRKRIGNTQKLADVPDLDVIEFGNSSNRSSSVSIND
FT                   IHSLDSLIGNFENIRLININALFNPQKFGNSRYISDKFKKFYFVLQGLSVDVEQWEKSI
FT                   RKLDYYIRLSILDNNLSIRDLDILCDKIADFFSFTLGLLFLPSIKDYLCFKFDSPISSD
FT                   NEYIHKFENLAQRLKFLKYLPVLEFEEFNEDIIQNILTVFDEKSHINAKKSRREQAFIT
FT                   FINELVSLFSTWYSIYAQNSDLELKSAIFKNINGSLPIIYKVLVEKFTESSITLQISLL
FT                   RIFTFIQSLDSYHLNEFINASTIVLPQSLFYPLILSNNPLIMSEACGYMAFCKTYKFKE
FT                   HDTAYKNLQNSYIMDTLNFIWRDKSFYYDEDSTAFSRAMFLDPEFLKNLRKLNIFNFSE
FT                   LLSLHTVGNIFHNPCWSFITTQLIRELEDKTENITIRHAGPITEESVSKLTHISGVEWL
FT                   PMNYDELKLQVLRSLDSLGYTGIADLLFSSLKTLMNKRN"
FT   gene            <405660..>408494
FT                   /locus_tag="DEHA2A05038g"
FT                   /old_locus_tag="DEHA0A05060g"
FT                   /old_locus_tag="DEHA-IPF6618"
FT                   /old_locus_tag="DEHA-CDS0510.1"
FT   CDS_pept        405660..408494
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05038g"
FT                   /old_locus_tag="DEHA0A05060g"
FT                   /old_locus_tag="DEHA-IPF6618"
FT                   /old_locus_tag="DEHA-CDS0510.1"
FT                   /product="DEHA2A05038p"
FT                   /note="similar to uniprot|P11325 Saccharomyces cerevisiae
FT                   YLR382C NAM2 Mitochondrial leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84495"
FT                   /db_xref="GOA:Q6BZ29"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ29"
FT                   /protein_id="CAG84495.2"
FT                   /translation="MLSIRQSAHIRAPIIRKCVGISKSTSRYSSVDTNQSTKTQINLNE
FT                   LDGKWAERWRNMSPNGSLHPSKHMVDESAEPFYCLSMFPYPSGMLHMGHLRVYTISDVI
FT                   ARFKRLKGYNVIHPMGWDAFGLPAENAAVERGINPAIWTDSNIQKMKEQMSLMLADFDW
FT                   DREISTCSPDYYKWTQKIFLLLFEHGLAYRNEAEINWDPVDQTVLANEQVDSEGKSWRS
FT                   GALVEKRNLEQWFIGITKYAKDLNEDLKVLDKWPDKVKSMQSHWIGESQGAEIKFLTND
FT                   NQFSEIQVFTTRPDTLFSAQFIALALNHPLVEKYAADDPKLAQFIKNCENSAIDSKEGY
FT                   LIEDVNVSIPITVNNEKNHKYDMRVYAAPYVLGTYGHGAVMGCPAHDERDFEFWKLHNP
FT                   TIAPLQSVGSLEPNKNENNVLYTNKRGILYDSSVLPNGVQDLGKYNRKSTSKAAHDIVE
FT                   TLERYNLGSKSIQYRIRDWLISRQRYWGAPIPIVHCDSCGPVAVPDDELPVMLPEIEGQ
FT                   SFGKGNPLAKLDEFVNTKCPSCGGNAKRDTDTMDTFMDSSWYFFRYTDPTNTQLPFDHA
FT                   IASKHMPIDMYIGGVEHAILHLLYSRFISKFLGDIGLWDGKDHRHEPIKQLVTQGMVHG
FT                   KTYTDPESERFLKPEELDLSNVNEPKIIKSGLLPKISFEKMSKSKYNGADPSECIKKYG
FT                   ADATRAHMLFQAPISDILNWNEEQIHGIDRWLRKVVNLNDVIAESMLNDNGRTNNDNCT
FT                   EYQNIQLNDITYETIKFNETEFELYNDAQNYVESVSKAIEIDFSFNTIISDFMKFTNSI
FT                   YAAIKSKDYVNSNLLLDSYKRLLIIMAPVTPCVAEECWEQISKSIRTPWSSIFFQKYPK
FT                   VNHIESSYTSYNVFVNGKARASFKGQKSLVTMDEHEILQEALRHGSISQYVPDGVVKKM
FT                   IVKPGMISLLTPKK"
FT   gene            complement(<408696..>411059)
FT                   /locus_tag="DEHA2A05060g"
FT                   /old_locus_tag="DEHA0A05082g"
FT                   /old_locus_tag="DEHA-IPF6622"
FT                   /old_locus_tag="DEHA-CDS0865.1"
FT   CDS_pept        complement(408696..411059)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05060g"
FT                   /old_locus_tag="DEHA0A05082g"
FT                   /old_locus_tag="DEHA-IPF6622"
FT                   /old_locus_tag="DEHA-CDS0865.1"
FT                   /product="DEHA2A05060p"
FT                   /note="weakly similar to uniprot|P48237 Saccharomyces
FT                   cerevisiae YGR150c singleton"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84496"
FT                   /db_xref="GOA:Q6BZ28"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BZ28"
FT                   /protein_id="CAG84496.2"
FT                   /translation="MMLRLSVKKRCMSRTIPRISGLQGSIYSSRNIFVVRSQKGKPTLR
FT                   KSKGSNDGGAVNNKEKLSEWVDSDFERKMKQQEVEYERRLKELKSLTASVARIIKKKED
FT                   IEKLQEIPMPSEVNRDAEKIYGSLEVGKEKLASLPENSPSLSGIEKQPEPFNASNHSLI
FT                   TPAIDMPESITKRLGLAIKFLVSKTNINWTMVLQQLKEGGGFQGLPERDIRMFIYSIPK
FT                   EQISHLIPVLEQLLEEGNVKKSSKIINVFIAGLSHGGYLSDESIAQIEQYCNHITKINK
FT                   KGKLSRETYELMIQAYGKNNNLEKINMCLSEMKQNKLEPSQKTFSNILSTCVYKANDHK
FT                   QAVEIFDSMKFLSQKTKPDTRAYQDIIVSYVNNDNIEKALDLYREMITEKIEINQRIMV
FT                   ALARGCTSRPELRFKAWDFIFDIYNNNWEPTLNTFEYMLYLSAKDGDVALSRAFYSKLN
FT                   ESNAITPRSFSFLLLAYSKSQVSQPGQSIELPPITFHEKGRNFRRNILSDVNLFPASAQ
FT                   NGIPFLPVLDLTSKEEIMAESSAMWAHTLMFNPSFVNTDCANTFLNIAAVMGRLNDFID
FT                   RYDSSTFLDRTGLSNDTRIIIEELPDSISSNTDISQTDGESVSSVQSKFDEMSITKSPL
FT                   LKDVGSNIGLGNRKISRTSLSYVIALKAAARFKNYKFAQRIWSERGTFRKTSNFKDLSR
FT                   STKDALDFQFANAMVSCLTKMNLLDDALAILLSTEYQFKWTWKELRELYQAASDIDHSD
FT                   ACKSIRGIAKRAQINYEGKIRRKDFKRYVMERGY"
FT   gene            <411286..>416046
FT                   /locus_tag="DEHA2A05082g"
FT                   /old_locus_tag="DEHA0A05104g"
FT                   /old_locus_tag="DEHA-IPF6623"
FT                   /old_locus_tag="DEHA-CDS0088.1"
FT   CDS_pept        411286..416046
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05082g"
FT                   /old_locus_tag="DEHA0A05104g"
FT                   /old_locus_tag="DEHA-IPF6623"
FT                   /old_locus_tag="DEHA-CDS0088.1"
FT                   /product="DEHA2A05082p"
FT                   /note="some similarities with uniprot|Q86ZP4 Gibberella
FT                   zeae CPS1 Acyl CoA ligase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84497"
FT                   /db_xref="GOA:Q6BZ27"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR037337"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ27"
FT                   /protein_id="CAG84497.2"
FT                   /translation="MSSSTVVGSAPGRNRGNSNANLHPDIGSVSATDANAITSSKPYNS
FT                   STPVGSAGGSSFPGGIAHDIPPDMSLLLQELEEDFTVNKTIDQWTYINRREEIMQSVNK
FT                   LHQQQQSNIELDSSMLEKPLYPRKAAEIMNENNLSSGYLMGILANRARIYKAEVAFSVL
FT                   DAKGKEISSITWEKLYTKAVKVAHEINKMALKNSDTVVLLYKDGEVCEFVVAMFGCFMA
FT                   GVTAIPIHQDISLHEVLDIINLTSTKLVLYSDTVAKELDKLNATGQKIIWPPKLIRWKT
FT                   TDFGSAKKSDLATWTNKISQQQQAPRESKSDLAYVEFSRSPVGELRGIALSHRTIVHQM
FT                   NCLDITLSSLPESGGGLQRSYKEYKGNKKVVLATLDIRFSIGLILGILFTVYSGNMLVW
FT                   VPQKVMEVQGLYANILSKCRASLLLADYLGLKRVTYDYQQSPNSTRYYSKTQKVDFSSV
FT                   KWVLVNALTIDGEFIEILAQRYLRPLGCQEPENAIIPMLTLSEYGGMVISLRDWLGGKE
FT                   KLGIEDADESSSSELSAVSIDKEALSRNIVKVVDTAPSSSDENSADTLRVDAFGFPLPD
FT                   ATLAVVNPESSLLVTKGELGEIWIDSPCLSGGFYGLRKESKSIFHAKCRDANGILEMDF
FT                   LRTGLLGFTYNGKIYVLGLYEDRIRHRVSWIDQKLYYKLKKNLIIGNGFRYHYSSHLLA
FT                   TLASEVRNVYDCTIFDVFIGNEYLPVAIIEAEVIRKSVDPNNNDNAVTGGGKAQNNSGD
FT                   GSQANSAVPLNEPVLNSIAQKCFDTLYKHHFLRLYCVLIVDCDTLPKIMRSGGREIANM
FT                   LCKKRFLEGSLKAEYVKFFVSKSISMIPHGEDVIGGIWSPYVSRLRNSALSRFPNQFSA
FT                   VDYREKSIDDKTGAPLTDFKSILDILKFRVASAGDAIAFQSIDNSGKSASKPLTWKKFE
FT                   HRVYAVCSYLIDKLSIKPGKYIILMYSLSEEFVIATYACLICGVIPIPMLPFDSNRIGE
FT                   DFPAFVGVIRDFDIHEIFVNEEVEKFLKNGPVADALKKMNNKKSTIHKIKNTGKLTKVS
FT                   NIASLNSKIKRYQGESNFRDDKTIAMVWLNFTSDHYRVGATLSHKNIIGICKVFKETCN
FT                   LSSNSSIVGCVRHSSGIGFVQAVFLGVFLGTTTYLSSPVTFAENPLAFFLSLARYKVKD
FT                   VFVTEQMLKYAALKFTPKGFNLANLKNMMISTEGRVEIDLLRKIAKVFQPTKLSAASMS
FT                   SVYTHCFNPIISTRSYMTVAPVDLYLDPIALRQGYISAVNQVDVPNALHIQDSGMVPVC
FT                   TEIAIVNPENNMICKEGEFGEIWVCSEANLTSFTNGPNGPIDNFSRQQFLGKIQDGNPE
FT                   MTYLRTGDLGFLHHISITKNSNNDNTNQPESTSFQPLFVLGKIADTFEVMGLHHFPIDI
FT                   ENTIESCHVDIFKNGSCIFKCAEYTIVVCESRRMRNFASLVPLIANTVLSKHHIIVDIV
FT                   AFMKKGEFPISRLGTKQRARIIDAWVQGILPVTASYGVNYGESNMTKLVKEIDAVARDH
FT                   PITGLKNPALSFYDLDLVDEYEDIFDGNQHGLALNDGNFDIVDKRKAVFSMSNNSSVSD
FT                   ESLPVHK"
FT   gene            <416207..>419344
FT                   /locus_tag="DEHA2A05104g"
FT                   /old_locus_tag="DEHA0A05126g"
FT                   /old_locus_tag="DEHA-IPF6626"
FT                   /old_locus_tag="DEHA-CDS0385.1"
FT   CDS_pept        416207..419344
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05104g"
FT                   /old_locus_tag="DEHA0A05126g"
FT                   /old_locus_tag="DEHA-IPF6626"
FT                   /old_locus_tag="DEHA-CDS0385.1"
FT                   /product="DEHA2A05104p"
FT                   /note="some similarities with uniprot|P14907 Saccharomyces
FT                   cerevisiae YJL041W NSP1 Essential component of the nuclear
FT                   pore complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84498"
FT                   /db_xref="GOA:Q6BZ26"
FT                   /db_xref="InterPro:IPR018892"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR037642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ26"
FT                   /protein_id="CAG84498.2"
FT                   /translation="MSYDRKRPISPRTIDKGNNGGFGIAKLFNFLKPRSSQQYKQQKQR
FT                   QNQIPSRNQQDASHIETDPLVNNFSSSRKRTLSIQSLHNNDVVPRSSTLNSNFGSYTNY
FT                   YDNLKNENEVLDNDLERRLSTEYGSDLVKESILPTSKPEFRERDDSPMSGLMKPRPSIL
FT                   PEINEKENHEDMPLIIEHEFAPLYKDSDGNLVRPPFINLDPRERYHVLQLKKSIQASES
FT                   LQNRIKYMVNPNETQSKPLYETNKVETSTQTHDLNYLENSLNLSGLKRRLSSKKECTKN
FT                   KRAKNSKGYFTGEFLYDDIESNEKSKDKLHGYLGDVTKPKFNNTTAISKNDKSASVQPR
FT                   KDESQIFNRFSNQNVKSTDNRIGLDNSLLNNEKVNVSLDSDYVTNAEKISNIIKLKADS
FT                   SNKPKEKELVQPSSGFKFSINSNDINSIINKKQEDDELVNKSNETLNKDGDGTKPSFSF
FT                   GASAEKKDNTNQSLLSFDSSGVKKDFSSEPAFSFGARNESDGTSEPTLKRGRVSEEKGV
FT                   TKPALSFGKPTEKKDDLAKPTFSFGESADKSNGTSKPKLSFGAPSENTDNNKPPVSFGS
FT                   SSEKDNSNITKTTFSFGATSDKKEDVMKPSLSFGASANKNDGIPKPTFAFGASSENKDD
FT                   SNSAGKTDEKTDNAIKPSFTFGMSTEKNDTPKPAFTFGASTEKKEDTTKPAFTFGAGTD
FT                   KKDVIPKPTLTFGAGTDKKDVIPKPTLTFGAGTDKKEDTTKPTFTFGASSEKKEDTTKP
FT                   TFTFGASSEKKEDTTKPAFTFGAGTEKKDDSPKPALTFGADTEKKEETPKPAFTLGAGS
FT                   EKKEETTKPAFTFGAPKINETPNPAFTFGANEKKETTPSFSFGEKPAGGIGAPSFGALN
FT                   QNKDSAPKPFEKPTAPFGSGSTTPNFSFGSRDSTPKPNFSFASGTGANAMPSNAPQPNN
FT                   LFNFTGTVNKEGTPDPASIFGGGANNMNTSNIQNGVNGLNKSAESSPFGFNAHQSTPDF
FT                   KFANGIQQPQFNSGLPADMNNQSFNSTSGMTPPTLSTTPPIIKSNRKIAQMRSRRR"
FT   gene            <419642..>421276
FT                   /locus_tag="DEHA2A05126g"
FT                   /old_locus_tag="DEHA0A05148g"
FT                   /old_locus_tag="DEHA-IPF6628"
FT                   /old_locus_tag="DEHA-CDS1951.1"
FT   CDS_pept        419642..421276
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05126g"
FT                   /old_locus_tag="DEHA0A05148g"
FT                   /old_locus_tag="DEHA-IPF6628"
FT                   /old_locus_tag="DEHA-CDS1951.1"
FT                   /product="DEHA2A05126p"
FT                   /note="weakly similar to uniprot|Q6B265 Saccharomyces
FT                   cerevisiae YLR380W CSR1 Phosphatidylinositol transfer
FT                   protein with a potential role in lipid turnover"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84499"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ25"
FT                   /protein_id="CAG84499.2"
FT                   /translation="MADYSSVKYRSGRIQTINAEQEIVLKQVWAHYLKYFGYEVNISSE
FT                   DIKFKESFIPSTTTIEYGESTGELGFSNGLVKTNTRGSLNSNASLKSSTKKKGFFQKGH
FT                   AEPPKIPAGSKRMRDIEAQCTTERYIPVIDASEEFKYMYYDYYKQGYESEDESGDDVSD
FT                   MNSMDTFITASTSITDPGSYELVQGLGKQNVSAQSLGSAPRSFQLKPNTKIIPCLSRYK
FT                   PEELHASLFKALRNDLFDNYLLRFVRARKFKYDEAIAMLSKSLDWRHNTLEADDFLLEG
FT                   DAPSYMNGTNKGFIKNFTVGKCYTRGVDKQKNPIVLFKARLNYPSDSPLEGTKRYALVI
FT                   IEWSRLNLKDISDSRDQCSVIFDLTGFSLKNNDLPAIKFLAEIFEAHFPEILGSILIHN
FT                   APWIFSTIWNLIKNWLDPVVASKIHFTKSTKDLNQFIDSDNLPESMGGKDPYAGEYPEP
FT                   KAEDCHPPKPKDAVYRQLKKERDENLVKFLETTKRWIESTDSDVSARYLQDKIDLGTKI
FT                   AQLYVDLDPYVRIPGIYDRNGSIDLSI"
FT   gene            <421731..>422888
FT                   /locus_tag="DEHA2A05148g"
FT                   /old_locus_tag="DEHA0A05170g"
FT                   /old_locus_tag="DEHA-IPF6630"
FT                   /old_locus_tag="DEHA-CDS3309.1"
FT   CDS_pept        421731..422888
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05148g"
FT                   /old_locus_tag="DEHA0A05170g"
FT                   /old_locus_tag="DEHA-IPF6630"
FT                   /old_locus_tag="DEHA-CDS3309.1"
FT                   /product="DEHA2A05148p"
FT                   /note="some similarities with uniprot|Q08923 Saccharomyces
FT                   cerevisiae YPL181w CTI6 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84500"
FT                   /db_xref="GOA:Q6BZ24"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ24"
FT                   /protein_id="CAG84500.2"
FT                   /translation="MSRRSGRSKAYPDQSELNSEFPEDDEINNYEAEAEDEVDEEQEVT
FT                   RCICGQDEVNTRGINPQLHALLWKEYQMKIDNGLFIQCDKCSVWQHGYCVGLFINEDVP
FT                   EKYWCEICKPDLHIFIYDNNETVRSLYKPVNDKRKKLLLENSISQENNNKRNKAKRQAQ
FT                   SNSSPVSASESNKHPRKERRHYDESYDEQLQQALRESAKESGISYDTKNKNKRKKNGDS
FT                   SDTNKKLKHESEQGQSNAEEAEMNDEIKGDSKLKKSKIKSKSSKSKVAKNPSNDSTSAT
FT                   MTKEELINQASKPRYVNEKSSIYELRKRTGAILEWLGRSQLELEEEKLNKIELFSYKDK
FT                   IDLNQQQIDQDNNKVIDGFNENLQLMEKLTEKILNWEQQFGKYAP"
FT   gene            complement(<422930..>424774)
FT                   /locus_tag="DEHA2A05170g"
FT                   /old_locus_tag="DEHA0A05192g"
FT                   /old_locus_tag="DEHA-IPF6631"
FT                   /old_locus_tag="DEHA-CDS1613.1"
FT   CDS_pept        complement(422930..424774)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05170g"
FT                   /old_locus_tag="DEHA0A05192g"
FT                   /old_locus_tag="DEHA-IPF6631"
FT                   /old_locus_tag="DEHA-CDS1613.1"
FT                   /product="DEHA2A05170p"
FT                   /note="similar to uniprot|P38932 Saccharomyces cerevisiae
FT                   YGL095C VPS45 Protein of the Sec1p family essential for
FT                   vacuolar protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84501"
FT                   /db_xref="GOA:Q6BZ23"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ23"
FT                   /protein_id="CAG84501.2"
FT                   /translation="MNGNPSALKTKMTLNLSKVSETYFNKLFETKVSPQSTEIKARVLL
FT                   VDKHTTPIISMSYTQSQLLQNDIVLVEMIENQSNLNVMKHLNCIVYIKPTQESIKNLIK
FT                   ELKSPHFNKYELFTNNTLNKNQLEGLAEADEFEAISQVLEIFQDYLIVNNNLFTINISS
FT                   GQNTIMEESNSLASLLLSLKKCPIIKYESNSIELKKLSSEILYNINSNSNNNLFEDLNK
FT                   NSDVPPILLLLDRKNDPITPLILPWTYQSMIHELIGINKNMVELAESEEPIILSESQDP
FT                   FFKQSMYLNYGDLTDKFQEYVEEYKKQTKQSSIENLKTQNLSELKKVLTRFPEFKKLSN
FT                   NILKHLNLISELDTQISRQSLWEVSELQQTIICNLENQQVIRTRLLEILDKATISTENK
FT                   IKLVLIYSVKFSQNDNDLAVFLNKFHDPTITNPVPTVSQMSLMKNFNKQFNKTPISTNN
FT                   NNSNNIGKIFNNKKISINSLFNNSTNNSTTNNIYMQYIPKLNELLNELINQSQNHSNQF
FT                   HLSTLVPDIVTKQYGNVGDSVQDIIIYIKGGITYEESRLIHDLSLSNNKINLIIGSDTI
FT                   LNSERWLNKMYDDINETHTNQTNTADHGLRTKQLRDIL"
FT   gene            complement(<424878..>428186)
FT                   /locus_tag="DEHA2A05192g"
FT                   /old_locus_tag="DEHA0A05214g"
FT                   /old_locus_tag="DEHA-IPF6633"
FT                   /old_locus_tag="DEHA-CDS0321.1"
FT   CDS_pept        complement(424878..428186)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05192g"
FT                   /old_locus_tag="DEHA0A05214g"
FT                   /old_locus_tag="DEHA-IPF6633"
FT                   /old_locus_tag="DEHA-CDS0321.1"
FT                   /product="DEHA2A05192p"
FT                   /note="similar to uniprot|Q06010 Saccharomyces cerevisiae
FT                   YLR389C STE23 Metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84502"
FT                   /db_xref="GOA:Q6BZ22"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR032632"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ22"
FT                   /protein_id="CAG84502.2"
FT                   /translation="MYSAKGLSRIINYKSGFNLQQVFYSSISKLRMQSDKYTVLADNSN
FT                   VEKPILDDRSYRLIKLNSNDLHVLIINDASTDKAAASLDVNVGSFADKNYQVPGLAHFC
FT                   EHLLFMGTSKYPEENEYSSYLSKHSGHSNAYTAAEHTNYYFELSSDYLEGALDRFSQFF
FT                   ISPLFSKSCKDREIKAVDSENKKNLQNDMWRFYQLDKSTSNPQHPYNGFSTGNYETLHE
FT                   EPTSQGLNVRDILLDFYKNHYSSNLMSLVILGKEDLDTLTSWAIDKFSEVPNSNLPRPN
FT                   YDGELIYNPDHLGKIIKAKPIMDSNKLELSFMVPSDQEANWDSKPASYYSHLLGHESSG
FT                   SILHYLKQKGWVNELSAGNMKVCQGNSIFVLEFDLTPNGLKNWEAIVVNVFEYLKLVLN
FT                   GEPKLWLWEELSNMSTINFKFKQKQRAAQTVSKMSNSLYKFTEGSYIPPQYLLSSSILR
FT                   EFKSQEIKEYGSFLNPDNFRILLTSQSLPDLDKSEHWYGTQYSYESISNNLKDQIESAE
FT                   TNENFHYPIPNKFIPKDFTVSKPKSENPLPHPYLIEDNNKFQVWYKQDDQFQIPKGAIE
FT                   IVLHLANANTSCKSSIYTMLLSQLIDDELNEIVYYASMVGISFTINHWRDGLLIRVSGY
FT                   NDKLPVLLEQILQKLITFKPKEDRFEVFKFKLNQEFKNFGFEVPYSQIGTHFLTLLNDK
FT                   TYPYDLKIDTLNKEINFGELLEFSTNKIWEQGVFGEVLIQGNFNDTKAFEISRAIQGHF
FT                   TEFKTIRDSQEEINEIVKLKTHIVPSNQRIRYEVALQDKNNINSCIEYFIQISDSFDDV
FT                   RLRVLTDLLGTVIHEPCFNQLRTKEQLGYVVFSGTRLTRTTLGFRILIQSERSSEYLEY
FT                   RIEEFINQFDKFVKKGLTDENFAKFKQALKDKKLTKLKNLSEEVSKFWNSIISGYYDFQ
FT                   EREKHVEVLESITKDEFIKFYNDYISADSNVSSRIIVHLKSPSVPKLEKSKLLHSSINN
FT                   YIYRNEFSISSDVLDSLIEANADDVAKLVEVLTNAIAEKKENNVSNKDRLKSDLSETIN
FT                   RELTTPVPPQYPSGKLVENVDQFKSTYPVGDIPRPVEPLSNFYYSKQPEDHAHL"
FT   gene            complement(<428390..>429496)
FT                   /locus_tag="DEHA2A05214g"
FT                   /old_locus_tag="DEHA0A05236g"
FT                   /old_locus_tag="DEHA-IPF6637"
FT                   /old_locus_tag="DEHA-CDS3488.1"
FT   CDS_pept        complement(428390..429496)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05214g"
FT                   /old_locus_tag="DEHA0A05236g"
FT                   /old_locus_tag="DEHA-IPF6637"
FT                   /old_locus_tag="DEHA-CDS3488.1"
FT                   /product="DEHA2A05214p"
FT                   /note="weakly similar to uniprot|Q03956 Saccharomyces
FT                   cerevisiae YDR202c RAV2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84503"
FT                   /db_xref="InterPro:IPR028241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ21"
FT                   /protein_id="CAG84503.2"
FT                   /translation="MMQIDRTQMQNVVSEIQTEHADQELHWLISQVITPEFPQIIEALG
FT                   ICSNLILYNSPQHPDAQKQIERGPEIKLPVSSSKSEALKGIIVRDGAYVTQMTVQLKES
FT                   HFNKILNKMTLKKPVLLPQIIGAKKSIDAAVGLIERASSEVLDDNCDQEHTRLIAMFHQ
FT                   MLCEIQIAKNSLQLPTDPELVFPLNVTPASSFSPVLTPNIAVDLYISQAEVCVDLKYLH
FT                   QVQDHPWCEIDSQGKSYVDKLRDDMRLPSSHVSRSSTPAAPQPLNMADIEQKIHQSAST
FT                   TPDGSRSQSNFVNNVWNHISLKPKHDPIDYITKCVTYNNMVVMVGKKIEVSSPDPVLVS
FT                   ALTKLDSVEYLVSSFLENLQKVVDSLHQ"
FT   gene            <429773..>431074
FT                   /locus_tag="DEHA2A05236g"
FT                   /old_locus_tag="DEHA0A05258g"
FT                   /old_locus_tag="DEHA-IPF6644"
FT                   /old_locus_tag="DEHA-CDS2883.1"
FT   CDS_pept        429773..431074
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05236g"
FT                   /old_locus_tag="DEHA0A05258g"
FT                   /old_locus_tag="DEHA-IPF6644"
FT                   /old_locus_tag="DEHA-CDS2883.1"
FT                   /product="DEHA2A05236p"
FT                   /note="some similarities with uniprot|Q00312 Candida
FT                   albicans RBF1 Transcription factor RBF1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84504"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ20"
FT                   /protein_id="CAG84504.2"
FT                   /translation="MSGPSTSSERSTVATNNHPIHPQHQQVHPHQHELARQPDYNQAAV
FT                   AVAAASGMMAPGAHPDDGSQFHPHQHHYNAAAHFQQQQVQQAQQAQLQQYQMLQQQQQQ
FT                   FQQQQQQMQAPHHQMGPQHHIQPPLQQHGMHQAPMHEPVGPPVGGSQHVGGDYEGGQYL
FT                   TSKFMENEIIKTFPSKPELVKFVKNVLNDEEQCKIVINSSKPKAVYFQCERSGSFRTTV
FT                   KDSTKRQRVAYTKRNKCGYRLVANLYPPEKDKKRAKKPEDDALDKDIDDKLNEFQNQNP
FT                   MANSTSEIWILRMIHPQHNHPPEPNVNSSSKKKRSKYTRTLVEKPLNRGNSNPVNNFSP
FT                   NDMVAHQHQHPHQQVHVPHPHVHPHHHDASHTPSVQDPAVIAAMEATPNTEAAEAAVAA
FT                   AAAMHHQHPPVDPNIDPNVDPSVQEHDHSHGTLR"
FT   gene            <431431..>434124
FT                   /locus_tag="DEHA2A05258g"
FT                   /old_locus_tag="DEHA0A05280g"
FT                   /old_locus_tag="DEHA-IPF6648"
FT                   /old_locus_tag="DEHA-CDS0612.1"
FT   CDS_pept        431431..434124
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05258g"
FT                   /old_locus_tag="DEHA0A05280g"
FT                   /old_locus_tag="DEHA-IPF6648"
FT                   /old_locus_tag="DEHA-CDS0612.1"
FT                   /product="DEHA2A05258p"
FT                   /note="weakly similar to CA5214|IPF19807 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84505"
FT                   /db_xref="GOA:Q6BZ19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ19"
FT                   /protein_id="CAG84505.2"
FT                   /translation="MDSNVRSTDLPSTTNDDPHTSTQTIPSNRSISPLTRVPLEENEPT
FT                   SNSRQESYPSIEASSNGTSRSYTEDSAFGDEENDERQPLLVVRSSESVDEIAKEYFSFE
FT                   NNKAFVYTLLILLGLGFFFYLTFQQSDSLVMSAIDTKFQSLSIMDLNNDGLDFHVLGSV
FT                   SMHYGNIGNHFYRFFMKLASVIIGSVIVIPNDAVKLFASLQGRNESLHVLNIYPPDIQV
FT                   DIANNALTEIDFISKSELIKENIVELLNTLEEINDEEVVVKLTGIFDSTIESKLFEYST
FT                   KNARFYLDYSLNKTDLAPTVLLDKLTVQQNPENSTEIEFYSTISMDNKFPIKAELEAID
FT                   WDISIAGCNKELVKLGEWHSSSLSIQPDSRVEFDVNGLIREIPDKLLQNCDNNITIINK
FT                   LVQDYLKGKATAVTISASNNLNNQENLPKWLLYVLNKAGYKLSVSLPYFQDDTMSYIKE
FT                   YDISSLFLEFLSPKSRESFSYALSSNVSMITTFPGIFDITFGVPRFQNSISLRDESETL
FT                   IKGWSNTNNTMDLHRYDDENLLEWDIAVSNFEADSVGPARLGALANNLLNGNDIADSMY
FT                   LDMILDEVELSMPILTTTLKHLILPSVQLNPPIETINSIDDVIDTLNITVDNILYVDSS
FT                   KEELRLMIDCSLLNPTNISIDVPDDTISLQLRYNDTIIGNVSTTDILIPQTGEYFNMTF
FT                   NLNLNTTTTHGKVSLEFLIGEFISGYEDLYFSVEGTNTSSSNNHGLSKFLSQIAINDIQ
FT                   VPNVSFSPERVQNLPHPLDHHPKHQSPFLIDATIHIFSSELELTLFNPLENAEIAVKIY
FT                   QAQASYENTKLGHVQPDQYLLIPPGVYTTPRIPFVMDSNIGMDILRKALNGSLRVQVLA
FT                   VFKANIGEFDLSLLYEGSDLSAAIRW"
FT   gene            <434689..>435369
FT                   /locus_tag="DEHA2A05280g"
FT                   /old_locus_tag="DEHA0A05302g"
FT                   /old_locus_tag="DEHA-IPF6650"
FT                   /old_locus_tag="DEHA-CDS5089.1"
FT   CDS_pept        434689..435369
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05280g"
FT                   /old_locus_tag="DEHA0A05302g"
FT                   /old_locus_tag="DEHA-IPF6650"
FT                   /old_locus_tag="DEHA-CDS5089.1"
FT                   /product="DEHA2A05280p"
FT                   /note="similar to uniprot|O13547 Saccharomyces cerevisiae
FT                   YLR390wa CW14 Secretory Stress Response protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84506"
FT                   /db_xref="GOA:Q6BZ18"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ18"
FT                   /protein_id="CAG84506.1"
FT                   /translation="MPSSMLKITTLVALASYISTTLAAPPACLLACVAQVEKKSDCTGL
FT                   NDLSCICSSKGSDVKKCLDDICPDGDANSAKSAFEDSCEGHSSSSSSSSEASSSTKASS
FT                   SEASSSTKASSSAASSSDAASSGAASSGAASSGAASSGAASTTEASSQSASNESSAAPT
FT                   QASSQVASDDEESTSLAGVATTVSSSTSGSSVPVVPTQSEDGANVQGLSVGAILAGLAG
FT                   VALL"
FT   gene            <435686..>437173
FT                   /locus_tag="DEHA2A05302g"
FT                   /old_locus_tag="DEHA0A05324g"
FT                   /old_locus_tag="DEHA-IPF6652"
FT                   /old_locus_tag="DEHA-CDS2432.1"
FT   CDS_pept        435686..437173
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05302g"
FT                   /old_locus_tag="DEHA0A05324g"
FT                   /old_locus_tag="DEHA-IPF6652"
FT                   /old_locus_tag="DEHA-CDS2432.1"
FT                   /product="DEHA2A05302p"
FT                   /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
FT                   YDL238C GUD1 Guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84507"
FT                   /db_xref="GOA:Q6BZ17"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ17"
FT                   /protein_id="CAG84507.2"
FT                   /translation="MSESNEVDMAAMKPIPYTLYYGTFIHTPNLGELKVCLKTLVGVNK
FT                   SGTIDYIHENYDHDGQSALEFFKQEFKKQGNQLDPSELHYVDISDDATKFFCPGFVDTH
FT                   IHASQYPNVGIGLGCQLLDWLKNYTYKLENGFTNPKDEECMKFAYDVYHKIIKKTLENG
FT                   TTCASYFTTIDPHTTMLFARLLLKLGQRGFVGKVCMDSNDVFETYQEDHDDCVKSMELI
FT                   TSYYENTNPKGEQLIKPIVTPRFAPVCSSGLLEYLGSLAATKELSIQTHISESHNEIEL
FT                   VAKLFPEFDNYASVYDNFKLLNSSTILAHGIHLNEKERKLIKSRNCSISHCPTSNTFIA
FT                   SGEAPVKKYLYEDKINVSVGSDVSGGYSPSILEVIKQTILVSHHLSIKTRNETASDPKL
FT                   SVADAIYMATQAGAKAVGLDNIIGSFDIGKRWDAQLINLNSANSNIDIFPCNVPDLKNI
FT                   NKDTETGIHNLLGKWIFCGDDRNCVMVWCNGRLVINK"
FT   gene            <437946..>441331
FT                   /locus_tag="DEHA2A05324g"
FT                   /old_locus_tag="DEHA0A05346g"
FT                   /old_locus_tag="DEHA-IPF6653"
FT                   /old_locus_tag="DEHA-CDS8503.1"
FT   CDS_pept        join(437946..438032,438152..441331)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05324g"
FT                   /old_locus_tag="DEHA0A05346g"
FT                   /old_locus_tag="DEHA-IPF6653"
FT                   /old_locus_tag="DEHA-CDS8503.1"
FT                   /product="DEHA2A05324p"
FT                   /note="similar to uniprot|Q12749 Saccharomyces cerevisiae
FT                   YLR383w RHC18 recombination repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84508"
FT                   /db_xref="GOA:Q6BZ16"
FT                   /db_xref="InterPro:IPR027132"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ16"
FT                   /protein_id="CAG84508.2"
FT                   /translation="MTVPASDGYRGTKRRTEEDEEGGDMFNPMKGSDDSESESESDSDD
FT                   ELENEDQVDSSPAKAGVIEKIILKNFMCHDSFELNLGPQLNFIIGRNGSGKSAILTGIS
FT                   IGLGVKASDTSRGSSIKNLIKDGKSTARVTVVFRNEGIEAYKPEEYGSKIIVERKIQRQ
FT                   GSNGYFIRSENLKTISTKKSVLDEILYKFNIAIDNPLAFLSQDKAREFLTSTTDKVKYD
FT                   YFMAGSLINDIIENYRITSGNIVEVQNKLKLAKTHLDVATKNYDESASLYNKFKKSDSL
FT                   RKHLELIHAKIYWYNVTVIEKKIQKYKDQLQQASHDIEVIEKKFEEIEQKSNQREQNVK
FT                   KLEEKNIAISKEIVESQDSYQEIKMTYQRLKSGINEVINEIKKGEEDIEGFHKDIERCQ
FT                   NIIAKEQQRIDEINGGSKEKLNDSLSELKAKLEDLAQERERVRSELNEAGNYNDSELLD
FT                   CEKKVNESKEIVSTLQEKKRRILASQKDKYSPWGNNITHLLANIKAINQWHQEPIGPIG
FT                   SLVSVKEEYSDWRDLINASIGKTLDSFLVCDEHDRKILSDLFKKYRINKNIITRRFESF
FT                   NFEDGIAYGHTTFLDILSIENENVLYTLIDLNSIEKNVICDDRNRARDLVTYPKILNVY
FT                   SLLNSKSGQRSSGDRNTFKIDPIYYRLNEPHKLSNKSQSSTNDIKKTDEQVDEEIVKIH
FT                   KLERRKREIKMKLQNEKQNLENRYETIQKETRRLNDELFKIENSLNENGDLSKIEALKI
FT                   QIAEDEAQASQKEGILESLNEDLEKDRSQFITVRENMKKLKQEIQEQLQLQEDTKKALV
FT                   ECEIERSAMLSETEHYKMTTSKRRDAMVVCETKISQGNERLAPLVLDAESKCPRTQVNI
FT                   TNEDTNESISTEYERAQEAVKEAEKSVGRSYQEIQQELLTNKDTKEVCEERVIDLDKIY
FT                   RSLSDDLNSRFNYLHTTILKNINEASSSFERSLALRGFKGELKFDFGEKSLTMLVQTKG
FT                   DSKKRTVESLSGGEKSFTQIALLLAIWKVMDSKVRGLDEFDVFMDSVNRSISIKLLLSE
FT                   LRKYPKSQSIFITPQDIAVVGDLDSKDVKIHKMNDPRSDN"
FT   gene            complement(<441418..>443226)
FT                   /locus_tag="DEHA2A05346g"
FT                   /old_locus_tag="DEHA0A05368g"
FT                   /old_locus_tag="DEHA-IPF6655"
FT                   /old_locus_tag="DEHA-CDS1610.1"
FT   CDS_pept        complement(441418..443226)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05346g"
FT                   /old_locus_tag="DEHA0A05368g"
FT                   /old_locus_tag="DEHA-IPF6655"
FT                   /old_locus_tag="DEHA-CDS1610.1"
FT                   /product="DEHA2A05346p"
FT                   /note="some similarities with CA4879|IPF1660 Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84509"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ15"
FT                   /protein_id="CAG84509.2"
FT                   /translation="MWSRYLRKRLLKPPVSNIKRTYSELCQSHNYRNDKTYGQYYDRFN
FT                   DVKQNPDRNSIRSILDSAFYTTPIDNNDSYLMNDFLETISNIPNHYHTYVQEYLEKLNR
FT                   NEIRDCLKQNIALQLLLSSNNSDQAEVYQFIVENLHHKLNVNLLEIFIFNLIKAENISA
FT                   ATTLLHILLDKIPNFNLSNELWSYYISKTCELGHYLGSCLIYHELIDNHQTRSGESTGI
FT                   NFQNSYIPFLVANSLLEKLGSIFSNNRDPMRINGVLNYHKRFYSYSGHADTYKSLRCSL
FT                   VEAYSNEGNLGEALKHFRTLAFIFKGHRNYKKNESISTPKMSAFSHFRWRRDNIKNNNY
FT                   DSISQVPDKIKTSLDFQEEASSKELNMKLFRPDEERNVYTYPGHSYIPVVDGSLRLSDL
FT                   PYFRSLINSNIQHLMNNSGPERLDSLMNYISGCHFMLHIFINSCLCELGYINEAFSLLV
FT                   KLPKIYPKVYSNVLIREEDFIYLFEACKHRFNSLDIDSDYTQFNEAEQTYQLLHEIKLF
FT                   QESVNQRANVNMFSMKLHEIFISTMLSYRGITLEKISVYLDNLLRLSTVNSPITILIDE
FT                   PQFNKLKSLCSTANELKYSKLVRMRD"
FT   gene            <443447..>444571
FT                   /locus_tag="DEHA2A05368g"
FT                   /old_locus_tag="DEHA0A05390g"
FT                   /old_locus_tag="DEHA-IPF6657"
FT                   /old_locus_tag="DEHA-CDS3974.1"
FT   CDS_pept        443447..444571
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05368g"
FT                   /old_locus_tag="DEHA0A05390g"
FT                   /old_locus_tag="DEHA-IPF6657"
FT                   /old_locus_tag="DEHA-CDS3974.1"
FT                   /product="DEHA2A05368p"
FT                   /note="similar to uniprot|P39952 Saccharomyces cerevisiae
FT                   YER154W OXA1 Translocase of the mitochondrial inner
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84510"
FT                   /db_xref="GOA:Q6BZ14"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ14"
FT                   /protein_id="CAG84510.1"
FT                   /translation="MFRTCMARSQRAIRIQNVLRPNILSVTPVFLNQTSTVRFNSTKSS
FT                   EIADKVSEIKNELTSFDHQASPTGYVSDMTSDQLGYLDSIGLAQGYGPTALIERLLEYS
FT                   HVYTGLPWWATIIVTTVAVRSVMFPLYVKASINGAKMAKIKPELDQVMQELREAENPQE
FT                   QVQAAHKRKALMKDNDVHMSHQMFPVLQLPIAYGFFQGLRKMANHPVEGFSTQGNAWFA
FT                   DLTQVDPYCGLQIISAAVVVSMVRLGGETGAAAMNPMMKKVMTYVPILSIFITKELSAA
FT                   VVLYFAANSIFSFIQALVLRNKYFRKFAKMPPIVAPASIPGAKQPPATVSEWWKEFNQN
FT                   MNQNVGKKMKESNTKLGAIHKRKSGISNGFIKKH"
FT   gene            complement(<444755..>450124)
FT                   /locus_tag="DEHA2A05390g"
FT                   /old_locus_tag="IPF_6660"
FT   CDS_pept        complement(444755..450124)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05390g"
FT                   /old_locus_tag="IPF_6660"
FT                   /product="DEHA2A05390p"
FT                   /note="weakly similar to uniprot|P39960 Saccharomyces
FT                   cerevisiae YER155C BEM2 Rho GTPase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65362"
FT                   /db_xref="GOA:B5RSQ6"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR037769"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ6"
FT                   /protein_id="CAR65362.1"
FT                   /translation="MRKIWSQRKERDKRKSFMSIYSSNEQQEHEKPSGGHGESDGLDDQ
FT                   STLANSTIGSIPESSESDYTVGTKNSVRSVSTLAKNDYDQHTVKNAWLNVTVGTSSVHD
FT                   MSENMLRVYRAELKGSHMYLYKPMVLNARRFQLADATEEADQHPDIFNHNNESGVSEQS
FT                   VAQEDTSNEFPQLTFFRIDMAHPGLKYDFDRRQFLLDSTVEALVHFLLFQTNSLYTIST
FT                   GQLIETLPLFPDFGAVIRLVLSFLTNLFDSKLKGEFNAQIMTERILRLLSNIEENFQGF
FT                   LVRCEVYPIILKIIEVLSDNLQHDDIVHKVQAFKTNLVGKQNSIIESVTYDLPSENPFH
FT                   ALNSNVFINDINVIDFSKTINFIDLNFFKNWNSNIDKSLLLYSSLKDNSAQDFFYKKNP
FT                   LIFDNDHHIHYLSRLLINHMFIENISGKNNNFLERKARLIEKWIDLGCFLEKSGNMSSW
FT                   LGIASIILSQPILRLTRIWYLVSPDYIRLLKNDWSPVLFELDRRFLVNGSINSDQISKT
FT                   SDSLNLKFDDFTSRDSYHIMAPRGLGKIYPKENVIPYFGDLIMNNHSTDINELESIWKR
FT                   INYSFNRWNEYLSSLTNYDEIIKYNDDVLRRYDNMGFIFSNESLNQVLYLGVNSDDTKP
FT                   LPAKYKDSSSSNINTDLHKKLLKLIEVNCDSTNLEKIMKLSLLMEPELPESYLKVPIDT
FT                   SSANSDGPNATISSISIHSNDSSGSLNTPLNDSNISLPSSQQQSLGDDRASKIPTFNNN
FT                   YFKIALAKYDDLLLQNISSEQKSKLQSLDSSVIKHNFVIDDELTLRVDDFVTDLESSFI
FT                   NSSTLQGLEDDDDDEIPGLGIDVDDILNSDKFNHIDINDNSEPTIQNEEKPINKNKRSK
FT                   NYSLISSDSSKFSPHSGYIPKYASIDRLIDLLLIDAKYFNENISINLSEYRFVFLLNYN
FT                   SFITTKELLDKLSHRFINSSNAIISIMKKLYLIKNGNVDIQSQLEFPNWNLDTSVNINE
FT                   LGNVDYEALLEIQTNILKVLIVLINNFYSNFVNDLINKKIFIKLLKLFSNEILQWYNSN
FT                   KIDSHLEKAFENLVKYYKKLKKLFIKKTYRPIEMSKFDENLIKEFRFSNSLHDVPINRN
FT                   LPGHKNLNKVEKFLHKFNKLLTTFYKLIKTEDWIKIYKILENQFEKHSLLGFNLQKAST
FT                   NDDNMIISNIFNFFESLSDPQEKQLVLKQFPLVFRKLFKLYFKFRSYLLIQLSDLNITV
FT                   DERLDRMKTLLLMLKISKMKMSDNQFVFEGDQDNIPSCIETAISNVIYLPESRLFASLW
FT                   IKASMSLNDDSSNLSFDDINSLLPTNISEANFAINEPLLPCFGWIIENLIEANKCPSFH
FT                   KQIINFNKRYLIYKIIKELCIEDIDGQESNGFNCHENREFDFLLKLDESLVNRQRIKDF
FT                   IVGQDKERSRLFRSVLHDQHKILALDNKKKHMRDGSGSNMSINPTSSMHTLSKKSSSSS
FT                   LRRQSLSYKSNSSSRFKISGIFSKSRPFSLNASSTSERIISSNELPNVESYADPKQKAF
FT                   LIIPLKNKKIFPVYSLPFAFKIDSDSPNEDSFFQAPNESELNDWLVKLNYANRHWFYSK
FT                   NLNLKANHSCSTFGIPIEVVCNRDQSLVPRFLVVIFEEIENEGIKDTGIYRISSSVSEL
FT                   NHVKSIIDKTGTISFNERAYNPHTLASCVKSYFRELPDALLIDQVIEGFFTLEKESPEK
FT                   SDSSSVIENYRQILKNLSTPNYQTLKLLLKHLQKVSQFSEHNKMTASNLATVIGPALTE
FT                   ASNLDCLINNFGFMNSILEKLITNYDYVFQDGS"
FT   gene            <451205..>452866
FT                   /locus_tag="DEHA2A05412g"
FT                   /old_locus_tag="DEHA0A05434g"
FT                   /old_locus_tag="DEHA-IPF6663"
FT                   /old_locus_tag="DEHA-CDS1936.1"
FT   CDS_pept        451205..452866
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05412g"
FT                   /old_locus_tag="DEHA0A05434g"
FT                   /old_locus_tag="DEHA-IPF6663"
FT                   /old_locus_tag="DEHA-CDS1936.1"
FT                   /product="DEHA2A05412p"
FT                   /note="similar to uniprot|P32048 Saccharomyces cerevisiae
FT                   YNL073W MSK1 Mitochondrial lysine-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84512"
FT                   /db_xref="GOA:Q6BZ12"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ12"
FT                   /protein_id="CAG84512.2"
FT                   /translation="MVSSRMWINRARRYVVGKGGMSLNRKLMSTSESETVNYANRKTII
FT                   EQKPQGYYPPIDTIRPNDAKRSRIPNFRQSFEMVDFVQYPSKRYPELYNIEGKITSIRK
FT                   SGKAMYFIDLIQDGAKVQIMASNKLMQMTAQEFDDAHAFFRKGDFISCVGHPSVTNVGE
FT                   LSLKLCRPINLASPCLNSMTIPDKIKDRGLINSNRVLDYLVNADSKQRLMIKSIVIQAI
FT                   RQFFVKRDFMEVQTPILGGYGTGANAEPFKTISNALKSTGDGSKYLQLRVAPELWLKKL
FT                   VISGFDKIFEIGQNFRNEGIDSTHNPEFTTCEFYQSFTNLNELMILTEELFVEIFDTLK
FT                   EKKLSLVDEQLPSLSALASGTFPKYEFIPTLESKTGVALPSELTAESLIEYYNSIGLEV
FT                   PVLKSPSNLLDNLSSIYLESISQDTKTPIFIYNQPSVLSPLAKSAILDYDGRSYDISLR
FT                   FELFIQGKEYVNSYEEENSPFEQSKKFKLQQLTKTQFNDNEMIIPDWEYIKSMEYGLPP
FT                   TGGWGCGIDRLCMLFSGSERIEEVLSFGNIRDVVRQ"
FT   gene            <453073..>455499
FT                   /locus_tag="DEHA2A05434g"
FT                   /old_locus_tag="DEHA0A05456g"
FT                   /old_locus_tag="DEHA-IPF6664"
FT                   /old_locus_tag="DEHA-CDS0805.1"
FT   CDS_pept        453073..455499
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05434g"
FT                   /old_locus_tag="DEHA0A05456g"
FT                   /old_locus_tag="DEHA-IPF6664"
FT                   /old_locus_tag="DEHA-CDS0805.1"
FT                   /product="DEHA2A05434p"
FT                   /note="similar to uniprot|P15303 Saccharomyces cerevisiae
FT                   YPR181C SEC23 cytoplasmic GTPase-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84513"
FT                   /db_xref="GOA:Q6BZ11"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ11"
FT                   /protein_id="CAG84513.2"
FT                   /translation="MDFYQREENDGVRFSWNCVPRTKLQHQRNVIPLASMYTPLNNKSS
FT                   IPVAPANDMVVCRQCRSFINPYVTMTEQQPDVWYCQFCQFANRLGQNQVAPSGLSPECS
FT                   TIEYSTGRLSKFPPIFFYVVDTCFVDEDLEDAYRSLKESLVISLSLLPENSLVGFISFG
FT                   KNVQIHDLSSEGIGKQHTFNGGKEYTLEQIQKSLGLLAAGLRSQSNHNSQHDPINELLG
FT                   PIGRKFLQPVSMAEYQLTSIIENLVPNRFPYPVMKERASRSTGSALNIASLLLSAVLGD
FT                   TGTTGGHIMCFVGGVCTFGPGRIASNQLKEPIRSHKDIEKAHQTLPSVPINGSNSKPDI
FT                   SLVKSAKKFYEKVTKSLVAMGLSCNIFIGSYDQIGLYEMDEVCYKTGGVVVMSDSFNTA
FT                   IFKQSFIKFFNKQQEENSEYLDMAFNATLECRTTLDLQIQGLVGNATKLPYRKDNRYIE
FT                   PIISKVSIGEGNTNTWKLCNTNPQSTYAIYFDKLDSQSIGFSYVQYLFHYQHPSGELRL
FT                   RVTTVPVTVIADTDITNLELGFDQEASIVLIARESINKLQPIHENSDKSHYDPSDVLKH
FT                   LDKSLIDYCTRYAVYTKGMLESFRLSAAFALLPQFMYYLRRSPFIRIFNNSPDETSFVR
FT                   HIFMHEDVGNSLIMIQPTLLSYDVDNFGAIDEETGETNTEPEPVLLDSLSLGPSKVLLL
FT                   DTFFHILIYHGSKVAQWRKAGYHTMEGYEHFKEFLEAPKREAMEILIDRFPLPRFIDCD
FT                   EGGSQARFLMANLNPSTSYASNPNNMYGGQLDVLTDDTNLQSFMDHVQKVIILKK"
FT   gene            <455675..>456343
FT                   /locus_tag="DEHA2A05456g"
FT                   /old_locus_tag="DEHA0A05478g"
FT                   /old_locus_tag="DEHA-IPF6665"
FT                   /old_locus_tag="DEHA-CDS5131.1"
FT   CDS_pept        455675..456343
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05456g"
FT                   /old_locus_tag="DEHA0A05478g"
FT                   /old_locus_tag="DEHA-IPF6665"
FT                   /old_locus_tag="DEHA-CDS5131.1"
FT                   /product="DEHA2A05456p"
FT                   /note="some similarities with CA2444|IPF13883 Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84514"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ10"
FT                   /protein_id="CAG84514.2"
FT                   /translation="MKRKWASSDIEKISEKVYKNQSLQILQVPTFKVQKYNVQQLNKLQ
FT                   IPPTLESVSESPKATAWVSDLLHSMFNSTDEIKFDDQDEPCTNGNNGVKVLVFLGAMGK
FT                   EYITSIRGQLEHYVDSMIFISSSLKLDSCDAGHHSDDQQCLQLSTYFELIDPLGGGAYP
FT                   LDYLVVVDSQDYIRCRIPIRICRNNFHSPHEKFGVDLERLPSLIEEYMQHFMSISAITY
FT                   "
FT   gene            complement(<456394..>457062)
FT                   /locus_tag="DEHA2A05478g"
FT                   /old_locus_tag="IPF_6667"
FT   CDS_pept        complement(456394..457062)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05478g"
FT                   /old_locus_tag="IPF_6667"
FT                   /product="DEHA2A05478p"
FT                   /note="similar to uniprot|P53930 Saccharomyces cerevisiae
FT                   YNL107W YAF9 Subunit of both the NuA4 histone H4
FT                   acetyltransferase complex and the SWR1 complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65363"
FT                   /db_xref="GOA:B5RSQ7"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR037989"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ7"
FT                   /protein_id="CAR65363.1"
FT                   /translation="MSSSSKRIKNVSIAVPVLYGNHSVRLAPEKRTEKTPPDHTHEWTI
FT                   FFKPVLDNIDLTPLIKKVTFKLHETYDTPVRSIEKPPYQVTETGWGEFEIIIKLHFHSG
FT                   AELGINEKNFQIFHGLKLHPFNPQHPPKENGEVHSVLYDELVFQEPTEKVFEILTQKPS
FT                   NLLPYKLSDESKRDQEYVRPDEIDELARLDVYINKVREEIENQRDQYKDLEQERLALLQ
FT                   "
FT   gene            complement(<457313..>459262)
FT                   /locus_tag="DEHA2A05500g"
FT                   /old_locus_tag="DEHA0A05544g"
FT                   /old_locus_tag="DEHA-IPF6670"
FT                   /old_locus_tag="DEHA-CDS1374.1"
FT   CDS_pept        complement(457313..459262)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05500g"
FT                   /old_locus_tag="DEHA0A05544g"
FT                   /old_locus_tag="DEHA-IPF6670"
FT                   /old_locus_tag="DEHA-CDS1374.1"
FT                   /product="DEHA2A05500p"
FT                   /note="weakly similar to uniprot|P32901 Saccharomyces
FT                   cerevisiae YKR093W PTR2 Functions in transport of small
FT                   peptides into the cell"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84517"
FT                   /db_xref="GOA:Q6BZ08"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ08"
FT                   /protein_id="CAG84517.2"
FT                   /translation="MTSVKEINEKDPGKDEYSVDERAEHEVAETHLNANHDNASIVSKE
FT                   EFEDEGIYDFDDSNNYSTTFVDDHNPMGLRKPTKQEASSLRRVLGRADWACYMICVAEF
FT                   AERASYYSCQTLLSNFVTNPLPEGSGTGKLMPGSVNPGALGLGVPTATAITYTLTFVAY
FT                   LVPLYAGYVADSQIGKFRAIWIGVICGFFAHILLVIAAIPAVIEGGNAIVPTAFGIITL
FT                   AFGTGFIKPNLLPLLLDQYPEESDVVKLLPSGEKVIVDRQKSLERMVLVFYWSVNLGAL
FT                   FPIPSVYIEQRIGFWFAFFIPIIIYLIIPAVFWFVRPRLKKEKLQSSVMVNTNKILKVS
FT                   FRGNWIKRIRNNTFWDYAAPTNMNARGEEYYSAKKKKPITWTDQWVLDVKQIVNISKVF
FT                   LYFVIFNLCDAGGTGATPALTAQSGSLTSDGTPNDIYSSFNPITIIFLIPILDYGIYPL
FT                   LRRWKIDFRPVLRITFGFLLAALSQVAAAVIQKEIYNQIECGDHATECVEKGIVAPFSA
FT                   WVSVMPYILSAASECFANTSGYELGYTRAPPHLKGFVQALFLLATALAAAIGDAISPAL
FT                   KDPNLVWYFAALAIVGGVFTVLFYVHFRNLHKIMGQESKLRAIMMRQENEKEVSEVNNL
FT                   ASITSVPSVAVKQI"
FT   gene            <460828..>461064
FT                   /locus_tag="DEHA2A05522g"
FT                   /old_locus_tag="DEHA0A05566g"
FT                   /old_locus_tag="DEHA-IPF6671"
FT                   /old_locus_tag="DEHA-CDS7676.1"
FT   CDS_pept        460828..461064
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05522g"
FT                   /old_locus_tag="DEHA0A05566g"
FT                   /old_locus_tag="DEHA-IPF6671"
FT                   /old_locus_tag="DEHA-CDS7676.1"
FT                   /product="DEHA2A05522p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84518"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ07"
FT                   /protein_id="CAG84518.1"
FT                   /translation="MESYNQNPPEWFTNEMSEIKRDIKYLRRDIKDLKGEFKDLKRDLN
FT                   KDVKDLKIEFKDLKRDLNKDVKDLKGEFKDLHI"
FT   gene            <461344..>462018
FT                   /locus_tag="DEHA2A05544g"
FT                   /old_locus_tag="DEHA0A05588g"
FT                   /old_locus_tag="DEHA-IPF6672"
FT                   /old_locus_tag="DEHA-CDS5334.1"
FT   CDS_pept        461344..462018
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05544g"
FT                   /old_locus_tag="DEHA0A05588g"
FT                   /old_locus_tag="DEHA-IPF6672"
FT                   /old_locus_tag="DEHA-CDS5334.1"
FT                   /product="DEHA2A05544p"
FT                   /note="some similarities with uniprot|Q9Y7S0
FT                   Schizosaccharomyces pombe SPCC569"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84519"
FT                   /db_xref="InterPro:IPR013902"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ06"
FT                   /protein_id="CAG84519.1"
FT                   /translation="MTEQINELFPRLGSCFEDTLTEMIEKKVNDNIQSIVEQTLESLNQ
FT                   NPPEWFTNEMREIKKDIKDLKGEFKDLKRDLNKDVKDLKIEFKDLKRDLNKDVKDLKIE
FT                   FKDLKRDVKRDLRDFKGDMDSGFKMSEYSHIRLYNMFRRMNGYPATPVPFLNVEAIMNE
FT                   LPPIGSVQDIDSLSKEECQTYLRAYNVEFHPNESVKLKERLRDAVGLAISYDLEFQFGS
FT                   FQ"
FT   gene            complement(<462752..>466213)
FT                   /locus_tag="DEHA2A05566g"
FT                   /old_locus_tag="IPF_6675"
FT   CDS_pept        complement(462752..466213)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05566g"
FT                   /old_locus_tag="IPF_6675"
FT                   /product="DEHA2A05566p"
FT                   /note="similar to uniprot|Q12271 Saccharomyces cerevisiae
FT                   YOR109w INP53 Phosphatidylinositol 4 5-bisphosphate 5-
FT                   phosphatase or uniprot|P50942 Saccharomyces cerevisiae
FT                   YNL106c PIE3 Phosphatidylinositol 4 5-bisphosphate 5-
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65364"
FT                   /db_xref="GOA:B5RSQ8"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ8"
FT                   /protein_id="CAR65364.1"
FT                   /translation="MMKVVYKENPRTICIRSDTHSLCFEELNTNRSKHLLKESAVAVEL
FT                   LPNDQITKENGFKPLLKKEVFGCLGLISIDKKAFLAVITGAMTDVAHPVVYESVDKIYS
FT                   VDFVSLSSDEWDFVSFDTSGLPLASTADEFEAENNYAREPHPCHEMQKLLSNGSFYYSN
FT                   DFDLTSLIQNRGIQNLRLHHEKEGVRKINLEHYSEEYMWNSFMMCEIFEFRSKLDSYVQ
FT                   STLDDNRFLTTVIRGFAKTVNLNSSGESMTIISKQSWKRAGTRFNARGIDDNGNVANFV
FT                   ETEFIFNQPTREQITSFTQIRGSVPTFWEQDSTLINPKITLTRSLEATQPIFNKHFTEI
FT                   CQKYGVCHIINLLSKTKPAEVQVSRRYKQLYTGSNRRDEMAFSEFDFHHETKQSSGGFA
FT                   GATKILPMLYDSLENFGWFVYDSDQGETVTRQDGVFRTNCLDCLDRTNLIQQVICQSIL
FT                   EHTLQNQRGSREGNHERYAVEDLVNKHNTLWADHGDAISQIYTGTNALKSSFSRSGKMN
FT                   FAGALSDVTKSVSRMYQNTFLDSKKQSTMDLLLGYDAQNSLPVRIYDPINEFVQEKLHG
FT                   EAGSFTTWNDINIFVGTFNVNAAVPHGKVDLASFLFPPENTEIELPDVYAIGLQEVIEL
FT                   NAGSILSSDSSKPSLWAKLLETQLNSQGEPYLLLRTESIASMSLFLFVKKSQVHKVTQV
FT                   AGSSKKTGLGGIAANKGACGVRFEFGSTSFVLVTSHLAAGTTALVERYNDYMTIMSGLT
FT                   FTRNFTIKDHDHIIWFGDLNYRVSLPNDQCRYFIENGAFDELTAVDQLNQEMTRKGAFY
FT                   GFKEGAIKFYPTYKFDKGTSNYDSSEKQRIPSWTDRVLYMTSKGVDPIKQLNYNSCMNI
FT                   VVSDHKPVYSTLKSRVKFVDEDKKIKLSKHLYDIYKKEHGDIGEVSLLELSDSMTSSSK
FT                   PSSLNSDSGFSMDTLSEMNLLDDADTDAPKLPARPMERTNTLPKRIPPPRMSRKQISSD
FT                   QTKTASNAFPRKLPPTPYNQEVLVPSPSKSISNPLSRSPTASTSASTPPPPPPSRKVGN
FT                   PVKPPIGFSSTPLISSRSNSATPSRGSPISTPSTTGNEQNQEHPKLNPIVPTKPASLAS
FT                   SKTKSSSSEATSASYIPNSTPATSARSTSSDGNGKSMSEWKPLMPS"
FT   gene            <467160..>467345
FT                   /locus_tag="DEHA2A05588g"
FT                   /old_locus_tag="DEHA0A05632g"
FT                   /old_locus_tag="DEHA-IPF6678"
FT                   /old_locus_tag="DEHA-CDS8433.1"
FT   CDS_pept        467160..467345
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05588g"
FT                   /old_locus_tag="DEHA0A05632g"
FT                   /old_locus_tag="DEHA-IPF6678"
FT                   /old_locus_tag="DEHA-CDS8433.1"
FT                   /product="DEHA2A05588p"
FT                   /note="similar to uniprot|P53507 Saccharomyces cerevisiae
FT                   YNL070W TOM7 Involved in mitochondrial protein import"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84521"
FT                   /db_xref="GOA:Q6BZ04"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ04"
FT                   /protein_id="CAG84521.1"
FT                   /translation="MASPNYQITLSDESKERITKVLEYSKTIAHYGFIPFVLYLGWSAT
FT                   PNRPSLFNLLSPFPSA"
FT   gene            <467833..>468801
FT                   /locus_tag="DEHA2A05610g"
FT                   /old_locus_tag="DEHA0A05654g"
FT                   /old_locus_tag="DEHA-IPF6679"
FT                   /old_locus_tag="DEHA-CDS4100.1"
FT   CDS_pept        467833..468801
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05610g"
FT                   /old_locus_tag="DEHA0A05654g"
FT                   /old_locus_tag="DEHA-IPF6679"
FT                   /old_locus_tag="DEHA-CDS4100.1"
FT                   /product="DEHA2A05610p"
FT                   /note="similar to uniprot|P40464 Saccharomyces cerevisiae
FT                   YIL134W FLX1 Protein required for transport of flavin
FT                   adenine dinucleotide (FAD) from mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84522"
FT                   /db_xref="GOA:Q6BZ03"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ03"
FT                   /protein_id="CAG84522.2"
FT                   /translation="MAVEQASNGTMFSRRQVEIISGLVAGFSTTIVMHPLDLIKIRLQL
FT                   SPEINTKRFKSLIDVISKINTSATTDFHQYKQAHHSSGIKSAILGRYKLPHTVLQYYRG
FT                   IGPNIGGNIVGWSLYFTLYAEFKRLIDFSSPTANYFTSSTAAGVTTGLLTNPIWVLKTR
FT                   ILGTTRSDTGAYRSVTDGVKNMLQKEGIRSFWKGTIPGLFSVFQASLQFTFYDHFKQYQ
FT                   LSKKSSTTDTLSTGEYIASSAASKILSTIIAYPSQVIKSRLQNSTTEYKSVISTCKDVW
FT                   HNEGHWRGFYKGVGTNMLRVVPATCITFVSYETAKDILSHM"
FT   gene            <468959..>470086
FT                   /locus_tag="DEHA2A05632g"
FT                   /old_locus_tag="DEHA0A05676g"
FT                   /old_locus_tag="DEHA-IPF6681"
FT                   /old_locus_tag="DEHA-CDS3409.1"
FT   CDS_pept        468959..470086
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05632g"
FT                   /old_locus_tag="DEHA0A05676g"
FT                   /old_locus_tag="DEHA-IPF6681"
FT                   /old_locus_tag="DEHA-CDS3409.1"
FT                   /product="DEHA2A05632p"
FT                   /note="similar to uniprot|P53942 Saccharomyces cerevisiae
FT                   YNL072W RNH201 Ribonuclease H2 catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84523"
FT                   /db_xref="GOA:Q6BZ02"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ02"
FT                   /protein_id="CAG84523.2"
FT                   /translation="MVLMTLFLITPASRPRDMTESKRKPLSDSEEVDQVATKKRKLEQE
FT                   NSPGNNAWVPPSITDISEPLNFDSSTYHSAIPREIKADITAPVVLGVDEAGRGPVLGPM
FT                   VYGIAYSLESYSKDLQTKYGFADSKTLKDDKRRQLFQMIENEDHELHGHVGWATTTMTA
FT                   KDISSGMLQTVLGKGSYNLNEQAHDTTIQLIKQVLAKGVNVTKVFVDTVGPPASYQAKL
FT                   SKIFPTVAITVAKKADSIYPIVSTASVVAKVTRDLNLHFYNIHLPLIHNHALGSGYPSD
FT                   PNTSKWLHANVDRVFGWCFGLVRFSWQTSKDSLEKNNAVPVVYEAQCIKEDSGYHDVGD
FT                   FFSSSDSPAANSGPDSSAPSLTIDSSYYGSTNVSL"
FT   gene            <470311..>471714
FT                   /locus_tag="DEHA2A05654g"
FT                   /old_locus_tag="DEHA0A05698g"
FT                   /old_locus_tag="DEHA-IPF6682"
FT                   /old_locus_tag="DEHA-CDS2956.1"
FT   CDS_pept        470311..471714
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05654g"
FT                   /old_locus_tag="DEHA0A05698g"
FT                   /old_locus_tag="DEHA-IPF6682"
FT                   /old_locus_tag="DEHA-CDS2956.1"
FT                   /product="DEHA2A05654p"
FT                   /note="similar to uniprot|P12695 Saccharomyces cerevisiae
FT                   YNL071W LAT1 Dihydrolipoamide acetyltransferase component
FT                   (E2) of pyruvate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84524"
FT                   /db_xref="GOA:Q6BZ01"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ01"
FT                   /protein_id="CAG84524.1"
FT                   /translation="MSALIAASRSTMAFRAVACTKQYSAGYLQLARLYSSGKFPPHTVI
FT                   NMPALSPTMTQGNIGSWSKSVGDELHAGEAIAEIETDKASMDFEFQEDGYLAKILLGDG
FT                   TKDVPVGKPIAVYVEESEDVQAFESFTAEDAGDASTEAKAPEPEKESKAEESKPEASEK
FT                   KSKSESAPAQSKPVAGRIFASPLAKTIALDKGIALKNIKGSGPNGRIVAKDVENFKAPA
FT                   AAAAAAPSATAAAYEDVPISNMRKTIATRLTQSTQESPSYIVQSQISVSKLLKLRQSLN
FT                   AAADGRYKLSINDLLIKAIALANLRVPEANSAWLLDQGVIRTYSNVDVSVAVATPTGLI
FT                   TPIIKNAHTKGLSAISNEIKELGKKAKAGKLAPEEYQGGTITISNLGMNHAVNSFTSII
FT                   NPPQSAIVAIGTVDKKAVPSNVNEQGFVFDDVMTITGTFDHRTVDGALGGEWIKALKTI
FT                   VENPLEMLV"
FT   gene            <472012..>473476
FT                   /locus_tag="DEHA2A05676g"
FT                   /old_locus_tag="DEHA0A05723"
FT                   /old_locus_tag="DEHA-IPF6683"
FT                   /old_locus_tag="DEHA-CDS4258.1"
FT   CDS_pept        join(472012..472820,472957..473476)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05676g"
FT                   /old_locus_tag="DEHA0A05723"
FT                   /old_locus_tag="DEHA-IPF6683"
FT                   /old_locus_tag="DEHA-CDS4258.1"
FT                   /product="DEHA2A05676p"
FT                   /note="similar to uniprot|Q12415 Saccharomyces cerevisiae
FT                   YOR110w TFC7 TFIIIC (transcription initiation factor)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84525"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014623"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BZ00"
FT                   /protein_id="CAG84525.1"
FT                   /translation="MTLKTIYIARHGYRANWLPPPHPPNPTGIDSDPPLASHGIDQAKQ
FT                   LAGYLNSLPAKEQPQFILSSPFYRCVQTSEPICDMLSVPLVLERGVGEWYKKDRGIVPE
FT                   PANYDVLKPFFSCLRDASEWDRDSTVGVIPSLDGESEEDIFARCVQFWKEFIPIFEAKY
FT                   PEITTILIVTHAATKIALGMSLLKFHDVYEAIDNDNTVLRAGACSLDKYERGGDDWSIK
FT                   MNGNCEFLLDGEEMNWNFHSAFEAGSDEDIKARRAEAKRKAEASNTKDKNFYVTIDVPM
FT                   IGNSNLSQFEDVNQPASQSKQDSKENITSNSKQNYIKSSSHLQVTDLNNKTPLIKLSNS
FT                   NVNTDNDSINNLSVIDGNIYQTNWTKLVGTELVFDDYGELIGSVREHLKCDENIKITSK
FT                   NEKDKKDTDIADDDSDVKVKDEQTSFLLKAIKSAKRKEAEVEV"
FT   gene            <473632..>474291
FT                   /locus_tag="DEHA2A05698g"
FT                   /old_locus_tag="DEHA0A05742g"
FT                   /old_locus_tag="DEHA-IPF6686"
FT                   /old_locus_tag="DEHA-CDS5255.1"
FT   CDS_pept        473632..474291
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05698g"
FT                   /old_locus_tag="DEHA0A05742g"
FT                   /old_locus_tag="DEHA-IPF6686"
FT                   /old_locus_tag="DEHA-CDS5255.1"
FT                   /product="DEHA2A05698p"
FT                   /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
FT                   YOR111W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84526"
FT                   /db_xref="GOA:Q6BYZ9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ9"
FT                   /protein_id="CAG84526.2"
FT                   /translation="MYFNHPLYDWLKQFQFVLASTSPRRLEILQKNLQIQDITIMPSNF
FT                   EENLSKEEHTCQEYVSNTSLGKGQAVMKQLISQNGPSSVIVSSDTIITCNQEVFEKPQT
FT                   KETQLEMFRKYCQHPDLEVITSVNVIKYDSATKDSIIKSAIEITKLRFNDELSDEFLQY
FT                   YVDSEEGLHVAGGFKYQNLGCLLFKSIEGDYFNIVGLPARTTFQLLSDILQPIERF"
FT   gene            <474993..>475763
FT                   /locus_tag="DEHA2A05720g"
FT                   /old_locus_tag="DEHA0A05764g"
FT                   /old_locus_tag="DEHA-IPF6690"
FT                   /old_locus_tag="DEHA-CDS4727.1"
FT   CDS_pept        474993..475763
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05720g"
FT                   /old_locus_tag="DEHA0A05764g"
FT                   /old_locus_tag="DEHA-IPF6690"
FT                   /old_locus_tag="DEHA-CDS4727.1"
FT                   /product="DEHA2A05720p"
FT                   /note="similar to uniprot|P53927 Saccharomyces cerevisiae
FT                   YNL110C NOP15 Constituent of 66S pre-ribosomal particles"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84527"
FT                   /db_xref="GOA:Q6BYZ8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ8"
FT                   /protein_id="CAG84527.1"
FT                   /translation="MGKFSNNKKQNADKKIEDIEKDLQLPESSEEELSGEEEGAEIGDE
FT                   SDEDSEELEGFSSDSDEEDDVDDKETKQHSTTKTSPTEKHIQASGHTVTKKKAVSAASN
FT                   PTKSKRGVIYVGRIPHGFYEAEMKKYFTQFGDITRLRLSRNKKTGKSKHYGFIEFAHHN
FT                   VAKVAAETMNNYLLFGHLLKVHLVEDPNIHEDLFQGANMKYKVIPWKKIGQNKNDAARS
FT                   KEKWDTLSQKWSKKRALKQKQLSDKGIDFDLSTI"
FT   gene            <475989..>476360
FT                   /locus_tag="DEHA2A05742g"
FT                   /old_locus_tag="DEHA0A05786g"
FT                   /old_locus_tag="DEHA-IPF6691"
FT                   /old_locus_tag="DEHA-CDS6660.1"
FT   CDS_pept        475989..476360
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05742g"
FT                   /old_locus_tag="DEHA0A05786g"
FT                   /old_locus_tag="DEHA-IPF6691"
FT                   /old_locus_tag="DEHA-CDS6660.1"
FT                   /product="DEHA2A05742p"
FT                   /note="similar to uniprot|P40312 Saccharomyces cerevisiae
FT                   YNL111C CYB5 Cytochrome b5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84528"
FT                   /db_xref="GOA:Q6BYZ7"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ7"
FT                   /protein_id="CAG84528.1"
FT                   /translation="MSEGEDLKAYTLDEVSQHNTVEDLWVVYNGGVYDITKYIDEHPGG
FT                   EEVVIDVAGMDATEAFEDIGHSDDAREILKGLLIGKVEGGNIKSPVSTATQPESTGSSM
FT                   PMLAIFVLLIAAGVYFYIK"
FT   gene            <477120..>478289
FT                   /locus_tag="DEHA2A05764g"
FT                   /old_locus_tag="DEHA0A05808g"
FT                   /old_locus_tag="DEHA-IPF6692"
FT                   /old_locus_tag="DEHA-CDS3271.1"
FT   CDS_pept        477120..478289
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05764g"
FT                   /old_locus_tag="DEHA0A05808g"
FT                   /old_locus_tag="DEHA-IPF6692"
FT                   /old_locus_tag="DEHA-CDS3271.1"
FT                   /product="DEHA2A05764p"
FT                   /note="similar to uniprot|Q12723 Williopsis mrakii 2-
FT                   nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84529"
FT                   /db_xref="GOA:Q6BYZ6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ6"
FT                   /protein_id="CAG84529.1"
FT                   /translation="MSKYQQSSLFIKRLGLEYPIIQSPMAGISTIKLASVISSNGGLGS
FT                   IPLASVDARKQSGIDSIDKQLNEFKSLAKTNVVNVNFFCHNHEEQQTPTATQTENWHKL
FT                   LGKASPSINKDIPSLQKSNISLTEVESNHPELFVQLLEKLVQCKPKVVSFHFGFPSQKA
FT                   IKFLQENGIMVFVTVTSVKEAKQLIDLKVDGLVSQGYEAGGHRGNFLLSEILDENLSTF
FT                   SLFTQIKIIVDNASWKPFIIPAGGIMDGKTIENYLANGASGVQLGTIFLSTPESNSNDF
FT                   IKNVVSESNDTPTIMTRLVSGKPARCLRTPFIQALIEDCDNLKLDDQPPYGYAYYGYKT
FT                   MAGLLKDPRYGFYLAGQNYHQISPDFNTEQVFLKLVDELKQAGFDAQAV"
FT   gene            complement(<478708..>479460)
FT                   /locus_tag="DEHA2A05786g"
FT                   /old_locus_tag="DEHA0A05830g"
FT                   /old_locus_tag="DEHA-IPF6693"
FT                   /old_locus_tag="DEHA-CDS4951.1"
FT   CDS_pept        complement(478708..479460)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05786g"
FT                   /old_locus_tag="DEHA0A05830g"
FT                   /old_locus_tag="DEHA-IPF6693"
FT                   /old_locus_tag="DEHA-CDS4951.1"
FT                   /product="DEHA2A05786p"
FT                   /note="similar to uniprot|P38340 Saccharomyces cerevisiae
FT                   YBR261C Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84530"
FT                   /db_xref="GOA:Q6BYZ5"
FT                   /db_xref="InterPro:IPR008576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ5"
FT                   /protein_id="CAG84530.2"
FT                   /translation="MPVKSIQVNGEYIMDEGLAADSQINYNDAIDYWTGVPASVDGVLG
FT                   GFGEQTAVPKADIVGSSTFLRKLQTRMTCPDGVEKLTIDMGAGIGRITRDLLWKVSDKC
FT                   DLLEPVKPFVAQMNNELVGVKNRGKLGDIYDIGMQEWECDANKVGKYWLVWCQWCVGQL
FT                   PDEELVKFWERCRTALIGNGIGTLIVKENIAPDDDIFDETDSSVTRSDAKFRELFIKAG
FT                   FKLIASDIQKGLPKELYPVRMYCLKPNN"
FT   gene            <479654..>480184
FT                   /locus_tag="DEHA2A05808g"
FT                   /old_locus_tag="DEHA0A05852g"
FT                   /old_locus_tag="DEHA-IPF6694"
FT                   /old_locus_tag="DEHA-CDS5653.1"
FT   CDS_pept        479654..480184
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05808g"
FT                   /old_locus_tag="DEHA0A05852g"
FT                   /old_locus_tag="DEHA-IPF6694"
FT                   /old_locus_tag="DEHA-CDS5653.1"
FT                   /product="DEHA2A05808p"
FT                   /note="similar to uniprot|Q12146 Saccharomyces cerevisiae
FT                   YOL146w PSF3 Subunit of the GINS complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84531"
FT                   /db_xref="GOA:Q6BYZ4"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYZ4"
FT                   /protein_id="CAG84531.2"
FT                   /translation="MTSNYFDLDDILSDGEKIPCRFNITVPGLGYLEGNPGKSIAKDTK
FT                   IELPLWLAEILAICELSEDSQQSFIDLSQPDFINYKVINAIKTNAVNIDLHSILTNYYK
FT                   LSEKWASMFNDVELIEVVMQMLKERSFEINNYASNASKQINNNFIFSLDEFEKKLFKVT
FT                   SDSNKQMRKWLKD"
FT   gene            complement(<480322..>483756)
FT                   /locus_tag="DEHA2A05830g"
FT                   /old_locus_tag="DEHA0A05874g"
FT                   /old_locus_tag="DEHA-IPF6696"
FT                   /old_locus_tag="DEHA-CDS0282.1"
FT   CDS_pept        complement(480322..483756)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05830g"
FT                   /old_locus_tag="DEHA0A05874g"
FT                   /old_locus_tag="DEHA-IPF6696"
FT                   /old_locus_tag="DEHA-CDS0282.1"
FT                   /product="DEHA2A05830p"
FT                   /note="similar to uniprot|P89105 Saccharomyces cerevisiae
FT                   YOL145C CTR9 Component of the Paf1p complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84532"
FT                   /db_xref="GOA:Q6BYZ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR031101"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ3"
FT                   /protein_id="CAG84532.2"
FT                   /translation="MEDPIDVSFYLGKQAAETIGNLDVPLSNGQIVSINLVEELPEDSN
FT                   ELISFLETENCPKKYWISVATAYAQSNKLNESLNVIKTAMGLSQFNNEDKLSFHSYLSW
FT                   LYLKFVSSGINKGENLVNATEELNHVSSLDSSKGSVSVLLAKAVLYLYKDQIEPALDIF
FT                   DRLLKIDNNNCFALLGKAQIILNKTKNYANALKLYQQVLILNPLMKPDPRIGIGLCFWF
FT                   LKDEPMALSSWRRALELDPTNLKAKILLNLANFNINFNNSLGDKDFQLNYEKCLKKLAD
FT                   NYKENSNDAIILLTLASYYFSKEEYSLVEKICNKVIHSISGNSASTKLYNPSKVSRFQS
FT                   NLLSQAAFWLGRVAFAKSDFMQSQKYFHEAIKLNENNLMAKLGLGQSQINRGSTEEATI
FT                   TYESILKTNPKCLEVNYSLGVLYSNHKSKRKQEQGISMLERYLRLAKNMGGQPSNKNED
FT                   DGSEIMNQEPVALNAFLILSKLHESKDMNQSLTYLNKAIESRKQINQDAPLEIYNNIGV
FT                   FNFIKHNYEAASNIFQTASEKLKTCNDFKNENGDVLMDLRDDLNVTISFNLARSKELSN
FT                   ESESIEIYESLLKDCPNYFSAKLRLLFLDCVSTNKSTKEEIKQEVENLLDLNASDLEIR
FT                   SFYGWFVKTFGKKVGMKPDADTNHQKDTLVEYDSHDCYALLSLANIYCIMARDIKGSSQ
FT                   DEKKKKYYIRAVELFTKVLSVDPHNVYGAQGLAIVYIENKESNKGLDILRKIRDSLNDI
FT                   SVYLNLGHVLLDLKQYSKAIENYEIALMRFANNDSKILSFLGRAWLSRGLTEKNLSYLN
FT                   NALSYSEKALQNATGAKSSLRFNMAYIQFQIAEFISKLPVEQRLIDDIKKGIDNLNTAI
FT                   ETLNSLSSDDEKHPPYPKSELKARANLGTNTLLNRLNACLDETVESVTKSEIRLKEAKE
FT                   LREQETAQLLQEQEERIAKERRIEEEMAKERAKLQEQAQQWAEEARMNVIVDEDDDKLF
FT                   NKESNMEEKKKRSKKSSTKGTKGKKKGKKRNVVSDSEDDAPSPSEDESEPENDSKRKGE
FT                   EDDNEEDEIKTSKKRKISKLSKETIEDSDDELDDDLFNEEGDEPTGNDDELPNEDAVEE
FT                   GQKENNEELPNESVEDEAQNEESQTEAQNENQSQDEQ"
FT   gene            complement(<483914..>487204)
FT                   /locus_tag="DEHA2A05852g"
FT                   /old_locus_tag="IPF_6697"
FT   CDS_pept        complement(483914..487204)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05852g"
FT                   /old_locus_tag="IPF_6697"
FT                   /product="DEHA2A05852p"
FT                   /note="weakly similar to uniprot|P53148 Saccharomyces
FT                   cerevisiae YGL093w SPC105 spindle pole body protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65365"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="InterPro:IPR028972"
FT                   /db_xref="InterPro:IPR033338"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSQ9"
FT                   /protein_id="CAR65365.1"
FT                   /translation="MNKENMGERPSRSILKNDATLPLLPSTNRLNRRVSFHPEVTLHKI
FT                   NFVPVQVDKRRETIAIIPSSRDNSDSGNSSIESKDDSNSTTSDDNPIGTAHENADENLG
FT                   TNGELDNGHNVDRDSDDDLANFEGNADEGEEETMELTGQFVPNPSAATNNTRDEEVDQG
FT                   DATDTANNADQIETFTKLKHTGVSVDSAANDIDSPPYYQDEDEGDMELTSNIGLNHQNI
FT                   VRLAENDVDAEKVNAEQPEQDIENHDIPSQAPEMNRDQASATDTGEYLHEDSMDILTYA
FT                   NGHKSLEYNVEVNNGEDQQTQQQNGNELEETMDITKFYSEINAQSSTSYMENDHFNQEM
FT                   TMDITKIYHQESRLELINEVPDAEPIMQYNEGSKIPENESIMEFTQEIGKINISGEGAD
FT                   SRLGHIHLQENENETNSNNENDEQHQEDNGTNTEQPLEPDSKELMSDNIIDEIHTGNED
FT                   DDFETDKDEAYKESENLENEAENEGGNEGNEINELHSDNANEQSEQEQDTNISSRYVTN
FT                   TSVDETIQNTAKDTQDSLYMDLTQLEQDAEPQELAAADTNHEIDQPSQKMQLTQEYGEI
FT                   KQIQLKRTIDDAEPIPHKYPKIDNHGGINKTITTTIPLADISTESIDDDDELDQNYTPV
FT                   SLNDFLKDISIRFYDDLEIGIKSVDRISISLPKINNEESYKFDEFVTAMNKMPLLELYD
FT                   FSCKELTKNIKDGTVLFDQFNQFTMENNPRLFKQYYSSSPNEKLSMKSEFQLIKDYTRL
FT                   QAKEVWYGWRTQLIKNLIIQLDEKHYTLVQARSLLLENLTLLNGIHEQLKDKFDNLSNQ
FT                   LNQLLQIESNCNDLDSSDLFSLRNELSVTCKQFKENQQNQTIQNKELNKLNSVISDNKA
FT                   LINAFTDEINDVEKSLNRNKKYELSEIELLKLKFNFLQSFTNLNYKYMEGTKLIFNFIG
FT                   VEVAMEFKDIYDLSNISYSVDQNSSSPFNNSFITTNIAPKLFNVISGSTIIESFQTFKK
FT                   HWSVLKSIDEDIYAISWKLPIVFIESQDNLINFKIRYYCGKHNFKVELFVSIDLSNLLD
FT                   YPNNFQIRGQLIKSDTKISQQIILTNLFNDCVHTALVNRDNQILIDGL"
FT   gene            <488372..>489049
FT                   /locus_tag="DEHA2A05874g"
FT                   /old_locus_tag="DEHA0A05918g"
FT                   /old_locus_tag="DEHA-IPF6701"
FT                   /old_locus_tag="DEHA-CDS5103.1"
FT   CDS_pept        488372..489049
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05874g"
FT                   /old_locus_tag="DEHA0A05918g"
FT                   /old_locus_tag="DEHA-IPF6701"
FT                   /old_locus_tag="DEHA-CDS5103.1"
FT                   /product="DEHA2A05874p"
FT                   /note="similar to uniprot|Q12462 Saccharomyces cerevisiae
FT                   YOL147c PMP27 peroxisomal membrane protein - peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84534"
FT                   /db_xref="GOA:Q6BYZ1"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ1"
FT                   /protein_id="CAG84534.1"
FT                   /translation="MVADTILYHPTFGKLTRFLDSTPKREKCFRLVVYLSRFLSYYLQR
FT                   QGFSPDVVNIFKDLKHHITIIRKGMRFLKPLNHLQAAAQTFDNKLMDPVLQKTTVIKNL
FT                   GYVGYLSLDSITWLKLMNILSAKRFPTISTWSSRFWLIALIAGVINSLRTLKISNAKLE
FT                   EKESEEINQKIYAAKRKLVWDFLDMFTCLNSLNYLHFTEGDVGLAGTITSIMGLHDLWK
FT                   SSK"
FT   gene            complement(<489335..>489556)
FT                   /locus_tag="DEHA2A05896g"
FT                   /old_locus_tag="DEHA0A05940g"
FT                   /old_locus_tag="DEHA-IPF6702"
FT                   /old_locus_tag="DEHA-CDS8052.1"
FT   CDS_pept        complement(489335..489556)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05896g"
FT                   /old_locus_tag="DEHA0A05940g"
FT                   /old_locus_tag="DEHA-IPF6702"
FT                   /old_locus_tag="DEHA-CDS8052.1"
FT                   /product="DEHA2A05896p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84535"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYZ0"
FT                   /protein_id="CAG84535.1"
FT                   /translation="MSSIDSRIHETWSRLKASHNQVQQISVEAPSLEKIIADQPNSDEL
FT                   EKELKDLVMKWYWNGYYQGFDDNETKPK"
FT   gene            <489816..>492113
FT                   /locus_tag="DEHA2A05918g"
FT                   /old_locus_tag="DEHA0A05962g"
FT                   /old_locus_tag="DEHA-IPF6706"
FT                   /old_locus_tag="DEHA-CDS0930.1"
FT   CDS_pept        489816..492113
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05918g"
FT                   /old_locus_tag="DEHA0A05962g"
FT                   /old_locus_tag="DEHA-IPF6706"
FT                   /old_locus_tag="DEHA-CDS0930.1"
FT                   /product="DEHA2A05918p"
FT                   /note="some similarities with uniprot|Q08287 Saccharomyces
FT                   cerevisiae YOL144W NOP8 Nucleolar protein required for 60S
FT                   ribosomal subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84536"
FT                   /db_xref="GOA:Q6BYY9"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY9"
FT                   /protein_id="CAG84536.2"
FT                   /translation="MNNEDIRELRIHIGNISPKLAENQSSLETRLGKFGKIVKPLELHT
FT                   KPIQDFYFGFITLELSNVSLEKLKNAFHGILFMGMKLTVGIAKQNFPESWIQDSKRPDL
FT                   LKLDRIKRDRIQRARTQRINEANTPYFMNNIDGSIVVSSLNIGANAALGYSKSSHTFND
FT                   MSGNTKHTQPTQTLVGTKSYSTDTLSKDVACQSYSRTSGKGEIIKGRHRVTKRPHIHFA
FT                   KGHQTLRILINGELKQIQGYKTKLWGMEKHKTARDLTWKYHNGTWRSGDDHIIEKNTTV
FT                   KIRDPIIGGPQPIECGIDGEKADNYGADIEVDSEENELKEERNKNTAVLASLFTNYDFD
FT                   KPMDLSDVDDNGIDEKDIIYDSKGRRKVNRYDYEIEGKEDDDEGDVSKYNIDSKKAKEL
FT                   IDSYKQISERPKEEIYFDEDDEGNELDLDALGKQYTTEAISEKYDEDHGFEVVKTSIDV
FT                   EESDEEMDEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEAEEEAEAEAEAEAEAEAEAE
FT                   AEAEAEAEAEAEAEEEAEEEAEEAAAEEAESEEAESEEAEESEEEKEEEEEKEEEDEEE
FT                   DEEEDEEKEEAEEEEEEEEEEFIPTFGNKAESQVNNTDTLRTLFNPNQVTSEPQESQFK
FT                   LALSEEDEDIDDEKEVDLSQQKELLDKIKSKQQQEAEEILTLRAKKYGLFWSHSDSPFL
FT                   QSQSQLNKVSGSKDLVKLPGEAESLISNAEGESPYEQWFWKMRGEFSRECKRRKRDVLR
FT                   IFKKKTTKNPVI"
FT   gene            <492252..>493697
FT                   /locus_tag="DEHA2A05940g"
FT                   /old_locus_tag="DEHA0A05984g"
FT                   /old_locus_tag="DEHA-IPF6708"
FT                   /old_locus_tag="DEHA-CDS2477.1"
FT   CDS_pept        492252..493697
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05940g"
FT                   /old_locus_tag="DEHA0A05984g"
FT                   /old_locus_tag="DEHA-IPF6708"
FT                   /old_locus_tag="DEHA-CDS2477.1"
FT                   /product="DEHA2A05940p"
FT                   /note="similar to uniprot|P38179 Saccharomyces cerevisiae
FT                   YBL082c RHK1 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84537"
FT                   /db_xref="GOA:Q6BYY8"
FT                   /db_xref="InterPro:IPR007873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYY8"
FT                   /protein_id="CAG84537.1"
FT                   /translation="MTEQSIKDGQRPELPPFTLRNVLNDIYNGILALFTDPFCTRIICP
FT                   VVIVLTSLLSKAIIYKVPYTEIDFRTYIQQIQIINDGELDYSLVQGDTGQIVYPAGFVQ
FT                   IYQVLNWLTDEGTDIHAGQTAFGYLLALTNFLVIIAYTMTPDFQPWPVYCLLLSKRLFS
FT                   IYVLRLFNDCFTTVCMVSVTILLQQAAYWYKKGGSSISFLLTMVAADLYSIAISIKMNA
FT                   LLYFPGFIIVAYFLCGENLLKFGTVLLVIPIVQVLMGWKFLLPFFNDEEASYIRWNYIN
FT                   QAFNFNRKFLYKWTVNWRFVSEEFFLSDVFSNGLLIANASVLIFFIFTRYISPRITCKP
FT                   VSRLIKDAMVGPFSSTINKNNLLIDPKCGPKLVMLILGSTNIIGILFARSLHYQFLSWY
FT                   CWQLPFMLYMTGWSLLVCIPLWVVHEWCWNVFPSTPMSSGLLVSILAIVLFGVWYNTNE
FT                   WFPKLADNEAATIDESGESKKDK"
FT   gene            complement(<493956..>496046)
FT                   /locus_tag="DEHA2A05962g"
FT                   /old_locus_tag="DEHA0A06006g"
FT                   /old_locus_tag="DEHA-IPF6711"
FT                   /old_locus_tag="DEHA-CDS1301.1"
FT   CDS_pept        complement(493956..496046)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05962g"
FT                   /old_locus_tag="DEHA0A06006g"
FT                   /old_locus_tag="DEHA-IPF6711"
FT                   /old_locus_tag="DEHA-CDS1301.1"
FT                   /product="DEHA2A05962p"
FT                   /note="weakly similar to uniprot|Q03825 Saccharomyces
FT                   cerevisiae YMR164C MSS11 Transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84538"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY7"
FT                   /protein_id="CAG84538.2"
FT                   /translation="MSHHSTPHLHNKKTPGGVGGDNGPSASTSTNRGPMDSNTSISDSQ
FT                   AANAKQLLNAYVYDFLIKSRLPQTARIFVNEAEVPSIQNSSASSNNNSPRQVSTGNTKG
FT                   TSNESTPHTPSGVSQQFPKENNLPCLALAMEAPQGFLFEWWSIFWDVLQAKNNKGGSQL
FT                   AAQYYQSQMLKQRQQQDLQGLNMQPNMFGPANGQIQQQMQQQLKSSIDQQQIPQQFNPQ
FT                   QQQLDPQQQQQRYMMQMMMKQQQMSMGGNPVDPQQQQQMFGNMPPNNNLTLQQRMFITQ
FT                   QQQQQQSQNRMQQHAQNQMNNLRQQAVAAQHHQPQQQSVPGQRNSQDVSSHSSPSNVPR
FT                   MNPQIAQAQNGVQPFQQAQQPMINGNGQAQDTFGQPQAHMGIRMNSSGKPAVPGNQGDN
FT                   MSIANPNPNDNGAPANRNMNALQDYQMQLMLLEKQNKKRLDIARNNGTADPNGLMGLNP
FT                   GVMPPQAQLQQHANSQNQNASPAAIVNSPVVNSRPSPTANNAAAVAKRKKDPPAKRGRK
FT                   PSATSVPSNLKAGNANSSAASAASNNPPNNSNNGPAFKKEYSAPLTPASESANDAVSKR
FT                   KRRNTSTTESPNKQSVTKNIASKERPIPEEPSKDKKNDDILPTTSSSFQGQPNDQIFPV
FT                   EILGGNNNNDNHLFGAPMNNGGLDDIDFDFNQFLDGSGDNSLNDGMNGFNWGSVDAIEN
FT                   GD"
FT   gene            complement(<496651..>497175)
FT                   /locus_tag="DEHA2A05984g"
FT                   /old_locus_tag="DEHA0A06028g"
FT                   /old_locus_tag="DEHA-IPF6713"
FT                   /old_locus_tag="DEHA-CDS5865.1"
FT   CDS_pept        complement(496651..497175)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A05984g"
FT                   /old_locus_tag="DEHA0A06028g"
FT                   /old_locus_tag="DEHA-IPF6713"
FT                   /old_locus_tag="DEHA-CDS5865.1"
FT                   /product="DEHA2A05984p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84539"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY6"
FT                   /protein_id="CAG84539.2"
FT                   /translation="MVDSVCYPRRCITVEPFGNQIDVIEKALIEIENQPPRHYTYANQN
FT                   TRRNNAVPFIPTMSASQPSFVPSNTSVFGGVPSEMSRGAYSEGYQAVPSVPQMSANTPP
FT                   KQQPSPKVSTTPSIYTTFDPFQPNFKTDTQLASGSLSGYLSGSLSSTATSSSIWGNNDT
FT                   HRNLNGAAVWG"
FT   gene            complement(<497474..>498586)
FT                   /locus_tag="DEHA2A06006g"
FT                   /old_locus_tag="DEHA0A06050g"
FT                   /old_locus_tag="DEHA-IPF6715"
FT                   /old_locus_tag="DEHA-CDS3355.1"
FT   CDS_pept        complement(497474..498586)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06006g"
FT                   /old_locus_tag="DEHA0A06050g"
FT                   /old_locus_tag="DEHA-IPF6715"
FT                   /old_locus_tag="DEHA-CDS3355.1"
FT                   /product="DEHA2A06006p"
FT                   /note="similar to uniprot|P40066 Saccharomyces cerevisiae
FT                   YER107C GLE2 Component of the nuclear pore complex required
FT                   for polyadenylated RNA export but not for protein import"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84540"
FT                   /db_xref="GOA:Q6BYY5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037631"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY5"
FT                   /protein_id="CAG84540.1"
FT                   /translation="MSFLSSNTAASTTNTSASNGQELINDITINNPPEDSISDIAFSPQ
FT                   QDLLVAASWDKKVRIYEIDPNTGNNQGRAMFEHEAPVFSARWSIDGTKVISGGADKQVK
FT                   LFDIASQQTQQIGAHDAPVRAVRFVECGPTNTQVVVSGSWDKTLKYWDMRAPQPVSTVN
FT                   LPERVYCMDSSQKLLVVGCAERQISIIDLNNPQQIFKNSMSPLKWQTRSISCYPQGNGF
FT                   AVGSIEGRCAIQYIDESEQSKFGFSFRCHRKTPTGANTTSALRTSANSESHIYSVNSIA
FT                   FHPVYGTFSTAGSDGTFCFWDKDAKQRLKTFPAVNCTIPATCFNKNGTIFAYAMSYDWS
FT                   QGHTGNKPDYPNQIKLHATKDEEIKQKKKR"
FT   gene            <498850..>501312
FT                   /locus_tag="DEHA2A06028g"
FT                   /old_locus_tag="DEHA0A06072g"
FT                   /old_locus_tag="DEHA-IPF6719"
FT                   /old_locus_tag="DEHA-CDS0780.1"
FT   CDS_pept        498850..501312
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06028g"
FT                   /old_locus_tag="DEHA0A06072g"
FT                   /old_locus_tag="DEHA-IPF6719"
FT                   /old_locus_tag="DEHA-CDS0780.1"
FT                   /product="DEHA2A06028p"
FT                   /note="weakly similar to uniprot|P37020 Saccharomyces
FT                   cerevisiae YJR040W GEF1 Chloride channel localized to late-
FT                   or post-Golgi vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84541"
FT                   /db_xref="GOA:Q6BYY4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY4"
FT                   /protein_id="CAG84541.2"
FT                   /translation="MSFSVPNSVKVSYDDDEIPILSYTNDTPIATGIRSELNRKEYENN
FT                   TYIDWNKESMLEPKSSDVVYRKWATIIVSSIILGYVTTFIDLASVWLNDVKKGLCYGEM
FT                   DKWSLSNPYSTCPAEDWYDWSQILVGSQGFISNMFINFPIYFVFAGCWIAVAAYITINR
FT                   DIFIKQSGIPEIKIIISGFNYDLPVYLGMHTFIYKIFGLILVVSSGLWLGKEGPLVHVS
FT                   CCILNILYDAIVNKNNQNEAVRRELLSAATATGISVAFNAPIGGVLFVLESMPSFFMPT
FT                   KVMWNSFLSATTAVVVLTGFKLFTEGENFYEKDLFRVNFGNFSWLFVELIPFVILGVLG
FT                   AFYGYIFINFNAKFSSKHFRGRVQEKLCQVFKVSDSWGKYLEILTIVVLTTILNFPFEM
FT                   TKLPLHAFLKILFTDCPDDSNTDLDSNSSNFMCSPSNGITSLKLLYIIVQGFFLTSYTY
FT                   GVNLPGGVLMPSLVLGATTGRLLGIISQALQNQINWDSLATCTQNSCLVSPSSYAVIGA
FT                   ASFMAGITKLTMCVVVIMFELTGAITYVLPIMCSVMISKFVNDWLCNDNIYDAWLKNHF
FT                   NRYDSNKGEPNEGKGNGLCDFTNLTATVKNRLPDVTIARAMVPIERTKYVCLIPEQPYT
FT                   NKTLYQFMNDDNHEGYPLIVNESNPISLGYAYKTNIASKLSTIDDALDDSVISFQIQGL
FT                   PNHILSQQLHYERSFETKNIIRLDITTENSVIITNDQTPLVLVLEMFEKLSLNYLIIMN
FT                   HNPHVDQLMSGFIDRFIVSRLINSNFRKLQGEDADSESMQDYDIENMLEDDHLLSTRLD
FT                   RMSVELIT"
FT   gene            <501446..>502678
FT                   /locus_tag="DEHA2A06050g"
FT                   /old_locus_tag="DEHA0A06094g"
FT                   /old_locus_tag="DEHA-IPF6721"
FT                   /old_locus_tag="DEHA-CDS3093.1"
FT   CDS_pept        501446..502678
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06050g"
FT                   /old_locus_tag="DEHA0A06094g"
FT                   /old_locus_tag="DEHA-IPF6721"
FT                   /old_locus_tag="DEHA-CDS3093.1"
FT                   /product="DEHA2A06050p"
FT                   /note="weakly similar to uniprot|P32357 Saccharomyces
FT                   cerevisiae YBL074C AAR2 Component of the U5 snRNP"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84542"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="InterPro:IPR033647"
FT                   /db_xref="InterPro:IPR033648"
FT                   /db_xref="InterPro:IPR038514"
FT                   /db_xref="InterPro:IPR038516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY3"
FT                   /protein_id="CAG84542.2"
FT                   /translation="MASSKPPQTTLVFENLPNEANLNLWLMGIDTQFFNINNIFRGIKL
FT                   IPAGIHLFHYSIPPGNGTINDNELPSETIISSSSRLGFWFDCKDNDVLILRWDDALERL
FT                   NIINPHKDEEQLNYTKCLNSIGDIYSYMVSYPEDASKWLNTSISYIDFEVIQEFLPCDN
FT                   DMYSGDITSMMPSKEENMVLLDALEKVNPQASSSLEDQSDKELRYTIIQFKINKENTES
FT                   VEEVTENYLDKSWYLSQLYGNDIELMFGELQLSFINFVILGNFCSGLQWLNIIKLISMS
FT                   KNFMKSSQKVALDFLTIFQHHLDKLPKEYLIDDLALNNSLDLQTYVSVLENFARDMFPK
FT                   DTWDLNGCCGKMKLSGFIKEKWHRILEINKSKFNIDFEKLDKNRTDENQIEVYDLNDYD
FT                   ENDEDAPAIVG"
FT   gene            complement(<502766..>503473)
FT                   /locus_tag="DEHA2A06072g"
FT                   /old_locus_tag="DEHA0A06116g"
FT                   /old_locus_tag="DEHA-IPF6722"
FT                   /old_locus_tag="DEHA-CDS5044.1"
FT   CDS_pept        complement(502766..503473)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06072g"
FT                   /old_locus_tag="DEHA0A06116g"
FT                   /old_locus_tag="DEHA-IPF6722"
FT                   /old_locus_tag="DEHA-CDS5044.1"
FT                   /product="DEHA2A06072p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84543"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY2"
FT                   /protein_id="CAG84543.2"
FT                   /translation="MLRISKMCYGVSAKAGYRTATSKPIEFLPSHLVVQKPYDFHAIHT
FT                   NYGWFIIPKPYYAYRWTTSNIHKAIEDRYPDIKDVPRSHEMLQKVVDDWGQTVDLSTKP
FT                   ITTKTTRADIKKQKDDALYRTQLKEDMPSLVTPSKQTTVPKKRSRLGTVTFIHAWNYYF
FT                   SITHPKYSHLDKKESRREIANEWNAMTTEEKDDYREAYANLLNDGKDIHKGKIVSREEK
FT                   LKKQFKKKKSDDK"
FT   gene            <503643..>506591
FT                   /locus_tag="DEHA2A06094g"
FT                   /old_locus_tag="DEHA0A06138g"
FT                   /old_locus_tag="DEHA-IPF6726"
FT                   /old_locus_tag="DEHA-CDS0479.1"
FT   CDS_pept        503643..506591
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06094g"
FT                   /old_locus_tag="DEHA0A06138g"
FT                   /old_locus_tag="DEHA-IPF6726"
FT                   /old_locus_tag="DEHA-CDS0479.1"
FT                   /product="DEHA2A06094p"
FT                   /note="weakly similar to uniprot|P47029 Saccharomyces
FT                   cerevisiae YJL084C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84544"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY1"
FT                   /protein_id="CAG84544.2"
FT                   /translation="MQTPNSPLFPAQKLTLSPSAVSLGGLTGTSSGVGSSTLIPQLPDK
FT                   PLTETSSIQVYVVPAEKDLFMQGFEPEEYEGRPPTLLRGCLFLRVLKPSKIRSVTLTFK
FT                   GQQRTDWPEGIPPKKTSYVELNDILSHTWPFYQSGNPLHSANGGADFFQELSKDHNSEV
FT                   ENSTLNVPLPVSRSRSPAAENGLGNFFTRNLSPATSFMRRAASPSSTVNESFSDLTSVL
FT                   STETDPLKPALFTPGDYIYNFEHPLHPSIPETSSVTFGEVFYYIEASVVRAGTFKSNLT
FT                   GKLPINIIRTPSESNMEENEPIIITRDWDDQLRYDIVIGRKSIVLDSYLPLAFRFVPLW
FT                   GKVALHRIRVYLSENLEYYCQNKKVHRLEPPKKYLLLEHKAKKGKSLLSEKSGQDEDED
FT                   DDAEILPKELEFQLFVPRVLSGRIKHEIHPDTSYENIQAHHWIKICLRLSKTDPEDPSK
FT                   RKHYEISIDSPIHILSSLAAHVNTLLPAYDEHLVLSPSYNVQDHATPPLSPEVIPIDNT
FT                   TVAGRNISRKGTENSVSLDEVIERPHANFEHITNHNGTFDDSDADMHLEANLYSPPDDN
FT                   RPEMASPQALPHSGTFNSPIQRPIHFVRKPSINPPPFQENTNDMLIGVDNLPPPAYEEE
FT                   DHSLSMSPLRIDESSDRGRSKSNSRFPGLTMTVSHEGPVKNLLSQQLRKSESELSRKYE
FT                   SEDISDNVSSVKPPTMSPIRNAVSPNRRATDATRQSNSSANSSDTGLTNSIISSSQSNE
FT                   TKSTHDQDEMYESSNVHKITNRNEKADANRKFSDDNYVPESTFHESENKDKSRQSSISS
FT                   LTSSLDIPVEHTLPLLNHSSSSLLTPQSNFKSMNSSINSLNDRRTSNVHEITKITDLVE
FT                   GGFNDDLYRVNDNLSHLRNPRIKKHYQNSDHMSETEINKQRQKSFGVINNNDSDMVTRM
FT                   SSSSESTVHGDDTVGASPLFNSNGGSPSNTNSLFKPLSGSPAPGLNYGFIIE"
FT   gene            complement(<506871..>507917)
FT                   /locus_tag="DEHA2A06116g"
FT                   /old_locus_tag="DEHA0A06160g"
FT                   /old_locus_tag="DEHA-IPF6728"
FT                   /old_locus_tag="DEHA-CDS3904.1"
FT   CDS_pept        complement(506871..507917)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06116g"
FT                   /old_locus_tag="DEHA0A06160g"
FT                   /old_locus_tag="DEHA-IPF6728"
FT                   /old_locus_tag="DEHA-CDS3904.1"
FT                   /product="DEHA2A06116p"
FT                   /note="similar to uniprot|Q9C1L3 Neurospora crassa Putative
FT                   3- hydroxyisobutyrate dehydrogenase G6G8.5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84545"
FT                   /db_xref="GOA:Q6BYY0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYY0"
FT                   /protein_id="CAG84545.2"
FT                   /translation="MISVKQGIRCLSTSSLRMTNYGFIGLGEMGQHMGRHIYNKLEPDD
FT                   KLYVYDLEPANTKKFVDTVTEASPANKKLVVPLESISDFVHKVDSQLEFIMTMVPEGKH
FT                   VKSVVEELVQNYKKCATDISGVSTTFLDSSTVDIPTSIEVHKYVKQQIPDFDFIDTPVS
FT                   GGVAGARKGTLSFMLSRETHEDMSPSLTSLLSKMGTNIFPCGKNHGTGLAAKLSNNYLL
FT                   AVTNLAVADSFQLAKSFGLDMKNYAKLVSVSTGKSWASVDNCPIKGAYPKENDLPADRD
FT                   CHGGFITKLARKDLVLATQSAKSNNRFLFLGEVGKKWYDKACEREDLATKDLSVLYEWL
FT                   EELSEKDK"
FT   gene            complement(<508189..>508506)
FT                   /locus_tag="DEHA2A06138g"
FT                   /old_locus_tag="DEHA0A06182g"
FT                   /old_locus_tag="DEHA-IPF6729"
FT                   /old_locus_tag="DEHA-CDS6874.1"
FT   CDS_pept        complement(508189..508506)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06138g"
FT                   /old_locus_tag="DEHA0A06182g"
FT                   /old_locus_tag="DEHA-IPF6729"
FT                   /old_locus_tag="DEHA-CDS6874.1"
FT                   /product="DEHA2A06138p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX9"
FT                   /protein_id="CAG84546.2"
FT                   /translation="MKTLYPFEYSHCVQLLQNSTDNTAYLHLTFSRTCFQHNLNRTING
FT                   LSNYSPQLILFQNSLTCALHSSQLAAYDIGATPVQAKIWGNRMHNQPPRNTHGTTPSKP
FT                   T"
FT   gene            <508999..>509889
FT                   /locus_tag="DEHA2A06160g"
FT                   /old_locus_tag="DEHA0A06204g"
FT                   /old_locus_tag="DEHA-IPF6730"
FT                   /old_locus_tag="DEHA-CDS4284.1"
FT   CDS_pept        508999..509889
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06160g"
FT                   /old_locus_tag="DEHA0A06204g"
FT                   /old_locus_tag="DEHA-IPF6730"
FT                   /old_locus_tag="DEHA-CDS4284.1"
FT                   /product="DEHA2A06160p"
FT                   /note="highly similar to uniprot|Q10082 Schizosaccharomyces
FT                   pombe SPAC11D3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84547"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX8"
FT                   /protein_id="CAG84547.2"
FT                   /translation="MSDNSSQTNIKTKYNLPKPTPAYYPHDGSPIYADKKLYQKIGACE
FT                   KTLVEKHLCQPRRGIAVKIPAKSVFRITTPEGPQVCDLNIWNLHNPRERFWAARSRQLH
FT                   SAHVSTYDRLWSNLPFLRPLVTITGDSMSDRGQDEWGGRLHDLNGTRCDPYIDQLISGQ
FT                   ENNFHCHSNLLRAVLPHGLTEFDIHDVINVFQVTGLNEYDQYFMEACPAKAGDYFECFA
FT                   EQDLLIAISACPGGDLSQWGWGEDGENLEDSKMVDCCRPLGIEVYKINDEKVLEGWVPP
FT                   NVVGYKGNHGLQNPA"
FT   gene            complement(<509921..>511324)
FT                   /locus_tag="DEHA2A06182g"
FT                   /old_locus_tag="IPF_6732"
FT   CDS_pept        complement(509921..511324)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06182g"
FT                   /old_locus_tag="IPF_6732"
FT                   /product="DEHA2A06182p"
FT                   /note="weakly similar to uniprot|P47051 Saccharomyces
FT                   cerevisiae YJL046W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65366"
FT                   /db_xref="GOA:B5RSR0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR0"
FT                   /protein_id="CAR65366.1"
FT                   /translation="MIRPSLSHINSLCIRLQTKRYFGNIHVPFQDDLDPANDDDFNLSD
FT                   FQHYKESKDVIMQKQKLYEDLEQETPEVKIDLQNYTKLREPVIFVSKLKDPYLNLAIED
FT                   SIYNDMPIPENDSKENYNRLMFYKNWPCAVIGKNQNPWKEVNLPLLNSLHIPLVRRRSG
FT                   GGTVVHDLGNVNYSFMTTKPKFDRFKFAEIIRDSVNKYPDLKYKLKVSERGDITTVTQP
FT                   DGVDYKVSGSAYKLSKGKSYHHGTMLLDSKLDVLGKLLTRDERQLGIVDSMASINSVKS
FT                   KVINLELKDEKFIELVSDGFSKNYGIVEKENDVQNEKLPSDSEEYDQNELFNLTDFVEA
FT                   YSDYARVVNIDETTVLNQQIYDLADELKEWKWKYGSTPKFSHELYNEKFGFTVKFHVKK
FT                   GAIIDTFELSFDEISNRMISTEKIKESFEFLEQIIETQELTYSGSNVSGFITNDMISDW
FT                   IGQSIDGTI"
FT   gene            <511455..>512321
FT                   /locus_tag="DEHA2A06204g"
FT                   /old_locus_tag="IPF_6733"
FT   CDS_pept        511455..512321
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06204g"
FT                   /old_locus_tag="IPF_6733"
FT                   /product="DEHA2A06204p"
FT                   /note="some similarities with uniprot|P38336 Saccharomyces
FT                   cerevisiae YBR257W POP4 Subunit of both RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65367"
FT                   /db_xref="GOA:B5RSR1"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR016848"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR1"
FT                   /protein_id="CAR65367.1"
FT                   /translation="MNRNNVLERHLLTRCYSSEARIEELLSTRYSITGDQRPSLLLMPT
FT                   GQDVENNKTKALLHQERPKTSDEAHKTKKYNTRIELKNYIKNTLNNQQKVIKKIQAYNR
FT                   LSKQNGKKKPFPILKLLEHYSIPMYEEFIPISNLWQDYMQNLLFPSANNKLPSLISILP
FT                   KLSSADYHGCLLTVLKSTNRLLVGVRGIVVWDTQHSFILCVPRTKDSKEWNENKEDFTP
FT                   SEQIGGLKIIPKKGCLFGFDVILPSNEGEEDEDECMGFTVIGSRFEFRSVDRSGKKFKN
FT                   HNVDDIL"
FT   gene            complement(<512347..>513252)
FT                   /locus_tag="DEHA2A06226g"
FT                   /old_locus_tag="DEHA0A06259g"
FT                   /old_locus_tag="DEHA-IPF6736"
FT                   /old_locus_tag="DEHA-CDS4193.1"
FT   CDS_pept        complement(512347..513252)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06226g"
FT                   /old_locus_tag="DEHA0A06259g"
FT                   /old_locus_tag="DEHA-IPF6736"
FT                   /old_locus_tag="DEHA-CDS4193.1"
FT                   /product="DEHA2A06226p"
FT                   /note="similar to CA1647|IPF16663 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84550"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX5"
FT                   /protein_id="CAG84550.2"
FT                   /translation="MSDTPVLSYKKPSSASSRQQSSTPSHPSSPLPKSQFESPRISSAT
FT                   TSRQVSSRRKALQDFYNIHHQESQDTNIEESISSSETTNNVNFNDPEQLLKFMKSTPVE
FT                   EILKLRNSITNKLNSHDSAKKSIIYDNYYELIKLSQILGDLSKPKPVAKENTLDGLGIF
FT                   TNPPNELKTKTKEINDHDLDSIFTDLSKFINEDVQQFNTEFETVVKSLQKDFDNDDNDS
FT                   ASSMKGIAENSEKDKFPESINKQQLVKEVNLLLDEDPKNVKQESKNKILNDIQDILKSL
FT                   NVHHDELLILQLNKLKSKFT"
FT   gene            complement(<513451..>514422)
FT                   /locus_tag="DEHA2A06248g"
FT                   /old_locus_tag="DEHA0A06281g"
FT                   /old_locus_tag="DEHA-IPF6737"
FT                   /old_locus_tag="DEHA-CDS3946.1"
FT   CDS_pept        complement(513451..514422)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06248g"
FT                   /old_locus_tag="DEHA0A06281g"
FT                   /old_locus_tag="DEHA-IPF6737"
FT                   /old_locus_tag="DEHA-CDS3946.1"
FT                   /product="DEHA2A06248p"
FT                   /note="similar to uniprot|P32910 Saccharomyces cerevisiae
FT                   YNR003C RPC34 RNA polymerase III subunit C34"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84551"
FT                   /db_xref="GOA:Q6BYX4"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX4"
FT                   /protein_id="CAG84551.2"
FT                   /translation="MADLSEKARTLHNKMLEFPSSTLFNQEQLQDFIQISVLADLLMIA
FT                   QELINRKLVKLVKQGDELKFQAISLSEASKITSMSEDEAMIYSYIEASGREGIWTKTIK
FT                   AKTNLHQHIVVRCLKALENQRYIKSIKSVKHPTRKIYMLYNLQPSIEVTGGPWFTDSEL
FT                   DTEFIDSLLTVIWRFVASKTYPTAFQTPSSNNNIYQSSYPANHTGFVNLDTIIEFITSN
FT                   NITNIDLAINDVRSLCDVLINDDKLELIKHTNDIFKATWQSVLEAGYGRAYADESFDKL
FT                   VDPSVKSLVTNQSFSIFDHFSVIEPSAEQDPDLVYLDSWIYE"
FT   gene            <514676..>515584
FT                   /locus_tag="DEHA2A06270g"
FT                   /old_locus_tag="DEHA0A06303g"
FT                   /old_locus_tag="DEHA-IPF6739"
FT                   /old_locus_tag="DEHA-CDS4223.1"
FT   CDS_pept        514676..515584
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06270g"
FT                   /old_locus_tag="DEHA0A06303g"
FT                   /old_locus_tag="DEHA-IPF6739"
FT                   /old_locus_tag="DEHA-CDS4223.1"
FT                   /product="DEHA2A06270p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84552"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX3"
FT                   /protein_id="CAG84552.2"
FT                   /translation="MSSEKLDLNVISSLDELEDNLENQAPQTNPTQAIFKKKGLKGKKS
FT                   NQRKVSLDFDVSDEEVEQKSFPVIKRTKFKSPHSFVTKSQPFRVGAGHTSIKETRNEDI
FT                   KYTQEHIRELRGEQMERNEDLMDVDEPVVVETTPAEVLQEFHKNAPIDNNDEDENIIPV
FT                   IEYDSDDNDNDDNFAAPTANSFPADDDLMPDNDDAFIDDGPLNLADSKKYPKLDIDEDL
FT                   YDMELPIGEEESEVELDVLKPNVSRVIEPIGITEHLETLKKSIENLKMERLESESQYAN
FT                   IKTQFDSIGRNKESLLLELIQ"
FT   gene            <515748..>516776
FT                   /locus_tag="DEHA2A06292g"
FT                   /old_locus_tag="DEHA0A06325g"
FT                   /old_locus_tag="DEHA-IPF6741"
FT                   /old_locus_tag="DEHA-CDS4072.1"
FT   CDS_pept        515748..516776
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06292g"
FT                   /old_locus_tag="DEHA0A06325g"
FT                   /old_locus_tag="DEHA-IPF6741"
FT                   /old_locus_tag="DEHA-CDS4072.1"
FT                   /product="DEHA2A06292p"
FT                   /note="similar to uniprot|P05150 Saccharomyces cerevisiae
FT                   YJL088W ARG3 Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84553"
FT                   /db_xref="GOA:Q6BYX2"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX2"
FT                   /protein_id="CAG84553.2"
FT                   /translation="MMSMPIKNMIGRRSFSSSAFLKSKPRHLVNTIELSNEELASLVGK
FT                   AEAFKKQVRSGNSVPIEQHQKLLGKLVALLFSKRSTRTRISTEGAAAYFGAQPMFLGKE
FT                   DIQLGVNESTYDTTKVISSMTSCIFARVNSHQEILDLCEHSSVPIINSLCDMYHPLQAI
FT                   TDILTIKEAFGKTEGLKLAWIGDSNNVINDLAIASLRSGISVAISIPKDIEFDPEVGKA
FT                   ASEIASDKGLSFDIFHEPSKAIDNANVIVTDTWISMGQESEKQAKMLQFDGYQITQNMI
FT                   SQGNASSDWKFMHCLPRHAEEVADDVFYSKNSLVFEEAENRLYAAMAVIEAFVVNKGDL
FT                   LK"
FT   gene            <517110..>518123
FT                   /locus_tag="DEHA2A06314g"
FT                   /old_locus_tag="DEHA0A06347g"
FT                   /old_locus_tag="DEHA-IPF6743"
FT                   /old_locus_tag="DEHA-CDS3828.1"
FT   CDS_pept        517110..518123
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06314g"
FT                   /old_locus_tag="DEHA0A06347g"
FT                   /old_locus_tag="DEHA-IPF6743"
FT                   /old_locus_tag="DEHA-CDS3828.1"
FT                   /product="DEHA2A06314p"
FT                   /note="similar to uniprot|Q12068 Saccharomyces cerevisiae
FT                   YOL151w GRE2 NADPH-dependent methylglyoxal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84554"
FT                   /db_xref="GOA:Q6BYX1"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYX1"
FT                   /protein_id="CAG84554.2"
FT                   /translation="MTSVFVSGATGYIAQHIVKTLLEKNYKVVGSVRSTEKGEKLKKLL
FT                   QSANFNYEVVNDIQKEGSFNDALKHHPEVTVFLHTASPFHFKAKDVEKELLIPAVNGTK
FT                   NALKAIKDYAPQVKRVVVTSSIAAIKVEAKENDSTFVTTEETWNPISWEEALTNPVLGY
FT                   RGSKTFAEKAAWEFVEMEKPSFILSTVNPVIVFGPQAFDSEVKETLNTSAEIINNLLKL
FT                   KPDDPVPPSNNAFIDVRDVAKAHVVAFENEYAANQRLLLSESRYSSQLVLDLIHKNFPE
FT                   FKSRIPLGTPGVYPDTSKLSKTDNSKTKAIVGFPFIPLEKSVVDTVSQIVAAEKHQ"
FT   gene            <518833..>520761
FT                   /locus_tag="DEHA2A06336g"
FT                   /old_locus_tag="IPF_6745"
FT   CDS_pept        518833..520761
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06336g"
FT                   /old_locus_tag="IPF_6745"
FT                   /product="DEHA2A06336p"
FT                   /note="similar to CA1866|IPF7647 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65368"
FT                   /db_xref="GOA:B5RSR2"
FT                   /db_xref="InterPro:IPR021988"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR2"
FT                   /protein_id="CAR65368.1"
FT                   /translation="MKVTMGLKFGRRRVLLYSTVFLILLGLIWIGRDVGLDGTKVIDQI
FT                   QGISRSRLPTSNFATNETLVIFPRGFELRASRDLRDYYRKHMNHDKNRVFNSVTYNGPP
FT                   SALTEAVKQIDYHQHDISMYDTTKDISNDFKKCESELNTKFKVDVGKAKKHDDSLARFV
FT                   KKFVHQLENDDAMKELANFFKDDLKKQLEDDTVDKHWYKFAGSSVWLQQYGVHFMISRM
FT                   LYSPTGNKSNPVMSLIFAQVYNEKWEEFEDIELVIPTIDPITNKKIYKNLAFPSFLPIP
FT                   FYHQSSYINKRWYGPEDARILLFKNDDGLEEPLIIFNAYHRKVNKQENIEEAASKVSHE
FT                   FYRSMFMGWPFRFQHGKENVDGISNAATDDKIYNKVVELRREGTKRLKVQKNWTPFVSV
FT                   KDRINGGSDESIYFVYRWQSLEILKCQLTGFTHDYAKCKFEYKRKEDLSSDEPVGALRG
FT                   GTEMISLNKILPSISSKLHPSKEVWVGFARAHLVRCGCGKDMYRPNLAIITREDNQFKI
FT                   SQLSSFFSLDMDVTGWRNPEVLCHPKDPNALIPNGISHWDVSTIKLGKKYVTEDFVTLS
FT                   LSVADATVHTIQIKNLLQNILSDTSVLSYNQKSGYTDDVVECSLKASNQFCAAYGKEQV
FT                   KLGKVPI"
FT   gene            <520908..>524012
FT                   /locus_tag="DEHA2A06358g"
FT                   /old_locus_tag="IPF_6747"
FT   CDS_pept        520908..524012
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06358g"
FT                   /old_locus_tag="IPF_6747"
FT                   /product="DEHA2A06358p"
FT                   /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
FT                   YPL183c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65369"
FT                   /db_xref="GOA:B5RSR3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR3"
FT                   /protein_id="CAR65369.1"
FT                   /translation="MSSSSLSGSPNPISSVNEDLFQILQHYGPVTALKIHMNYIICGYG
FT                   SILKIFKIEKDFTHQLVFNRQILDRNKIHNISVSPCGTRIILSGGRSFIVLNISDLLNT
FT                   NHASSKEKAINEWITCTEFLDNNTVLILTSHNIVYKVDVSDMESNQHFEIVDRIHCNEK
FT                   SILYTGSIRIIGEKTLIAAGTVMGGVIVWDLDSRQILHNLTDHEGSIFGVRIDSEGKYI
FT                   ISCSDDRSIKLYDFKSGRLLATGWGHGSRIWNLEFFKCKDSLKIFSTGEDCTARIWEFE
FT                   SGNPLLKLLDVSDCHLGKHVWSGDLDDDILQLSVTGGADGRIKLHDLTLFANSNKTSYT
FT                   LETIEKEVGIKFDKNEIVKQYLELPELNLLIVLTSNGKVLSLDQKNKKWELIDLSSEEV
FT                   NKFKNFGLVRGFIDINVIIICTRSGDLLVLKFDADSQKPVSKTWFLDEHLNGNKVTNFM
FT                   TSYDKEGNNFYVLIDCPNPKIPFILRKFKFDNHTLVCDGIIHLEQPDQTSFTTTCMTLD
FT                   SVNKILILGSRYVSFALYDLSTGADLIQLSGLFKKLSKGDTITAISIVHSQTNCIRILV
FT                   TVRDGIYMYVELNKKDGSFTHQVIHKNKLSKGFVEGGFLHNNELIVYGFKSSYFYVWNE
FT                   TKQLEVASELCGGAHRQWELFRYKNSMSEMKFVYISKSTLNIKSFKQKFGDGSYGLIND
FT                   GTHGREIRDIAISPSISPDDTSRLIMTASEDTTIRLGKLFANGEIKNYWSLNEHISGLQ
FT                   RINFLNDTYVGSSAANEEFFIWKLNKLDTGIPTITKYATLKTSQANPDLRIMDFDSYPF
FT                   ANGFVISTVYSDSNLKIWYFDCVSGKFHLIANDFYTTCCILNVNFLKFNDKIYIMIGTT
FT                   DGCLSIWDISNIMNNLDTESSEVQKLGTMIIKQHLHQNGIKAVLCLPDMPNGYRVFTGG
FT                   DDNSLISSTLCFEEESEELILKTNCFVEKAASSTITSLSFGGSNQIVVTSVDQIVRLWK
FT                   FDDTSLTCSSARYTTIADTGCSDTTKFDDKDIIVVGGAGLSSWSF"
FT   gene            complement(<524114..>527362)
FT                   /locus_tag="DEHA2A06380g"
FT                   /old_locus_tag="DEHA0A06413g"
FT                   /old_locus_tag="DEHA-IPF6748"
FT                   /old_locus_tag="DEHA-CDS0335.1"
FT   CDS_pept        complement(524114..527362)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06380g"
FT                   /old_locus_tag="DEHA0A06413g"
FT                   /old_locus_tag="DEHA-IPF6748"
FT                   /old_locus_tag="DEHA-CDS0335.1"
FT                   /product="DEHA2A06380p"
FT                   /note="highly similar to uniprot|P09436 Saccharomyces
FT                   cerevisiae YBL076C ILS1 Cytoplasmic isoleucine-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84557"
FT                   /db_xref="GOA:Q6BYW8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYW8"
FT                   /protein_id="CAG84557.1"
FT                   /translation="MSEQEASNQFFNFPREEENVIKQWEESNAFQRSLEITKDLPPFAF
FT                   FDGPPFATGTPHYGHILASTVKDIIPRYATMNGHHVERRFGWDTHGLPVEHEIDKKLGI
FT                   TGKEDVMNMGIDKYNNECRAIVMRYADEWRKTITRLGRWIDMDNDYKTLYPEFMESVWW
FT                   AFKELFKKDAVYKGLRVMPYSTGLTTPLSNFEAQQNYKEVNDPAVTIGFPLVDDENTWL
FT                   VAWTTTPWTLPSNIALAVHPEFEYIKIFDEEKQKNFILLESLLSTLYKKPAAAKYKVIE
FT                   KIKGKDLAGTKYTPLFPYFYESFKDRGFKVICADYVTAESGTGIVHQSPAFGEEDFNAA
FT                   TKAGIIDEKKQPPNPVDDNGKFTNEVSDFAGIYVKDADKLIIKKLTQDGRLLVSTQLKH
FT                   SYPFCWRSDTPLLYRTVPAWFVRITNIVPDMLKNVERTRWVPSTIKEKRFSNWIANARD
FT                   WNISRNRYWGTPIPLWVSDDFEEIVCVGSIDELKELSGCDDITDIHRESIDSITIPSKQ
FT                   GKGQLKRIEEVFDCWFESGSMPYSSNHYPFENKDKFLKAFPANFISEGLDQTRGWFYTL
FT                   TVLGTYLFNTAPYQNVIVSGIVLASDGKKMSKRLKNYPDPSIVLEKYGADALRLYLINS
FT                   PVLRAETLKFKEEGVREVVSSVLLPWYNSYKFFKDAADLFKKENNVNFVYDSTLKSTNV
FT                   MDRWLLASIQSLIKFIHVEMSEYRLYTVVPRLLSLIDELTNWYIRFNRRRLKGYSDEGV
FT                   DDTRVGLNTLTEALLTLSRAMAPFTPYLSDGIYQRLKPYFTDEELEKYCVNPNMKDTRS
FT                   IHFLSYPSVKEELFDTEIEVAVSRMQKVIDLGRNIREKKTISLKTPLKELVILHSDPGY
FT                   LRDVESLKGYITDELNVRNLVITSDEAKYGVEYTVVADWPVLGKKLKKDAKRVKAALPN
FT                   VSSAEVQKFAESGKITVDGIDLVTEDLQVQRGLPTEKASHGQESRSQQDVLIILDVNMY
FT                   PELQSEGLARELINRVQRLRKKAGLNTTDDIKVEYNLIKDTINFENVIKDHEGILVKST
FT                   KRPLEPFTSDESKVIIDEEQTINDTTFNLRLLRI"
FT   gene            <527566..>529074
FT                   /locus_tag="DEHA2A06402g"
FT                   /old_locus_tag="DEHA0A06435g"
FT                   /old_locus_tag="DEHA-IPF6752"
FT                   /old_locus_tag="DEHA-CDS2117.1"
FT   CDS_pept        527566..529074
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06402g"
FT                   /old_locus_tag="DEHA0A06435g"
FT                   /old_locus_tag="DEHA-IPF6752"
FT                   /old_locus_tag="DEHA-CDS2117.1"
FT                   /product="DEHA2A06402p"
FT                   /note="weakly similar to uniprot|Q10441 Schizosaccharomyces
FT                   pombe SPAC12B10"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84558"
FT                   /db_xref="GOA:Q6BYW7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYW7"
FT                   /protein_id="CAG84558.2"
FT                   /translation="MISNRLFGEVLRKCFKNGTFPERIVVALSGGVDSLCLTYLLGQFK
FT                   RIYKPSLQITAITIDHKYRAGSGKEAEKVGVLVRPWGVKHIVKTLEYEDRDIGKITNFE
FT                   EVAREKRYDIFEQVCRELDVKSLIVAHNLNDQIETFLQRLQQNSSIFGLVGLRTVDHLP
FT                   ISPTSPSENGDSIHVVRPLLSFDKSEIIETCTKNGIRWFEDHTNSDIHLTRRNLLRHIV
FT                   SEVVPHRLDNQDIPIEECNALSLVSKESLVKTHNEILSLVCEMQHQIANIENHLKLRGL
FT                   FSLDKKNLSLTVSLPFNILDTYNPMVLSRFFYQNMYLISSVKHYHWSYAKLERHAIPKI
FT                   LRFYNNNKEISPPVSMKLTYLNVLFNIKLDTHNKQMRISLTRQPLMRNEYSQVCLDCTL
FT                   NDQWSDWFMFDRRYWIRLKSRNSDIKVSIVPYRHNDVAFRKQLNLAFKGSNNGPLLSIL
FT                   QEGTPVIVTYSHSGHFAALPTYNIYSQEDVIDVEWLAKNNVHSL"
FT   gene            <529238..>534124
FT                   /locus_tag="DEHA2A06424g"
FT                   /old_locus_tag="IPF_6756"
FT   CDS_pept        529238..534124
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06424g"
FT                   /old_locus_tag="IPF_6756"
FT                   /product="DEHA2A06424p"
FT                   /note="similar to uniprot|P23255 Saccharomyces cerevisiae
FT                   YCR042C TAF2 TFIID subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65370"
FT                   /db_xref="GOA:B5RSR4"
FT                   /db_xref="InterPro:IPR037813"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR4"
FT                   /protein_id="CAR65370.1"
FT                   /translation="MKMPTTSHTDMIHTLGTPRLSGQAITPKTFRASKSSRHVNHSSQS
FT                   IRIAHQRVNIDVDLTQNKLEGFTELTVIPTMGSLKSIKLDCREMKIKNVYINNTRNTNY
FT                   IYKDVLYINDDKYFEESLDNKSVNLFDMYSDDLTIHQHHLIRQKLNYVFGEINNDPREL
FT                   PRELHNGNTEELLIFLPDNLKLELADANAFTTPESQVVTPRYPKSKNTMSESQYSFTVK
FT                   IEFESINPKNGLNFITDKKADRKYWHAYTVNSDYNISTSSWVPCVDNLWDRCTWSLEIN
FT                   IPRTIKDIGNPRIIGSENTNPSEKEHETERTQKYVRNGGHDDFENNADDVEHDGDNVDD
FT                   DEDDTENYDLVVCTGDFNNVKETPHPIDSSKKVVSWSIFNPVCAHHVGWALGSFQSIIL
FT                   STPTQEGDEEIKDQVEFEDIEKVTDNSPVTIYFLVGREDMARNTCILANKAIDFFSKEF
FT                   GSFPFSSYAMVFVQNNASESNNFAGLSVMSDSLLYPSDLIEPMISTTDTILEGMATQWS
FT                   GINIVPLSFNDYWCTIGIAKYMALQFIKVLMGTNEYRFKIKKKMNEIVEKDIGKKPLAL
FT                   QFFRFPISDLDLDFLRLKAPIVLYILDKRMTKTDKSFGLSRVLPKLFLQAMSGDLQNGA
FT                   LSTQHFQYVCEKVNRNKLDTFFKQWVFGSGVPIFNISQKFNKKRSMIEMSIRQVQQSDT
FT                   KKLHPNPESFINDSISHLDDEPSFSIQPVFTGPMTIRIHEADGTPYEHIVDLKDGHVKL
FT                   DIQYNTKFKRLKKNREDLNEPNTTFSKLGDILTTPEEMDEWGLNEWVKHEEDMLYNDAF
FT                   EWIRVDADYEWIAQINVKQPDYMFGSQLQYDRDVEAQYEAVRYFGDREKPNTLYCTALT
FT                   RTVMDDRYYYGLRIAAAQALADISKPDNNFIGIGYLIKIFKELYCFPGSSIPLSNDFNN
FT                   FNRFFLQKQIPQILSEVRDENGEVPFVIKNLLLNLVKFNENSNNNFQDCFYMSDLITSL
FT                   TTSALNAKSALTSQDPLNLLDTSDSINSEKQKFLQDVITEINRLQKLDEWVPSHQSIIA
FT                   ITCIKSKIRLATHGLLQLSFEDLLYYTLEKYPFDIRIEAFRGLLILGGLKNASVLQYYL
FT                   KVCLLGATTPYFRGKLIDLLINAICVAAIDGTPSTLDDPEFKTLEKLFDENSRMANNQT
FT                   NMVIIEDGSNNELNSRRDTFARATLNGAIELLRRDYSIGKGLKILFWELLHTSLLSIYE
FT                   RRNIFNVCQVLYKEIDTFIARVPVPSVPLSELKKKIVLRNMGDGKVVIKREGRFKIQLA
FT                   SRRLTIQEPSKSKVSQEKAKPKPTDVPAVVEHPPETKLKLKLGSTSTTVEPKKDTPRVS
FT                   KKTEATRDPELVTIDPYAKSKVTIKFKNHTLPSSSLFDFPTQNASSTVGHSVSVQGSTI
FT                   TLKFTSDKIAKVKDILSGKSSKPRYVKILTKDKRIFVSPTPFSSPEEKTVLTDQPNGKF
FT                   GGESMNPSCKTKSTSSGSSNGKFSGAESTKIKLKGDKSKEQSIESPSESEEKKPRLKIP
FT                   IKRELKQPERLSSEPVSKPVERSVSPFSRSASPFSPAPSSQRTNKKTKIYIHPNDEKSA
FT                   SSSAQDEPQVANMDVSDSTENQKPDKSPEDKPKKTNSKPGFKLKLNLKR"
FT   gene            <534308..>536749
FT                   /locus_tag="DEHA2A06446g"
FT                   /old_locus_tag="IPF_6761"
FT   CDS_pept        534308..536749
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06446g"
FT                   /old_locus_tag="IPF_6761"
FT                   /product="DEHA2A06446p"
FT                   /note="some similarities with uniprot|P54787 Saccharomyces
FT                   cerevisiae YML097C VPS9 Protein required for Golgi to
FT                   vacuole trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65371"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="InterPro:IPR041545"
FT                   /db_xref="InterPro:IPR041804"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR5"
FT                   /protein_id="CAR65371.1"
FT                   /translation="MSYNNHLAFNISKATPTTSTTNAHTTSTPPASNEGASSGGTNSTN
FT                   SKSPFLQNILSKSTPSAGNVSPQLGSRSTVTPTFVNIGDEGSHSSSVKDSQAGNNKPDL
FT                   IDLFGKFDISNKKGDDEDADQEDKEAKIDINCDEETKDNSHDEKLANEKTNKQEDEMTE
FT                   TSVAKSVEKEGLSEPIESKEIQNAKSTSEMIEKTPTNKPAQVDGNDANIETTSDTNTET
FT                   HTDINPDTDANTNTDSNTSTNIGTNIGTNADTNADTNADTNADTNTGTNTGTNTGTNTG
FT                   TNAETNTETNIEANTESQSDETDNEAHNDRDLTDITGNTNEDDSVAEEYSIREHESTPV
FT                   ESELEDVSESEGITKNIIESQHMSGKSKKNQPLISSDEQYQQSHKPFDFQQFLNHLKKK
FT                   SADPIVRYIRSFLVSFSRQGHTFTSDQKIKIIRDFKEFMNDKFSLYEPFASMDDIDLEN
FT                   SREGLEKLIMNRLYEHCFPPEVVAQAPSFIPESIQEDLQNDENFLRQLEKFNWINGTHL
FT                   DIDLDYLTKHKSKTNKDNLNFIDFAIAELNKINNYRAPRDKIICILNSCKIIFSFLRVS
FT                   KRETNADSFIPLLILVIIKAKTDNLISNMHYIEHFRNEEWLSHGETSYYLSSLQGAIGF
FT                   IQNLCFDDLTIDEEEYSAHMEAWEAGEKQRNSRKPIAMPIPQRKDSELEEFQNSTPIKS
FT                   GLSPSNVLMTSAEMFTKSLSNFLSPSPHESPRQDDSRPTTEVQGRVEQQHQTHQQSHSQ
FT                   SQSQDQTQSQENTAAMKETYKSLREVFPNLDKAVLKDVVFMNQGKLDESLDACLQLVND
FT                   V"
FT   gene            complement(<536841..>536941)
FT                   /locus_tag="DEHA2A06468r"
FT                   /old_locus_tag="Deha0A.9"
FT   tRNA            complement(join(536841..536877,536904..536941))
FT                   /locus_tag="DEHA2A06468r"
FT                   /old_locus_tag="Deha0A.9"
FT                   /note="tRNA Lys (TTT) cove"
FT   gene            <537976..>539496
FT                   /locus_tag="DEHA2A06490g"
FT                   /old_locus_tag="DEHA0A06545g"
FT                   /old_locus_tag="DEHA-IPF6762"
FT                   /old_locus_tag="DEHA-CDS2289.1"
FT   CDS_pept        537976..539496
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06490g"
FT                   /old_locus_tag="DEHA0A06545g"
FT                   /old_locus_tag="DEHA-IPF6762"
FT                   /old_locus_tag="DEHA-CDS2289.1"
FT                   /product="DEHA2A06490p"
FT                   /note="similar to uniprot|P06101 Saccharomyces cerevisiae
FT                   YDR168W CDC37 Essential Hsp90p co-chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84561"
FT                   /db_xref="GOA:Q6BYW4"
FT                   /db_xref="InterPro:IPR004918"
FT                   /db_xref="InterPro:IPR013855"
FT                   /db_xref="InterPro:IPR013873"
FT                   /db_xref="InterPro:IPR013874"
FT                   /db_xref="InterPro:IPR038189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYW4"
FT                   /protein_id="CAG84561.2"
FT                   /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKNSFIKWKQRDIHEKRQQR
FT                   NIEIKSILVQLTMYAKLNERVDFLLSDVDEEQLLDDSLIMKKLNDKFDKTEKFDYDLLK
FT                   KEKGDTLRKGLKDLSFSAEEIDNTPPYNEMIEDLFIQVKEDHPDAAKDAAKLTQYLKEH
FT                   RAKIDDVLSRQAIKLDDLLYQKSMLISSDDIHTGFDKSFLNKEKEDDQPAPPAPASQKK
FT                   TVTTTETINNASNVSPASKEPKSDKDVLDELTLNPSTAEFGKISSTNIDESANYLIRHT
FT                   HICNEQQKDALIMTAFDHQLQGDTDAARQVIHQSLLLQYVAQLAGVKPNKDSIIKAVKL
FT                   FCSKINDKSSPARMGFSQDVTNTFNHIKSRCEIIKQEQGTENNDNEEEALIQLKALDDK
FT                   TELSVNIPQEGSPEFQIFSTKLSKEMQDAVKTESLDAVNNVFAKLKVEEAENILEIFNE
FT                   CGVIGINGYIEDENEFKELQKQYNEGMDLEAEKLEEIHEELNTEDTVD"
FT   gene            complement(<539639..>542134)
FT                   /locus_tag="DEHA2A06512g"
FT                   /old_locus_tag="DEHA0A06567g"
FT                   /old_locus_tag="DEHA-IPF6768"
FT                   /old_locus_tag="DEHA-CDS0727.1"
FT   CDS_pept        complement(539639..542134)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06512g"
FT                   /old_locus_tag="DEHA0A06567g"
FT                   /old_locus_tag="DEHA-IPF6768"
FT                   /old_locus_tag="DEHA-CDS0727.1"
FT                   /product="DEHA2A06512p"
FT                   /note="weakly similar to uniprot|P38996 Saccharomyces
FT                   cerevisiae YPL190C NAB3 Single stranded DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84562"
FT                   /db_xref="GOA:Q6BYW3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYW3"
FT                   /protein_id="CAG84562.2"
FT                   /translation="MSDEPELGTNSRESSNESVHEQEVRDNSEENKDEHEELEQEQSSG
FT                   EEEEYDPEVERVEDNPETEHEKVDVYDNRNTESSDKQQEEDDDDDDEYDPEGDHDESNT
FT                   TSEAANVGVNVSNDDDDEYDPESAYEEISVANASEVSPSQQNDPVIDKSDEEDEYDPEV
FT                   PLNDPESHQREDHGYEPKPKASNIIKGKLPAGLPPKPGLPPKPPVNAAERTPANKDSQQ
FT                   QLKEAYDAIMQSEIVKDPNFVNLSQPEQMKLIMEQLSQRNVNLSGTAIASNPSGVNYDQ
FT                   VYSYNKPFKNLKNPIPLVPVNEFCRRPNITAPMTPEEEKAYDDFIKREAYYMNLQNWDE
FT                   FPDKSRLFIGNLPANTISKQDLFRIFSQYGDIIQIAIKAGYGFTQFRTAESCLDCIKGE
FT                   SNVPLHNKVMRLDASRPQKSRRPGKPEINNPNLASRGRDRSPDESSGKRGRDEQMPGNR
FT                   YGYGENKKQKSIVPDCQVYITGKSSVFFIRKVKKAFSSSQVTIDVEDITHGDFNDVISE
FT                   AAYSGILGTCVIKEAKVDVQTFENTADGGIKFDEYADIDPEVAADILSKAKFKKYGNTA
FT                   SPQPYGNQNQPQTHNQNQNQNQNKNYVAAMNNDFYDNGYGGNRRGGGRNDHHDNRGRSG
FT                   RNEYGRGRGGRNNNNWESHHGNNNNMYNQSVPYGQPPAPNYGSPQPAFNQPPAAQVDPN
FT                   SQANLIQTLQGMDPASMQSMIALLQQQQHQHQQQHQHQQQHQQQQQQSAPQPVQSMGMG
FT                   QPIGQPMNQSPYGYNQPLNYGQAPPPPQSHTQAPSGQVNSLLSQLQSSSSSGYNPQQQS
FT                   QPANSTQSLMETLARLSRK"
FT   gene            <542558..>543619
FT                   /locus_tag="DEHA2A06534g"
FT                   /old_locus_tag="DEHA0A06589g"
FT                   /old_locus_tag="DEHA-IPF6769"
FT                   /old_locus_tag="DEHA-CDS3719.1"
FT   CDS_pept        542558..543619
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06534g"
FT                   /old_locus_tag="DEHA0A06589g"
FT                   /old_locus_tag="DEHA-IPF6769"
FT                   /old_locus_tag="DEHA-CDS3719.1"
FT                   /product="DEHA2A06534p"
FT                   /note="similar to uniprot|Q04869 Saccharomyces cerevisiae
FT                   YMR315W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84563"
FT                   /db_xref="GOA:Q6BYW2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYW2"
FT                   /protein_id="CAG84563.1"
FT                   /translation="MSSENKNLKLAIVGTGIFATDQHLPTIDKLPNLTPAACYNRTKAK
FT                   AETFASKANIDPSQVYESLEDIIKTDSVDFVDALLPVQYNLDAVKLAVKYNKPICLEKP
FT                   IAANMAQAKEIVHLANGTDVPISILENWSYLKAIEILNKDVLPKIGDIVSFTYKSTGAW
FT                   NDNNKYLATSWRQNPEHIGGFLSDGGVHQLALLTEVLGEVESVSGLTKQIREESGADDI
FT                   LFSTMKTKAGAIGTFTYGSSFGATDKSTSFTIYGTNGSAVYDFSPNLSKPTITYQTGPS
FT                   SQKASKKTVIEVDENDTFVEEFKNFAEAVTKNDKSIVHVTAAKAYHHLAIVAAALDSSA
FT                   KNGDSVKVEQPQV"
FT   gene            complement(<543670..>544704)
FT                   /locus_tag="DEHA2A06556g"
FT                   /old_locus_tag="DEHA0A06611g"
FT                   /old_locus_tag="DEHA-IPF6771"
FT                   /old_locus_tag="DEHA-CDS3744.1"
FT   CDS_pept        complement(543670..544704)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06556g"
FT                   /old_locus_tag="DEHA0A06611g"
FT                   /old_locus_tag="DEHA-IPF6771"
FT                   /old_locus_tag="DEHA-CDS3744.1"
FT                   /product="DEHA2A06556p"
FT                   /note="similar to uniprot|Q9P887 Candida albicans Sec20p
FT                   secretory pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65372"
FT                   /db_xref="GOA:B5RSR6"
FT                   /db_xref="InterPro:IPR005606"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR6"
FT                   /protein_id="CAR65372.1"
FT                   /translation="MTISSDIDNSFKRLDELQFSVFAKINEIIDDSDPTANQGEESIEL
FT                   KRIKSTKDANGLIFKFRDMLKVIEINISGVSDDQLSIRYQMYKEKLSNLRIKLRESQLQ
FT                   SYNSENELIHNQRIAKYSSVIRDNFDESDLRKDLFSGRSTKDDSKVKNKTIQDQILSHN
FT                   KSITSALQSTRQLMSTSIVQTELNIDSVEQQTKDLSNLNDKFTDFESLLNKSKNVVRFI
FT                   EKQDRKDKNNIYLSIGFLLSCSAWVIWRRLLKMPIKFFLWSLFKIFRIFNRMFVNSSSK
FT                   GDVDVYATVGAISSSLIASSILSSSTGTINLNEEFTMSIEPHGEHKTWEDIVNEATSRI
FT                   VDEL"
FT   gene            <544842..>546413
FT                   /locus_tag="DEHA2A06578g"
FT                   /old_locus_tag="IPF_6772"
FT   CDS_pept        544842..546413
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06578g"
FT                   /old_locus_tag="IPF_6772"
FT                   /product="DEHA2A06578p"
FT                   /note="similar to uniprot|Q03264 Saccharomyces cerevisiae
FT                   YMR285C NGL2 Protein involved in 5.8S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65373"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR7"
FT                   /protein_id="CAR65373.1"
FT                   /translation="MGLIMSNISNVPTNEEKNAGVSQKEPIADAKLIQGSKKQKSTKKS
FT                   RDPSTLTPEYIEEQRRQRNLKKEKKKQELLAQGIDPNAVNTPVELRFKTRELLELPNNV
FT                   ASDDSFKIKIMSYNILAQALIRRKLFPTSGNALKWSTRSQVLLSEFKHYDADILCLQEL
FT                   DFIQYNSYWRKELGKLGYDMKYYRADTKNHGLAIAFKSDKFICKHQSFMYYDKETSGEL
FT                   RPRTATQNIGFLACLEFTPDILTKYSNISRNGIIIGTTHLFWHPFGTFERTRQTYLILK
FT                   KFKEFRSTMNTLKGNDDDWYGFFAGDFNSQPFDAPYLSITAKPAHYAERARIVLGCSLS
FT                   YQYSKNRGVIDQEDDNGDEDKENGQEEEGGNIEKFGSNQPKDPVPESFKPTTEQLKLVN
FT                   SMEDLHNSLDMRAISLYSVGYKLVDPDNAGLDNNRDEPIFSNWAHAWRGLLDYIFVISS
FT                   WDATRESFSDKVDTVEDVEHNNGVRITKLLKLPLPKEMGPEPSGQPRLGQYPSDHLCLM
FT                   AEVALC"
FT   gene            complement(<546483..>547286)
FT                   /locus_tag="DEHA2A06600g"
FT                   /old_locus_tag="DEHA0A06677g"
FT                   /old_locus_tag="DEHA-IPF6776"
FT                   /old_locus_tag="DEHA-CDS4619.1"
FT   CDS_pept        complement(546483..547286)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06600g"
FT                   /old_locus_tag="DEHA0A06677g"
FT                   /old_locus_tag="DEHA-IPF6776"
FT                   /old_locus_tag="DEHA-CDS4619.1"
FT                   /product="DEHA2A06600p"
FT                   /note="similar to uniprot|P40484 Saccharomyces cerevisiae
FT                   YIL106W MOB1 Mps One Binder"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84566"
FT                   /db_xref="GOA:Q6BYV9"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV9"
FT                   /protein_id="CAG84566.2"
FT                   /translation="MSFFQNFNTHSLRSTRGFKLKQSSPISSPQPVSNSTFPNPPQNNQ
FT                   PYQQEPGQAYQTINLNNGGQSVSSHKDIRHYAEQTLGSDSALIQAVKLPQDEDINEWLA
FT                   IHVVDFYNQINMLYGAITEFCSPKTCPRMIATDEYEYLWQETNPSSNGMASPKRPVSLP
FT                   ACEYTENLMNWIQNFFDNDNIFPSKIGAPFPQQFPSLVKTIFKRLFRIYAHIYCHHFHE
FT                   ISELGLQSHLNTSLKHYVLFSNEFNLITRKDYGPLEDLVDTMLKK"
FT   gene            complement(<547407..>548327)
FT                   /locus_tag="DEHA2A06622g"
FT                   /old_locus_tag="DEHA0A06699g"
FT                   /old_locus_tag="DEHA-IPF6778"
FT                   /old_locus_tag="DEHA-CDS8816.1"
FT   CDS_pept        complement(join(547407..548150,548202..548327))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06622g"
FT                   /old_locus_tag="DEHA0A06699g"
FT                   /old_locus_tag="DEHA-IPF6778"
FT                   /old_locus_tag="DEHA-CDS8816.1"
FT                   /product="DEHA2A06622p"
FT                   /note="some similarities with CA0211|IPF4326 Candida
FT                   albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84567"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV8"
FT                   /protein_id="CAG84567.2"
FT                   /translation="MTVDTLTVKKDEDYFSLKYSYQLQNDNSNLEEQFIIPDKKFSLNV
FT                   NLHINGTKLHTTDYGSLVEAIGHSFVECRYWKHIDMNTSLFIRGDKTTSFSLDLECNVS
FT                   TPIINDLLDMKYAFPNSINLLSSIDLDFHFNTFQPKLQLADIVDALNYSLGSLFINLEF
FT                   KFPFVFSFYGRKLFKTNYNWLFRNLDEMLCSSPANLPSVIHNKNEAFLQSMKNIQLKAL
FT                   AEYNTLSIMKECDMSGSKLDACKKYRSRFLDSGLPPTPNLSIKAMVFDLQLFDLKYIES
FT                   HLNIESIT"
FT   gene            <548455..>549096
FT                   /locus_tag="DEHA2A06644g"
FT                   /old_locus_tag="DEHA0A06721g"
FT                   /old_locus_tag="DEHA-IPF6779"
FT                   /old_locus_tag="DEHA-CDS5376.1"
FT   CDS_pept        548455..549096
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06644g"
FT                   /old_locus_tag="DEHA0A06721g"
FT                   /old_locus_tag="DEHA-IPF6779"
FT                   /old_locus_tag="DEHA-CDS5376.1"
FT                   /product="DEHA2A06644p"
FT                   /note="weakly similar to uniprot|Q07843 Saccharomyces
FT                   cerevisiae YLL033w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84568"
FT                   /db_xref="GOA:Q6BYV7"
FT                   /db_xref="InterPro:IPR016613"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV7"
FT                   /protein_id="CAG84568.2"
FT                   /translation="MNKTKQVVTIGNDLIVKYQVSLLAGLEGLNELSSKKSKFLSLYKK
FT                   FYKLRNMIDSKPYNKETYQNIIRRKFTMEDFNLKRNILLEGSDKLSELQLFERMINTLA
FT                   FVHNSTVYLPSEGKEKPAFFFQDLKIPQRMEKSIILTLLKMDQQKPNTIKYDRKYEWIP
FT                   QIYNKLSQLPDDPDAKEYKSIFKDIDANLIGFRDYELNLMRLNECYRLCL"
FT   gene            <549308..>549766
FT                   /locus_tag="DEHA2A06666g"
FT                   /old_locus_tag="DEHA0A06743g"
FT                   /old_locus_tag="DEHA-IPF6780"
FT                   /old_locus_tag="DEHA-CDS6048.1"
FT   CDS_pept        549308..549766
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06666g"
FT                   /old_locus_tag="DEHA0A06743g"
FT                   /old_locus_tag="DEHA-IPF6780"
FT                   /old_locus_tag="DEHA-CDS6048.1"
FT                   /product="DEHA2A06666p"
FT                   /note="similar to CA2525|IPF4324.3 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV6"
FT                   /protein_id="CAG84569.1"
FT                   /translation="MGWFSKDTSSTIPNNQVEQRSHQPLDLSGQPAFNSTTANSNGHSS
FT                   DISHTLEQLTENEAPLKLKELKENSVKANNESVSDFVHARPKNLFVIDGEKEIEESIIC
FT                   TNNEQGGKTCLKLKYNSVQLFKQMQKLEYFCSLPDDINATYFECRKIT"
FT   gene            complement(<549961..>550959)
FT                   /locus_tag="DEHA2A06688g"
FT                   /old_locus_tag="DEHA0A06765g"
FT                   /old_locus_tag="DEHA-IPF6781"
FT                   /old_locus_tag="DEHA-CDS3891.1"
FT   CDS_pept        complement(549961..550959)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06688g"
FT                   /old_locus_tag="DEHA0A06765g"
FT                   /old_locus_tag="DEHA-IPF6781"
FT                   /old_locus_tag="DEHA-CDS3891.1"
FT                   /product="DEHA2A06688p"
FT                   /note="some similarities with uniprot|Q9P3Q3 Neurospora
FT                   crassa B24P7 Superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84570"
FT                   /db_xref="GOA:Q6BYV5"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV5"
FT                   /protein_id="CAG84570.2"
FT                   /translation="MQINIPLILSLLSVSQLALGDKAPKIKKNPKNVVAIADFPFGFDN
FT                   NVQGNIVFTAKRGKAVNVHVDVTGLPKEGGPFQYHIHENSVPSDGNCDLVGLHFNPYDA
FT                   PPDCEDQKDDSYCQVGDLSGKHGWIDTTCFETKYNDPYLSLNKKSNSYIVGRSVTFHFA
FT                   NLTKFACADIELASNIRLQSLQDEYNSNSNYDLQELQKDLASGLEFNQDYKEYSYDEDE
FT                   VDKYEVFDEGPDADDEPEVEDSKPENDYADDDEDNTEDTKSKTKLINDVKSRNTTHNAT
FT                   HPHNGTDLIHNGNHSNVSLNEYNSETESGSSTFGLSISLMIGLGVVTGLLI"
FT   gene            complement(<551414..>552241)
FT                   /locus_tag="DEHA2A06710g"
FT                   /old_locus_tag="DEHA0A06787g"
FT                   /old_locus_tag="DEHA-IPF6784"
FT                   /old_locus_tag="DEHA-CDS4865.1"
FT   CDS_pept        complement(551414..552241)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06710g"
FT                   /old_locus_tag="DEHA0A06787g"
FT                   /old_locus_tag="DEHA-IPF6784"
FT                   /old_locus_tag="DEHA-CDS4865.1"
FT                   /product="DEHA2A06710p"
FT                   /note="similar to uniprot|Q07821 Saccharomyces cerevisiae
FT                   YLL027w ISA1 mitochondrial protein required for normal iron
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84571"
FT                   /db_xref="GOA:Q6BYV4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV4"
FT                   /protein_id="CAG84571.2"
FT                   /translation="MIAKRIILTNLNHTYKRYASNEAKKGGKRFMQTIPVTTSKNDFYS
FT                   GLKYPMKKTNLGESTKEPSDSSSKWSKHSLGPMEKVSTKDQSTSAPARRSRASKFSNKT
FT                   LKNIGKPETAETKSTKEETKNTEAQKPAQPNIISTVTVEPTTPKITENEKPAKKTKQKR
FT                   TLRPRKALITFSANAVDHLKNLLDQPEPQLIRIGVQNRGCSGLTYNLEYVSEPGKFDEK
FT                   VEQDGVKVYIDSKALFSIVGSEMDWLDDKLSSRFIFRNPNSKGTCGCGESFMV"
FT   gene            complement(<552557..>554653)
FT                   /locus_tag="DEHA2A06732g"
FT                   /old_locus_tag="IPF_6787"
FT   CDS_pept        complement(552557..554653)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06732g"
FT                   /old_locus_tag="IPF_6787"
FT                   /product="DEHA2A06732p"
FT                   /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
FT                   YLL029w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65374"
FT                   /db_xref="GOA:B5RSR8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR8"
FT                   /protein_id="CAR65374.1"
FT                   /translation="MRKVSRAQCANCTCSPGLLSRTHKRSVSLAKQVSMRNSGSGSPRG
FT                   ASRKGSVFTIDAASLCAPDAKEVNTSKRLEKLRLLMAEYDLGVYVVPSEDQHQSEYVSA
FT                   FDQKRSFISGFQGSAGVAVVTRDVMCMNETPEGLAAVSTDGRYFNQATNELDFNWVLLK
FT                   QGVKSEPTWQEWSVDQAIQLSLDSGSKINIGVDPKLITYQVFEKFDKVVRDKLSSPKNT
FT                   KAEVELVAVKDNLIEKMWIDFEDLPSSPASIIKVLDEKYTGRTYSDKIKDVTEAMNKHK
FT                   CVGLVVSALDEIAWLLNLRGSDIEYNPVFYGYLIITNQQVTLFANNYRFDTKVQAALQA
FT                   DNVNVEPYENFWTKLNSLSKDFNMANKKLLVPKNSSWEIIRNLKCSFEQPLRSPIEDLK
FT                   GIKNEVELKGARSAHLKDGRALCKFFAWLENELLNKGELIDELQADDKLTQFRMQEDNF
FT                   VGLSFATISATGANAAVIHYKPIKGECAVINPHKIYLNDSGSQFLEGTTDVTRTIHFTN
FT                   PKPDEIKHYTLVLKGNISLGDLKFPEDTTGALIDSIARQHLWSAGLDYGHGTSHGIGAY
FT                   LNVHEGPIGIGPRPNAASSSLRPGHLISNEPGYYEDGDYGIRIENVMYVKQSGHSYNER
FT                   DFLEFDTLTRVPFCKKLIDISLLTTEEKAWINKYHQTVWNELSPSFSKTSLEYIWLKKE
FT                   TAPL"
FT   gene            <555124..>558221
FT                   /locus_tag="DEHA2A06754g"
FT   CDS_pept        join(555124..555153,555237..558221)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06754g"
FT                   /product="DEHA2A06754p"
FT                   /note="weakly similar to uniprot|P32767 Saccharomyces
FT                   cerevisiae YGL016w PDR6 Member of the karyopherin-beta
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65375"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSR9"
FT                   /protein_id="CAR65375.1"
FT                   /translation="MNISFEQVVQHIETLYSTRDPDVVNRIQNELQELQRSGDGYQVAG
FT                   MLMKHSSRNCQFFGALTYAVVINSMGPKLEIDKLEVLVREMEGHICAIVRSGETEANMF
FT                   IIRKLFSNLSLVFISNHETYSNPVESLLRSLCGSTDLAQVVGGLQDMQLMVLVMFSSVI
FT                   VEDISKQERSAEIHAVVESELYRDLIIIYDFLNSTSRSVAIDSLALDCLNSWVTYISVA
FT                   ECNSQVRYTSVETLITFLFNHFSTQQNPADDEVLKLINKAVGVVTEILEINPRMLTPEM
FT                   KSYLDNLLFESQNWGAYYIDTIILGEAREMYSEEIDSFINLLITFLQNDILKLSKSIMH
FT                   TNVQYKIKTLVSLTNFPGTPIEDESVSDQFLAFWEEFINIYVDDIDTFEAIFLNAPNDR
FT                   QSFFSKRDEIINDVCSIYWNKIHLPELNVLEANKSEFLHYRTGVSDLFIAGYSLLSVPF
FT                   YEKLTHSITVNILETDENPTKIIDIESTLYLLFKITEDCTFYESQSSILIPYVDSLFES
FT                   RLLDVIKLYTAGEGIYRYVYSTFVNFLSSIQFYLKGERGSRYLGTIFDLLFSIVLDGPQ
FT                   SLSLNTSRTILKICQECRESLTSFLPNLEVLLVEMLKNLSVDGLIRQRMFNAYTSIAQC
FT                   LKEPSKFSDILKRMITAIHNRALEVMNSSPQLNENEEDYLLSLLSCVCEVGRACEIPEE
FT                   VDDFYNEEQKFLVNQYWIEDPMQVKDLNLSIVKTYLLNYAPIINNTTCTEKCCLILKAG
FT                   IREPIEGPFKFPMDTIFNFISAKIDNCNIDSVPYLYGLIETVVIVNHKFLDQEIVGQLV
FT                   KRVFTDHIDFLKSDPYTINSAIELFATILERNPSLIVSLPVFENVIVGFAIDGLKAHEA
FT                   FIIKSISKFWVALIALKKGTKENQDFIRSMMVNTNLGTLFVFDLLKAFLGTPRSNLDHY
FT                   YPIFRNLITKYPIELKKWLQVAFRELKNSKLDEKNIDALISRIMATRGQRSANDILKKI
FT                   WLQLNGLIEFNSRSF"
FT   gene            complement(<558298..>560160)
FT                   /locus_tag="DEHA2A06776g"
FT                   /old_locus_tag="DEHA0A06875g"
FT                   /old_locus_tag="DEHA-IPF6794"
FT                   /old_locus_tag="DEHA-CDS1517.1"
FT   CDS_pept        complement(558298..560160)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06776g"
FT                   /old_locus_tag="DEHA0A06875g"
FT                   /old_locus_tag="DEHA-IPF6794"
FT                   /old_locus_tag="DEHA-CDS1517.1"
FT                   /product="DEHA2A06776p"
FT                   /note="similar to uniprot|P22336 Saccharomyces cerevisiae
FT                   YAR007C RFA1 Subunit of heterotrimeric Replication Factor
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84575"
FT                   /db_xref="GOA:Q6BYV0"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYV0"
FT                   /protein_id="CAG84575.1"
FT                   /translation="MAEAYGLSSGALKGILSKTERQSFEGKPITVQVTNIKIIDQSLEN
FT                   GNGDSAVKYRVLLNDGAYSLHGLITSECIPYCEANGFKKTSVIIIKDYSLVTTQKHIMI
FT                   INNLEVKFQTSNKSTNTLISCDSYYAEHPEDDYLELANKSQKLESAELNQAKAPQQQQQ
FT                   QPQKASTFQQRHVNAIEQLSPYQNQWVIKARVSYKGDIRKWSNARGEGKLFNVNFLDES
FT                   DEIRATAFNDLAEKFYQELEEGKVYYISKARIQQAKPQFSHLSHPYELALDRDTNVEEC
FT                   FDTTDVPKIHFNFTKLNQIESCEPNSIIDVIGVLKEVNPVFQITAKSTGKPFDRRNITI
FT                   VDDSNFAITVGLWNNTAVDFDTSEGSVIAFKGCKIQDFAGRSLTLTHAGSMMANPDTAE
FT                   AYQLKGWFDNQGVNENFKTLKNENSSNQNLINNRKSILQAQEENLGMSEKPDFFNIKAT
FT                   VNFFKTENFCYPACNNSLQSSSQQPSTTCNRKVVEQPDGTWRCEKCDINFNEPHYRYIL
FT                   NCSVMDSSGQLWMTLFDQEANKLFGKTAGELLTLREQQTNNENNVFQDLINDITMKEFN
FT                   FRLKARQDSYNGVVRVRYQAMTINDVDFNAECEHLCSELDSMLH"
FT   gene            complement(<560479..>561693)
FT                   /locus_tag="DEHA2A06798g"
FT                   /old_locus_tag="DEHA0A06897g"
FT                   /old_locus_tag="DEHA-IPF6796"
FT                   /old_locus_tag="DEHA-CDS3135.1"
FT   CDS_pept        complement(560479..561693)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06798g"
FT                   /old_locus_tag="DEHA0A06897g"
FT                   /old_locus_tag="DEHA-IPF6796"
FT                   /old_locus_tag="DEHA-CDS3135.1"
FT                   /product="DEHA2A06798p"
FT                   /note="similar to uniprot|P53101 Saccharomyces cerevisiae
FT                   YGL184C STR3 Cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84576"
FT                   /db_xref="GOA:Q6BYU9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU9"
FT                   /protein_id="CAG84576.1"
FT                   /translation="MAPPKSYNIETELVFSKSTDQHNASVPPLYQSATFKQNSLSDMGE
FT                   YDYTRSGNPTRTYLQNHMAKIMKAKHAFAVTSGMGCLDVITRILKPGDEVLAGDDLYGG
FT                   TNRLLTYLNKKGDLKVQHWDTTNTELFTSKITNNTKMIFLESPTNPLIKVCDVKSITDY
FT                   AHRKNPDVVVVFDNTMMSPILMTPLDLGVDIQYESATKYLNGHHDIMAGVIATRDAKLA
FT                   EKVYFVINSTGCGLSPFDSWLLSRGLRTLAVRVERQQQNCQKIAEFLSSIGFRVRYPGL
FT                   KSHPQYELHASMCKGAGAVISFETGSIKTSEKIVENTDIFGIAVSFGCVNSLISMPCKM
FT                   SHASIDAKTREERDFPEDLIRLCIGIENSDDLINDLTKALLKSGAVKINSKDELFNAVS
FT                   VQPKL"
FT   gene            complement(<562099..>562815)
FT                   /locus_tag="DEHA2A06820g"
FT                   /old_locus_tag="DEHA0A06919g"
FT                   /old_locus_tag="DEHA-IPF6798"
FT                   /old_locus_tag="DEHA-CDS5132.1"
FT   CDS_pept        complement(562099..562815)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06820g"
FT                   /old_locus_tag="DEHA0A06919g"
FT                   /old_locus_tag="DEHA-IPF6798"
FT                   /old_locus_tag="DEHA-CDS5132.1"
FT                   /product="DEHA2A06820p"
FT                   /note="highly similar to uniprot|Q9UUT9 Yarrowia lipolytica
FT                   YALI0D00737g nuhm Subunit NUHM of protein NADH:Ubiquinone
FT                   Oxidoreductase (Complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84577"
FT                   /db_xref="GOA:Q6BYU8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU8"
FT                   /protein_id="CAG84577.1"
FT                   /translation="MFRFIPRSVQRSTHRSVVNKRFSSIISIHRDTKEDNKNMSFEFNS
FT                   ENLKRANEIIAKYPPQYKKAAVMPLLDLGQRQTGFTSIAVMNYVAKYLDMPPMRVYEVA
FT                   TFYTMYNRKPMGKYNIQVCTTTPCQLCGSDEVMDAITSHLKIKPGQTTPDKLFTLQEVE
FT                   CLGACVNAPMLALNDDFHEDLTAEKTIDLLKTLQAGKEPKAGPVSGRDTCEPFSGAKVL
FT                   LGEKPFDVSTVTRSDL"
FT   gene            complement(<563213..>564409)
FT                   /locus_tag="DEHA2A06842g"
FT                   /old_locus_tag="DEHA0A06941g"
FT                   /old_locus_tag="DEHA-IPF6802"
FT                   /old_locus_tag="DEHA-CDS3530.1"
FT   CDS_pept        complement(563213..564409)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06842g"
FT                   /old_locus_tag="DEHA0A06941g"
FT                   /old_locus_tag="DEHA-IPF6802"
FT                   /old_locus_tag="DEHA-CDS3530.1"
FT                   /product="DEHA2A06842p"
FT                   /note="weakly similar to uniprot|Q12303 Saccharomyces
FT                   cerevisiae YLR121C YPS3 Aspartic protease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84578"
FT                   /db_xref="GOA:Q6BYU7"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU7"
FT                   /protein_id="CAG84578.2"
FT                   /translation="MQLVYLLVALGIYGQVFAASGGYVEIPLERSSDSMYYVESLRVGK
FT                   RQQELKNVILDTGSADVVLTGSTYQYEKSLFTPEYVAQYGSSEPFEMFQQNETISGNGW
FT                   ALKGATFGVTNVSDIDSFYGVFGIGYATIEAMDPYENFPMKLESQGLIDYQVYSVSGRE
FT                   SHSSIIFGGIDSGAYKGPLVKTQIGFEVGPSATREYHTATAVTVSSIKVASHNSRTSIS
FT                   TQKLIYTLDTGSNGLMLPEPVYTNLVTAIHAKKQWHDDTPLFHQDSLAAESLTFDITGF
FT                   PVSIPITDLIDECTAIRGAQYCTLRIGIVDIGTNSYVATLPNSIFKYIYTVFDLQDNQV
FT                   FMAPYGPLASKSIKHVSNTHFPVETTTAPNYNDVYSTMYQTSDETTVHRSSSTKNCRR"
FT   gene            <565153..>566931
FT                   /locus_tag="DEHA2A06864g"
FT                   /old_locus_tag="DEHA0A06963g"
FT                   /old_locus_tag="DEHA-IPF6807"
FT                   /old_locus_tag="DEHA-CDS1675.1"
FT   CDS_pept        565153..566931
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06864g"
FT                   /old_locus_tag="DEHA0A06963g"
FT                   /old_locus_tag="DEHA-IPF6807"
FT                   /old_locus_tag="DEHA-CDS1675.1"
FT                   /product="DEHA2A06864p"
FT                   /note="similar to uniprot|P53197 Saccharomyces cerevisiae
FT                   YGL003c CDH1 substrate-specific activator of APC-dependent
FT                   proteolysis P29.1.f2.5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84579"
FT                   /db_xref="GOA:Q6BYU6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU6"
FT                   /protein_id="CAG84579.2"
FT                   /translation="MNNSKNNTASGRNVINNGYSSRRSTLETPRSPSRSTRNLEPPHLN
FT                   DGGGLPSTSPRRRNQKSIFSDRYIPNRTGIDLQAAFSLSNQEILPEIKNRHDRIDNEIE
FT                   IRKEEEANQTFSTILKAELFGDNVPMATANLSKNAKVSNSRPNSTGNLNSTASSSSLHS
FT                   IRSSGMADNASTGGDDGTTGNTRITPPRSTRNNASNNSLTSGSVNTTNHDSNSITNTPR
FT                   QTANLFTYQSPKKNRPVSRDLQNELYSLSPVRQESQKLLLSPQKKPRNISKVPYRVLDA
FT                   PELSDDFYLNLVDWGQQDILAVGLGDSVYLWDGSTQSVDRLCNLSNKDKVTSINWIGSG
FT                   THLAVGTSKGLVEIWDATKIKCVRTMSGHSLRVSSLAWNEHILSSGSRDRSILNRDVRI
FT                   ESHYVNKFEAHKQEVCGLKWNVEENKLASGGNDNKLFIWDALNTKPLYQFNDHTAAVKA
FT                   ISWSPHQRGVLASGGGTADKTIKTWNTLTGSLTNNVNTGSQVCNLIWSKNSNELVSTHG
FT                   FSRNQIIVWKYPSMQQIAQLTGHTYRVLYLSLSPDGETIVTGAGDETLRFWNVFDKNKN
FT                   DEPPSSVLLDAFSQLR"
FT   gene            <566958..>568667
FT                   /locus_tag="DEHA2A06886g"
FT                   /old_locus_tag="DEHA0A06974g"
FT                   /old_locus_tag="DEHA-IPF6809"
FT                   /old_locus_tag="DEHA-CDS1666.1"
FT   CDS_pept        566958..568667
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06886g"
FT                   /old_locus_tag="DEHA0A06974g"
FT                   /old_locus_tag="DEHA-IPF6809"
FT                   /old_locus_tag="DEHA-CDS1666.1"
FT                   /product="DEHA2A06886p"
FT                   /note="similar to uniprot|P53090 Saccharomyces cerevisiae
FT                   YGL202W ARO8 Aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84580"
FT                   /db_xref="GOA:Q6BYU5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU5"
FT                   /protein_id="CAG84580.2"
FT                   /translation="MLNKLLNGVIPPFNFCHNLDRYYDRRFDNAVKVLTCTFSGDFRIL
FT                   QVMYLLLIIYYIRTYILLYFIICNKHIDSTKKDMSKPEAKDLSHLLSEEAKSRKNSPLK
FT                   AAFKYYKQPGMTFLGGGLPLSDCFPFNKVTADIPSVPFSEGISAPLSDENKTVVEVYKR
FT                   AEMNKTEDKQIELARSLQYGHTEGQAEIIDFLKEHTEKIHNVPYKDWDLIASVGNTQSW
FT                   DATLRSFVTRGDSILVEEYSFSSALETAHAQGVNTIPVPMDAKGILPEALEKQLDQWVG
FT                   PKPKLLYTICTGQNPTGSCLSAERRRAIYKLACKHDFIIIEDEPYYFLQMEDYTTDEKS
FT                   RASNKVDSHDEFVKALVPSYISMDVEGRVIRLDSFSKVLAPGLRFGWIVGQAKLLERYV
FT                   RIHEVSIQCPSGFTQSICNSLLQKWGQKGYLDWLMGLRADYTHKRDVAIDAVNKYFPKE
FT                   VVSFIPPVAGMFFTTTIDASKHPKFKSEFNEDPLQVENAVYEQALKQGCLMIPGSWFKA
FT                   DGKSNPPQPELPENPASKNTFFFRGTYAAVPLDQLVIGLEKFGKAIKVEYGL"
FT   gene            <568838..>571855
FT                   /locus_tag="DEHA2A06908g"
FT   CDS_pept        join(568838..568874,568935..571855)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06908g"
FT                   /product="DEHA2A06908p"
FT                   /note="similar to uniprot|P32479 Saccharomyces cerevisiae
FT                   YBL008W HIR1 Non-essential transcriptional corepressor
FT                   involved in the cell cycle-regulated transcription of
FT                   histone H2A H2B H3 and H4 genes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84581"
FT                   /db_xref="GOA:Q6BYU4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYU4"
FT                   /protein_id="CAG84581.2"
FT                   /translation="MHILKLPWFGHKAENKQIECYSVSINSDGSRLASGGLDGNVKIWD
FT                   TKSILHFKNYEAEPATLNNKNGINLDTLNSDIIRRPLCSMSRHNGVVTSVKFSPDGRFL
FT                   ASGSDDKIVLIWEKDEEQANRPKQFGEAEADLEHWTVRKRLVAHDNDIQDICWSPDGSL
FT                   LVTVGLDRSIIIWNGLTFERIKRYDIHQSMVKGIVFDPANKFFATASDDRSVRIFRYYR
FT                   KLSESSINNYEFQMEHIVIDPFKKSPLTSYFRRMSWSPDGQHIAVPNATNGPVTSVAII
FT                   NRTNWGTDISLIGHEAPCEVCCFSPRLFEYDDSNDSQKNKNGMGNFTTILATAGQDQNL
FT                   VVWTTRQSKPLVVAHDIVSGSITDMCWAPDGQTLYFSCLDGSITCVSFEDNELGKVVSE
FT                   NMNDLQLHRYGADRESATFPESVEQLLLEEKSEVTEHKENKKLAITKPPTTILKSRPEE
FT                   VRPKEVSPKINNLTPKQVNKLTQSITITKNGKKRVAPLLVSSSSKISVPVLGTSGKVTK
FT                   KFQIGSKLSQTSYFLPRLGVSTSVQGLKSKNLVHEFNQTNEANNDDQDNDNEDMGIDSA
FT                   KVNDNPKDALNQSVSDATLRRQRNKIKRAILETRYPSCFQLISTLPDNLFNNQAILNSK
FT                   VNQILNNNFNSKRENNNEIISGSSIDAIDEDLIFSVIVTGIQSIEDRSSIIINDAYDAN
FT                   TSITSIVEVRNGPSWKVNEDDITDFEYGDRIDFQDPTRVIVSNDQNHTKRSYTVFFPYK
FT                   VQHVLPIIKNRILTFYVLASFNGTIQIISAKSGKYVTASMEVGNNVILLKQEGDYLMCV
FT                   TNQGLIFVWKLPNLPVERFLTGVVRGISLAPILNNMVEVPSIEKKNLNKRHANIPQLMM
FT                   PNVRKLDVDTRNGSPLAILEDNNEVYKFSLDLMVWIKVVDPWYFLALTDSPVDSFKTGN
FT                   CIDSLLHKSYKSFEEDVKRSKIGLYIYNNSEETNELQKVMEARFKQSIELAGQIA"
FT   gene            complement(<571903..>572553)
FT                   /locus_tag="DEHA2A06930g"
FT                   /old_locus_tag="DEHA0A07018g"
FT                   /old_locus_tag="DEHA-IPF6814"
FT                   /old_locus_tag="DEHA-CDS5197.1"
FT   CDS_pept        complement(571903..572553)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06930g"
FT                   /old_locus_tag="DEHA0A07018g"
FT                   /old_locus_tag="DEHA-IPF6814"
FT                   /old_locus_tag="DEHA-CDS5197.1"
FT                   /product="DEHA2A06930p"
FT                   /note="weakly similar to uniprot|P53192 Saccharomyces
FT                   cerevisiae YGL020C MDM39 Protein involved in determination
FT                   of mitochondrial structure"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84582"
FT                   /db_xref="GOA:Q6BYU3"
FT                   /db_xref="InterPro:IPR027538"
FT                   /db_xref="InterPro:IPR028945"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYU3"
FT                   /protein_id="CAG84582.1"
FT                   /translation="MFDISSSNLLISVLVVLFAKQLINAVGKATLENIGWSAYCKVAPK
FT                   LGDSKFIALDQKNVELAKVSKERKSISAQDQYARWTKLNRQFDKLTGEINKLKEETSAS
FT                   RSYISKYIGYMILVTTTLPIWFFRVWFRKAVLFYFPTGVLPHYLEWFLALPFITTGGVG
FT                   LTIWMSAVNNVVSSVIFLVKFPFEKEVPFPSKEVGNEKTSINKEEVSGTPAAN"
FT   gene            <572785..>573636
FT                   /locus_tag="DEHA2A06952g"
FT                   /old_locus_tag="DEHA0A07040g"
FT                   /old_locus_tag="DEHA-IPF6815"
FT                   /old_locus_tag="DEHA-CDS4429.1"
FT   CDS_pept        572785..573636
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06952g"
FT                   /old_locus_tag="DEHA0A07040g"
FT                   /old_locus_tag="DEHA-IPF6815"
FT                   /old_locus_tag="DEHA-CDS4429.1"
FT                   /product="DEHA2A06952p"
FT                   /note="similar to uniprot|P43639 Saccharomyces cerevisiae
FT                   YGL019W CKB1 beta (38kDa) subunit of protein kinase CK2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84583"
FT                   /db_xref="GOA:Q6BYU2"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU2"
FT                   /protein_id="CAG84583.2"
FT                   /translation="MSSDPEEDYIPWIQQFCELFGHDYFVPVSQDFIEDDFNLTGLSSQ
FT                   VPYYREALYTILDYQVETADDNGSNGTSNNKGSKTELPNKALLAHSAELLYGLIHARYI
FT                   ISKPGLTAMASKFERNEFGSCPRYYCDGMHLIPVGSTDIPGQETVRLYCPCCNDIYLPS
FT                   SSRYLNIDGAFFGTTFPGLLVKMFPEIENQCRNRVYKVNQNDFGLRLFGFQISELSASG
FT                   PRMKWLRLHPRTSQEKEEFNNCELSVPSEFDESDVPFNSDSEMGDPEDNDDDDKTMASE
FT                   GN"
FT   gene            complement(<573795..>574490)
FT                   /locus_tag="DEHA2A06974g"
FT                   /old_locus_tag="DEHA0A07062g"
FT                   /old_locus_tag="DEHA-IPF6816"
FT                   /old_locus_tag="DEHA-CDS5209.1"
FT   CDS_pept        complement(573795..574490)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06974g"
FT                   /old_locus_tag="DEHA0A07062g"
FT                   /old_locus_tag="DEHA-IPF6816"
FT                   /old_locus_tag="DEHA-CDS5209.1"
FT                   /product="DEHA2A06974p"
FT                   /note="similar to uniprot|P53193 Saccharomyces cerevisiae
FT                   YGL018C JAC1 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84584"
FT                   /db_xref="GOA:Q6BYU1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYU1"
FT                   /protein_id="CAG84584.2"
FT                   /translation="MLRKACTYVPRVGTGLVNSRFYSNATTIKSYFDLFPQTFPDHGPP
FT                   NESFMINPRRLRREYRTLQSEHHPDIVIGSAALSKSGDNGVDDKFSSLLNKAYSTISNP
FT                   YSRIAHLIEVNHPDHLDITQDDISKRLISDFQSSSDERSMEYKNMLMMVLEAHESLELA
FT                   TQDQDLEALSEENDERIVESEEAIGKLLETKPLNWNGIMMEAVRLKYWINIQKGIKDWE
FT                   PGKPVNITH"
FT   gene            <574648..>575346
FT                   /locus_tag="DEHA2A06996g"
FT                   /old_locus_tag="DEHA0A07084g"
FT                   /old_locus_tag="DEHA-IPF6817"
FT                   /old_locus_tag="DEHA-CDS5007.1"
FT   CDS_pept        574648..575346
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A06996g"
FT                   /old_locus_tag="DEHA0A07084g"
FT                   /old_locus_tag="DEHA-IPF6817"
FT                   /old_locus_tag="DEHA-CDS5007.1"
FT                   /product="DEHA2A06996p"
FT                   /note="similar to uniprot|P53769 Saccharomyces cerevisiae
FT                   YLR323C CWC24 Essential protein component of a complex
FT                   containing Cef1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84585"
FT                   /db_xref="GOA:Q6BYU0"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYU0"
FT                   /protein_id="CAG84585.2"
FT                   /translation="MAMFKKRFIKKSEDGKVAKPKRKLDVDGFESDSDDVLEKETKSSS
FT                   QGIKKHKPINGTKKPTRDVEHGQNSSTGNALSNPSLDQATTDKSAGEKSVGPIKPPPIS
FT                   IKTTTITDFQPDVCKDFLQTGYCGYGDTCKFLHIRDESKQRKPIEKEWETVTEQQKPDK
FT                   SKEQVPYRCVLCSKDYTSPVKTECNHLFCQKCFMNRYRNLKKPNCFICGKDTGGVCSPV
FT                   SKKELEKLIS"
FT   gene            <575522..>576250
FT                   /locus_tag="DEHA2A07018g"
FT                   /old_locus_tag="DEHA0A07106g"
FT                   /old_locus_tag="DEHA-IPF6818"
FT                   /old_locus_tag="DEHA-CDS4902.1"
FT   CDS_pept        575522..576250
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07018g"
FT                   /old_locus_tag="DEHA0A07106g"
FT                   /old_locus_tag="DEHA-IPF6818"
FT                   /old_locus_tag="DEHA-CDS4902.1"
FT                   /product="DEHA2A07018p"
FT                   /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
FT                   YLR326w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84586"
FT                   /db_xref="GOA:Q6BYT9"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT9"
FT                   /protein_id="CAG84586.2"
FT                   /translation="MSNVQDQLEGLPGYDIVMDYWNDYAEEHIKVGKNPYEDENGNKLR
FT                   LPKNTTKEEQKIWKRVQSTAWVHDKCFLGSCGVGMDCGLGSVPLVVALFPVLGPLVMYG
FT                   LHARLIHIVTNEYKLPNKLVLQMESQIAFDLLISLPPILGGFLAWLNGCSTRNAGMIYN
FT                   YFAYVSSEREKNKQPTYVGTGDISEYLRSPEPAYTNTARQNNYQSSNNGGKSISAFKKK
FT                   PPANNTNTIKVGNQQQSGFV"
FT   gene            <576333..>577545
FT                   /locus_tag="DEHA2A07040g"
FT                   /old_locus_tag="DEHA0A07128g"
FT   CDS_pept        join(576333..576405,576464..577545)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07040g"
FT                   /old_locus_tag="DEHA0A07128g"
FT                   /product="DEHA2A07040p"
FT                   /note="similar to uniprot|P33412 Saccharomyces cerevisiae
FT                   YGR007W MUQ1 Choline phosphate cytidylyltransferase
FT                   hypothetical startno similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84587"
FT                   /db_xref="GOA:Q6BYT8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT8"
FT                   /protein_id="CAG84587.2"
FT                   /translation="MFERPEGIENCRIWMDGCFDFVHHGHAGAMLQARQLGKELYVGIH
FT                   SDEDILKNKGPVVMTLKERVKAVEACKWSTQPVPDAPYVTDPKVMDGYGCKYVVHGDDI
FT                   TTDANGEDCYQEVKDLGKFVVVKRTPNISTTDLVGRMLLMSKDHHFQPIRDIDNHSLLD
FT                   KKDNLDKFAKYATDETGLKPGSGVYLNIDTDKELHTLVEPSKEILNKYKSIAYVDGGFD
FT                   LFHPGHIEALRLVKQNALKDGCAIIVGVHDDHTINNVKGLNYPIMNIFERALCILQCAY
FT                   VDGIVLGAPFSPTSQFLSKLPGTVAAVYHGPTQVEEEPYAEAKQNGLFKEIGPHEFANI
FT                   NTEFIVHRVLNNKEAYEARQKAKGWKADHEAQLRVQEQSRHKSS"
FT   gene            complement(<577662..>578111)
FT                   /locus_tag="DEHA2A07062g"
FT                   /old_locus_tag="DEHA0A07150g"
FT                   /old_locus_tag="DEHA-IPF6821"
FT                   /old_locus_tag="DEHA-CDS5866.1"
FT   CDS_pept        complement(577662..578111)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07062g"
FT                   /old_locus_tag="DEHA0A07150g"
FT                   /old_locus_tag="DEHA-IPF6821"
FT                   /old_locus_tag="DEHA-CDS5866.1"
FT                   /product="DEHA2A07062p"
FT                   /note="similar to uniprot|Q06177 Saccharomyces cerevisiae
FT                   YLR327c RBF9 or uniprot|P16965 Saccharomyces cerevisiae
FT                   YGR008c STF2 ATPase stabilizing factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84588"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT7"
FT                   /protein_id="CAG84588.2"
FT                   /translation="MDISHPTLFSLGHKSRLKYKIIPSINRGSNKHSFEVLEAKQIKIA
FT                   QLYIIYIFNKYKMTRTNKWTVHEAKSNSKWFTHHGPINCDPTKVKKSGAGKGNWGKPGD
FT                   EMKDDTDMDMVTMFGQSQRRNSNHSQNEQDMKMLNEQLDHSMFAM"
FT   gene            complement(<578158..>579612)
FT                   /locus_tag="DEHA2A07084g"
FT                   /old_locus_tag="DEHA0A07172g"
FT                   /old_locus_tag="DEHA-IPF6822"
FT                   /old_locus_tag="DEHA-CDS2213.1"
FT   CDS_pept        complement(578158..579612)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07084g"
FT                   /old_locus_tag="DEHA0A07172g"
FT                   /old_locus_tag="DEHA-IPF6822"
FT                   /old_locus_tag="DEHA-CDS2213.1"
FT                   /product="DEHA2A07084p"
FT                   /note="similar to uniprot|P16639 Saccharomyces cerevisiae
FT                   YGL017W ATE1 Arginyl-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84589"
FT                   /db_xref="GOA:Q6BYT6"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT6"
FT                   /protein_id="CAG84589.2"
FT                   /translation="MKPGPDLPMVISRPHYISGRDCGYCNGKKEDYHALESQKTTNGDK
FT                   ESQSITIGCQVEQMTCQHYDELINQGFRRSGTFLYKPDLLRGCCRLFTIRTDVTQLKVT
FT                   KAHRKTINRFIRAISDEPDTKEGNKHFDLHSLVKEEQKSTRFHTKYEPSKFSKEKFELY
FT                   KKYQVHIHNDEPSDVTERSFKRFLCDTPFPEKEVMGSSDDWETLNHWVKRWSPEDNTPS
FT                   NRVGPTHECYYLDGKLIAISILDFLSTGVSSIYFIWDPDYAHLSLGTLSGLREIIMCSE
FT                   LQLGYYYLGYYIEDCAKMNYKSKFGGELLDLCNEVYFPLPAVGEFIKNGRFFVVGDAND
FT                   SDETAYSNELELENTGHPMAVSGSEFDNKSLVDVSEKIYANDSIYDDANKALAILQKSY
FT                   GIGSASDSVYKLPAVVPGIIPIWQILEWFHSGAIDNDLPVSIFTMMTADLKECDFGQLN
FT                   PIGKSIVIDCIRLFGLEKFQDCIILV"
FT   gene            <579807..>581018
FT                   /locus_tag="DEHA2A07106g"
FT                   /old_locus_tag="DEHA0A07194g"
FT                   /old_locus_tag="DEHA-IPF6823"
FT                   /old_locus_tag="DEHA-CDS3344.1"
FT   CDS_pept        579807..581018
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07106g"
FT                   /old_locus_tag="DEHA0A07194g"
FT                   /old_locus_tag="DEHA-IPF6823"
FT                   /old_locus_tag="DEHA-CDS3344.1"
FT                   /product="DEHA2A07106p"
FT                   /note="similar to uniprot|P41896 Saccharomyces cerevisiae
FT                   YGR005c TFG2 TFIIF subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84590"
FT                   /db_xref="GOA:Q6BYT5"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT5"
FT                   /protein_id="CAG84590.1"
FT                   /translation="MSGSTKTSPVKKAAKQAGSNEKVATDKGDAVSNGNSITKDQNSNE
FT                   AEEPDHSILSDPEDYLEEDESLDMNLTNGEQKVWLVKLPRYLAEKWSNIDELSGEQLGR
FT                   VKIKQSGRNGNNSGKLQVKLVLNESAMNEEIPHEYDISMLNTQVRNSYVFSEENLTKFK
FT                   QELTEVAEMPEQPSLQPVDKKKIQNKPQKFFRIQKNKEGQDGKPVKKFVPYVKTIPKKT
FT                   ALAGKVCHDCQIIPSKSDTKYSQVSMKRQNIQPTKPRPKVTLLDEIPGVVQSNAGPSIK
FT                   GNNTSVFLKSNPAKSKNGEGRAIRMPKKDLLDLLFRLFEEYEYWSMKGLKERTRQPESY
FT                   LKESLDSIANLIKKGPYTSKYNLKPEYRRLRDAERAARLGLVINEENEEKEDEEEDIEM
FT                   EDVI"
FT   gene            complement(<581146..>581692)
FT                   /locus_tag="DEHA2A07128g"
FT   CDS_pept        complement(join(581146..581376,581687..581692))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07128g"
FT                   /product="DEHA2A07128p"
FT                   /note="highly similar to uniprot|P49167 Saccharomyces
FT                   cerevisiae YLR325C RPL38 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84591"
FT                   /db_xref="GOA:Q6BYT4"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT4"
FT                   /protein_id="CAG84591.1"
FT                   /translation="MAREIKDIKEFVELARRSDIKSAVVKVNKALNANGKKIKQTKFKV
FT                   RGSRYQYTLVVNDAAKAKKLQQSLPPTLEIKNL"
FT   gene            complement(<582025..>582924)
FT                   /locus_tag="DEHA2A07150g"
FT                   /old_locus_tag="DEHA0A07238g"
FT                   /old_locus_tag="DEHA-IPF6826"
FT                   /old_locus_tag="DEHA-CDS4250.1"
FT   CDS_pept        complement(582025..582924)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07150g"
FT                   /old_locus_tag="DEHA0A07238g"
FT                   /old_locus_tag="DEHA-IPF6826"
FT                   /old_locus_tag="DEHA-CDS4250.1"
FT                   /product="DEHA2A07150p"
FT                   /note="weakly similar to uniprot|P33411 Saccharomyces
FT                   cerevisiae YGR006W PRP18 Splicing factor involved in the
FT                   positioning of the 3' splice site during the second
FT                   catalytic step of splicing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84592"
FT                   /db_xref="GOA:Q6BYT3"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR039979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT3"
FT                   /protein_id="CAG84592.2"
FT                   /translation="MDFSSLLSKEIDKKRKLADETKKNKKVKAEDEVNIIEADTVPRAT
FT                   NSDTSEKNNRQVYTPEETTLINSISDEQLDAKLEQLGERCNTGSTKLDKIRKVEVLLRL
FT                   QKKNEVYRIQLEKEEATDRTIKLEDIASSDAREKLHTQVRMYVKYMVKEWENDVQSKTE
FT                   GFSSIRDDEEREGEEESVARQSSMLLDTKKDLVRLLYKLRTQKLTDSMSTSLCTIMYYL
FT                   QVRDYRRANESYMKLSIGNVAWPIGVKGVGIHERSAASKITGENKQNSANIMLDDKTRR
FT                   WITAIKRLISFAERKWPI"
FT   gene            <583182..>584795
FT                   /locus_tag="DEHA2A07172g"
FT                   /old_locus_tag="DEHA0A07260g"
FT                   /old_locus_tag="DEHA-IPF6827"
FT                   /old_locus_tag="DEHA-CDS2219.1"
FT   CDS_pept        583182..584795
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07172g"
FT                   /old_locus_tag="DEHA0A07260g"
FT                   /old_locus_tag="DEHA-IPF6827"
FT                   /old_locus_tag="DEHA-CDS2219.1"
FT                   /product="DEHA2A07172p"
FT                   /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
FT                   YLR324w PEX30 Peroxisomal integral membrane protein or
FT                   uniprot|P53203 Saccharomyces cerevisiae YGR004w PEX31
FT                   Peroxisomal integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84593"
FT                   /db_xref="GOA:Q6BYT2"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT2"
FT                   /protein_id="CAG84593.2"
FT                   /translation="MSGKQSNHNGENLGNKSSGSKVHSSPNSGKVEGSGESKDNTAEIR
FT                   AVFTSSDSKQDEESKSRPQTSPLLSSTPPSVAKSLVRSYPYLLIVNKFLSIITWTNDDY
FT                   WINIILVCLYSLAILYFENLVTWSGHLIIVGIITLYALLNNKIIEETNLHPTLDDVVQA
FT                   LTTTCIKADMLLNPITSLSLTAYDIKRLLFTTVFLTPLYLIVTFLLVKPRIILLFTGLH
FT                   ILTYHSSYSRVARKMLWKIKLVRVLCFYLTGLDFSQARNHSLFAAAFAKVHKNAGHSLD
FT                   LSSEASNKPVRFTYVIYENQRRWLGIGWTSNLLSYERTPWTDEFLNESSSLESFQLPNN
FT                   ENNDYSFGAQQSQQLSGSDTTWRWVDKTWRLDLTNDGAITLQNNKRSKTTANPATDEGY
FT                   IYYDNTWKKPSTEDSFSKYTRRRRWIRTAELVFNGSSDKTPSTEEEISSNSASIPGSSN
FT                   STTGAETGNSTKSAKKRKSLRFVDPESDTTDEKTDGPESLAQVEKELAADEQDTKDLKR
FT                   GVEELTSMAQEADFAGKKND"
FT   gene            <585306..>586220
FT                   /locus_tag="DEHA2A07194g"
FT                   /old_locus_tag="DEHA0A07282g"
FT                   /old_locus_tag="DEHA-IPF6829"
FT                   /old_locus_tag="DEHA-CDS4194.1"
FT   CDS_pept        585306..586220
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07194g"
FT                   /old_locus_tag="DEHA0A07282g"
FT                   /old_locus_tag="DEHA-IPF6829"
FT                   /old_locus_tag="DEHA-CDS4194.1"
FT                   /product="DEHA2A07194p"
FT                   /note="similar to uniprot|P78609 Pichia jadinii Uricase (EC
FT                   1.7.3.3) (Urate oxidase)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84594"
FT                   /db_xref="GOA:Q6BYT1"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="InterPro:IPR019842"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYT1"
FT                   /protein_id="CAG84594.1"
FT                   /translation="MQSELLDSSYGKGNVKFLKVKKNPHNSKEQDVLEANVQVLLKGNF
FT                   DVSYTKADNAPIVPTDTVKNTILIEAKTTNVWPIERFAAHLAKHFTEKYAHVSGIEVSI
FT                   VQSKWTKYEVDGKIHPHSFKHEGPETRRTFLTYCRSNKKLTITSSIKDLTVLKSTGSMF
FT                   YGYNVCDYTTLKPTKDRILSTDVDASWTYDPKQVTSLDQVLTQADKGLFDSTYDSARKV
FT                   TLDLFALENSASVQATMYNMSHKILELVPEVGTVSYALPNKHYILFNLEWKGIKQNDEL
FT                   FYPSPDPNGLIKSTVGRKTQSKL"
FT   gene            <586382..>587701
FT                   /locus_tag="DEHA2A07216g"
FT                   /old_locus_tag="IPF_6831"
FT   CDS_pept        586382..587701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07216g"
FT                   /old_locus_tag="IPF_6831"
FT                   /product="DEHA2A07216p"
FT                   /note="similar to uniprot|P36101 Saccharomyces cerevisiae
FT                   YKL027w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65376"
FT                   /db_xref="GOA:B5RSS0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS0"
FT                   /protein_id="CAR65376.1"
FT                   /translation="MSCHSKVWMLVVATALVTTGVVEGFHRYMDSRDNVKSPPSTKQIT
FT                   ETNKDYSEELIQEQLARNYAFLTEGGMEKVRNQNIVVVGAGGVGSWVTTMLVRSGVGKI
FT                   RVIDFDQVSLSSLNRHAVANLKDVGISKVECLRNHLLQIAPWIEIDTKNQLWNIDVAEE
FT                   LIFGEDFKPTYVVDCIDNIDTKVDLLTFCHEKKLPVISSGGAACKSDPTRVNISDISKT
FT                   EEDPLSRSVRIRLKKRGIISSIPVVFSAEKPDPRKAQLMPLTDAEIAKGEVDQLSAIKN
FT                   FRVRILPVLGTMPGMFGLTLATHLITSISGYPVEPIEGKNRYKVYDGILQSLAGQQSRI
FT                   GKLDQRVPIALNDVNYILEEVFHGKSPISNYSTRLTLSRWDPRKELSYQNVVIMTKEEQ
FT                   KLHEDRVLKGGELLTEVYTKEILDRVEQRFSEERFYSQFR"
FT   gene            <587847..>588557
FT                   /locus_tag="DEHA2A07238g"
FT                   /old_locus_tag="DEHA0A07348g"
FT                   /old_locus_tag="DEHA-IPF6833"
FT                   /old_locus_tag="DEHA-CDS4961.1"
FT   CDS_pept        587847..588557
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07238g"
FT                   /old_locus_tag="DEHA0A07348g"
FT                   /old_locus_tag="DEHA-IPF6833"
FT                   /old_locus_tag="DEHA-CDS4961.1"
FT                   /product="DEHA2A07238p"
FT                   /note="weakly similar to uniprot|P37293 Saccharomyces
FT                   cerevisiae YGR147c NAT2 N-acetyltransferase for N-terminal
FT                   methionine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84597"
FT                   /db_xref="GOA:Q6BYS8"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS8"
FT                   /protein_id="CAG84597.1"
FT                   /translation="MSRMNLLSRIQIPVKPLFSRSPGQIVTRQIPKNQFLKRFQSTLKS
FT                   GKPTPPPQAPNKPKSLKHLMKEYGYAGLGVYLAISFIDLPICYVLVHSMGKEQIEYYEN
FT                   KVKQTFGYGVSDEELQKKHEISKIEEMNEQSNSEEVNENGSFFTMLLSQFSWTEFAIAY
FT                   GIHKSLIFIRLPITAAITPGIVKGLRNWGFKIGSDKLSTTASIAKGTIKDITASSQKFG
FT                   TRPNGKKKWFSWFF"
FT   gene            complement(<588854..>590050)
FT                   /locus_tag="DEHA2A07260g"
FT                   /old_locus_tag="DEHA0A07370g"
FT                   /old_locus_tag="DEHA-IPF6834"
FT                   /old_locus_tag="DEHA-CDS3201.1"
FT   CDS_pept        complement(588854..590050)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07260g"
FT                   /old_locus_tag="DEHA0A07370g"
FT                   /old_locus_tag="DEHA-IPF6834"
FT                   /old_locus_tag="DEHA-CDS3201.1"
FT                   /product="DEHA2A07260p"
FT                   /note="similar to uniprot|P38702 Saccharomyces cerevisiae
FT                   YHR002w Mitochondrial carrier protein LEU5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84598"
FT                   /db_xref="GOA:Q6BYS7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS7"
FT                   /protein_id="CAG84598.1"
FT                   /translation="MIPTTNRNKLNMNCNEESTPFEPVRVIDKQSLDYVLRSGVSGGLA
FT                   GSAAKTLIAPLDRVKILFQTSNPEFLKYRGKFSGLFRASKRIWSNDGFYGLFQGHSVTL
FT                   LRIFPYAAIKFVAYEQIRTILIPTDLHETAIRRFMAGSLSGLASVFFTYPLDLLRVRMA
FT                   FETKHLHNDDIRANSRQHIIAQHRGRLSTTVREILNERPPHKVNDPTWFKLMRQNLPPS
FT                   VMSLSNFYRGFAPTILGMIPYAGVSFYTHDLIHDILRSKYLSKYTVQSAGALSHSISTS
FT                   SSSNRVIRKSSSNKDQINSRDSRLPLKAYAQLLAGGLAGMCSQTAAYPFEVIRRRMQVG
FT                   GAVNQGQHLSFKSTAKIVYRESGFRGFFVGLSIGYIKVIPMVACSFYVYERCKMFFGI"
FT   gene            complement(<590610..>591854)
FT                   /locus_tag="DEHA2A07282g"
FT                   /old_locus_tag="DEHA0A07392g"
FT                   /old_locus_tag="DEHA-IPF6836"
FT                   /old_locus_tag="DEHA-CDS3057.1"
FT   CDS_pept        complement(590610..591854)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07282g"
FT                   /old_locus_tag="DEHA0A07392g"
FT                   /old_locus_tag="DEHA-IPF6836"
FT                   /old_locus_tag="DEHA-CDS3057.1"
FT                   /product="DEHA2A07282p"
FT                   /note="some similarities with uniprot|P38830 Saccharomyces
FT                   cerevisiae YHR124w meiosis-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84599"
FT                   /db_xref="GOA:Q6BYS6"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="InterPro:IPR037141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS6"
FT                   /protein_id="CAG84599.2"
FT                   /translation="MMTLPNDEPTISPDDAATAAAVAAASTAAAAVAAIPQLKDDDHSL
FT                   HHQFVQQHHHQLQEQHAHQQHALQQHHQHHQHHQHPHEHDHDQLNSQLNHQLQQHNLAH
FT                   HQLNHTPHHHLEMLAQANEEDFLDSTNRKVAPRSSDLFKVGPQFSETRHHQDIYCKRND
FT                   MDVNPILEARIDRGFEVGENGTWIGYKRNYFTLVASFSLENFNFDRFIQNKFYTYEKSS
FT                   KNGESVGENKVEISYFAIRLVAKCSDDDVAISLVQHTAKRDKGPQFPPPIYPAVPGDLP
FT                   DHETVRASCNKRNGNKIENMNKVFYFDRAEYYHNTNLDTLKDDSVLKNYPSDSIARVAR
FT                   FERIQFTSSIRLKSTSVNSRYFTLHVELLGIIENEDCQIQPILLSSIETPPLIIRGRSP
FT                   SNYHKDRTSGYRGHI"
FT   gene            <592634..>592706
FT                   /locus_tag="DEHA2A07304r"
FT                   /old_locus_tag="Deha0A.3"
FT   tRNA            592634..592706
FT                   /locus_tag="DEHA2A07304r"
FT                   /old_locus_tag="Deha0A.3"
FT                   /note="tRNA Thr (AGT) cove score=74.95"
FT   gene            <592873..>598215
FT                   /locus_tag="DEHA2A07326g"
FT                   /old_locus_tag="DEHA0A07436g"
FT                   /old_locus_tag="DEHA-IPF6841"
FT                   /old_locus_tag="DEHA-CDS0058.1"
FT   CDS_pept        592873..598215
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07326g"
FT                   /old_locus_tag="DEHA0A07436g"
FT                   /old_locus_tag="DEHA-IPF6841"
FT                   /old_locus_tag="DEHA-CDS0058.1"
FT                   /product="DEHA2A07326p"
FT                   /note="similar to uniprot|Q04952 Saccharomyces cerevisiae
FT                   YMR306w FKS3 or uniprot|P38631 Saccharomyces cerevisiae
FT                   YLR342W FKS1 Catalytic subunit of 1 3-beta -D-glucan
FT                   synthase or uniprot|P40989 Saccharomyces cerevisiae YGR032W
FT                   GSC2 Catalytic subunit of 1 3-beta -glucan synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84600"
FT                   /db_xref="GOA:Q6BYS5"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS5"
FT                   /protein_id="CAG84600.2"
FT                   /translation="MHSQTSADAYREFSIYQSMGSGIYDALEGETEMNGVENGGMIEEV
FT                   DGEEDNGIVSEVSDIEGSTYCNGIKEEATPYPSWCIQNGAPINKDEIWQIFLTLGNMFG
FT                   FQSDSQSNIYDLFMTSLDSRSSRMSCKLALLSLHADYIGGEHSNYKKWYFAAHFELDEN
FT                   VKVNEKQWRWFKDFAKFKSKSNTPYNLNDIQDTSCLLAMEYNWRLRMKNYTDEDYIYQI
FT                   ALYLLIWGEANNLRFMPECICFIYKCAFDYFESAELDTKANEFEFLDTVVTPIYSYIRN
FT                   QQYELVNNVWKKSEKDHSDIIGYDDVNQFFWYRGNLEKIMLLDKSLLYEYPRNQRYTKF
FT                   KSIKWKKLFYKTYSERRTWLHLFTNFSRVWVIHVTMFWYYTCFNSPTIYTKNYVQLLDN
FT                   KPAPQVQWSAVALGGTVACLLTILATLIEWLFVPRKWPGAQHLFFKLVLLVLITIINAG
FT                   PSVYIFLFLPIDKYSKIGHIVGIIQFVISIITFLYFAIESPNRLFNFFLKKNSNIIKTE
FT                   IFTSSFPKLHLRNQIYSYLLWVCVFLAKFSESYFFLTLSLRDPIRVLSIMEMTRCKGDI
FT                   FLGNLLCKQQARFTLILLYVTDLVLFFLDTYLWYIICNCIFSIGLSFSLGISIFTPWRN
FT                   IFSRLPERIFSKIIYLNGTSKIDSALLISQIWNSIVLSMYREHLLSIDQVNKLVYQQIN
FT                   VSNEESMDKTYLRSPLFFILQDDNSLNLHDFFTASKEAERRISFFAQSLSSPLPEPFPI
FT                   LAIPAFTVLIPHYSEKIILSLREIIKEDKHSKVSLLEYLKSLHSTDWELFVEDTKILSL
FT                   VSSQPLDLGEADFPSEQSLNHKHESDLVNNQISDLPYYCVGFKDSSPEYTLRTRIWSSL
FT                   RCQTLFRTISGFMNYEKAIKLLYKLENYDLDSNSYFDVDTELNEFVQRKFKLLISMQRF
FT                   QKFHENELNDAELLFGIYPQIQISYLEEEVNGDQTTYYSTLLNVSEKDSYGNYKKKYRV
FT                   KLSGNPILGDGKSDNQNNCIIFYRGEYIQVIDANQDNYLEECLKIKSVLAEFEEIDMDP
FT                   SSEYVPGIFSENLKDPVAILGAREYIFSENIGVLGDIAAGKEQTFGTLFARTLAEIGGK
FT                   LHYGHPDFLNGIFMTTRGGVSKAQKGLHLNEDIYAGMTAVCRGGRIKHCDYYQCGKGRD
FT                   LGFGTILNFTTKIGAGMGEQILSREYYYLGTQLPIDRFLSFYYAHAGFHINNLFIMLSV
FT                   HLFMLVLVNLGSLKHESVVCMYDSNIPFTDLQVPLGCYNLQPVLNWVSRFVLSVFICFF
FT                   ISFIPLIFQELIEKGFIKAIYRIFHHFVSLAPFFEVFVCQIYAKSLKDNITFGGAKYVA
FT                   TGRGFATSRISFNTLYSRYASTSIYSGSTVFLIVIFASLSMWQPSLLWFCITFVSMCLA
FT                   PFIFNPHQFSWGDFFIDYREFLRWLSRGNSSWHRNSWIGFIRSHRAKYTGYKKNALGEV
FT                   GQRINDASRRPSRWNSFIDQIVIPLICIVCYLVPYMFINAQNGVSNPSRVNPLFRIIIL
FT                   CFIPIIFSILITLLLFVFSCTLGPILSCCCTRVPSFIASFAHLMSVLINLVNFEVFLYL
FT                   EGLNFTRTLCGFICMIAIQKTILQFTMSICLSRELKDDYSNRAWWSGKWITSGLGWLVI
FT                   TQPLREFIVKICEMNLYAYDFILAHCLLFVMGPVLLIPFIDKWHSSMLFWFKPTKQFRE
FT                   PILSKRQRRKRKLKILKYSFLFFTLMLCFIALILAPVLAESYIPNFRRQLPSFIAEIIQ
FT                   PNHQNNNDTGDNAPRTVLRAKPNQ"
FT   gene            <598359..>600218
FT                   /locus_tag="DEHA2A07348g"
FT                   /old_locus_tag="DEHA0A07458g"
FT                   /old_locus_tag="DEHA-IPF6843"
FT                   /old_locus_tag="DEHA-CDS1522.1"
FT   CDS_pept        598359..600218
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07348g"
FT                   /old_locus_tag="DEHA0A07458g"
FT                   /old_locus_tag="DEHA-IPF6843"
FT                   /old_locus_tag="DEHA-CDS1522.1"
FT                   /product="DEHA2A07348p"
FT                   /note="weakly similar to uniprot|Q10951 Schizosaccharomyces
FT                   pombe Byr4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84601"
FT                   /db_xref="GOA:Q6BYS4"
FT                   /db_xref="InterPro:IPR034586"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS4"
FT                   /protein_id="CAG84601.2"
FT                   /translation="MNSINRNPKPISRKPSSFRSGLNITPTTNRAGRFSSKSDLLARFQ
FT                   DNEDNNEEDNIFEGDAFEDLPIEDEFKTLKISANELETLRLKKDRVSNDSNNINNRIHQ
FT                   FQDEDPDDLGFGDEDFVRDDLQLNYRTTLNEPDDDELKLSPGTISTSSPKPRMRSKSLS
FT                   EYSEDTNDTDVTSQFNDDDFDDINDVDDIFGNEESGIYSSGGNGNTSKANRHLLMKQQK
FT                   LQNDAEIEERELFKKYKRLANDETNTLKLKDFTFYDHNPIDTDALENEKTVDYEYTKDD
FT                   FENFEDGFDTDVPIKLDVDKLKQYARGNKTVNIKSSMPNFNNKNNLSKAKKYKSTMDLV
FT                   NEFETQHPVFNNNNKIIRKLDRIPSFYNKNDAMKSNNSKLNHDIELEKQQLLNKYMEIT
FT                   EKQNRLNNRHRKKNLSMKHPNGKNKRIGLVRYLNDNPIPQSNNNSKMKYNPVNKKWEGN
FT                   DIELVKFENLNVPKPSLISFSEFKNNMKDKKLQGNMVYDPDQLKWINLNKDEDNVFQGL
FT                   PDLPDLQINKRSVPNSPTKTVGRGVSAFTQRTGSTNSIASNSPNSNEFEVPPRLIEKFH
FT                   KEEMKLSKKINYWFQQENYDLINSDFNHNYFWEIRKMVIDNED"
FT   gene            complement(<600415..>602070)
FT                   /locus_tag="DEHA2A07370g"
FT                   /old_locus_tag="DEHA0A07480g"
FT                   /old_locus_tag="DEHA-IPF6844"
FT                   /old_locus_tag="DEHA-CDS1952.1"
FT   CDS_pept        complement(600415..602070)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07370g"
FT                   /old_locus_tag="DEHA0A07480g"
FT                   /old_locus_tag="DEHA-IPF6844"
FT                   /old_locus_tag="DEHA-CDS1952.1"
FT                   /product="DEHA2A07370p"
FT                   /note="similar to uniprot|P22146 Saccharomyces cerevisiae
FT                   YMR307W GAS1 Beta-1.3-glucanosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84602"
FT                   /db_xref="GOA:Q6BYS3"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS3"
FT                   /protein_id="CAG84602.2"
FT                   /translation="MLFKSLISSALLATSALVPSAVAEDLPEIEVVGNKFFYSNNGSQF
FT                   FMKGVAYQQNTANSSDVSFVDPLADAEACKRDIPYLEELQTNVIRVYALNVSLDHTECM
FT                   SLLQDAGIYVIADLSQPDESINRKSPEWNLELFDRYTGVVDLFQNYTNVLGFFAGNEVT
FT                   NDKTNTDASAYVKAAVRDTKAYIKAQNYRTIPVGYSANDDSDIRDSLADYFACGSEEER
FT                   ADFFGINMYEWCGSSSFKKSGYESITKQYKNLGIPIFFSEYGCNEVSPRKFEEVGTIYG
FT                   DDMTDVWSGGIVYMYFQEENDYGLVSVSGSSVSTLKDFSYLKAELASISPSAAQSSSVG
FT                   SASVTSCPTSTSNWSAATKLPPTPDKEACDCMAKSLTCVVDSDVSSDDYEDLFDYVCSK
FT                   VDCDGINGNGTTGDYGAYSPCSDKQKLNFVLNLYYEENGSAKSDCDFSGSATTQKANTA
FT                   SSCSAYLKSAGSSGVGTISGSIQTTKHTGITKTGSSSKSTSGSGSGSGSGSSSSSSSTN
FT                   TGSSSGSHQISLGLATKSLLVGAVSIFGFGLIFA"
FT   gene            <604534..>605658
FT                   /locus_tag="DEHA2A07392g"
FT                   /old_locus_tag="DEHA0A07502g"
FT                   /old_locus_tag="DEHA-IPF6847"
FT                   /old_locus_tag="DEHA-CDS3410.1"
FT   CDS_pept        604534..605658
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07392g"
FT                   /old_locus_tag="DEHA0A07502g"
FT                   /old_locus_tag="DEHA-IPF6847"
FT                   /old_locus_tag="DEHA-CDS3410.1"
FT                   /product="DEHA2A07392p"
FT                   /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
FT                   YML048w EFF2 involved in glucose repression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84603"
FT                   /db_xref="GOA:Q6BYS2"
FT                   /db_xref="InterPro:IPR022757"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS2"
FT                   /protein_id="CAG84603.1"
FT                   /translation="MSDEKILNDVSESEDTGYLESYIRFNDDLEKDYCFQIKVDKRYRD
FT                   LLEIFKSLPIALRPNVFHYSKPIGFQVSTCPGYLTEDGSLLFSYETGMEKFLKKVSFDD
FT                   KIADTIWPGQLILPVWEFNSFAFYSFITLLVCWLYTDLPDFISPTPGICLTNHMTRGAS
FT                   YLATYFGQHKLAHALIVDIEDPVGIIGQCLFFVFHLIKVLVIFLLFHLGTFNPIRMNRF
FT                   SGTKVPTDISREQLIELGWTGSRRATPDEYKEYYRDYKIKEHGGMVQAHQAGVFDTLKN
FT                   LGIYLGEGEGFNTPMDSKSTMADLCDEENDKFTLSYDYLAQLGAFFASYIEKEGVDLAD
FT                   TIKQFRRFGLLHCTDSVKKAVQQRKIFGDSKINK"
FT   gene            <606159..>608462
FT                   /locus_tag="DEHA2A07414g"
FT                   /old_locus_tag="DEHA0A07524g"
FT                   /old_locus_tag="DEHA-IPF6848"
FT                   /old_locus_tag="DEHA-CDS0923.1"
FT   CDS_pept        606159..608462
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07414g"
FT                   /old_locus_tag="DEHA0A07524g"
FT                   /old_locus_tag="DEHA-IPF6848"
FT                   /old_locus_tag="DEHA-CDS0923.1"
FT                   /product="DEHA2A07414p"
FT                   /note="highly similar to uniprot|P05694 Saccharomyces
FT                   cerevisiae YER091c MET6 5-
FT                   methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84604"
FT                   /db_xref="GOA:Q6BYS1"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS1"
FT                   /protein_id="CAG84604.1"
FT                   /translation="MVQSSILGFPRIGGQRELKKVTESYWQGKVGVNDLLSKGKELRSH
FT                   NWKLQKEAGVDVIPSNDFSYYDQVLDLSLLFNVIPDRYTKFELAPIDVLFAMGRGLQRK
FT                   ATDSTPAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNTEAGLKPVDEYLEAKALGIE
FT                   TRPVIVGPISYLYLGKADKDSLDLDPISLLDKILPVYKQLLAKLKEAGAKEVQIDEPIL
FT                   VLDLPKEIQAKYADAYKALAGSDVPEIVLATYFGDVRPNLSAIKGLPVSGFHFDFARVP
FT                   EQLDEVVAALGDKQTLSVGIVDGRNIWKTDYSKASAFVAKAIEKVGKDRVVVSTSSSLL
FT                   HTPVDLQNEKKLDATIKDWFSFATQKLDEVVVLAKNASGEDVSKELAANAQSIKSRQES
FT                   SITTNPKVQERLATVNESLSTRKVPFAERLPSQQTKYNLPLFPTTTIGSFPQTKDIRIN
FT                   RNKYTKGELTAEQYEEFINKEIETVVRFQEEIGLDVLVHGEPERNDMVQYFGEQLEGYA
FT                   FTTNGWVQSYGSRYVRPPIVVGDVSRPKAMTVKESVYAQSITDKPMKGMLTGPVTCLRW
FT                   SFPRDDVSQKVQALQLGLALRDEVQDLEKAGITVIQVDEPAIREGLPLRSGKERSDYLN
FT                   WAAQSFRVATSGVENDTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKDDANYIQEFSN
FT                   YPNHIGLGLFDIHSPRIPSKEEFISRIEEILKVYPANKFWVNPDCGLKTRGWEETKASL
FT                   TNMVDAAKHFRGKY"
FT   gene            <608943..>610111
FT                   /locus_tag="DEHA2A07436g"
FT   CDS_pept        join(608943..609133,609217..610111)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07436g"
FT                   /product="DEHA2A07436p"
FT                   /note="similar to uniprot|P34223 Saccharomyces cerevisiae
FT                   YBL058W SHP1 UBX (ubiquitin regulatory X) domain-
FT                   containing protein that regulates Glc7p phosphatase
FT                   activity and interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84605"
FT                   /db_xref="GOA:Q6BYS0"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYS0"
FT                   /protein_id="CAG84605.2"
FT                   /translation="MSNQEQDQLIDQFVTVTNSSKSLAEQYLARNENDLINAIEDYYAT
FT                   SSNTENSGIDNTKPKQPKADLNNNEDDDEEDKTDTNFFTGGEKSALQVEDPNKRGDKKK
FT                   EKSIIDQIFQRAKEQMDQPDERPSSNQDQPEEVRKFTGTGFKLGGENEPSEQVADMNSR
FT                   LPKKPSKVTREITFWKQGFTVGEGALHRYDDPNNASVLQELNAGRVPMSLLDVEFGQDV
FT                   DVSVFKKTDEDWVPPKRKVGGFSGQGQRLGSPVPGESCGASPAPEAQPEPTKETKPEDK
FT                   GEGDSLVQIRFANGKKTSHKFNSTDSITKVYDFVRTHPFTESDKSFILTHAFPVKPIEE
FT                   SNDLTVGDAKLKNAVIVQRWI"
FT   gene            <610405..>613701
FT                   /locus_tag="DEHA2A07458g"
FT                   /old_locus_tag="IPF_6858"
FT   CDS_pept        610405..613701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07458g"
FT                   /old_locus_tag="IPF_6858"
FT                   /product="DEHA2A07458p"
FT                   /note="similar to CA0260|IPF13683 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65377"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS1"
FT                   /protein_id="CAR65377.1"
FT                   /translation="MMIKIIRPNVKIRVLNLSSYIRISLQIQKRCINTTIPCTYRSKLG
FT                   IPNIFGANESIVQLNNDSANGTNEFNDYSSIDDLQISLKNFMTSKPAFINAYNDYRKKD
FT                   LSVTRKFGELDEFISGIPKPNYRAIVSTNENMPPNTGSFIEIIDPSTSCVTFGVVLEGS
FT                   QTKFNENYNKLLVLTVDNKIEKIYPQDVSFHLSQVLDPHWIKTLRVIENRHDSTFGNRL
FT                   VLADILKLFLDKSLNRLQRLQDPNNNQFSIVFSQYATPFQMKSISLPDIYESFKLSDPV
FT                   LSDINSSYYNQSAFLLSCHLGMINSPEMWLVSSCYGTNKLTNLVKEGCSNEITSGSRYF
FT                   VNSITNMESLSKLFDDFENPIYLAKYNTFLTTLFGEQTSQNPKSFDDLNVYFNIWEGKY
FT                   FLNIITVMKFFIIYPHSLIRDRIEKLTILGGQSMDPCTTYKFLEDLKIYNNRRHQMTDI
FT                   YLSANIMGKSLLSQLSISSINDLRPTSTQAESDNFMNEKITDKFPHLRKSKVYYQDHIV
FT                   YGLPFGKSIDSKQKSSLLAVSLEKINSRKYLINIHIPDMITKLSPSSNLFDEIASSSLN
FT                   MKSLTKLINDSNINIFDSDLIDKLSFPDHNLRETSDWFSVGDVSQRSNKYDSGNKSNNN
FT                   VTCMTVSFVYNKYESNPFSDLEEKISFSFDSLNSVSIKNIDWNTLEKCLNGVTEVSPFT
FT                   LFKERASRSKDKNNAELDDDDIHNMNFIFNVMKSHIKIRNLDGASNVDPSIAFQNNDSS
FT                   NLLKELSIVNKYEDQEKVLTTIESKTLENQLELSKSKFFINELDKFVGKLTSRYCLMHD
FT                   IPILTHHQDILESLNNESNPELIMKRETRDLNDEAYISHNNLFLPNYHANSYFQTLIAR
FT                   DSSGYVSMSAYLIGLNYLTKPNIEVFADENLSFVPLGINDGYVRMFGVFTDYEVLLNQF
FT                   QILSHIQKFSQGNNPAFFKDNEHSAIIRQFSYLKRYGYKLNGPLSHDALNHQLHKILNS
FT                   YKLCDHLGTVHKHFWTLKLLEQRLLQETSLDSGTTGVTYDCIITRAGYEIPSISKKIAR
FT                   GYCSQLNIEIDIMIPLDREVTIGNQIICDKVMFLDPIGGHCVLRESQLLH"
FT   gene            <613874..>615492
FT                   /locus_tag="DEHA2A07480g"
FT   CDS_pept        join(613874..613879,613954..615492)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07480g"
FT                   /product="DEHA2A07480p"
FT                   /note="highly similar to uniprot|P00899 Saccharomyces
FT                   cerevisiae YER090w TRP2 anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84608"
FT                   /db_xref="GOA:Q6BYR7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYR7"
FT                   /protein_id="CAG84608.1"
FT                   /translation="MFSKIQPSLEALTSIVQSHQDDENKPNLYPIYKYVTADDLTVHKA
FT                   YLKLAKLNDPKRSPSFLFESAVNGDTVDRYSFIGLNPRKVIRTGEDERLFPKEHCNVDP
FT                   ITILEKELAKYNQIQLPGLPKFSGGAVGYISYDCIKYFEPKTRKPLEDVLQLPEAVLML
FT                   CDLIVAFDRVYDRFQIINNVAVTDSNDLQASFNKAAEAIDNVEKILRSESTPEEINPKQ
FT                   PPIKANQTFTSNIGQEGYEGHVSTLKKHILKGDIIQAVPSQRVARPTSLHPFNIYRHLR
FT                   TVNPSPYLFYIDLIDFEIIGASPELLVKADEKGKVVTHPIAGTVKRGKTNEEDEANAEI
FT                   LRSSLKDRAEHIMLVDLARNDINRICTPESNKVDRLLTIERFSHVMHLVSEVSGTLRSD
FT                   KTRFDAFRSIFPAGTVSGAPKVKAMELIGTLEKEKRGVYAGAVGHWGYDGKTMDTCIAL
FT                   RTMVYKNGIAYLQAGGGIVFDSDEYDEYVETMNKMKANNQTIIDAEKVWIEKVGQE"
FT   gene            <615764..>617452
FT                   /locus_tag="DEHA2A07502g"
FT                   /old_locus_tag="IPF_6860"
FT   CDS_pept        615764..617452
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07502g"
FT                   /old_locus_tag="IPF_6860"
FT                   /product="DEHA2A07502p"
FT                   /note="some similarities with uniprot|P40059 Saccharomyces
FT                   cerevisiae YER088c DOT6"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65378"
FT                   /db_xref="GOA:B5RSS2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS2"
FT                   /protein_id="CAR65378.1"
FT                   /translation="MKSSEDESSPSMSSNTANAKNFSRTPTSWDASDDILLMHLKDQQK
FT                   LGWKEIASNFTNRTPNACQFRWRRLKSGNLKNPPKSSSGLGSPASGSKVPATSGLKKSK
FT                   KGPGNARSVSPSNDSPSAFSSYSPITTATFTGYDNNINNALAGLNALSNTPSNISSPMP
FT                   NYHIGTNTNSSTPGLNSPDGGNRSHSLGHNHFDNSPRSEVSLDPQSHHGTTTNSGGGYY
FT                   ADISIDPTMNLPHNQAHPHTPGHLTPRNSTSQGSQANSNRSNHQTHPIPHNVHNNSIIQ
FT                   IVKDDRTSVSSATRASVSSLPSKSMNIPHHQSNNSALAHLPILFGGGSSISGPSRNASV
FT                   SGIPSTYQSTTVSSIRNGSVGSSGYYSRSGSVVIPFTGDKRDDENLKPDLKKADFPANT
FT                   KKTPNKTHNSQKNTSKSSTPNAQATIFKIPWSMEEDELLINRRNRELSFAELSILLPQR
FT                   TEGEIWSRIDYLEKLRNGHRSSTSREHRKGRQSSIGLDDDDDFYDEVDDVIDGIDVSED
FT                   DDEDDDVLVDDDESLHHGTRKRKKRRTSSAVNPLAVGETLRRKLK"
FT   gene            complement(<617578..>618186)
FT                   /locus_tag="DEHA2A07524g"
FT                   /old_locus_tag="DEHA0A07656g"
FT                   /old_locus_tag="DEHA-IPF6864"
FT                   /old_locus_tag="DEHA-CDS5335.1"
FT   CDS_pept        complement(617578..618186)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07524g"
FT                   /old_locus_tag="DEHA0A07656g"
FT                   /old_locus_tag="DEHA-IPF6864"
FT                   /old_locus_tag="DEHA-CDS5335.1"
FT                   /product="DEHA2A07524p"
FT                   /note="similar to uniprot|P34222 Saccharomyces cerevisiae
FT                   YBL057C PTH2 mitochondrially-localized peptidyl-tRNA
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84610"
FT                   /db_xref="GOA:Q6BYR5"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYR5"
FT                   /protein_id="CAG84610.2"
FT                   /translation="MSQQNLSHLLSVGVISLITGFCISQYCGTKQCSRSKLKDSKKIPK
FT                   VPVENLSTEDESEYEDDSEDESIDIDSTPLNDVPGEVRMTLIVRQDLKMGKGKAAAQCS
FT                   HATLALYKKISNPESEAYNPEMVNRWEYGNGQAKITLQVPNQEEMDTLFAQAISLDVNA
FT                   YIVHDAGRTQIAAGSATVLGLGPAPKLVIDQITKDLKLY"
FT   gene            complement(<618321..>619025)
FT                   /locus_tag="DEHA2A07546g"
FT                   /old_locus_tag="DEHA0A07678g"
FT                   /old_locus_tag="DEHA-IPF6866"
FT                   /old_locus_tag="DEHA-CDS4877.1"
FT   CDS_pept        complement(618321..619025)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07546g"
FT                   /old_locus_tag="DEHA0A07678g"
FT                   /old_locus_tag="DEHA-IPF6866"
FT                   /old_locus_tag="DEHA-CDS4877.1"
FT                   /product="DEHA2A07546p"
FT                   /note="similar to CA1056|IPF17503 Candida albicans
FT                   IPF17503"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84611"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYR4"
FT                   /protein_id="CAG84611.2"
FT                   /translation="MSDDLDRVLSTEESALVKDREIERVLNCCPWDYYSILEINPLKKD
FT                   IQLQNQIKRTYRKKTLLIHPDKVSNPNAPHAFDRLKKAELVLSFDIPESESEIESQDDT
FT                   SKLYVNEKKRLLAIYNDAENRLLRSKKIIQGDTYSEENYKQILQIVTEILNEEIKQEEI
FT                   ERNFQQQQEAKKMAELKKVQQERELKKKLANKWEDERDIRVNNWRSYTNKIEKPKSKSK
FT                   KKSGNSKKNVLA"
FT   gene            <619154..>620437
FT                   /locus_tag="DEHA2A07568g"
FT                   /old_locus_tag="IPF_6867"
FT   CDS_pept        619154..620437
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07568g"
FT                   /old_locus_tag="IPF_6867"
FT                   /product="DEHA2A07568p"
FT                   /note="similar to CA1055|IPF17504 Candida albicans
FT                   IPF17504"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65379"
FT                   /db_xref="GOA:B5RSS3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS3"
FT                   /protein_id="CAR65379.1"
FT                   /translation="MLTRLSLRVFSHFKASRMTFATSNEWKPRYFDIGVNFSDSMFQGC
FT                   YNGSTTPKHPADIDKVIARAHLFNVNKMLITASSIQESEEHFALCKEHPGMFYSTVGVH
FT                   PCTVAQEFYQKDEEMNEFTEELVPDVENRLNKLRDLVKLGYENGYVKAFGEIGLDYDRF
FT                   HYASKEQQITMFGKQLEVISSLKELKLPLFLHMRSACDDFISIIKPFIDRGDILKGNGV
FT                   IHSFTGSKEELEKLSELGFYIGINGCSLKTDDNLEVAKLIPKDKLMIETDAPWCEIRKS
FT                   HSSYKYITPYPNQFYPEISMEEPKPSSVEDESNGTHVQGKQKQKQKQASKQPQIKFDDF
FT                   LPFPTIKKEHFAKHQNIIDTIAKQRNLEKITQPIGEFAYPLIRSRNEPVFVGYVAEIMC
FT                   ELYDIKDPKDIADFIDLIYENTCKLFQI"
FT   gene            complement(<620543..>622939)
FT                   /locus_tag="DEHA2A07590g"
FT                   /old_locus_tag="IPF_6868"
FT   CDS_pept        complement(620543..622939)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07590g"
FT                   /old_locus_tag="IPF_6868"
FT                   /product="DEHA2A07590p"
FT                   /note="some similarities with uniprot|P34218 Saccharomyces
FT                   cerevisiae YBL052C SAS3 Histone acetyltransferase catalytic
FT                   subunit of NuA3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65380"
FT                   /db_xref="GOA:B5RSS4"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS4"
FT                   /protein_id="CAR65380.1"
FT                   /translation="MTPKHNLLNSLRITNNKIYEDISLGHDVTDRSQRRKPPNNSYSIK
FT                   KLVRSTMNGVDVADSKSSVGVNSNVTIIRPITKHFYVKIRYDRNNRKSRNILKIPIRRK
FT                   LESKEHSLKDKNTNKATKYTGDEFSRELPYKGILKFPDCIINDTDPTRKDRELFHKLYH
FT                   EGEQLRKSNQIDETPTVEEISAMHGSTESTPAPTGNNYLKSQIKKIQFRDYEIDTWYTS
FT                   PYPEEYSQSKILYICEHCLKYMSSPISYERHQLKNCNLSNNHPPGIEIYRDLDTNIAVW
FT                   EVDGRKNINYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEIDKENPTKYHFVGYFSKE
FT                   KLSNSDYNVSCILTLPIYQRKGYGNLLIDFSYLLSRHEFKFGTPEKPLSDLGLVSYRNY
FT                   WKITIALKLKELHSKYLNNTNNDKNSNTLSISIENLSKLTGIIPSDVVVGLEQLDSLIK
FT                   NPITNSYGIVINLQKINYIIEKWKNKKYVCLNYSKLLWKPMLFGPSGGINSAPAMPSNP
FT                   VSNLNNSTNFPSQPVINNSISNIVNFLKDDINNPYSFEEEASKEIECYLDLGQEKEDIN
FT                   LRDNDIDDYIICYPGIDVNLRKKSTPVRQPPKINLLIESGKEPSMSPDTRDVKGVNDLM
FT                   DDEDIFEDEDEGVVSDESEDYVEDSDIGDEDEEEEEIGEVNEAEQQGGDEVNYSSEQID
FT                   DVEEIRIPDYISDQDATNDNFDKTVAQPEGLPLTDRLEYDNPNIHETRKTRSHSNRQAV
FT                   GPETLTRDTRSRRSPPDHDVPIRTTRFGRQRVHITEESPRLRRRR"
FT   gene            complement(<623471..>625018)
FT                   /locus_tag="DEHA2A07612g"
FT                   /old_locus_tag="DEHA0A07744g"
FT                   /old_locus_tag="DEHA-IPF6871"
FT                   /old_locus_tag="DEHA-CDS2226.1"
FT   CDS_pept        complement(623471..625018)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07612g"
FT                   /old_locus_tag="DEHA0A07744g"
FT                   /old_locus_tag="DEHA-IPF6871"
FT                   /old_locus_tag="DEHA-CDS2226.1"
FT                   /product="DEHA2A07612p"
FT                   /note="weakly similar to uniprot|P39966 Saccharomyces
FT                   cerevisiae YER089C PTC2 Type 2C protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84614"
FT                   /db_xref="GOA:Q6BYR1"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYR1"
FT                   /protein_id="CAG84614.1"
FT                   /translation="MGQILSQPVTEKISEHGIDKHLAYGISCMQGWRVNMEDAHATILN
FT                   LYDLKNEGKGAVSDKAQDNSSSGKSGTDNDTTEEHTSFFGVYDGHGGEKVAIFTGQHLH
FT                   EIIKSTKAFQEKDYVNAFKEGFLNCDQAILNDDEMKEDDSGCAAVSVIITPRQVICGNA
FT                   GDSRSIMSINGFAKALSYDHKPSNEGEKSRICSAGGYVDMGRVNGNLALSRGIGDFEFK
FT                   KNIDLPPEEQTVTCYPDVIQHNLDFTKDEFVVLACDGIWDCLSSQQCIECVSRGLYERK
FT                   PLQDICEEIMELCCAPTSDGSGIGCDNMSMSIVALLDESRNESLDQWYDRVIKRIELSQ
FT                   SEDEESQFYGNISGEYNDMYKQMYGEYFEIGQQSQNSNTKSAGNNSSYYSMFGGLPGLR
FT                   NGPGLNQNEDEEENELSNEPTEEIQEDGTAADLAGNGAISLQKLLASNAITNENGVIYL
FT                   DTSSAQSLLAHFGMSGEDDEYEGNDVHDKHIEEEEVEEDDDQESKSKIEEEPQDDEE"
FT   gene            complement(<626009..>628060)
FT                   /locus_tag="DEHA2A07634g"
FT                   /old_locus_tag="DEHA0A07766g"
FT                   /old_locus_tag="DEHA-IPF6873"
FT                   /old_locus_tag="DEHA-CDS1204.1"
FT   CDS_pept        complement(626009..628060)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07634g"
FT                   /old_locus_tag="DEHA0A07766g"
FT                   /old_locus_tag="DEHA-IPF6873"
FT                   /old_locus_tag="DEHA-CDS1204.1"
FT                   /product="DEHA2A07634p"
FT                   /note="similar to CA1071|IPF16624 Candida albicans
FT                   IPF16624"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84615"
FT                   /db_xref="GOA:Q6BYR0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034186"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYR0"
FT                   /protein_id="CAG84615.2"
FT                   /translation="MDLRNLSSTPNQLDSVMQRRPSLSSLSSASGYASSNYGGNTTPQI
FT                   SKQRMSQARNFGNGNSNSSTNLQSAWLNQGQISSVSGQPSNQPSNQHVVNTVGPWVEQQ
FT                   QAQQQAGVASLSGLDSKVIPPNLNDKNSSSINDNDNDNEVKQNAANDNNDDDDDDIDDD
FT                   DELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYHFDNGVFRGLAFANFTSTDE
FT                   TSSVVGLLNGREIGGRKLRVEYKKMLPAQERERIEREKREKRGQLEEQHRSTSNASLAS
FT                   LLSAASTTAATKNLSVNGTSNNQTERLFITFPSASGNLPLPPSELNLNDPEILELYSQL
FT                   ILFRDDMAKSIFELAFPSSLGIAHRKILSILCSYLNLLELYDNGLIIIRRKQGQPAHLT
FT                   QQSSAPQHSSSMMNLNQLPGIVSNPPNGVTPAAHPELLRSQSQSALQMPRLRQQSSTPI
FT                   QQNFPQYQQQPQGQQQSQLSHPQASGSQSQAQPPHQSQSQQQSQRPLYSSNISQVQPYN
FT                   MFQQPPAGHGQSQQVATPSMGSSSAAALLRSSNNRSYVDVRSTPPLSTTFSQPPQSGNE
FT                   SPTPQHYHFANSNSNNQISQPTTPLANPDINSRFAPFGQHAHLTGSFSSLHNSTNNASS
FT                   QGPPNPQASQTNEEFADPEVFANKFNSINLSGNYENSNMSNSGIWGPK"
FT   gene            <628604..>629034
FT                   /locus_tag="DEHA2A07656g"
FT   CDS_pept        join(628604..628606,628759..629034)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07656g"
FT                   /product="DEHA2A07656p"
FT                   /note="highly similar to uniprot|P52871 Saccharomyces
FT                   cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
FT                   component, involved in protein translocation into the
FT                   endoplasmic reticulum; homologous to Sbh1p,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84616"
FT                   /db_xref="GOA:Q6BYQ9"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ9"
FT                   /protein_id="CAG84616.1"
FT                   /translation="MSSSSAQAPGGLRSAAKRRIAADKKAQSSNAMPLSTRSAGAGGSS
FT                   ATMMKLFTDEAQGLRVDPLVVLFLAVGFIFSVIILHVFAKITGKFSS"
FT   gene            complement(<629195..>630925)
FT                   /locus_tag="DEHA2A07678g"
FT                   /old_locus_tag="DEHA0A07810g"
FT                   /old_locus_tag="DEHA-IPF6875"
FT                   /old_locus_tag="DEHA-CDS1772.1"
FT   CDS_pept        complement(629195..630925)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07678g"
FT                   /old_locus_tag="DEHA0A07810g"
FT                   /old_locus_tag="DEHA-IPF6875"
FT                   /old_locus_tag="DEHA-CDS1772.1"
FT                   /product="DEHA2A07678p"
FT                   /note="similar to uniprot|P39965 Saccharomyces cerevisiae
FT                   YER087W Probable Prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84617"
FT                   /db_xref="GOA:Q6BYQ8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ8"
FT                   /protein_id="CAG84617.2"
FT                   /translation="MIGIRAGRYRHLCVRFTHTSTVPKLYLNNVELSGNDLTGIPTHEL
FT                   FTKFGFINHPKPGLVHWLPVGLAISQNVSRVIHRRMRECNAEEINLSLLSSSQLWQETG
FT                   RWDNSELFKLKDSSKNDFCLVATCEEEITKLIGANLNSYKNLPLLYYQINEKFRDEKRP
FT                   RSGLLRGREFLMKDAYSFDLNEEAAMKTYNKVVDAYYKIFQDLRIPFVKADADTGEIGG
FT                   TLSHEWHYLHKVGEDTLFTCDECGNSSNIEKALSYPEDVDDSVDASVQYFMTKDKSTLV
FT                   CAYYPTDRTIEASFVKEEVPDLDLNETNQDSILKEFSDEDTLISKKIIRMMDSRLNSRS
FT                   NFPDFPIKFINRSLITTLTDIPIVTAVEDEICAKCEEGHLKLHRAIEVGHTFYLGDKYS
FT                   KPLKCEVEVPNQDGSQQLTNVLMGCYGIGISRIIAAIGEINKDSTGFRWPSVIAPWNVT
FT                   VVQSPKFDDSKGIKVYNLLNAASISYRLDDRSKIGLGKKIKQSHMVGIPLTVILGNQFP
FT                   LVEVEIRGRRYTDDLSWKRLYESRDFEWEVVTDADGNDIKHLVHIDGVARAINSLLIDM
FT                   "
FT   gene            complement(<631125..>632525)
FT                   /locus_tag="DEHA2A07700g"
FT                   /old_locus_tag="DEHA0A07832g"
FT                   /old_locus_tag="DEHA-IPF6878"
FT                   /old_locus_tag="DEHA-CDS2600.1"
FT   CDS_pept        complement(631125..632525)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07700g"
FT                   /old_locus_tag="DEHA0A07832g"
FT                   /old_locus_tag="DEHA-IPF6878"
FT                   /old_locus_tag="DEHA-CDS2600.1"
FT                   /product="DEHA2A07700p"
FT                   /note="weakly similar to uniprot|P53707 Candida albicans
FT                   CSP37 37 kDa cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84618"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ7"
FT                   /protein_id="CAG84618.2"
FT                   /translation="MSKGTKSLLALAATGGAVYWYDQNVSEILPRQQRIPPQPASTGEK
FT                   INRNINRQVDKLDNKKDELVDKVSSFTNEQQREAQKASESTLDSIKNSRLVNNISGSVT
FT                   DSRRRIEANVDQDKNVLYKLTDKYIDFVNDIGGSTTNQVDQLKSTAKSDKKRAEDKANS
FT                   WFNWFGDKKDEAANNLDNNYDQAKRDAEKKKNEWFSWGSQKKDEAADRANAEAENLKKE
FT                   KNAWSAWGSKKTDEVADKAAEEKKAWTSWGSKKADEAADKAAAEKNAWSSWGSKKVDDA
FT                   TDKANQEAERLGKEKDAWTSWGSKKVDEATEKANQEAEALRKEKDAWASWGSKKADEAA
FT                   DKFNEETERLKKEWENADKSGNSTAQQYTRGAKNSERAFGDAGDPLSASYVQGKERAIG
FT                   NYEAAKKNLEDLTNKANANVKSLFQKAEPSSDERLKQAQEDFNSAFHNLRSYGADVVEQ
FT                   IESNFKRN"
FT   gene            <633269..>633541
FT                   /locus_tag="DEHA2A07722g"
FT                   /old_locus_tag="DEHA0A07854g"
FT                   /old_locus_tag="DEHA-IPF6879"
FT                   /old_locus_tag="DEHA-CDS6412.1"
FT   CDS_pept        633269..633541
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07722g"
FT                   /old_locus_tag="DEHA0A07854g"
FT                   /old_locus_tag="DEHA-IPF6879"
FT                   /old_locus_tag="DEHA-CDS6412.1"
FT                   /product="DEHA2A07722p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ6"
FT                   /protein_id="CAG84619.2"
FT                   /translation="MPKEQFVSFIRYCHYSFVRNIILNLCGNTYQTNCDLFRFRTVRSM
FT                   TGSIVSKLTWIKFSGLDHLNSLGTLGNEELQCCAAVNGFISQNGP"
FT   gene            <634673..>636244
FT                   /locus_tag="DEHA2A07744g"
FT                   /old_locus_tag="DEHA0A07898g"
FT                   /old_locus_tag="DEHA-IPF6881"
FT                   /old_locus_tag="DEHA-CDS2167.1"
FT   CDS_pept        634673..636244
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07744g"
FT                   /old_locus_tag="DEHA0A07898g"
FT                   /old_locus_tag="DEHA-IPF6881"
FT                   /old_locus_tag="DEHA-CDS2167.1"
FT                   /product="DEHA2A07744p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84621"
FT                   /db_xref="GOA:Q6BYQ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ4"
FT                   /protein_id="CAG84621.2"
FT                   /translation="MMRTTDKKQNDRSASVQTSIAAEGNNTDVEDNVITSVMSPQTGKL
FT                   VNITADGDVAMNYTMDEKEVEMDEATNKRILRKIDMYLMPVMCLLYCFQFIDKMANSFA
FT                   SIMGMREDLHMVGNQYSWSGTSFYLGYLVLEFPVSLLLQRFPVSKTVSTFIILWGFIMC
FT                   MHSVPEYPGFIALRTILGMLESSITPAFVILTSQWYKREEQFIRTALWFGCNGLGQIIG
FT                   AGAISYNLFVNADSYSMEAWKLLFIITGVLTIALGFLIMAHIPDTPTKAWFLTEEEKHL
FT                   VVQRIRSNQQGFGNKHFKKDQFIEAITDIQTWLFAIFTISNNIPNGAVTNFSSILISGM
FT                   GYSTSESLLMQMPQGTCMTCGCIGIACGTLLYPYRFFWAAVGISISLIGSCMLSFAGPY
FT                   KAQYAGLCLWNVAPVGFICMLSIIASNSAGHTKKVTVNAITLIAYCVGNLIGPQTFIEA
FT                   QAPEYAGGKIAIVVCIAISLATLFCIWFVFWARNKKLDANLNTKVENLEFADLTDKQNP
FT                   NFRYAL"
FT   gene            <636673..>638256
FT                   /pseudo
FT                   /locus_tag="DEHA2A07755g"
FT                   /old_locus_tag="DEHA-IPF6883"
FT                   /old_locus_tag="DEHA-CDS5154.1"
FT                   /old_locus_tag="DEHA0A07920g"
FT                   /old_locus_tag="DEHA-IPF6884"
FT                   /old_locus_tag="DEHA-CDS4893.1"
FT                   /old_locus_tag="DEHA0A07942g"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease stop in frame"
FT   gene            <639390..>641903
FT                   /locus_tag="DEHA2A07766g"
FT                   /old_locus_tag="DEHA0A07964g"
FT                   /old_locus_tag="DEHA-IPF6890"
FT                   /old_locus_tag="DEHA-CDS0736.1"
FT   CDS_pept        639390..641903
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07766g"
FT                   /old_locus_tag="DEHA0A07964g"
FT                   /old_locus_tag="DEHA-IPF6890"
FT                   /old_locus_tag="DEHA-CDS0736.1"
FT                   /product="DEHA2A07766p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84624"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYQ1"
FT                   /protein_id="CAG84624.2"
FT                   /translation="MGMGSTTIDLSVDYDTQCGESLYKLWKITNNQIRCPKISSTERLS
FT                   NRSWRMLNQKVLLNNEANSDVMKDLYVDSLSDLKPKSSQFLSSRPSLFSNTSKSTLFSH
FT                   SSKNSSVGEKNEIEEIENGSEDVSDISDISDILEEDDYASSDSDEQDKKVNESNIQKIN
FT                   TYDQPEPNFAFGYFPPQLDIQNKEAEIKPPLNRSKTSFVRGFSPNHISVASSCSKSKES
FT                   LSLSAKKDINADGVDENMCRTNRNIFYIANSPSPPENNDTNRNSINSNRNGSHKPVNES
FT                   SPLLSKTGGSFDNVSPSKIKRQDSLFNNLQEQNNQVNSNDDDYLSTDISEEDDDDSSDE
FT                   DQSDVENDAKNTICESTSNNNPFSDDFDDQPGNMNESPDTAAKKKSQTHDSDMIIKDHG
FT                   KSNDNDSEWLSISSEDEKNYEPIPHEKLVFDKRLNPMSNNSSMSTDIIPIQDNEKRGSS
FT                   PPISKPRSLLSSLFLNEMASSSSTSSFSTTNAKPLLKRSSTTGIITIDQTNHGSNKGNS
FT                   NKKSNKINRPSILFSRKHTSLTDISKNYPHYQNDLVQKHILNDYTNDQDNEDNEDDFSG
FT                   KQKSIVGVSDFNVTTKATDISNTNSINNDNSNTKVNDNEHNDNITLASSLNKYSDSLSN
FT                   NSIKSLLSRSSLNLSQLFNSKNKSKKDLNVSTEKQESLKPTSRNPGSSQGSDCSKSLSP
FT                   SLLPMSPNSRTASTQKQKLDPYFKDRAGVNSNSNFNSTTSAVTNPDPNLKVDPHPIAKS
FT                   ESNLTTNSEDNINVNNPRSIKLSPKSTRRSMLSTELSKSLKESILIDYKLGKIPLPLKV
FT                   INDGDFVNKNSDTSECLDDYHLRGW"
FT   gene            <642043..>643845
FT                   /locus_tag="DEHA2A07788g"
FT                   /old_locus_tag="IPF_6892"
FT   CDS_pept        642043..643845
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07788g"
FT                   /old_locus_tag="IPF_6892"
FT                   /product="DEHA2A07788p"
FT                   /note="similar to uniprot|P53863 Saccharomyces cerevisiae
FT                   YNL227C JJJ1 Protein with a DnaJ-like domain that may
FT                   function as a cochaperone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65381"
FT                   /db_xref="GOA:B5RSS5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS5"
FT                   /protein_id="CAR65381.1"
FT                   /translation="MKTCYYELLQVESTATDLELKKAYRKKALQLHPDKNPDDIEGATA
FT                   RFALVRAAYEVLSDPQERSWYDSHKSQILRDEDTFEVDENELVIPSISVEEILRYFNPS
FT                   FYTTIDDSQVGFYNVVSRLFERIAAEEISHAKHQGLAKYEKYHDDASNVNVIDESMLLY
FT                   PKFGNSKSDYISHVRPFYNTWLSFQSVKAFNWKDEYRYSMAPDRRTRRLMERENKKARD
FT                   AARKEYNETVRSLVAFIKKRDMRVKQGISEYEKQKKKKQQEELEDQIKNNRQDELRKLA
FT                   TQNKFEIQDWQQLSVEELHELEQMLDEEYNSSSDSEFDEYEQTGDENFFECFVCNKYFK
FT                   SEKQFETHEQSNKHKKVVSKLKWEMQKEGIELGIDKDDVDLDEFETASSGLDSEDDDID
FT                   TEDDNLSEVSDSPNDNLGQDNRVNSPQVIEHADNTIESIEFEVDDEINSDFEDGAEPII
FT                   VPQASLRKSKNKNKNKKSTPAYSDDENDDLQRELSKLTSNLNGVALDDDSDWSTNPKGK
FT                   KNKKKRNPTADSETASPQPQAALPKKKKYTESDDLPTHVPKGSDICVVCKELFTSRNKL
FT                   FQHVKTTGHAAPLPQAKKGKKKKN"
FT   gene            complement(<643884..>646310)
FT                   /locus_tag="DEHA2A07810g"
FT                   /old_locus_tag="DEHA0A08008g"
FT                   /old_locus_tag="DEHA-IPF6893"
FT                   /old_locus_tag="DEHA-CDS0806.1"
FT   CDS_pept        complement(643884..646310)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07810g"
FT                   /old_locus_tag="DEHA0A08008g"
FT                   /old_locus_tag="DEHA-IPF6893"
FT                   /old_locus_tag="DEHA-CDS0806.1"
FT                   /product="DEHA2A07810p"
FT                   /note="similar to CA1960|IPF15232 Candida albicans
FT                   IPF15232"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84626"
FT                   /db_xref="GOA:Q6BYP9"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR034082"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYP9"
FT                   /protein_id="CAG84626.2"
FT                   /translation="MPKRGGRKSHPKKDKGGGGGGSNFGRFKTNKNKKKTGMGSSKNHG
FT                   TPRSTNIDIPELMDLDDNVYIPEIDTKVSQSSMKNLSRRPGRRHLYEEVGYTDKHIEDT
FT                   LRQPLRNRPIEFVKAKQVYDPSADLFKKLGKSGIPKVHQDLLDSMNSPPSQEAHVPESP
FT                   ILDILSEESEDDAIDEVVAHLASSNTSLDSDLVGRGEISKTNDEGESDDVEEEIEEEVE
FT                   DENESEHNEHRGIESQTESEQDEQDEQDEQDEAEEVEEEEEEAFIIDDTGDAEILKDHN
FT                   PVKPQTSLLIQSKLPKSSTQNDIDNIGGGLDYDPVLNIGKVSLQTKRDENGQSTTELMS
FT                   VNQLNKISTKGFIDEKKMLPNMEKNVSDISDDDFGGYKDYIAQVMRDGKLEVDSDEYES
FT                   ETNFDIMASSSDNDDDDEDNDEGEKDPSEIEYGFLPEDYEFDVSQVSISNVRFGINNQL
FT                   YTKCAELTGSDDQFLWIDEDDLVDYVLSKGVREHRLNSFMKFITKGLIDEEAIEVPNYS
FT                   DVYISETSEDEEEGANSEDENLAAMIAFTKSQQQSFMDLDIPSTERLKTKGKGKKKQLD
FT                   LDRMQLDIDMRESLQDQYQVHRQAKRSKKQRREDARYEGGIAKHDLLVKYPYSLHIKDI
FT                   CYEFETFLHDTSRDSMNFPPLDPHGNKTVIKISNFYNMKSLKCGTGLKSFVKVSKNRKT
FT                   FHYLPRYDQIGNVSRQRPIFNRIDQKRPKDEITRSDGNSKKDRSRGRNKSESSAQSREG
FT                   DIVGASAPEIGTNNIGRKLLEKLGWSKGEGLGAHGNKGISEPVVAKIKKSKTGLK"
FT   gene            <646494..>647972
FT                   /locus_tag="DEHA2A07832g"
FT                   /old_locus_tag="DEHA0A08030g"
FT                   /old_locus_tag="DEHA-IPF6894"
FT                   /old_locus_tag="DEHA-CDS2399.1"
FT   CDS_pept        646494..647972
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07832g"
FT                   /old_locus_tag="DEHA0A08030g"
FT                   /old_locus_tag="DEHA-IPF6894"
FT                   /old_locus_tag="DEHA-CDS2399.1"
FT                   /product="DEHA2A07832p"
FT                   /note="weakly similar to uniprot|P53867 Saccharomyces
FT                   cerevisiae YNL223W ATG4 Cysteine protease required for
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84627"
FT                   /db_xref="GOA:Q6BYP8"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYP8"
FT                   /protein_id="CAG84627.2"
FT                   /translation="MSNRDSSEHGDSSNKIASNECNEATKLGFNFTQLWSQITTTYSLI
FT                   DRNDSNMFNRDERVESEQEKKSVVILGKKYDDISVDDGVIEQDIYSKIWLTYRTGFEPI
FT                   AKCLDGPQPLSFVQSMVFNRNPISSTFNNFHGLLDNDNFTTDVGWGCMIRTSQALLANT
FT                   YQLLFLGRGFSYGRDRSPRHDEIIDMFMDEPRAPFSLHNFIKVASESPLKVKPGQWFGP
FT                   NAASLSIKRLCDNVYESNGTGRVKVVISESSNLYDDIITQMFTTLNPVPDAILVLLPVR
FT                   LGIDKVNPLYHASVLELLALRQSVGIAGGKPSSSFYFFGYKGNDLLYLDPHYPQFVRNK
FT                   TSVYDTYHTNSYQKLSVDDMDPSMMIGILIKDINDYEDFKSSCTKSSNKILHFHPTSEK
FT                   ADRRGSLSEFKRKNSEFVCIESKDVQRREDFITIDNVSRDDLNNMEGFIDMADEFDSEI
FT                   DQNNKDDNFDDDEPVNVSQTSIGEEYTSTAGSRP"
FT   gene            <648333..>649004
FT                   /locus_tag="DEHA2A07854g"
FT                   /old_locus_tag="DEHA0A08052g"
FT                   /old_locus_tag="DEHA-IPF6895"
FT                   /old_locus_tag="DEHA-CDS5123.1"
FT   CDS_pept        648333..649004
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07854g"
FT                   /old_locus_tag="DEHA0A08052g"
FT                   /old_locus_tag="DEHA-IPF6895"
FT                   /old_locus_tag="DEHA-CDS5123.1"
FT                   /product="DEHA2A07854p"
FT                   /note="similar to uniprot|P53538 Saccharomyces cerevisiae
FT                   YNL222W SSU72 Transcription/RNA-processing factor that
FT                   associates with TFIIB and cleavage/polyadenylation factor
FT                   Pta1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84628"
FT                   /db_xref="GOA:Q6BYP7"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYP7"
FT                   /protein_id="CAG84628.2"
FT                   /translation="MVSDSLKICTVCAANNNRSMESHKQLKDAGYNVRSFGTGSAVRLP
FT                   GPSVDKPNVYEFGTPYDDIYRDLTSQEYHKMYESNGLIRMINRNRHIKRAPEKWHNNAS
FT                   AGKFDLVITCEERCFDLVLDDLMVRLVNKDQADTEIKQAVHIINIDIKDDYENAVIGGK
FT                   GILKLVNMIHEFRNTNKQRRLDHDFDDESDTILEDQMMKLLAKWQQEHTHLPTLYSVAY
FT                   Y"
FT   gene            <649155..>651461
FT                   /locus_tag="DEHA2A07876g"
FT                   /old_locus_tag="DEHA0A08074g"
FT                   /old_locus_tag="DEHA-IPF6897"
FT                   /old_locus_tag="DEHA-CDS0850.1"
FT   CDS_pept        649155..651461
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07876g"
FT                   /old_locus_tag="DEHA0A08074g"
FT                   /old_locus_tag="DEHA-IPF6897"
FT                   /old_locus_tag="DEHA-CDS0850.1"
FT                   /product="DEHA2A07876p"
FT                   /note="similar to uniprot|P41812 Saccharomyces cerevisiae
FT                   YNL221C POP1 Subunit of both RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84629"
FT                   /db_xref="GOA:Q6BYP6"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="InterPro:IPR039182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYP6"
FT                   /protein_id="CAG84629.2"
FT                   /translation="MPPKPNISNKKAKLYNSRSIRAELTDPSFNEGKLSVPDFLSSRNF
FT                   EIKSFELSQLNSKYASSTRCFQSLPRKLRRRTASHNVKRIPKRLRNRALREMQNSINGL
FT                   PPKKKHLRGRELYRLKMSKRLLKLASRIKSLRSIPSEDIQNKPLKLRQKLKILDEQIKS
FT                   LCKNTAKPTLNNKMGSYDNTGINAFASKPRGNLKYAKRQNNFVWIPTHVWHAKRFHMIK
FT                   KWGYQIPLEPTQKCFKSTNRASRNETIIYDTSYYDCLIVETVNSAEANTFLNIITKLKG
FT                   DIPKKILSGHKCYDDWLFKDGKRIGMGLVFSVEDLNKILIRVHPSLYDEFFEYVKSLLK
FT                   VSETGNNVFDCRYSLGSIELNGPKSVNSLSKVLHLNSSDPITKNWFELAKLNDPNSVPN
FT                   GTTFSFNIKDPRFFKSPTNVPYNTDVVNFNDLIVRLSQERTIDIDTLDVLLDNGKRNNT
FT                   YCDQLSTKEISREFQKDKVVQKMHEFPVLITKLKSSNNWTLICPWYWTLPIWLKLNQIH
FT                   HISTGGIKQLHQINFEHCRASYPIDFQFLKEGYLENKFKSTIAEAQYAKKPKSKRPKYE
FT                   ISEGIISPFGCDWDFLQKMIFASSLSNNSTLCTKNQFGNFDENLIRKVESVNDVIALVK
FT                   QCQSNDQIPIELYDKHNPQHIKFINKSSFEHMDEFPKVPVLQINLQIQGRGSIQDNSRI
FT                   YRIPSETRNQYLRGTFDHCPPPTDLIGFVTSGSYNLNLGFASGIGCIVASHKDELVLVR
FT                   NVGSSLTRLAKWSII"
FT   gene            <651586..>651722
FT                   /gene="SNR19"
FT                   /locus_tag="DEHA2A07898r"
FT                   /old_locus_tag="DEHA0A08088r"
FT   ncRNA           651586..651722
FT                   /gene="SNR19"
FT                   /locus_tag="DEHA2A07898r"
FT                   /old_locus_tag="DEHA0A08088r"
FT                   /product="U1 RNA"
FT                   /note="SNR19 (U1 RNA)"
FT                   /ncRNA_class="snRNA"
FT   gene            <653106..>653429
FT                   /locus_tag="DEHA2A07920g"
FT                   /old_locus_tag="DEHA0A08096g"
FT                   /old_locus_tag="DEHA-IPF6898"
FT                   /old_locus_tag="DEHA-CDS7108.1"
FT   CDS_pept        653106..653429
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07920g"
FT                   /old_locus_tag="DEHA0A08096g"
FT                   /old_locus_tag="DEHA-IPF6898"
FT                   /old_locus_tag="DEHA-CDS7108.1"
FT                   /product="DEHA2A07920p"
FT                   /note="similar to CA2885|IPF7204 Candida albicans IPF7204"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84630"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYP5"
FT                   /protein_id="CAG84630.1"
FT                   /translation="MQFSKVLIPAALAAYVSASNVTVTTDVVVTDYTTYCPEPTSVVVN
FT                   NKTITVSEATTLTITGPCTIPTTYTTSNAETSAPSVTSVENGAGKAVVGAAAGVAAIAA
FT                   ALF"
FT   gene            complement(<653958..>656588)
FT                   /locus_tag="DEHA2A07942g"
FT                   /old_locus_tag="DEHA0A08118g"
FT                   /old_locus_tag="DEHA-IPF6900"
FT                   /old_locus_tag="DEHA-CDS0720.1"
FT   CDS_pept        complement(653958..656588)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07942g"
FT                   /old_locus_tag="DEHA0A08118g"
FT                   /old_locus_tag="DEHA-IPF6900"
FT                   /old_locus_tag="DEHA-CDS0720.1"
FT                   /product="DEHA2A07942p"
FT                   /note="similar to uniprot|Q01477 Saccharomyces cerevisiae
FT                   YER151C UBP3 Ubiquitin-specific protease that interacts
FT                   with Bre5p to co-regulate anterograde and retrograde
FT                   transport between endoplasmic reticulum and Golgi
FT                   compartments"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84631"
FT                   /db_xref="GOA:Q6BYP4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYP4"
FT                   /protein_id="CAG84631.2"
FT                   /translation="MSTSSNTSNSGPNRFRSDAASFSPSVPSPGVMNQQMQQQQHIYPQ
FT                   YMYGTPQMVPNQYYPYMTPYMMHPNAPYSDFNPYTQAYGGYPMQMPQYPGQPYPGMPNM
FT                   SGGGNMNMNAMMNNRPKMNHNNKSKPYISNSNRSRSSSTVSSNVPNQYQHHQQTPPVSH
FT                   PHPHPHPQDQWKHENKPENPADEKAQTDQRKSDTSSSTDTNHETSKQVKKHVTLESTTK
FT                   KGQEKTPSTSSNKPMSYPLYFNETAQDFIKSQQSIASERNQLVKQKNERLNEFIRSENN
FT                   EKQSLVINRNSNITIIDYNTNTTHKTIENNNYNTHRPNDNDDNNSNKFNDNSNEVDLEG
FT                   EDSTDINKDNKSANWASFLQTTATVPAKKSKSQPKPSTGPSQISASSSTTGISPSTNNT
FT                   QVNNILALDSSQPLGILMLKIMFDNNYSVMNSYNNCPIFRVKPRGLTNTGNICYMNAIL
FT                   QVLLYCEPFNKTLKLVESKSIGSLSQKSTTPLLDIVIKFWKEFSQPSSMKPISPDNFYM
FT                   SLITHEKFSHLKWGQQEDAEEFLGYFLDGLHEEFVGSIKGLNTPQTDLLIQQFQQQNED
FT                   IDQLKLNAFKLNIKNTMKIIKKSKSENQDTTHQEEVSDHESNGWSEVGSNNKKISAKRT
FT                   VEIEPSPITTIFGGQFRSVLQIPKNKESQSITLDPFQCIQLDISDSSITTVEDAFKQLN
FT                   EPENIPYKSSSNKEVIAKKQTFIDQLPNILIIHLKRFSYQQEKEKESTPSNEQSSNTSS
FT                   NGSRPLGSIEKLRKKIEYSHHLTIPNEVLSPLYKHSGNISNHYKLFGVVYHHGVSAEGG
FT                   HYTSDVLRKSSVFDNEEESNDKKVDNQWIRIDDTQITELEKDEVLNGGDEETTKNAYIL
FT                   FYQKT"
FT   gene            complement(<656986..>658131)
FT                   /locus_tag="DEHA2A07964g"
FT                   /old_locus_tag="DEHA0A08140g"
FT                   /old_locus_tag="DEHA-IPF6902"
FT                   /old_locus_tag="DEHA-CDS3281.1"
FT   CDS_pept        complement(656986..658131)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07964g"
FT                   /old_locus_tag="DEHA0A08140g"
FT                   /old_locus_tag="DEHA-IPF6902"
FT                   /old_locus_tag="DEHA-CDS3281.1"
FT                   /product="DEHA2A07964p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84632"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYP3"
FT                   /protein_id="CAG84632.2"
FT                   /translation="MQGSDENSFNDDDDFLLQENSAILSILPSLIQDLFHWESHLEILL
FT                   KFLQNQIEASEVLEESQTIQLQAIYSQIQEISEKGMVENCHQKDVLVIDENKSILLAFT
FT                   FGRAFADALSILSDPRNINIVVYCEEGTDENLVNELGANYLQGKFESTGSNACLPISVK
FT                   VTQVKQIRESSKGRVSKKRMAEIGQRLAHLNLEKMLHNAGLTINDAGELTTIPKSTSIL
FT                   NIPTNTSKPTTMFSANSVERTRLQKELDAAVATKRESYVVDLKSWYCSCDEFQASYVPQ
FT                   TTPDTSDNDSDTHCPISPYDTLSTPAGLYMMDTDDLIAKCHDNPITRYFRSLSPHNQTR
FT                   HLSKLPICCHLIALSIAATNSPHTHRYFTILSSDNVWSMLT"
FT   gene            <658274..>659722
FT                   /locus_tag="DEHA2A07986g"
FT                   /old_locus_tag="DEHA0A08162g"
FT                   /old_locus_tag="DEHA-IPF6903"
FT                   /old_locus_tag="DEHA-CDS2461.1"
FT   CDS_pept        658274..659722
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A07986g"
FT                   /old_locus_tag="DEHA0A08162g"
FT                   /old_locus_tag="DEHA-IPF6903"
FT                   /old_locus_tag="DEHA-CDS2461.1"
FT                   /product="DEHA2A07986p"
FT                   /note="weakly similar to uniprot|P40161 Saccharomyces
FT                   cerevisiae YNL206C RTT106 Regulator of Ty1 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84633"
FT                   /db_xref="GOA:Q6BYP2"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR040770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYP2"
FT                   /protein_id="CAG84633.2"
FT                   /translation="MSNDQKWIKSLPSDLQNQVNALVEAHPPSLTVIHKLCEYFKTNAS
FT                   EHEDKRRKLSSDPEIKSEGHVPEALSGPKSEVPGQIHEQEIIFELPQISFQSPIRKKLN
FT                   LIFHLLVEPGQSPKPVMSLALPTTYVPEISIHNLASSIRLCVLLPILGNSTNNTKRNIG
FT                   LLCFWIHDDAASDPNKNDPIICQVNFDQVKKQLIKAGKIPAEAETQLKEMNESNQSQDG
FT                   IKAINEAIINFLQKQFQLCGIHMINYLPSSSATKNKLTINTDAGVAVSSNANSVNDLVM
FT                   VEAYKGARDGAVLMLTANEYNQPYIIFGFKKPILIFDISKVQHVSYSNITRLTYSMIVT
FT                   VVNEKKDSKVETLEFGMIDQKYFQIMDEFIKSQGINDNSFDEDLREKVTTNANSGEGEQ
FT                   ASEQAAPADSDDEEEDGTFQVGQEEEGESSVDEEYDSNAGSDGDSDVGEEEDDTNENNE
FT                   GANPAASTEADDVVTQSKEEDDEQ"
FT   gene            complement(<659942..>660286)
FT                   /locus_tag="DEHA2A08008g"
FT                   /old_locus_tag="IPF_6907"
FT   CDS_pept        complement(659942..660286)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08008g"
FT                   /old_locus_tag="IPF_6907"
FT                   /product="DEHA2A08008p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65382"
FT                   /db_xref="GOA:B5RSS6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS6"
FT                   /protein_id="CAR65382.1"
FT                   /translation="MVVASPAGLLVSGFLGLITRRMQVSIIGKEYPRSFNRVPGYLYSV
FT                   GAFVGGYLIFSNIVENNRELLDRRLSILREQRALKDAFHEFKEEPDHRFIAEKRGRFFK
FT                   LMDKFSTTDK"
FT   gene            <660705..>662027
FT                   /locus_tag="DEHA2A08030g"
FT                   /old_locus_tag="IPF_6908"
FT   CDS_pept        660705..662027
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08030g"
FT                   /old_locus_tag="IPF_6908"
FT                   /product="DEHA2A08030p"
FT                   /note="similar to uniprot|P10356 Saccharomyces cerevisiae
FT                   YER152C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65383"
FT                   /db_xref="GOA:B5RSS7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS7"
FT                   /protein_id="CAR65383.1"
FT                   /translation="MSKSTQPLINFFKGHPTNSLLPSKEIANSYKNVLLEYDYTKYDND
FT                   PLNRHALTYGADAGNLDTRKAISKWNDKYFGRNGTDPDCINLTGGASYGFANILASMTD
FT                   TKDITRRGFIVSPTYYLITPSFIDAGFEDKLTAVVETPGQEYEIDLKFLEEQLEFYDRG
FT                   LPPVGNKEINIISDPSGRPDRKLYRYVIYIVPTYSNPGGLVYSAKTRTKLIELARKHDM
FT                   LIVSDDVYELLNYTDADTPIPRFCYLDRDSLPEDFKFGNSISNATVSKLLAPGLRFGWQ
FT                   ETPTPNLVQQLAITGANLSGGTPGQLASIVVQDLITSGQADIIIAGLIKVYKSRAQTMI
FT                   RSIKKYLPACTNVYGGEGGYFLWVTINADIDHTKIVDMLKEEHNIILASGNNFEVCGDE
FT                   KGWGKNSVRLSVSFLNEHEIEKGIRKWGDVLRRKHIEVFKN"
FT   gene            <662497..>663663
FT                   /locus_tag="DEHA2A08052g"
FT                   /old_locus_tag="DEHA0A08228g"
FT                   /old_locus_tag="DEHA-IPF6910"
FT                   /old_locus_tag="DEHA-CDS3260.1"
FT   CDS_pept        662497..663663
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08052g"
FT                   /old_locus_tag="DEHA0A08228g"
FT                   /old_locus_tag="DEHA-IPF6910"
FT                   /old_locus_tag="DEHA-CDS3260.1"
FT                   /product="DEHA2A08052p"
FT                   /note="similar to CA0676|IPF13097 Candida albicans
FT                   IPF13097"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84636"
FT                   /db_xref="GOA:Q6BYN9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN9"
FT                   /protein_id="CAG84636.2"
FT                   /translation="MHFYFPDWVIKYKEHQISALSLYSYILDWSIYILILVIFMVYGTL
FT                   LAPRYHEFSLSDSTLMYSYRSEKETVIPLYMLIIIAVVIPIIQFVFCSIYNRHTLSGAR
FT                   RAWDIFSGLMALSGSMATQLMITCILKNICGLPRPDLISRCQPTQTEMLIYGQLATVEI
FT                   CETFSRDSVGPSLHILQEGFRSFPSGHSSTVFCGMVITSLNFAGKLQIFDKRGISFKVL
FT                   LAICPIMVACFVSCTRISDNRHFLRDVIGGSVIGTHVAIWFYLQYFPSIFNLENCGRAY
FT                   PPRRIGVANFFNNVGGFWKIRDVLPGAYVERVLNNPGIIPQLSSELQPGESISAMEIVD
FT                   LSTNISFFNKLTSLLPDKYINLNNTDPILPVWTSRSADNDPPIIPKST"
FT   gene            complement(<663739..>664773)
FT                   /locus_tag="DEHA2A08074g"
FT                   /old_locus_tag="DEHA0A08250g"
FT                   /old_locus_tag="DEHA-IPF6913"
FT                   /old_locus_tag="DEHA-CDS3745.1"
FT   CDS_pept        complement(663739..664773)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08074g"
FT                   /old_locus_tag="DEHA0A08250g"
FT                   /old_locus_tag="DEHA-IPF6913"
FT                   /old_locus_tag="DEHA-CDS3745.1"
FT                   /product="DEHA2A08074p"
FT                   /note="similar to uniprot|Q9P827 Candida albicans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84637"
FT                   /db_xref="GOA:Q6BYN8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN8"
FT                   /protein_id="CAG84637.2"
FT                   /translation="MSSNEVISIPTTSVSKDNVVYYNVNIKMPLRSSSVSRRYSEFTRL
FT                   VDQLCYEIGINNKDFPYKLPSKASIWSMTNKNAVVSERQIELTSFLNQLLKDKDLQNHP
FT                   LVHDFLQLPASFKVTSSMFERKGKDASITELIIPDAQAIDSHKWLEYSRLFKYHINDLR
FT                   DSYNTAGNISMKVDIRDKINKIIKPNLAQLSGSLTNLLNNQMIDKREYNKRQVLLESLK
FT                   TDLDELFGELDALNSKNSNKQTLFSNSRRVLGGANTADNAKETNETLPLDNQELLQSQL
FT                   QIHSQQDQDVAQLRKLIQRQKEIGQTINTEVEEQNELLDQFNEDVDKTTDRLQVARKKA
FT                   RNIL"
FT   gene            <665114..>666823
FT                   /locus_tag="DEHA2A08096g"
FT                   /old_locus_tag="DEHA0A08272g"
FT                   /old_locus_tag="DEHA-IPF6916"
FT                   /old_locus_tag="DEHA-CDS1822.1"
FT   CDS_pept        665114..666823
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08096g"
FT                   /old_locus_tag="DEHA0A08272g"
FT                   /old_locus_tag="DEHA-IPF6916"
FT                   /old_locus_tag="DEHA-CDS1822.1"
FT                   /product="DEHA2A08096p"
FT                   /note="similar to CA0678|IPF13094 Candida albicans
FT                   IPF13094"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84638"
FT                   /db_xref="GOA:Q6BYN7"
FT                   /db_xref="InterPro:IPR019431"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN7"
FT                   /protein_id="CAG84638.2"
FT                   /translation="MSSEYQSIPQEEGSSSSNAISNEVNRSSMNDRHSSTESIISTDAE
FT                   RQPLVDRESGNHRYLSPDDPLVSPINLYKIRVLRVSLLTIFAINCVLFFAFLLSDFIAI
FT                   PGLNNRGKSFLELDLVILNILTNLVTLWCFVVPAYYERVLGYISASLLLIDFIIMFSIP
FT                   RMRDQFGVIGTFVLLWTLANVVLNCFADFWVEKGKLYLERKYTGREETRKSISELFVIA
FT                   VKVLFKLFLLWLIWCISLSLWLQAFDSHEKPWGKMIPVDNDQFKVHLACYGDVHAPPGD
FT                   INATDNKEKQPIVLIEGGQLDSSEVVQEWVEELYHLGKIDRYCIWDRPGYGFSDSAPSP
FT                   LSIGIVSEYLIEALRKERLEGPFSLVGFDIGGLYARMFASRSSGNIHSLLLVDSWHEDL
FT                   LKIRPFSGSNMKNENKRVFKNILELMDTKTGLKLWLKGLVSPLGIVSNINWFFHPKRHS
FT                   SNSRIFGSDMYYSSKYIRARLQEQVTASILSYNEMAGTDLHDIPVSVISSDFMIKNSLN
FT                   WGKWQRSLTKLSDQTIEWVVAENSNHLIWRSPKGKAQLQQLLLRLVSEKSNY"
FT   gene            <667210..>668739
FT                   /locus_tag="DEHA2A08118g"
FT                   /old_locus_tag="DEHA0A08294g"
FT                   /old_locus_tag="DEHA-IPF6918"
FT                   /old_locus_tag="DEHA-CDS2269.1"
FT   CDS_pept        667210..668739
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08118g"
FT                   /old_locus_tag="DEHA0A08294g"
FT                   /old_locus_tag="DEHA-IPF6918"
FT                   /old_locus_tag="DEHA-CDS2269.1"
FT                   /product="DEHA2A08118p"
FT                   /note="similar to uniprot|P53924 Saccharomyces cerevisiae
FT                   YNL116W DMA2 Protein involved in regulating spindle
FT                   position and orientation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84639"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN6"
FT                   /protein_id="CAG84639.2"
FT                   /translation="MIGESTSGDVNPVLTRNMSTNKSTPVSSPSLSFRSSPPENNNEGS
FT                   QVQGGNLTNGEVASSTNPPGVSVDRNSRTSTPNENANATSGTYIPTDGPSSNISSANGP
FT                   GQFENIGPTNGSSTNIISKTSSNATNNPPAPTRRSSFGLGFLSSLTNSIRSQHNTSSAS
FT                   ETPHNFMSNSPTIANLNNYSMSLSEPIEPVISEDAMPPPNDTNASESSNSDFDHNAELN
FT                   NLSNLNDEAIDGDRTRVAVNNPSEDQLVEGSNKGVENGIDKDGYFSVRLTPLIDYSSSA
FT                   SGLYFSPIIRKVKPTNSITIGRYTEKNKSAAHAPQGSSAPIVFKSKVVSRTHALFQCNE
FT                   DGQWFLKDCKSSSGTFLNHIRLSPASQASTLMPLIDGDIVQLGMDYRGGTEEVYRCVKM
FT                   RCEFNKSWQRKVNQFNLEIHQKLKNMAIGSNDNDIAMNPINKALVSENLSECAICLLEL
FT                   EPCQALFISPCSHSWHYKCIRPIIIKSYPQFYCPNCRSMCDLETDIEDEGE"
FT   gene            <670000..>671739
FT                   /locus_tag="DEHA2A08140g"
FT                   /old_locus_tag="DEHA0A08316g"
FT                   /old_locus_tag="DEHA-IPF6921"
FT                   /old_locus_tag="DEHA-CDS1751.1"
FT   CDS_pept        670000..671739
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08140g"
FT                   /old_locus_tag="DEHA0A08316g"
FT                   /old_locus_tag="DEHA-IPF6921"
FT                   /old_locus_tag="DEHA-CDS1751.1"
FT                   /product="DEHA2A08140p"
FT                   /note="similar to uniprot|P47186 Saccharomyces cerevisiae
FT                   YJR160C MPH3 Alpha-glucoside permease and similar to
FT                   uniprot|P47186 Saccharomyces cerevisiae YDL247W MPH2 Alpha-
FT                   glucoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84640"
FT                   /db_xref="GOA:Q6BYN5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN5"
FT                   /protein_id="CAG84640.2"
FT                   /translation="MSAQHVEDIDKPGVVIEVNPLNKNMTDDSMAHEAQDFMDKFLDMS
FT                   ENAKDNDRKEKYMPLKEGLKTFPKAAMWSVILSTALIMEGYDTNLLNSLYAFPDFAKKF
FT                   GEYSESDGSYQIPAKWQTSLSMCVNVGEIIGLFIAGIIADRIGYRKTLIGALMLTTGFI
FT                   FIVFFAVNVEMLLAGELLLGLPWGAFQTLTVSYASEVCPTTLRVYLTTYVNVCWVFGQL
FT                   ISSGILRGLVSSDIEDVYRIPFAVQWVWPIPIAIGIYLAPESPWWLARKNRIQEAKHSI
FT                   KRLLTVNEHLPDKEILAEAMVQKIQMTLKEEALTNNGESFLDCFKGQDLRRTRIAAIVW
FT                   VSQNLTGSSLMGYSTYFYQQAGLGQNMSFTFSIIQYCFGIVGTLGSWLLSQKAGRFTIY
FT                   FYGLCSLFCILFVVGCLGINPTESSSWGVGSLLLVYTFVYDLTIGPLCYCIVAEIPSTK
FT                   LRTKTIIIARNAYNIAGIVVAIITPYMLNPTAWNWKAKTGFFWSGFAFFAAIWCWFDLP
FT                   ETKGKTFAELDQLFENKVKARQFKKTEVEVFNTDELIERLGEDGIKDLVVTDASKDEFS
FT                   EKV"
FT   gene            complement(<671913..>673868)
FT                   /locus_tag="DEHA2A08162g"
FT                   /old_locus_tag="DEHA0A08338g"
FT                   /old_locus_tag="DEHA-IPF6922"
FT                   /old_locus_tag="DEHA-CDS1351.1"
FT   CDS_pept        complement(671913..673868)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08162g"
FT                   /old_locus_tag="DEHA0A08338g"
FT                   /old_locus_tag="DEHA-IPF6922"
FT                   /old_locus_tag="DEHA-CDS1351.1"
FT                   /product="DEHA2A08162p"
FT                   /note="weakly similar to CA5555|CaSUC1 Candida albicans
FT                   SUC1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84641"
FT                   /db_xref="GOA:Q6BYN4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN4"
FT                   /protein_id="CAG84641.2"
FT                   /translation="MISPKHNYIEEDLGALDFNGILLRPCDGCALRKVRCNRQKPCSQC
FT                   IKHNVSCTSKRIKKKCGPKQIHKKTKETIQRLNLENGVEPGLQATATKTSDTKIFTVDK
FT                   LLPYLQIYQTWYYGAWPVLSVAHMVAKMVQDEGKDQSEMNTEIDAAYVLACSVCADIAT
FT                   QLTFLSDTLHVRDLPTGVEAKDFADEALRIRSRINYRLNPNIDTLLSSFFLYDYYVNVK
FT                   DYKSVAITYLRETLTFAQILGLHNPKTYFNQTPATVHRMKKIYYMLMITERFLCIEENI
FT                   PVLLTPSIPFPALEDEEYPEILSGFTELVRIFSIPDKSFFDKLAEESSNSSNLKLFQKS
FT                   LFQLSNPPTQNWIVNVQNNLQNVSISPLIPDTQKLNIILSQHWMRALGWHIANQNELLI
FT                   RDSDENHCLNPQFPLRIAKDFLKSTENLSSFAFESNGSGVCVKLLEIANALADSVSDST
FT                   VYKYDAYNSYDALGAIFQLVGKFKRDILLPVDLYNKIDTIISDKTIAKFPAAYITEVDD
FT                   EASSRIASSNSSNENNSSDNVSEIVNDLPQTNNATNKLFSPYTQMTMGIGLSPGTILPT
FT                   LSSSNLAALQLQYHQQPNNIPFYDQHQEHKQQETHHYELPLLDLDRNVMSGSNVYVKDP
FT                   KIRFDSGIDFDDLYNL"
FT   repeat_region   complement(674819..675201)
FT                   /locus_tag="DEHA2A08184t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh2
FT                   retrotransposon"
FT   gene            <675428..>676258
FT                   /locus_tag="DEHA2A08206g"
FT                   /old_locus_tag="DEHA0A08382g"
FT                   /old_locus_tag="DEHA-IPF6923"
FT                   /old_locus_tag="DEHA-CDS4505.1"
FT   CDS_pept        675428..676258
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08206g"
FT                   /old_locus_tag="DEHA0A08382g"
FT                   /old_locus_tag="DEHA-IPF6923"
FT                   /old_locus_tag="DEHA-CDS4505.1"
FT                   /product="DEHA2A08206p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN3"
FT                   /protein_id="CAG84642.1"
FT                   /translation="MDDLLNQKNQDIVLLAPGNSVNLEVPTINIDTNQENNGINESNVE
FT                   EANVYLSRLKLNNAPGEEQRQGEIYLTKLKQQAAENKIGTNLHHQRLRDSTIEVRENVD
FT                   HINQYLFLDENGQPQDADNTTFDFGNPALNQMYSLIRRDLNALTNRMDRKFSGVDRKFR
FT                   GMDRKFSEMKRLIMSQENRSQNKLLASGGDTDSPNAYLPICNDRGQHPTDCGLEPLTSL
FT                   DQINRMNGILTDQYLSFYHLGTTRLVSEKKARLMEYIGIHERIVVNSVRGAPPV"
FT   gene            <677709..>678539
FT                   /locus_tag="DEHA2A08228g"
FT                   /old_locus_tag="DEHA0A08404g"
FT                   /old_locus_tag="DEHA-IPF6924"
FT                   /old_locus_tag="DEHA-CDS4506.1"
FT   CDS_pept        677709..678539
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08228g"
FT                   /old_locus_tag="DEHA0A08404g"
FT                   /old_locus_tag="DEHA-IPF6924"
FT                   /old_locus_tag="DEHA-CDS4506.1"
FT                   /product="DEHA2A08228p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84643"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN2"
FT                   /protein_id="CAG84643.1"
FT                   /translation="MDDLLNQKNQDIVLLAPGNSVNLEVPTINIDTNQENNGINESNVE
FT                   EANVYLSRLKLNNAPGEEQRQGEIYLTKLKQQAAENKIGTNLHHQRLRDSTIEVRENVD
FT                   HINQYLFLDENGQPQDADNATFDFGNPALNQMYSLIRRDLNAQTNRMDREFRGMDRKFR
FT                   GMDREFSELKRLVRSERNRSKNKLLASGDNTDSPNAYLPICNDRGQHPTDCGLEPLTSL
FT                   DQINRMNGILTDQYLSFYHLGTTRLVSEKKARLMEYIGIHERIVVNSVRGAPPV"
FT   gene            <678933..>679103
FT                   /locus_tag="DEHA2A08250g"
FT   CDS_pept        678933..679103
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08250g"
FT                   /product="DEHA2A08250p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65384"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS8"
FT                   /protein_id="CAR65384.1"
FT                   /translation="MFSTLDASSFSELNNIKIDPTEDENRVKHRQIQMKNIVSGSRVRS
FT                   KTGCICCRRRK"
FT   gene            <679251..>680801
FT                   /locus_tag="DEHA2A08272g"
FT   CDS_pept        679251..680801
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08272g"
FT                   /product="DEHA2A08272p"
FT                   /note="similar to uniprot|P26370 Saccharomyces cerevisiae
FT                   YDL170W UGA3,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65385"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSS9"
FT                   /protein_id="CAR65385.1"
FT                   /translation="MKAKKTNKLTGMKAPEVDNMTNNINEAKKGKIIDAVDTTNFPIQT
FT                   DTNLSPFFKAVLGSPGELSPMQLGEIEDIPSSVMSYNETNDIDFSEFSNILLSPSSTFS
FT                   LYLDEPGLRLLEYFENKVAKILCISPESSNYFLKTFVSVAMTEESIMHALAAWGGVFSE
FT                   GASSELVNYHMSQATILIHERHLANSKLNKHGYYVAVCYYLIAIGIEICSGDVSKWYKH
FT                   FNACTELLRSYGGLAKFLKDFNYSNNVKWLIASFQFHDIMSSVTLSSGTSCSMKNYNNL
FT                   FKNYNLLDIGDYGIDPYQGCIQPIYLILGEIMNSYVELKEERKKLKASILHLSLEDSNS
FT                   SEIDGLMQQRIEHYNIVSTRYDELLNKVQLARPNEKQIASIMNNKEELDLHLTLFELYR
FT                   LTCQMYLLLYIKQTQPSSSEVQMLLLTSFAYISTLVESPMTASLSMSLLICGISCCNHS
FT                   DRNYIRTKFTKIYDKYKAGNVRRVWDIVEESWRRNPDGNICIDWVEICEQYGWKLPVC"
FT   gene            complement(<680871..>681905)
FT                   /locus_tag="DEHA2A08294g"
FT                   /old_locus_tag="DEHA0A08448g"
FT                   /old_locus_tag="DEHA-IPF6929"
FT                   /old_locus_tag="DEHA-CDS4386.1"
FT   CDS_pept        complement(680871..681905)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08294g"
FT                   /old_locus_tag="DEHA0A08448g"
FT                   /old_locus_tag="DEHA-IPF6929"
FT                   /old_locus_tag="DEHA-CDS4386.1"
FT                   /product="DEHA2A08294p"
FT                   /note="weakly similar to CA2824|IPF17888 Candida albicans
FT                   IPF17888"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84645"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYN0"
FT                   /protein_id="CAG84645.2"
FT                   /translation="MSLPPYEASIGNEGYPDDVKKFGPSDDVKSPDPPAYNQEIGLPEN
FT                   PNLIQRGIIFCNMNMTTDVLTFTSEDAVAKYKSFKKVPADSDNFKHVLDLQQQGIGMPL
FT                   MEAQFTIMPSFGNGKFVTIYKFIAPPPGSGRLFDKKIDKYKFCSVRKKIGPHYSRYTFK
FT                   ISPNADNPSETFEFSTFFHNKLPIADVTKYGGSDKRYRWVHSEYHPILSNFTYSLYSLD
FT                   EHQTSMIDNMDAQSQKLDKKNPLVNNSFGQLFKFPSRRIKENYLSSVKFGELIHLKEKF
FT                   IISSFQETAKLLLHIERSTQPINLESTNSVSVHELIIICMSYVFKRREEIRIERRRAAR
FT                   RSGG"
FT   gene            complement(<682524..>683555)
FT                   /locus_tag="DEHA2A08316g"
FT                   /old_locus_tag="DEHA0A08470g"
FT                   /old_locus_tag="DEHA-IPF6931"
FT                   /old_locus_tag="DEHA-CDS3756.1"
FT   CDS_pept        complement(682524..683555)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08316g"
FT                   /old_locus_tag="DEHA0A08470g"
FT                   /old_locus_tag="DEHA-IPF6931"
FT                   /old_locus_tag="DEHA-CDS3756.1"
FT                   /product="DEHA2A08316p"
FT                   /note="weakly similar to CA2824|IPF17888 Candida albicans
FT                   IPF17888"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84646"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM9"
FT                   /protein_id="CAG84646.2"
FT                   /translation="MSLPPYESSKGNEGYLDDVKKSGPPDDVKSSGLPAYDLEYGLPEG
FT                   PNFIRREFIFCNMHWTTDTLAFTSSDSVTKYKSFKKVPADSDNFKHVSNLQQQGIGMPL
FT                   MEAVFSWTHSFGNGKFATIYKYLPPSPGSGRLFDKKRDRYKFCSVRKKAGPHYSRYTFT
FT                   ISPKPENPSETFEFSIFFHSKLPIADVTKCENSDQRYRWVHSEYHALMSNFTYSLYALD
FT                   EHQTSMIDNIDAGSQKLDKKNPLVYSSLGQLFKFESTTIKDEYLSSVKSGELIHLKEKI
FT                   MITSYQETAKLLLHIERNSHSTDLESVNSVELHELINMCMSFVIKRREELRIESAIATV
FT                   SSA"
FT   gene            complement(<684237..>684605)
FT                   /locus_tag="DEHA2A08338g"
FT                   /old_locus_tag="DEHA0A08492g"
FT                   /old_locus_tag="DEHA-IPF6932"
FT                   /old_locus_tag="DEHA-CDS6684.1"
FT   CDS_pept        complement(684237..684605)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08338g"
FT                   /old_locus_tag="DEHA0A08492g"
FT                   /old_locus_tag="DEHA-IPF6932"
FT                   /old_locus_tag="DEHA-CDS6684.1"
FT                   /product="DEHA2A08338p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84647"
FT                   /db_xref="GOA:Q6BYM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM8"
FT                   /protein_id="CAG84647.1"
FT                   /translation="MKDKAIQEKKLILFVNLEHLLNIWFCFMGRMILQTLRVFPSKKKG
FT                   NFSYCNYVYLYHQYFRFCHALGCSTGDSGRGSCRFGGNNFTSLSVLGYASGPVLWGPLS
FT                   DVRRKVFLSLSSFFYLRI"
FT   gene            complement(<685312..>685572)
FT                   /locus_tag="DEHA2A08360g"
FT                   /old_locus_tag="DEHA0A08514g"
FT                   /old_locus_tag="DEHA-IPF6934"
FT                   /old_locus_tag="DEHA-CDS7544.1"
FT   CDS_pept        complement(685312..685572)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08360g"
FT                   /old_locus_tag="DEHA0A08514g"
FT                   /old_locus_tag="DEHA-IPF6934"
FT                   /old_locus_tag="DEHA-CDS7544.1"
FT                   /product="DEHA2A08360p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM7"
FT                   /protein_id="CAG84648.2"
FT                   /translation="MVTVKNGGLGHNCWFSTSRGETRAEHWFNIRQESEEGIWSSGRVG
FT                   EEKKEWWYCAGCLISVASGYFATKQMVVGSGRRVEMFIILK"
FT   gene            <686403..>687749
FT                   /locus_tag="DEHA2A08382g"
FT                   /old_locus_tag="DEHA0A08536g"
FT                   /old_locus_tag="DEHA-IPF6939"
FT                   /old_locus_tag="DEHA-CDS2753.1"
FT   CDS_pept        686403..687749
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08382g"
FT                   /old_locus_tag="DEHA0A08536g"
FT                   /old_locus_tag="DEHA-IPF6939"
FT                   /old_locus_tag="DEHA-CDS2753.1"
FT                   /product="DEHA2A08382p"
FT                   /note="weakly similar to uniprot|P33749 Saccharomyces
FT                   cerevisiae YKL062W MSN4 Transcriptional activator related
FT                   to Msn2p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84649"
FT                   /db_xref="GOA:Q6BYM6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM6"
FT                   /protein_id="CAG84649.2"
FT                   /translation="MPVNAAIMTGEFGIPASQPGELNINDEVFLRQNEYDLIGSEVMGE
FT                   ENMGVFEELASNISSRSSLANMPVGQTTYSTTNTTPELSSPPKSHPVSRSSFSLPIDQL
FT                   NLLSLKSMSSTQSSKSPSPEYNLYSVIRENPEEEKTINPRQLFSEDIDIGAASASAASA
FT                   PTDKRTDETEGTSARGYILPSSSSPSLSTLFDGTQRASYPKAKSHSISMGSDITASKKF
FT                   DFIMNNECFNAISYWINDTLQNVNSKMNDDDEELGGAEEIMVNPTGIIKSNYYKRRNSI
FT                   QLVTPSSYNQHNSFDDEARVQKKKRRKSYNHDYAKSMTKQDTPAASSANNPEPVGTVHN
FT                   RPNPDTIKEPSNDNRSFSNDEDEQDKPFPCPDCAKQFKRSEHLKRHIRSVHSNIRPFHC
FT                   KYCEKKFSRSDNLAQHLKTHYKVNTNGTTTIIYGNPNLHNRGGRKKHSD"
FT   gene            <688889..>689719
FT                   /locus_tag="DEHA2A08404g"
FT                   /old_locus_tag="DEHA0A08558g"
FT                   /old_locus_tag="DEHA-IPF6941"
FT                   /old_locus_tag="DEHA-CDS4507.1"
FT   CDS_pept        688889..689719
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08404g"
FT                   /old_locus_tag="DEHA0A08558g"
FT                   /old_locus_tag="DEHA-IPF6941"
FT                   /old_locus_tag="DEHA-CDS4507.1"
FT                   /product="DEHA2A08404p"
FT                   /note="similar to uniprot|Q8TS14 Methanosarcina acetivorans
FT                   MA0993 Chloride peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84650"
FT                   /db_xref="GOA:Q6BYM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM5"
FT                   /protein_id="CAG84650.2"
FT                   /translation="MTGSAKLKLSDGTELFYKDWGTGDPIVFSHGWPLTSDAFEDQMMF
FT                   LALKGFRVIAHDRRGHGRSSQPWEGHTMDQYADDLAELVDHLGLKNAIHVGHSTGGGEV
FT                   ARYIGRHGIGKVSKCVLISAVPPLMVKSEENLVGTPIEVFHDIRDNVSKDRSKFFKDLA
FT                   FTFYGLDRDESEASTGFIDSFWMQGMQGSIKALYDCVAAFSETDQREDLRNMNIPTLVL
FT                   YGDNDQIVPPISSSKAAIKFLPQAKEKVYAGAPHGLCSTHKKLVNEDIYRFITH"
FT   gene            <689875..>690045
FT                   /locus_tag="DEHA2A08426g"
FT                   /old_locus_tag="DEHA0A08580g"
FT                   /old_locus_tag="DEHA-IPF6942"
FT                   /old_locus_tag="DEHA-CDS8115.1"
FT   CDS_pept        689875..690045
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08426g"
FT                   /old_locus_tag="DEHA0A08580g"
FT                   /old_locus_tag="DEHA-IPF6942"
FT                   /old_locus_tag="DEHA-CDS8115.1"
FT                   /product="DEHA2A08426p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM4"
FT                   /protein_id="CAG84651.1"
FT                   /translation="MGYKKGSLSFAFTFKRSVVKAQGEILTEVGSSFQKHTLLLMLVFQ
FT                   LFTWMNYLVST"
FT   gene            complement(<690141..>691199)
FT                   /locus_tag="DEHA2A08448g"
FT                   /old_locus_tag="DEHA0A08602g"
FT                   /old_locus_tag="DEHA-IPF6943"
FT                   /old_locus_tag="DEHA-CDS3650.1"
FT   CDS_pept        complement(690141..691199)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08448g"
FT                   /old_locus_tag="DEHA0A08602g"
FT                   /old_locus_tag="DEHA-IPF6943"
FT                   /old_locus_tag="DEHA-CDS3650.1"
FT                   /product="DEHA2A08448p"
FT                   /note="similar to uniprot|Q6FDV9 Acinetobacter sp
FT                   ACIAD0849"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84652"
FT                   /db_xref="GOA:Q6BYM3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM3"
FT                   /protein_id="CAG84652.2"
FT                   /translation="MSKTEFDTKSPVLVTGATGYVAGWIVKKLLEAGVTVHAAVRDPSN
FT                   HDKLNHLEELKNSTNGDLKFFAADLLKEGSYAEGMAGCKVVFHTASPFTSKITDPQKDL
FT                   VDPAKLGTRNVLETANKTESVSRVVLTSSCAAIYGDNKDLVSLPNGTLDESVWNNSSSL
FT                   SHNAYSYSKTVAEKEAWSICENQSKWDLVVLNPSLVFGPGLNSNATSESFSIMKSFGNG
FT                   SMNRGTPDIGIGIIDVRDLADAHLRAAFIKNAHGRYIISAHNTSFLEIGKSLSPEYDSY
FT                   PIPKSAAPKFLIWLVGPFVDKNLTRRYIRDNVNYKWKADNSKSIKELEIRYRPLKDTVS
FT                   DFFQSIIDAKQI"
FT   gene            complement(<691722..>691868)
FT                   /locus_tag="DEHA2A08470g"
FT                   /old_locus_tag="IPF_45446"
FT   CDS_pept        complement(691722..691868)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08470g"
FT                   /old_locus_tag="IPF_45446"
FT                   /product="DEHA2A08470p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65386"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST0"
FT                   /protein_id="CAR65386.1"
FT                   /translation="MYSGAPCSTMCGTIGGTIFDAFHRVCRTIVFGDALFYNMRMNSYI
FT                   VTI"
FT   gene            <692193..>694682
FT                   /locus_tag="DEHA2A08492g"
FT                   /old_locus_tag="DEHA0A08624g"
FT                   /old_locus_tag="DEHA-IPF6948"
FT                   /old_locus_tag="DEHA-CDS0760.1"
FT   CDS_pept        692193..694682
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08492g"
FT                   /old_locus_tag="DEHA0A08624g"
FT                   /old_locus_tag="DEHA-IPF6948"
FT                   /old_locus_tag="DEHA-CDS0760.1"
FT                   /product="DEHA2A08492p"
FT                   /note="similar to CA3147|IPF9803 Candida albicans IPF9803"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84653"
FT                   /db_xref="InterPro:IPR024527"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM2"
FT                   /protein_id="CAG84653.2"
FT                   /translation="MSQSVYQVNGKPLSQTALYQQRLRQGVYQSPSNVSVGVNTNASDT
FT                   AALLAASSDLTVKPSYERTIAQDAHTAALSAKRDESSLWTRDDEARTATMKSVGSGYTG
FT                   VTGVVNGGSIYKVATKNSTGTMSTRLDPVKDYRHGLAAKGSAAALNIAKINQVATHNSN
FT                   KSLNSRFNPDLDYRSGLAGHHRPAEFLDQEEEDLAASGATASLKHGGSTSSGAASQVRS
FT                   KSFKSTDVAYGNLLVAANSKAQDRLKSLNSSTSKDFREQAKEYAGALAIAQKNSDERMK
FT                   NNKAGMVDLGGGLTMSLTDLDAKAALVVGPVLSDIESKAVAQREADEQTKTKHAKLVGL
FT                   HQKSKQEEQARKERERKDIEKEKNVRVTANEERKKDEDSKYVDYQASRNEEVEGKVGEL
FT                   KALELKYAEEKESLLAEKQENQDRIDAEEKELNDNRSKELKELQAEKDDILKPTLDELE
FT                   EENTKLETIVNSKNEITEEVEKSKALNKEYDSKLAELTNNLEKVKIEIEEYTMELELAT
FT                   QKYEETSKETDNLRQTSIDELKQAEDSHNELDSKISDLDATKSKHLEDKVSQRKEIESK
FT                   LDERVKNEKEINKELPEHLQKDIDENKLRDTGSLFDEPKYEDDEEDEAETPQPSKSKSV
FT                   GVSGVKEIPLVDDKELETGAVVPGKSKSETKAKDTEKKSKSTAGTATKESKKPQPKASN
FT                   AKSPTKAKPASNQVANESPKKASGFKRFTKYFSGSLQEPPASTKKAESKSTKIDDKTKS
FT                   TKDTAKDATKNTKASSSKDTSKKESTSVAKDSSKDSSKVADQKDEKLAKKESEGSGVDI
FT                   DDLSSSKNQGGVFKEEI"
FT   gene            <694978..>695478
FT                   /locus_tag="DEHA2A08514g"
FT                   /old_locus_tag="DEHA0A08646g"
FT                   /old_locus_tag="DEHA-IPF6949"
FT                   /old_locus_tag="DEHA-CDS5797.1"
FT   CDS_pept        694978..695478
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08514g"
FT                   /old_locus_tag="DEHA0A08646g"
FT                   /old_locus_tag="DEHA-IPF6949"
FT                   /old_locus_tag="DEHA-CDS5797.1"
FT                   /product="DEHA2A08514p"
FT                   /note="similar to CA3146|IPF9797 Candida albicans IPF9797"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84654"
FT                   /db_xref="GOA:Q6BYM1"
FT                   /db_xref="InterPro:IPR038814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYM1"
FT                   /protein_id="CAG84654.1"
FT                   /translation="MSAEPSQFNKLLTKYDFKLASASEEYRNRRKRQMMLFMGSAAITI
FT                   FTSRLAYKSTITRQYVPSLFQGNHAPPLSYNFTSDAAVAVGTGTLLCGSVSSMVIFGTC
FT                   WIIDVSNFQEFGWKMKSLMGGYEKQKELAKLPMDEESAFLQDSLNDILDGKYDFDETTP
FT                   AEK"
FT   gene            <695957..>696478
FT                   /locus_tag="DEHA2A08536g"
FT                   /old_locus_tag="DEHA0A08668g"
FT                   /old_locus_tag="DEHA-IPF6950"
FT                   /old_locus_tag="DEHA-CDS5643.1"
FT   CDS_pept        695957..696478
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08536g"
FT                   /old_locus_tag="DEHA0A08668g"
FT                   /old_locus_tag="DEHA-IPF6950"
FT                   /old_locus_tag="DEHA-CDS5643.1"
FT                   /product="DEHA2A08536p"
FT                   /note="similar to CA3148|IPF9808 Candida albicans IPF9808"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84655"
FT                   /db_xref="GOA:Q6BYM0"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYM0"
FT                   /protein_id="CAG84655.1"
FT                   /translation="MARISTSSSNRNLPSSNALRRQREREEQIRRGRVGQSSANHSRQS
FT                   SVNRQRETGIYQNQPGDPPTAKATSTKRKRRYKPGTNAIREIRQFQKSTDFLISKLPFS
FT                   RLVREIAENYIGASYGIRWQSNAVLALQEASEAYLVHLLEDTNLCAIHAKRVTIMQRDI
FT                   QLARRIRGHI"
FT   gene            <696980..>698281
FT                   /locus_tag="DEHA2A08558g"
FT                   /old_locus_tag="DEHA0A08690g"
FT                   /old_locus_tag="DEHA-IPF6951"
FT                   /old_locus_tag="DEHA-CDS2884.1"
FT   CDS_pept        696980..698281
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08558g"
FT                   /old_locus_tag="DEHA0A08690g"
FT                   /old_locus_tag="DEHA-IPF6951"
FT                   /old_locus_tag="DEHA-CDS2884.1"
FT                   /product="DEHA2A08558p"
FT                   /note="some similarities with CA1042|IPF18784 Candida
FT                   albicans IPF18784"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84656"
FT                   /db_xref="GOA:Q6BYL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL9"
FT                   /protein_id="CAG84656.2"
FT                   /translation="MATITTSTTGKKKIVYKQDTDGVFRLKKIPTDGGVFGKDRDSKNA
FT                   AEDHLNELIGCTYQVSNSSTEEPSNVSPTPETVSVCPKDTEYVSTDYPVTPKRKPIKRR
FT                   NTNASTPPVRLKVPNIKISTEAFEKITGIHVPSFVAGCMVTLVFVSSSPLISHYTSMIF
FT                   NVVKLGLFWVILIGGITWYSGVVKLQDSETMGAFVNGIKDTFLETEIDEEEEEKDIEHD
FT                   MHSGSMHEQSENYSRKNSSEFAIPNAVPRRRSASPVKSARVPLTSVTPFKSTPSKQDSR
FT                   FQSTPELVAGEHSSPPKLNRFHTSDPKGYQNQPKKGSIFSLGKSRRPSNNSLELTKTKT
FT                   NQSIPSVESIDSSSSRHSPIRQHYSHHDDPEELPFINEVKLISSEDDFGNMPDPLPPIN
FT                   NINRSNSVMSKQSVLGTRANYNKFLANVHGNDGD"
FT   gene            <698562..>699977
FT                   /locus_tag="DEHA2A08580g"
FT                   /old_locus_tag="DEHA0A08712g"
FT                   /old_locus_tag="DEHA-IPF6952"
FT                   /old_locus_tag="DEHA-CDS2555.1"
FT   CDS_pept        698562..699977
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08580g"
FT                   /old_locus_tag="DEHA0A08712g"
FT                   /old_locus_tag="DEHA-IPF6952"
FT                   /old_locus_tag="DEHA-CDS2555.1"
FT                   /product="DEHA2A08580p"
FT                   /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
FT                   YMR033W ARP9 Actin-related protein involved in
FT                   transcriptional regulation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84657"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL8"
FT                   /protein_id="CAG84657.2"
FT                   /translation="MPLFRESSFLVVHPGSQYTIFSFGLQDPLSPPQYKIPSVVYQDPN
FT                   TREYKSKKNEGEELIEVHPIKESKIIDLDAFNYLLKIILQSVITNNPVVTINQIPLLLI
FT                   APSLAWSRSNIEYVTKYVIESLEFTAFNIIDLSIACNFGMGSSASSCVVNVGHESCQIM
FT                   PVIGYQSIKYAGTYLNGVGGKTINEEVQKLLPNLSNKQIDALKTSGIFEAVNDHDSSFY
FT                   SVADLNTIGENNEEEEDFDVAKIVTEQNGNLPKSDPGANEGEEKKQDEKSNSELEKNFF
FT                   LDPDTNEKIYVGKERFQGASKLVNSIAEAIYESLLLIPDLEKRQECYDNLIFVGSTFKI
FT                   PGLKQALLIKLTTDYLVRSPGESTANDDTTAINSAIVAYQQAEELNESNGESNFILSQV
FT                   PTAIRTAKHPDYFPEWKQPKEKGGSWEDVYFLGAEIYAKQIFGGNSNQGGELFLDADGY
FT                   EERGPQGIWDATI"
FT   gene            <700185..>702434
FT                   /locus_tag="DEHA2A08602g"
FT                   /old_locus_tag="DEHA0A08734g"
FT                   /old_locus_tag="DEHA-IPF6954"
FT                   /old_locus_tag="DEHA-CDS0979.1"
FT   CDS_pept        700185..702434
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08602g"
FT                   /old_locus_tag="DEHA0A08734g"
FT                   /old_locus_tag="DEHA-IPF6954"
FT                   /old_locus_tag="DEHA-CDS0979.1"
FT                   /product="DEHA2A08602p"
FT                   /note="similar to uniprot|P04819 Saccharomyces cerevisiae
FT                   YDL164C CDC9 DNA ligase found in the nucleus and
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84658"
FT                   /db_xref="GOA:Q6BYL7"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL7"
FT                   /protein_id="CAG84658.2"
FT                   /translation="MVLRHCINQLTRPTKLSFKYCILKPIFLMPQQQSLARFFSASGNL
FT                   PKTKPSVDKADISESDKPSISEIKRKASSTIPENVEKKLKVEATEAVDSDPSEVSEEDT
FT                   KAQELSDASKLIKLSEKEQEKHTCTEASSKIHYSELTELFEKIEQESSRLKITAFISQF
FT                   YYQILEHATSDKLVKIIYLCINRLGPDYEPDLELGLGETLLIKAISECYGRPPSKIKKD
FT                   YQEVGDLGIVAQKSRSGQPTMFKPTRLDIVTVFENLTKIAKSTGKDSQSKKISTINKML
FT                   TACEMKSNEAKFLIRSLEGKLRIGLAEKTVLIGLAQAFVNYENKSNKKISPEKLAQAED
FT                   IIREAFSRIPNYEIIISNAYEHGIFNLLDYCILTPGIPLKPMLAKPTKSVSEILDRFQG
FT                   EEFTCEYKYDGERAQVHLLPTGEVRIYSRNSEDMSQRYPDLISIIKDFLKTQEISGKHS
FT                   MVLDCEAVAWDRETNKILPFQVLSTRKRKDVEEKDIKVHICLFAFDLLYYNDKPLITTS
FT                   LAERRKVMFENLRPIEGKFQFATFKNTTNLDELQHFLDQSVKDSCEGLMVKMMNGTDSY
FT                   YEPSKRSRNWLKLKKDYLAGVGDSLDLVVIGAYIGKGKRTGSYGGFLLASYNQDSGEYE
FT                   TTCKIGTGFSDEDLVSIHARLKPTEIQRPKPYYVYDTTNSNAVPDVWFEPTTIFEVLTA
FT                   DLSLSPIYKAAHQQYGKGISLRFPRFLRIRDDKGTEDATSSTEVSEFYERQANLN"
FT   gene            complement(<702547..>705039)
FT                   /locus_tag="DEHA2A08624g"
FT                   /old_locus_tag="IPF_6958"
FT   CDS_pept        complement(702547..705039)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08624g"
FT                   /old_locus_tag="IPF_6958"
FT                   /product="DEHA2A08624p"
FT                   /note="similar to uniprot|P32784 Saccharomyces cerevisiae
FT                   YBL011W SCT1 High copy suppressor of choline-transport
FT                   mutants"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65387"
FT                   /db_xref="GOA:B5RST1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST1"
FT                   /protein_id="CAR65387.1"
FT                   /translation="MPYVGKGLLHSRRQTLIGCEDEIGATTMTNAHSSSEDAGEALLQS
FT                   NGQANLSDKVNMDLNDDNGNKASRGRKASASGDSFVRNKEMDEFEHRQRQWYRMVIFDL
FT                   VLWMFSVVCDCFFREIRPRGAFRLPRQGPVIFVAAPHANQFVDPIILMGQVRKEAQRRV
FT                   SFLIAAKSYKQRIIGFLSRCQFSIPVIRAQDNLKKATGKIFIDVESDPCRVTGKNTKFL
FT                   SECAVRGMLALPQSLGASEISEIISDTELVIRKEFKRTDQITTLLKNGTSFKSADRIDQ
FT                   KKVYQIVFRHLSLGNCIGIFPEGGSHDRTDLLPLKAGVAIMALGAMEYNPDCNVKIVPC
FT                   GMNYFNAHKFRSRAVIEFGHPIDIPKELVKKYSNPETNRESVKELLDLITTGLKAVTVT
FT                   CEDYETLMVVQAARRLYAGNFVQFLPLPLVVEMNRRLVLGYQTFRNEEQIKNLKEKIII
FT                   YNNQLKQLYLPDHHVEACDESHKLRVLPILLFRIVKLFLLMLLALPGATLFSPVFICTK
FT                   WYSTRKAKTALANSTVKIKANDVVATWKILISMGIAPLVYSFYASIGTWYCHRYKKFED
FT                   WNVSLFFVWFILYMLGVIVTYSALLTGEQGMDIFKSIRPLYLSITSGSSIKDLKKLRNE
FT                   LSEEITYVVNHFGPDLFPNDFNLLKLKEHLKISDNVDYVDSDEEEERKTQEVRKRRMKN
FT                   RKAARRKQASDDSISGLSLDEKNSSSVSDGISLMNSDNSLTNIPMFSDYHLHMNAKNPD
FT                   IKIEQQSVVHSSASIADDFNYKVHNSPAGKPSVSRYDSNSHIELNFGNLKEEQPSKSKL
FT                   SDKIKYKIRESRDKAAGN"
FT   gene            <705804..>708503
FT                   /locus_tag="DEHA2A08646g"
FT                   /old_locus_tag="DEHA0A08778g"
FT                   /old_locus_tag="DEHA-IPF6960"
FT                   /old_locus_tag="DEHA-CDS0610.1"
FT   CDS_pept        705804..708503
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08646g"
FT                   /old_locus_tag="DEHA0A08778g"
FT                   /old_locus_tag="DEHA-IPF6960"
FT                   /old_locus_tag="DEHA-CDS0610.1"
FT                   /product="DEHA2A08646p"
FT                   /note="similar to uniprot|Q02207 Saccharomyces cerevisiae
FT                   YKR009C FOX2 Multifunctional enzyme of the peroxisomal
FT                   fatty acid beta-oxidation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84660"
FT                   /db_xref="GOA:Q6BYL5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL5"
FT                   /protein_id="CAG84660.2"
FT                   /translation="MSEISFKDKVVVVTGAGGGLGKQYCLEYAKRGAKVVVNDLGGSLK
FT                   GDGGNSSAADDVVEEIKKAGGIAVADYNNVLDGAKIIETAVKSFGTVHIIVNNAGVLRD
FT                   ASFKKMQEKDFKFVIDVHLNGAYKVTQAAWPYFRKQQYGRVLNTASPAGLYGNFGQANY
FT                   SAAKLGLASFAETLAKEGEKYNIKANTIAPLARSRMTESILPPPVLEQLSPAKVAPLVL
FT                   YLTSDANELSGQIFEVAAGFFGQIRWERSGGALFKPDETFTAEAVAKRFNEIMDFDDSK
FT                   KPELLKNQHPFMLNDYKSLITAANKLPANDVSGAPTVSLKGKVVLITGAGAGLGRDYAL
FT                   WFAKYGAKVVVNDFKDPSKVVDEIIKSGGEAHGDKHDVASDSQAIIDNVINKYGTIDVL
FT                   VNNAGVLRDKSFAKMSDADWEIVQKVHLFGTFNLVRLAWPHFLEKKSGRVINITSTSGI
FT                   YGNFGQANYASAKAAIIGLSRTLAIEGAKNNIKVNAVAPHAETAMTLTIFNEDDKNLFH
FT                   PDQVAPLLVYLASDDVPVTGELFEVGGGWIGNTRWQRAKGAVSKDEHTAPEFVRDHIKD
FT                   VIDFSTGTFNPRSTEDSSMAILSAVGDDDDDEDDEDDDDSDDEDDVNERTYTYGDREVI
FT                   LYNIGIGANSHELKYVYENDSDFQVIPTFGHLVTFLSGKSTHSFAKLLKNFNPMYLLHG
FT                   EHYLKVEKYPIPTEASMLTEFKPLAVTQKGTNSIVVHGSKTVDAKTGELLFTNEATYFI
FT                   RKCEGETKVYGDRKAFATKQFNAPNSSPDFTIDVKISEHQASLYRLNGDRNPLHLDPEF
FT                   AKGANFDKPILHGMCTYGMSAKVLLDKFGPFDEIKGRFTGIVFPGETLKVLAWKQGDIV
FT                   IFQVHVVERKTIAINNAAIKLINNKAKI"
FT   gene            complement(<708649..>710958)
FT                   /locus_tag="DEHA2A08668g"
FT                   /old_locus_tag="DEHA0A08800g"
FT                   /old_locus_tag="DEHA-IPF6963"
FT                   /old_locus_tag="DEHA-CDS0941.1"
FT   CDS_pept        complement(708649..710958)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08668g"
FT                   /old_locus_tag="DEHA0A08800g"
FT                   /old_locus_tag="DEHA-IPF6963"
FT                   /old_locus_tag="DEHA-CDS0941.1"
FT                   /product="DEHA2A08668p"
FT                   /note="similar to CA0578|IPF9605 Candida albicans IPF9605"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84661"
FT                   /db_xref="GOA:Q6BYL4"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL4"
FT                   /protein_id="CAG84661.2"
FT                   /translation="MKDGSDDMISDNSAGLNHHTSVSRKARFMDSRSTTTKRDRPLSSY
FT                   FDSPSNTKPIEASDYFSLKGDGINHLHINDEREDKDEDSHEFTSPLVNRKPFRNLSNFV
FT                   NNLEFTGMKKKLASSKKSLTRSMTSVAKYSNKEREKKEDEVEKKLQNESDDVTNNEPNI
FT                   IGGSPTQMVPRNKSIRRIHSMCQTTKEKETYNMEDNSHLPKTTINTFKVDNDLLPRINE
FT                   DELFRILNGDYKEEFDEYVVIDCRFNYEYDGGHIMNAINITSQQGLEERFIRNNTNDSS
FT                   KRRLYIFHCEFSIFRSPTMASHLRKCDRILNSNNYPKLTYPDIVVLEGGYKGFYDKYKS
FT                   HCYPQAYIEMKDVNHQKTCELEMGKVRQANKLPRAKSYNHFLGNNSLSNTHNRSNSFTT
FT                   ITSHAENLKILKRQRSTSKFNLSNNDTDNEISIPGTQDLSDNRLTRASTFTYTPSIFNS
FT                   SPANSPNIMSNRGMDSDFQPPSALFKSGGHQKSFSNSSNFSSSSISINSSSSSICSDLA
FT                   FSSTDSLTDSYSSPVGEMPEFFEPKGHNLTSYLKMNTNNSFYNHLHANKPSLIKPISRK
FT                   PSGPIPQLPAQQRNIISSSSINASTTSDTTIVHQNSKNLPNSSFKFPLSSNSKNKASRN
FT                   LSRINTNTKHLSNSSLSNIFAVPTAASSPIMNSPLSTATPISTTDSSKSHLSIIDPIND
FT                   TPVDFSVPSSAKRPFHPRRRSGSILSSGGGIHRFLDLDIDEVEEEEEEITEDNDRTLTD
FT                   IKLNKISDFIQKSPFN"
FT   gene            complement(<711675..>713720)
FT                   /locus_tag="DEHA2A08690g"
FT                   /old_locus_tag="DEHA0A08822g"
FT                   /old_locus_tag="DEHA-IPF6965"
FT                   /old_locus_tag="DEHA-CDS1215.1"
FT   CDS_pept        complement(711675..713720)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08690g"
FT                   /old_locus_tag="DEHA0A08822g"
FT                   /old_locus_tag="DEHA-IPF6965"
FT                   /old_locus_tag="DEHA-CDS1215.1"
FT                   /product="DEHA2A08690p"
FT                   /note="similar to CA0577|IPF16051 Candida albicans
FT                   IPF16051"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84662"
FT                   /db_xref="GOA:Q6BYL3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL3"
FT                   /protein_id="CAG84662.2"
FT                   /translation="MDISTLSIENDPKSNRKVINKTYRITKKIGQGQFGKVLLAENIGK
FT                   HNVQKSCTTVAIKTINRLDKTRLITKTYLNHTTKIKREIQIMKECNHPNVVKLYQVIDD
FT                   LKYDKILLVLEYCPFGEIDWKKYNHYNEKYNKKDGITLNKILRDVVNGLEYLHDYKKIV
FT                   HRDLKPSNLLISADKTIKISDFGVSLILENNANDDKELGKSMGTPAFFAPELCQFVNNR
FT                   LSMINDSFKAKNKIDSRIDLWSLGVILYCLIFNDLPFNGFNEFGLFKNIVNKDLKFPRV
FT                   RSTTHTTKNDLKELNLLKDLIEKLLTKDPTKRITLEKVKQHGFTIFDITPSEQDTFQDF
FT                   NRQIIRQDGSLTTKIKRLFVSKPESPVSPKLPVDKPEPNADALEPVDDLLDSYFDDSSS
FT                   LGSYEETTEIDTTNLLESLETKESTPPVENKPNNLLNLEFLSKDNKSHKRTNKNTPSPL
FT                   QLSQPSPQPYASRSASSSSSHFQSPLSPSSPIANAVTIGADSPSSIKSMFSPSKRFFAR
FT                   NKSKELASPNKKTHTISSLSNTSSLKSKNSDKKTAVYNDLMEPPPIFGTTSSLSSTNQS
FT                   PSSTCSRKNSISSSKSSGLSRITSSSSSLNLNAYLTDDAYSLSSMKDPAITENSKGNNN
FT                   KASNNSHQGVTDDDPDEDVDETLILPDHEQSDMKHYSSMSDFLDRI"
FT   gene            complement(<714067..>715437)
FT                   /locus_tag="DEHA2A08712g"
FT                   /old_locus_tag="DEHA0A08844g"
FT                   /old_locus_tag="DEHA-IPF6966"
FT                   /old_locus_tag="DEHA-CDS2895.1"
FT   CDS_pept        complement(714067..715437)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08712g"
FT                   /old_locus_tag="DEHA0A08844g"
FT                   /old_locus_tag="DEHA-IPF6966"
FT                   /old_locus_tag="DEHA-CDS2895.1"
FT                   /product="DEHA2A08712p"
FT                   /note="similar to uniprot|P53096 Saccharomyces cerevisiae
FT                   YGL194C HOS2 Histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84663"
FT                   /db_xref="GOA:Q6BYL2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL2"
FT                   /protein_id="CAG84663.2"
FT                   /translation="MSIPANQSPTFTKDKKTQENTPLYLANSTSKLPNVSYHYNPQVSQ
FT                   YHFGPHHPMKPFRLMLTDHLVISYKLYEQMDLYTPRRATKEELLEFHAEDYIDFLQTIT
FT                   PEKTLKMSDQKLAQFNIGDDCPVFDGIYDYSSIYAGASLDASRKLISGMSDIAINWSGG
FT                   LHHAKKFEPSGFCYVNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYVTDRVMTVS
FT                   FHKYNGEFFPGTGSVDETGLGKGKNYAVNVPLKDGIDDDSYIRLFKSIMEPLITKFQPT
FT                   CIVQQCGADSLGYDRLGCFNLNIRAHGECVKYIKSFGIPMLVLGGGGYTPRNVSRLWCY
FT                   ETSVLNDVTLDHTIPNYLPTHDWFGPDYSLHPQLDGRIDNKNSKKYLESVKQEVLEQLR
FT                   YLTYAPSVQMQEIPPDITGLTEEEEDIIKELNSMNDDKDVRIMKNIKDEARSSEMVN"
FT   gene            <715702..>716509
FT                   /locus_tag="DEHA2A08734g"
FT   CDS_pept        join(715702..715708,715773..716509)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08734g"
FT                   /product="DEHA2A08734p"
FT                   /note="similar to uniprot|P21243 Saccharomyces cerevisiae
FT                   YGL011c SCL1 20S proteasome subunit YC7ALPHA/Y8"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84664"
FT                   /db_xref="GOA:Q6BYL1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL1"
FT                   /protein_id="CAG84664.1"
FT                   /translation="MSGSAGFDRHITIFSPEGRLYQVEYAFKAINSSNITSIGVTGKDS
FT                   AVLISQKKIPDKLLDPETVSYIFKITPSIGLVATGSIADARAQALRARSEAAEFRYKYG
FT                   YEMPVESLAKRMANLSQLYTQRAYMRPLGVALTFCQVDFEDEDRGSQIFKCDPAGYYTG
FT                   VKAVATGPKQQEATTYLEKKFKKIEHVKGDWKDTVEFAITALSSVLGTDFRKNDIEIGV
FT                   ATEEGFRILNPEEIDERLVTIAEQD"
FT   gene            complement(<716706..>718109)
FT                   /locus_tag="DEHA2A08756g"
FT                   /old_locus_tag="DEHA0A08888g"
FT                   /old_locus_tag="DEHA-IPF6968"
FT                   /old_locus_tag="DEHA-CDS2999.1"
FT   CDS_pept        complement(716706..718109)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08756g"
FT                   /old_locus_tag="DEHA0A08888g"
FT                   /old_locus_tag="DEHA-IPF6968"
FT                   /old_locus_tag="DEHA-CDS2999.1"
FT                   /product="DEHA2A08756p"
FT                   /note="similar to uniprot|P25340 Saccharomyces cerevisiae
FT                   YGL012W ERG4 C-24(28) sterol reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84665"
FT                   /db_xref="GOA:Q6BYL0"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYL0"
FT                   /protein_id="CAG84665.1"
FT                   /translation="MSSDEDITTPLVEERREVKPGYLPKEEIEWEFGGPVGALGMMVGF
FT                   PLLMYYMWISAQFYDGKPAWPAENQTWKEFVAGDLFQYFVKYGIPSFKSWFIFTLFILV
FT                   QAAFYLTLPGIWTKGQPLTHLNNKQLPYYCNAIWSFYTSLAIALVLHFTGLFRLTYILS
FT                   HFGEIMTTAIIYGLTLPVILYLVCIHVTGDYHRMTGNHIYDIFMGAPLNPRLGKYLDFK
FT                   MFFEVRIPWFILFFLTLALNLKQFEEYGYVSPQALFVLLAHWLYANACAKGEELIVPTW
FT                   DMAYEKFGFMLLFWNIAGVPFTYCHCTLYLAYHDPKEYQWSIGYNIAIYVILLVAYYFF
FT                   DTGNRQKNSFRRQMAGNTSIRKTFPYLPYSDLENPKYIKCANGSYLLTDGWYVYARKMH
FT                   YTADYTQSLTWGLICGFASPFPWFFPVFFLIVLIHRALRDTRKCERKYGEDWDRYLEAC
FT                   PYMFIPYVW"
FT   gene            complement(<718663..>721089)
FT                   /locus_tag="DEHA2A08778g"
FT                   /old_locus_tag="DEHA0A08910g"
FT                   /old_locus_tag="DEHA-IPF6969"
FT                   /old_locus_tag="DEHA-CDS0807.1"
FT   CDS_pept        complement(718663..721089)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08778g"
FT                   /old_locus_tag="DEHA0A08910g"
FT                   /old_locus_tag="DEHA-IPF6969"
FT                   /old_locus_tag="DEHA-CDS0807.1"
FT                   /product="DEHA2A08778p"
FT                   /note="weakly similar to uniprot|P25339 Saccharomyces
FT                   cerevisiae YGL014W PUF4"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84666"
FT                   /db_xref="GOA:Q6BYK9"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK9"
FT                   /protein_id="CAG84666.2"
FT                   /translation="MTTNLQSRSASVSNQGDAEEPSSFLPGKAGASKNVGNNLRSASIG
FT                   SSFFNKDASNFFNPKDAANTTSSSMDDEFVKETNENPPNPPASSDLDIVDALGTLNLDE
FT                   EFELTNKDTGNAKEKKGTQSSNEAAKQRDTATSNTPFSQHAQFLYAGNSNTNDGNNNYH
FT                   QQFYSQYPAQQGSLTPNSSIGTFVPSTFGHVNTPSSTWSNTFIPSSAPPFAYGNSNAAS
FT                   ANALNVKPFELPDDGKSKDKRANGENVIPGLHLPFTTTPPPLDTFGGVLNSQIPFGANV
FT                   PIGMESYGFQEGYKLAEGSSSESEVENSIPSDRTKGSSNQQQFMSGSIRMDGAQAASVN
FT                   EYQSIVGNEGSHSNNQFNNLPDNLNFPMLNVGQMVPPSAQSGTPNMWNQIPMNYNSNVN
FT                   SQQHSFVNNRVPQNQAISGQGVNGGRFNNNGNHNNNNNRRNHYNSNDGMNVHRKMHINN
FT                   KRKGDDASKYTNAKLEDFTGQIYSLCKDQHGCRFLQRQLDLGREAASNPNADLENTQIL
FT                   TNDIAATMIFNEIYLKIIELMTDPFGNYLIQKLFENVSADQRIILVKNASPEFIRIALD
FT                   PHGTRALQKLIECITTEEESRLIINSLSPRIVALSRDLNGNHVVQKCLQRLKPEENQFI
FT                   FETASLHCNEIATHRHGCCVLQRCLDHGNLAQRKQLSLKVAENATNLSLDPFGNYVVQY
FT                   VLSRGDDESIRIILDHIKANVVSLSLHKFGSNVIEKSLRINKLTDSLIDVLLLNKERFS
FT                   EMLNDAFGNYVLQTSLDVANVRDLGKLSQALQPLLPNIKNTPHGRRIMIKIQNIL"
FT   gene            complement(<722029..>724719)
FT                   /locus_tag="DEHA2A08800g"
FT                   /old_locus_tag="DEHA0A08932g"
FT                   /old_locus_tag="DEHA-IPF6971"
FT                   /old_locus_tag="DEHA-CDS0616.1"
FT   CDS_pept        complement(722029..724719)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08800g"
FT                   /old_locus_tag="DEHA0A08932g"
FT                   /old_locus_tag="DEHA-IPF6971"
FT                   /old_locus_tag="DEHA-CDS0616.1"
FT                   /product="DEHA2A08800p"
FT                   /note="highly similar to uniprot|P05030 Saccharomyces
FT                   cerevisiae YGL008C PMA1 Plasma membrane H+-ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84667"
FT                   /db_xref="GOA:Q6BYK8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK8"
FT                   /protein_id="CAG84667.1"
FT                   /translation="MSGTEPTNEKVDKIVSDDEEEDIDQLIMDLQSHKGLDDEDDDEAV
FT                   DDSSFKAVPEELLKTDPTTGLTADEVTKRRKKYGLNQMSEDKENLVLKFVMFFVGPIQF
FT                   VMEAAAILAAGLEDWIDFGVICALLLLNAFVGFVQEYQAGSIVDELKKTLANFAFVIRD
FT                   GSLIEIAASEIVPGDILQLEDGTVIPADGRVVSEDCHLQIDQSAITGESLAVEKRFGDA
FT                   TYSSSTVKTGEAFMIVTATADSTFTGRAAALVNKAGASGGHFTEVLNSIGTLLLVLVIV
FT                   TLLPIWVACFYRTVRIVPILRYTLAILIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQK
FT                   LSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTGCLAASRKKKGLDA
FT                   IDKAFLKSLIDYPRAKAALTKYKLIEFQPFDPVSKKVTSIVESPEGERIICVKGSPLFV
FT                   LKTVEDDHPIPEDVHENYQNTVTEFASRGFRSLGVARKRGEGHWEILGIMPVMDPPRDD
FT                   TAQTINEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYDADRLGLSGGGDMAGSEIA
FT                   DFVENADGFAEVFPQHKYNAVEILQSRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDA
FT                   ARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVVYRIALSLHLEIFLGLWIVILNQS
FT                   LSIDLIVFIALFADVATLAIAYDNAPYDPMPVKWNTPRLWGMSIVLGIILAIGTWITLT
FT                   TMFMKKGGIVQNFGGLDGILFLQISLTENWLIFITRAQGPFWSSIPSWQLGGAILIVDI
FT                   IATCFTLFGWWSQNWTDIVTVVRTWIFSFGVFCVMGGLYYLMSGSEAFDNICNGRPAKP
FT                   HKDNRSVEDFLMSMQRVSTQHEKST"
FT   gene            complement(<727242..>730319)
FT                   /locus_tag="DEHA2A08822g"
FT                   /old_locus_tag="IPF_6975"
FT   CDS_pept        complement(727242..730319)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08822g"
FT                   /old_locus_tag="IPF_6975"
FT                   /product="DEHA2A08822p"
FT                   /note="similar to uniprot|Q875J0 Candida albicans CHS8
FT                   Chitin synthase 8"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65388"
FT                   /db_xref="GOA:B5RST2"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST2"
FT                   /protein_id="CAR65388.1"
FT                   /translation="MSGTNKADISDDDDLFGDNEVRRSSFEQGDDEEQLVPNPFYYDQF
FT                   QPHQQYSVPQLQSGNLQLMQPSMHGHQHQGSASTFVDENNDYSIEKLGSEASLSTTSTF
FT                   PNRSKTVAFRESEPEYPPTAYSPGKTMNHYAEPLHYDMERVDTYDFDNPSMALRPYSQV
FT                   LTFTGDDYMINPLEDADDDEDLDPFGDDESLFSETGEEIIRRGTTIKRSNTTISRRDTL
FT                   KRKNSMATGLSLVDEEDDFKPRLNYTKTIKKAKLVNGNYVIDAPAPKSLLDTYGRKITD
FT                   SGREMSFMRYTAVTCGPSNFMKYKYNIRQALYTPPRETEIMVCITMYNEDEILLARTLK
FT                   GIFDNIKNLTNRNDSKWGEDSWKKIVVCIISDGRVDLNKRSQELLTALGLYQDGYAKSK
FT                   INDKSVKSHIYEYTSTVGIETINDKIHFCTNSSPVQFLFCLKEKNTRKINSHRWCFQSF
FT                   APILKPKVIMLLDCGTKPSKDAFYHLWKSFNDPNVAGACGEMRAALGPNRKYLANPLVA
FT                   AQNFEYKISNVLDKPMESVFGFISVLPGAFSAYRYEALLNVDGEGPLEKYFKGEFLHQE
FT                   TQVIEDEEDDEKTLKEKNFQEAGIFTSNMYLAEDRILCFELVAKKNHNYVLRYVNEAKA
FT                   ETDVPEVIDEFVLQRRRWLNGSLFAAAYAVFHWTKIWKSNHSLLRKLFLQLEFYYQLIT
FT                   LLVSWFSIASFFLVFRILTANLGAKDMNFDVGKYLAVIFLWFYVGSVVCTFVLSFGNTP
FT                   RGTRKFYLVIACIFAVLMVYMLFAAIFLAVHTVQAALKSHKDDFTVSLLFTDTKFRDLI
FT                   VSVVSTYALYFVASLMYGEPSFMVTSFLQYLLLSPSYINILNIYSFCNIHDVSWGTKGS
FT                   VQARDLGSAKSADNDKENIVTIVPGVSEELNETYLNTLESLRTLPPPPLEVNNKKRKDD
FT                   SYYAFIRTVTVLVWMLTNAILIAIVLEAGGVDTLTSSDSTSISGNSEIFLTIILWIVAG
FT                   LAAFRFIGSSVYLILKVFRPLKWRIRARKAARTQNY"
FT   gene            complement(<730622..>734872)
FT                   /locus_tag="DEHA2A08844g"
FT                   /old_locus_tag="IPF_6979"
FT   CDS_pept        complement(730622..734872)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08844g"
FT                   /old_locus_tag="IPF_6979"
FT                   /product="DEHA2A08844p"
FT                   /note="similar to CA5751|CaVPS8 Candida albicans VPS8"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65389"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST3"
FT                   /protein_id="CAR65389.1"
FT                   /translation="MGSISDEQADDNTSQSPPNLGVPATSRKNILSPSISVDSTISNGS
FT                   TPIRKHRFDDRAQTWISLALRSHKHEFSRDSSPFDLTNSIISDDSQDMLKLTETPKITE
FT                   IINSPSFRATYGLVECIEPSNIYIAVGTEKGFIVGFNYHQGVEYILTTEEERKDNKEQF
FT                   EGGSVSAISFSSDSSYLVAGYSRGAIITWNLSSTSTTSAGCIKPYYIIEPTTLENRFTR
FT                   NVQGHLHNNRINSVCFIGSSRSQLISSDVSGLVFYHHGFKKFMKKYFQTQKILGRNDAN
FT                   IVDNGGRYIIYGCEMLPLGSAHQITDYLGLIAVMTGNVLAIVSVLSLNNPSMINMRVHF
FT                   KIGRTKHSNKTGTSEGCLSWYPCMKNENNKLQNAKLAYAWNNIVTILEVDNNSLPENLI
FT                   HIIADLKDKDKAIPVLPIQKTCKWISSNKSNSIVSLKWISNNILFAYIQEPLNSELTLT
FT                   ALHYTFDKGKRRLVRVGQNSLRGLQIASSKVSIESNNRDTHSTRKQNCINLFNNSIKAF
FT                   KNRLLVLVDDDTNKKLFIGRSISWADKLLGLLASREYSKALSTANDFYNSKNNGQLVLA
FT                   DLPENQELRREMLKPYLVNIMKESINNIFGAEGSDYGFHLATYLDIVSYLYKYDESLSD
FT                   ELYFILETVFEVLNNQFLFFDTIESYILSGKIMTLPPLILKKLIEYYTLNEKGELLTEM
FT                   ICILDVKTLDIDLAIQLCKKYKLRDCLIYIWNFILGDYATPFADFIKDICNLDVDVDND
FT                   NEDCLKVFSYMSYILTGRQYPTEKFIDVSQENPAKKSIYKLLFSATSIRYPNDDSDILV
FT                   AGSEETIFPYLYSLLQFNSFETLSTINEFFEDSILNDDNNSHLTRQYIIEALFDIYEVN
FT                   ETTFTDFDRCQLAIFVARNYPKYSQFIRLSESVLSSIIDDLCTVTNQDIKYDCELALQS
FT                   LLPLYEPDGELFLLDKLKSARFYSVLISIYRSKGKYSNVLKTWLEKSQQESTENDTLSG
FT                   ILEEAFIYTKSHADKIDLVTFIKRNFQQILIVNIPDFVTLINKYYPSLHSEALTINSDQ
FT                   YFYEYMYVLLDIVDLKSINIENMPQIVGRYMKVLCDYNPSKLYSFVETANLILARDTNE
FT                   FESVKKTFQQKGLIESLTILLISQSKYEESLNVLLQSMDRLIDSAISNQKKEDLLSKFA
FT                   NCLGRAMDICEIEDTYVEHDGDMYLNERLWLTLIENCVKMSNIAATKRLKSKNNEYQNV
FT                   SEFLDRCIHDCFKRISESKLNPNVSENEKKEKSFLVIFNRFLENSTKDSKMTTISNIRD
FT                   ILREVFISYSYENEILSISLKMLNESIGESLDLIKLDNLKAWTIKSKWCTSCGKTMWGP
FT                   DVPKEHFMAWEDRQREALILAQGLGNTVIGAPFNDKKYHNCELIFFKCNHGYHMSCLEN
FT                   LGSKRSKSCVLCLQ"
FT   gene            complement(<735109..>735843)
FT                   /locus_tag="DEHA2A08866g"
FT                   /old_locus_tag="DEHA0A09042g"
FT                   /old_locus_tag="DEHA-IPF6982"
FT                   /old_locus_tag="DEHA-CDS4702.1"
FT   CDS_pept        complement(735109..735843)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08866g"
FT                   /old_locus_tag="DEHA0A09042g"
FT                   /old_locus_tag="DEHA-IPF6982"
FT                   /old_locus_tag="DEHA-CDS4702.1"
FT                   /product="DEHA2A08866p"
FT                   /note="similar to uniprot|P53198 Saccharomyces cerevisiae
FT                   YGL002W ERP6 Protein member of the p24 family involved in
FT                   ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84672"
FT                   /db_xref="GOA:Q6BYK4"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK4"
FT                   /protein_id="CAG84672.2"
FT                   /translation="MVHFQSLNRSHVFLVGILLLIQFSFPIQGLLHFYTDAGARRCFYK
FT                   ELPQGTLLIGRYKLEIFDEDAHEFYSPLDKLNTGILIDVEEKFDTDHRVVHQKGSPRGQ
FT                   FTFSALESGEHRICFTPKSFYKRRWLDGGGNDVDALKDSRFKKSRIMVDFSIRDGEIFD
FT                   TKHSIKVNTLTEQVNSINDKLTDIKREQEFIREKEESFRDQSERTCERVIRWSIVQIGA
FT                   LVITCVYQMIALSSFFVKEKVS"
FT   gene            <736065..>737432
FT                   /locus_tag="DEHA2A08888g"
FT                   /old_locus_tag="DEHA0A09064g"
FT                   /old_locus_tag="DEHA-IPF6986"
FT                   /old_locus_tag="DEHA-CDS2684.1"
FT   CDS_pept        736065..737432
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08888g"
FT                   /old_locus_tag="DEHA0A09064g"
FT                   /old_locus_tag="DEHA-IPF6986"
FT                   /old_locus_tag="DEHA-CDS2684.1"
FT                   /product="DEHA2A08888p"
FT                   /note="similar to uniprot|P39706 Saccharomyces cerevisiae
FT                   YAR003W SWD1 Subunit of the COMPASS complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84673"
FT                   /db_xref="GOA:Q6BYK3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK3"
FT                   /protein_id="CAG84673.2"
FT                   /translation="MNLSLQDPFAVAKEYPENLTHTLQYGHSVVIQFNHKGDYLASGLS
FT                   DGSIVIYDLTSNGGIVAHLENGGHTRPVSSISWSGCGRYLLTSSQDWCCNLWDLNRVNR
FT                   DEGDELEDGPIIRRVKFDGPIWSAMLHPNNHFLITASLYEDSPVFVDLSIESDIKVHRL
FT                   NTVPLPLQQREEGAEQPAQADDSDEEKASRKKKKDKHMTLVTTFTPGDGTYIFTGTSKG
FT                   WLNIISTETLQLVHSIKIANSNIKNLVVSPNGRKLAINSSDRIIRQINLPDMINITDPN
FT                   HWEFEVEHKYQDVVNRLQWNSVTFNHNAEFLIASTFGQSSQDLYMWETSLGSLIKILEG
FT                   SNEELIDVKWNYHRCTVGSTGLDSGSIYLWSIQFPQKWSALAPDFVEIEENIDYEEKED
FT                   EFDYINEDILNKRRMEEEDLIVDIVTKETVDARGFDVAQDSFIIPIDYDQQPGDFV"
FT   gene            <737901..>740012
FT                   /locus_tag="DEHA2A08910g"
FT                   /old_locus_tag="DEHA0A09086g"
FT                   /old_locus_tag="DEHA-IPF6989"
FT                   /old_locus_tag="DEHA-CDS1238.1"
FT   CDS_pept        737901..740012
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08910g"
FT                   /old_locus_tag="DEHA0A09086g"
FT                   /old_locus_tag="DEHA-IPF6989"
FT                   /old_locus_tag="DEHA-CDS1238.1"
FT                   /product="DEHA2A08910p"
FT                   /note="similar to uniprot|P41813 Saccharomyces cerevisiae
FT                   YNL068C FKH2 Transcription factor of the forkhead family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84674"
FT                   /db_xref="GOA:Q6BYK2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK2"
FT                   /protein_id="CAG84674.2"
FT                   /translation="MSGTSTPRKRTLGDLNDGEVPNFEDPLDVVNAVISTLQTPVEKTN
FT                   VAMTYANDKNLATEVQAYAKIAGQDWTYYVKSLSIPIGRNTDNPGGSSQPLVDIDLGPA
FT                   KVVSRQHAMITYNLDLRYWELKVLGRNGARVDGQKVPFGENHSTPLHSGAILDIGGTQM
FT                   MFILPDSPPNISQKMLSTCLAKYNANLNKSKRKSISDFPQQHTIPINPSNQIKSFQMFD
FT                   KAQLTQSPSSASATSLQNNLDQDLSKEEAKDIKPPYSYATMITQAILSNDDGVMSLSEI
FT                   YNWIASHYAYYKYSKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWQISESYKEDFL
FT                   TKIQSGSLSKARRGSSVSRQLQLHLATHQNLPESQKYYAKDDPSRSNSFDQRFNHERNS
FT                   SLPKLGQPMQYQQAPSNPMQHNPLSYISNQQPQNGSFGVPPPRSYGYQHPPPPQLMYGS
FT                   HMMHQNQNDSPSIQQVPGNKNELSSPIRQLSDINTTTPKLPKVSGNHLFNLPPPPPSTH
FT                   SMGTSAPQAHHSRSNSYNHQHQLTENNSNSYNTSGNNQTSESNTTNTNAQNVSSGPTTN
FT                   TSDLALGFTSPKKIAPLEAFTPERGSKSSSNKLGVANGVNTNQSSPAFWNFVQFSTPNA
FT                   QTPLKGNDQNNQLSPTLNRRVFGSNGYAKEKSEKGDLSPLKSRNSHDDNSKADNADELN
FT                   TQKNEEINA"
FT   gene            complement(<740265..>744035)
FT                   /locus_tag="DEHA2A08932g"
FT                   /old_locus_tag="DEHA0A09141g"
FT                   /old_locus_tag="DEHA-IPF6992"
FT                   /old_locus_tag="DEHA-CDS0202.1"
FT   CDS_pept        complement(740265..744035)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08932g"
FT                   /old_locus_tag="DEHA0A09141g"
FT                   /old_locus_tag="DEHA-IPF6992"
FT                   /old_locus_tag="DEHA-CDS0202.1"
FT                   /product="DEHA2A08932p"
FT                   /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
FT                   YML049C RSE1 RNA splicing and ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84677"
FT                   /db_xref="GOA:Q6BYK1"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYK1"
FT                   /protein_id="CAG84677.2"
FT                   /translation="MSVDNESLYLYNLTIKHPSSCIASIVGQFLGNKKSQEIILANSTS
FT                   IELWKADSNTGKLEKIYQQASFGIIQGIDKIRLVGTQKDYVVITSDSGKLVVLEFDIEK
FT                   LQFVPLFQEPHSKNGLRRTSPGEYLCVDPHNRAILIGAIEKNKLVYKVQSNDEGKLELS
FT                   SPLETFSKHTLTLQICAMDTGFENPMFAAIECDYNARQQDNGEEEDAGEASLLLNYYEL
FT                   DQGLNHVVKHKSNEKIPGSSSHLIPLPDFIGGLLVCSKSTIIYAHPSKDKLYLPIPIRS
FT                   NTNETLIVNHVIHRLKKNNFFILVQSQLGDCFKITIDHDEVNESIENINITYFDTIPLS
FT                   QSLNIFKSGFLFANVATNNKLFYQFEKLGDDNNNTTLQSCNFSDYNSIFELDISKRSFK
FT                   VAGLENLALVDIMETLNPITDGALIETLRPEVPDPFKQLTALSSHSYLKTLTHGISTNT
FT                   VVSSPLPIKPTAIHTTRIFAESANDEYLVISSTLSSQTLVLSIGEVVEEVNDSQFVTNE
FT                   PTINVQQVGKSSVVQIYSNGIRHIKHTMRNDTIEKKYTDWYPPAGISIIQASTNNEQVI
FT                   IGLSNREICYFEIDPHDDQLVEYQERLEMSGGSISALAISSSSISKLQRKSSYAIVGCS
FT                   DETIQAISLKPHNCLEIVTLQALSANSSSIAMVPHGYSTSVHIGMENGLYVRVTIDEIT
FT                   GKLSDTRIQFLGSKPVQLSVIGLPQLQQNGLLAISSRPWIGYYSKGDFKMTPLLNTNIS
FT                   NGASFYSEDIGGEGIVGIDDNNLIILTISNTDGEESGLNVNDDFIINSVKLRYLPRKMN
FT                   VDSPGDNEISSSSYIYIIESEYGITSPFPVTVLPDNQKESTNENIDTPEIDQDYYDAFG
FT                   FERSRHSWASCVEVIDFNNQEIVQTIELPKNESAISLCRLQFESQQTKNQEYLIIGTTQ
FT                   DQKFLPNSYSNNYLYTFTINKSSNKNKSQNEILEFVHKTELDYQPTAIIPFNGRLLVGM
FT                   SNFLRLYDLGQRQLLRKASSNIEYLKNIIRLTHQGGSRIVVGDSSMSTTFVKYDSTENQ
FT                   FIPFADDIMKRQITALVTLDYDTIIGGDKFGNIFVSRVPETISQQSDKDWSLLRYQESY
FT                   LNGSGSRLKNICEFYLQDIPTSFTKGSLVMGGKESIIYTGIQGTLGLLLPLSTENEVKF
FT                   LGDLQLLLRKYFDYNFDDFDKDKNGYNLLGKDHLKFRSYYNPVKNVMDGDLIERFYELS
FT                   QSMKIRIGTELNRTPREIEKKISEMRHRSAF"
FT   gene            complement(<744923..>746482)
FT                   /locus_tag="DEHA2A08954g"
FT                   /old_locus_tag="DEHA0A09163g"
FT                   /old_locus_tag="DEHA-IPF6993"
FT                   /old_locus_tag="DEHA-CDS2187.1"
FT   CDS_pept        complement(744923..746482)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08954g"
FT                   /old_locus_tag="DEHA0A09163g"
FT                   /old_locus_tag="DEHA-IPF6993"
FT                   /old_locus_tag="DEHA-CDS2187.1"
FT                   /product="DEHA2A08954p"
FT                   /note="similar to CA5756|IPF1065 Candida albicans IPF1065"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84678"
FT                   /db_xref="GOA:Q6BYK0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYK0"
FT                   /protein_id="CAG84678.1"
FT                   /translation="MSEKETNTNVELDSSVESSDHYHHDDSHLELKKHSPEEIAASGKW
FT                   YDRRFIRGIPQYSDSMVQIVMLSFVVFMTPGMYNALSGIGGAGISDRATADNANVALYS
FT                   CFATIGFFAGTICNYFGIKACLIGGGTGYFLYSSSLLCFYHTENKGFVIFSGAYLGICA
FT                   SCLWAAQGTIIMSYPTEDKKGRAIMIFWVIFNLGAVIGSVIPLANNINNKGSAVGDSTY
FT                   IAFMVLMFCGSLIAMCMLPMNKVWKSDGTRVMNKKFPSWKQELIDLYRMLVSEPRIFFV
FT                   FPMFFASNWFYTYQFNDFNAGRFNIRTRSLNSLLYWLSQMFGAIIFGSILDLKCFRRST
FT                   RAKIGYIILTVISLAIWGGGLKFQLGFTREDVTSPDAAGEIPPKFAPIDFEDGSYIGPM
FT                   FLYIFYGIFDSMFQTYLFWVLGSMSNNPKKTALYAGFYKGLQSAGAAIAWRLDALEKPY
FT                   MDLFASSWGLVNGSLLIALPLIWFKITDHTDIEKDGLTKVVTDNEIKSVKSFPQEGTIE
FT                   VV"
FT   gene            complement(<747400..>748920)
FT                   /locus_tag="DEHA2A08976g"
FT                   /old_locus_tag="DEHA0A09185g"
FT                   /old_locus_tag="DEHA-IPF6995"
FT                   /old_locus_tag="DEHA-CDS2290.1"
FT   CDS_pept        complement(747400..748920)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08976g"
FT                   /old_locus_tag="DEHA0A09185g"
FT                   /old_locus_tag="DEHA-IPF6995"
FT                   /old_locus_tag="DEHA-CDS2290.1"
FT                   /product="DEHA2A08976p"
FT                   /note="highly similar to CA5757|IPF1067 Candida albicans
FT                   IPF1067"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84679"
FT                   /db_xref="GOA:Q6BYJ9"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ9"
FT                   /protein_id="CAG84679.2"
FT                   /translation="MTKISCDIESDRVAELDKLLGLIKPKILHYIDKADPNSSNYETDS
FT                   LGKYHSPEFLKNQFTDDKQLDSGIKGDYEKLSSTIDQVLKYSVNTWNPGFLDKLYASNN
FT                   PIGVISDLILSILNTNSHVYTVSPALSVLENYIGKKYAQLFFDDDQETCGGLTFSGGSW
FT                   SNITSMQIARALKYPDTKENGNTNYKFAIYTSEHCHYSVVKGAILLGLGSSNVFKVKIL
FT                   PDGSMDVNNLSEVIERSVEQGYTPLYINGTAGTTVFGSYDPFEEISKVAKKFDCWFHID
FT                   GSWGGNVVFSQTHKSKMKGSKLADSVTVNPHKMLGIPATCSFLLLPHVSHFQKSMSLSA
FT                   PYLFHGRESDDDSIENYDLADGTMGCGRRADSFKFYMGWLYYGKEGFANRVDHAFAIAK
FT                   DFVEKISKNPKFKLVIGSEKDLPACLQVCFYYKPSDYTDHDNTEITRFISRELHKRGRY
FT                   LVDFSPNPTDKNNEGEFFRVVFNSPTLTDSVVDDLINSIIEVGAEYKK"
FT   gene            complement(<749509..>750039)
FT                   /locus_tag="DEHA2A08998g"
FT   CDS_pept        complement(join(749509..749884,750029..750039))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A08998g"
FT                   /product="DEHA2A08998p"
FT                   /note="highly similar to uniprot|Q02772 Saccharomyces
FT                   cerevisiae YJR034W PET191,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84680"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ8"
FT                   /protein_id="CAG84680.1"
FT                   /translation="MGASCKDQKKALAICLQRSPCVLIERNTPKKCLSDPELKKDLPEL
FT                   CIANFRAFMECRNGMFDMRKRMKGNAPLSTGKYDDTYENLSSGNFEAHEEMKKLEVLNR
FT                   NLSRQRLLREEQERARLAGTLEKN"
FT   gene            <750399..>754733
FT                   /locus_tag="DEHA2A09020g"
FT                   /old_locus_tag="DEHA0A09229g"
FT                   /old_locus_tag="DEHA-IPF6997"
FT                   /old_locus_tag="DEHA-CDS0127.1"
FT   CDS_pept        750399..754733
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09020g"
FT                   /old_locus_tag="DEHA0A09229g"
FT                   /old_locus_tag="DEHA-IPF6997"
FT                   /old_locus_tag="DEHA-CDS0127.1"
FT                   /product="DEHA2A09020p"
FT                   /note="weakly similar to uniprot|P47104 Saccharomyces
FT                   cerevisiae YJR033C RAV1 Subunit of the RAVE complex which
FT                   promotes assembly of the V-ATPase holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84681"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ7"
FT                   /protein_id="CAG84681.2"
FT                   /translation="MTINFVPGEVNNSPYSVSQGLWKSHHIIAYGSGNNLIIYATTTDS
FT                   TKHKKSDHLQTIYLEADPYAIDVNSSNGFIVISIGNNIVVYKPLNEYMSKPQWSHALEF
FT                   DNVDSTMISCLQWAPLEDELIVGSKETLALYHIYDEYGSLRYEKRWHSIQANPIINIKI
FT                   TNNSNKIITLSGNYERLVKVWSRINYGENTLFELSYLNHPLNTYVTDLKWKYRIPSDSI
FT                   NTVDSSMANIKNIRGYIDNGNDDNDIIYTLTNDNILRVWAAYEFSGHNHFRSWASLDLS
FT                   ECFVDDEIISMVTIDNFHLQKTLIPQIEAGNGSSNIYKYFENQNLNDLDLLFVISKQGK
FT                   VAIYSILNISLTPPNAIKFERLDQSNMSFDKNSFPNGINYTKFENLTKEIIQSEEFLIN
FT                   LKPIIFPELEFLDNSDSSTGLSILIHDRLKNTIRFNAFEFKNILKSDSSVLGAKLIDKF
FT                   QGHTKSIRKLVKSYSSSASNNIVFSISNFPEHNYLWEPLSIGSSNTESMTITKKFQVNL
FT                   NHGSNINEKNQGIWDSVLLNDIEPPNKIGRHHLVVALEKNGLISLWDCNALTLDIQEAA
FT                   LLERLEILNSINERIIREPRAFVITEFPNESNHTKEYCIIAIFENDLIKAWKLIININT
FT                   QPLSTSLKPLNINNLPQDEKIHQIALIDSFESKGERNLVSVIDKQDKVKFFAINFAKSR
FT                   DSLEWIETYRLHTNISEATKIHGASIINKFAIVDKTGSRLTIWDTKSGVLEYEETFDDS
FT                   YGAVTDLDWTFITSNSERSTSNAILSVGFSRFVLLYTQLRYDYTNKIPTFAVLKKIDIS
FT                   NYTSHEIGDSIWLDDGYLVIGCGNQFFIDDKWVKLGSSANNSLDSTIRQLMVGYTNIEN
FT                   EDYDSSQKETKSTYDMIYDIEQLVRILNGPLPVYHPQFLIQCLFMHQISLVKDVFVRLF
FT                   QILRKGDSIQWDLSMDLTNEVLENNESRQSGASTPSLSSKIDIINDAFSSKFDSSGIHI
FT                   FNSFNDNLSDLLIEKLMKISLPLLTRHQQITLISIISIVKELGKYLMSLDENGLRFLMG
FT                   FKLFQLSSKQSKLTTRDISWALHSDNKEMLLTMVEEYFKNRLKWENVKQIGLVYWVETI
FT                   RLTKIMESCARNEFSDTRDPSGRVSLFYLAIRKKQVLIGLWRTVSHTEQQKMLKFLAND
FT                   FNESRWKSAALKNAYVLMGKHRYIDAAYFFLLADALKDCCNIIATKLNDVQLAIAIAKI
FT                   YSATSKGTISEGEIIKNLIENYMVPEVLKNGDRWITSWIFWELEEHEISIQALIKSPIE
FT                   IINHHKAKFSDDCSKNYISKITPRFSSMSFLKDDPVLIILFHALRQKTIKYLKGSLSIA
FT                   PDEEFNFIIKVCSIYTRMGCDYLAVVLIRNWSFLKYDESKNEIKWSNHTTENTNQSNEQ
FT                   QNTLSFTENGIHPENMTQKINAQPPPPTAFQEPDMSAFDFGF"
FT   gene            complement(<754777..>755379)
FT                   /locus_tag="DEHA2A09042g"
FT                   /old_locus_tag="DEHA0A09251g"
FT                   /old_locus_tag="DEHA-IPF6998"
FT                   /old_locus_tag="DEHA-CDS5798.1"
FT   CDS_pept        complement(754777..755379)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09042g"
FT                   /old_locus_tag="DEHA0A09251g"
FT                   /old_locus_tag="DEHA-IPF6998"
FT                   /old_locus_tag="DEHA-CDS5798.1"
FT                   /product="DEHA2A09042p"
FT                   /note="similar to CA1644|IPF9345 Candida albicans IPF9345"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84682"
FT                   /db_xref="GOA:Q6BYJ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ6"
FT                   /protein_id="CAG84682.2"
FT                   /translation="MFERSRFVSLHYYGKIFLENLQFACLFIIPLYLIVFTVPLVVNPD
FT                   TIDQFKINFKVVLLSKPFCEVKSEECQKLLDPEYGNPSLLLKTSFSDYELVYIRHYSID
FT                   YLDNILITLVDKSFFRPLILMIKKPTNPAEWWSKVLESLRVVMAIGNAMIFHAIKGVLV
FT                   SKMWVFFIFGAITTIYDSWASLIQTLSGVLRSANTIF"
FT   gene            complement(<755482..>755554)
FT                   /locus_tag="DEHA2A09064r"
FT                   /old_locus_tag="Deha0A.8"
FT   tRNA            complement(755482..755554)
FT                   /locus_tag="DEHA2A09064r"
FT                   /old_locus_tag="Deha0A.8"
FT                   /note="tRNA Arg (CCT) cove score=66.21"
FT   gene            <756870..>760286
FT                   /locus_tag="DEHA2A09086g"
FT                   /old_locus_tag="IPF_7002"
FT   CDS_pept        756870..760286
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09086g"
FT                   /old_locus_tag="IPF_7002"
FT                   /product="DEHA2A09086p"
FT                   /note="similar to uniprot|P38929 Saccharomyces cerevisiae
FT                   YGL006W PMC1 May be involved in depleting cytosol of Ca2+
FT                   ions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65390"
FT                   /db_xref="GOA:B5RST4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST4"
FT                   /protein_id="CAR65390.1"
FT                   /translation="MVALNPNKYGQNLGVEPQKFQDESDQASTSSASPLTGEPYSIGPD
FT                   DLAELHDPKSMKKLYELGGIDSLSANFTTSIKGGINDEDQHDMKKRMEYYGKNKLPTKV
FT                   RKNFFELCFDALKDKVLILLSVAAVISLALGLYETFGQGVMYDDEGNALPKVDWVEGVA
FT                   IMVAVAIVVLVGAANDFQKERQFAKLNAKKEDRELIVIRNGSQKMISIYDLMVGDITNL
FT                   QTGDVLPADAILISGEVECDESALTGEAKTIRKSPAEEAMQFYESQLPTNEDIGSSSIK
FT                   FEDPFLISGAKVLSGLGNAMVTAVGPNSIHGRTMASLNHENETTPLQLRLDNLAEGISK
FT                   YGFLAALVLFIVLFIRYCVNIAPGGKFNLLKSAEKGKKFVDILITAITIVVVAVPEGLP
FT                   LAVTLALAFASTRMAQNGNLVRVLKSCETMGGATAVCSDKTGTLTENRMRVVKGFFGNQ
FT                   EFDDTVGSDGPRSSDMFSQMLDNLKVFYCTNVAINSTCFVNSEYDEEKAKLAKQKPKRQ
FT                   SLIKHLLTNSNDRQKRQVEFSQNNEPYLGNKTESAMLILADEKLNLFGKRSLEQQRQDS
FT                   SSDVVQVLPFESSRKWSGVVMKIENGFRFYCKGAAEIIFKNCGYQFDSNGDIIRMDRNL
FT                   RDAALTKIDQYANDALRAIASCHRDFVGISSWPPQELVKDIKSEADAELLINVSGNLED
FT                   DRKMMIMDSIVGIQDPLKEGVPESVLRCKQAGVSVRMVTGDNLITAKAISKSCNILTSE
FT                   DLSNEYAFMEGPAFRKLSAQERDKVAPKLRVLARSSPEDKRILVETLRSQGEVVAVTGD
FT                   GTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTDIVQAIKWGRTVASSIKKFI
FT                   QFQLTVNITACLLTFVSAVASSENKSVLTAVQLLWVNLIMDTLAALALATDKPDESSLR
FT                   KKPAGRHTPLISVSMWKMILGQSTTQLIVTFVLHFAGKSIFFGSRPATNHENQQLDAMT
FT                   FNAFVWLQFWKLIVTRKLDEADGVSKVRDRLTRDNLDFTQHLFRNWYFIGIAAIIGGAQ
FT                   VLIMFVGGAAFSITRQTPAMWGTALICGFLSIPAGLILRIIPNEWVVAIFPTKAFNIFI
FT                   YYAGFKFLRSKKKAKSGVNDDLERFSSSDKD"
FT   gene            complement(<760431..>761180)
FT                   /locus_tag="DEHA2A09108g"
FT                   /old_locus_tag="IPF_7003"
FT   CDS_pept        complement(760431..761180)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09108g"
FT                   /old_locus_tag="IPF_7003"
FT                   /product="DEHA2A09108p"
FT                   /note="similar to CA5760|IPF1072 Candida albicans IPF1072"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65391"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST5"
FT                   /protein_id="CAR65391.1"
FT                   /translation="MTQVNDESLSMFFDSDFNPSNYVDALFQSISNNKSQSQIYSKNNL
FT                   QSLSNKCSNLVTHLDYHTSELSNDLISQIETLQNSSKIITQGLNNDEVLNASNDMTRLQ
FT                   YFINTLNNSILLLQTDIKQVNEELNVNNESQPESINSLIKLKGIKNNLNQVLVIFERLN
FT                   SITMNNPDSTTVESFQSSLNTLYETIRNQLTNEENEINQLLVTNIKELINLLPFFQNLT
FT                   NFYPIYKKFTNKLNIDLDHYLSTNKHS"
FT   gene            <761294..>762478
FT                   /locus_tag="DEHA2A09130g"
FT                   /old_locus_tag="IPF_7004"
FT   CDS_pept        761294..762478
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09130g"
FT                   /old_locus_tag="IPF_7004"
FT                   /product="DEHA2A09130p"
FT                   /note="weakly similar to uniprot|P53196 Saccharomyces
FT                   cerevisiae YGL004C RPN14 Putative non-ATPase subunit of the
FT                   19S regulatory particle of the 26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65392"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST6"
FT                   /protein_id="CAR65392.1"
FT                   /translation="MDLLTIQDSFEEVISDIQNGRLEQDKFWVARRSIESEENQDFWYI
FT                   NVTKQGMKDDGNKIKFMCGKDKKYQLQVDEKIYNLQSFYRKVNLANNRISSVAVSSDSE
FT                   RFIVGTKKGELIIYNLRTDTVEQKIPEAHFEDITMLKFFPSDKVVMSVGIDLKIKLWGL
FT                   TGELVRTMSNQVKEITEIGLLGKTGRNFISGSKDGSIDMWECGHGQVIYSFKRIQNNND
FT                   PVNCFVLGRHESTGSKLSELEVETENQCVYVGFDSGIIQQFNIGDHCQTSVRFEDGNAG
FT                   VSSIDISDNILVSGYNDGQLKVWDIAGGNMVFKYQLNSHFPISTLKVLHRQDDTITVLV
FT                   YNGPETLLKLEIDLKSEVVNQTYLIGMEENFSVHDVALNKDNIIIASDQLTVYK"
FT   gene            complement(<762813..>763196)
FT                   /locus_tag="DEHA2A09152g"
FT                   /old_locus_tag="DEHA0A09361g"
FT                   /old_locus_tag="DEHA-IPF7005"
FT                   /old_locus_tag="DEHA-CDS6561.1"
FT   CDS_pept        complement(762813..763196)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09152g"
FT                   /old_locus_tag="DEHA0A09361g"
FT                   /old_locus_tag="DEHA-IPF7005"
FT                   /old_locus_tag="DEHA-CDS6561.1"
FT                   /product="DEHA2A09152p"
FT                   /note="highly similar to CA1558|IPF15679 Candida albicans
FT                   IPF15679"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84686"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ2"
FT                   /protein_id="CAG84686.1"
FT                   /translation="MSDITVDGFNASPLFKDLSEALQDDKIKQKAISGVKATLVLTLKN
FT                   KEGKEQSWLLDLKKDGTVKKVDSVPKSDVQLILKDADFVKLATGKSNGQKLFMNGKLKI
FT                   KGNMMKATSLEGVFKAIGPKAKL"
FT   gene            <764375..>764962
FT                   /locus_tag="DEHA2A09174g"
FT                   /old_locus_tag="DEHA0A09383g"
FT                   /old_locus_tag="DEHA-IPF7007"
FT                   /old_locus_tag="DEHA-CDS5416.1"
FT   CDS_pept        764375..764962
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09174g"
FT                   /old_locus_tag="DEHA0A09383g"
FT                   /old_locus_tag="DEHA-IPF7007"
FT                   /old_locus_tag="DEHA-CDS5416.1"
FT                   /product="DEHA2A09174p"
FT                   /note="similar to uniprot|P40470 Saccharomyces cerevisiae
FT                   YIL127C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84687"
FT                   /db_xref="GOA:Q6BYJ1"
FT                   /db_xref="InterPro:IPR031404"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYJ1"
FT                   /protein_id="CAG84687.1"
FT                   /translation="MSFTSKTSKSHAEATVNKLFSSLLPGTQGTTSKQSSSLSSAELLS
FT                   IEIENKNKLSKEELKKIHKQNKFKQHKKIKKALEDEKRFNKLAKYHLIKHHKTGGELSE
FT                   EEAKYLKKLVKKNVNSLNRVSEIDDMEIKSELDQVRQDILKINKEKHDKKAKRIQNKKT
FT                   KDFNSKVAKGMISYPGLTPGLAPVGLDDSDDE"
FT   gene            complement(<765032..>768346)
FT                   /locus_tag="DEHA2A09196g"
FT                   /old_locus_tag="DEHA0A09405g"
FT                   /old_locus_tag="DEHA-IPF7009"
FT                   /old_locus_tag="DEHA-CDS0320.1"
FT   CDS_pept        complement(765032..768346)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09196g"
FT                   /old_locus_tag="DEHA0A09405g"
FT                   /old_locus_tag="DEHA-IPF7009"
FT                   /old_locus_tag="DEHA-CDS0320.1"
FT                   /product="DEHA2A09196p"
FT                   /note="weakly similar to uniprot|P40469 Saccharomyces
FT                   cerevisiae YIL128W MET18 DNA repair and TFIIH regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84688"
FT                   /db_xref="GOA:Q6BYJ0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024687"
FT                   /db_xref="InterPro:IPR029240"
FT                   /db_xref="InterPro:IPR039920"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYJ0"
FT                   /protein_id="CAG84688.2"
FT                   /translation="MQSSESIHDIPTLINQFIASADDSDVSITYSKELAELIEKDEMTL
FT                   LKFIQSLGPNLTSDSDLIRSKSIQCMSESLKCLNVNKLSKQDINVLFEFLLAKFEDIFC
FT                   LGHILSSLNSLISFKNFIFGMNNNVEKLLTNILNNYDPKKHLAKVRYEPFRTLNALVTI
FT                   DPVYFQSSSRVSDLMVKTFIHVASGEKDPRNLLLSFDTNTKINEVFEFDPLNEVHKDLI
FT                   SELFDVCFCYFPISFSPPPNDPYKITAQDLKLKLRNTIASQSYFAKESFADLIEKLTST
FT                   NPVIRNDVLKTLLLCVENYKLETVAEYWVTIWNALKFEVLHNDVSIFKPYIDVIVPEDY
FT                   DEEIDDSDEFKPLITTLVIIKKLANRMTDFGELENLLTTITNELKSNLVTINDKSFKQS
FT                   VLLLSVLASDSSAGFNFIIKFLFLQEIWGKYINADEDSSIEEVPSELDKTEDLVLNTSK
FT                   QKELIDNLGFVLTSYNVLLGNLENQDEFIENNNLKLYKDHLLIFMGQLLQASSNLEKTL
FT                   KCKVIQQLIKLAQLKGFLNVQECTLILGYFSNILLDTANSKSKNWEKDQVTKEIVNGLI
FT                   KLMNSEGASNNDKTALVIDLILPHLLEILPSTDSLSNFKKLLEIIGELCTNYQFLEVLS
FT                   IRLLNRLTNYDQFNIDQFEVFRNITNLLVESIKKVQVSKQFLMNSWYKNFVPRFINCLL
FT                   EILKVKDDHILIELSGDLIGLIVKYNDKSKHQEILNDFVAMFLLDKANGFNVNVNVIHQ
FT                   QKPLINLFNKILANIDKACVVQLNDTFTMNELTDRIIGLCNSRGDEYSRLGYLQNLSLL
FT                   VNKFLQSNEFIEEKLKLTFENISNISKFDSVLSQDQIESFEVIVWILKSLILKIDTLGI
FT                   EYINRLISLLSCENRQMQQLTAKSFNILMIDLPIFTNQQIGGKTKIISGVQNLNVRLLY
FT                   KQKVFGILLPKIIEGYNISNIRNKENYLISLSLILNNVPHSILKSYLSQILPLILNSLN
FT                   LPNPIILNASLATCEIIIDESPDLVIPHLSTLIPKLVGLSMGKIVVEKSLVNNEEVRLT
FT                   SLNCLQKVFSNIELKYIIPFQKSALNKLTPGLDDKKRTVRKLCCDVRQTLFELGKY"
FT   gene            <768772..>777180
FT                   /locus_tag="DEHA2A09218g"
FT                   /old_locus_tag="DEHA0A09427g"
FT                   /old_locus_tag="DEHA-IPF7013"
FT                   /old_locus_tag="DEHA-CDS0006.1"
FT   CDS_pept        768772..777180
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09218g"
FT                   /old_locus_tag="DEHA0A09427g"
FT                   /old_locus_tag="DEHA-IPF7013"
FT                   /old_locus_tag="DEHA-CDS0006.1"
FT                   /product="DEHA2A09218p"
FT                   /note="similar to uniprot|P40468 Saccharomyces cerevisiae
FT                   YIL129C TAO3 Transcriptional Activator of OCH1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84689"
FT                   /db_xref="GOA:Q6BYI9"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025481"
FT                   /db_xref="InterPro:IPR025614"
FT                   /db_xref="InterPro:IPR029473"
FT                   /db_xref="InterPro:IPR039867"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI9"
FT                   /protein_id="CAG84689.2"
FT                   /translation="MIEIPDLDESSPYQYVLDQSQVQRSQQPQQPQQPQQSHHIRHISD
FT                   ITGDYRRNTTDEPTDSAASEVKKYALYESSEGPMPDQEDENSEDPHIQDQHSRQFRQFQ
FT                   YPNEANGVGDSDLPAPPVPKAIASSIDNLSYVPGLDSLASLALSEESNDTNAQIIEYNT
FT                   AQPLFMNQINMTGAPTSDTPRVHVVEQHGYGQETFKLQDPPLIHDKYSLQNTEHDKEED
FT                   KLGELGYIKKGDASNSNLSLSQQLASPMSQFPIHDYTKESPQLPPPLSTITNKRLTLSN
FT                   GEEFSYMRKELATYSKTPAEYTLHIVFTQFVRHAERKLNLCLDYPLMEEPPVVEILAEG
FT                   VDSQFDKIVASLGYIARRKPKPVIDSVMFWRKSKSEVASMAASEVEKILSTAKSNLSKA
FT                   QHNDNIPASNPVINKNSNTGNKAKRSLSLMRTKSISKMTGHSRNQSTSSTMSNQTTLKS
FT                   PNLTQMKSSESVPFKQRNLYDDQITQARETAIQADRKSLASIYILCRVLIEVVKQASPE
FT                   VMGNDLGDKLEEIVFTQLKTTDPTSKNESLVRSSNWNLFAELLGYMSEKRFLSVSDRFI
FT                   ANLERIPPKIKHEDEPKLYLLIQGMSYLKLTNYPLETFEESAEFIQSLAKFFEKSNNES
FT                   IIFAYCEVLSNLLLPLASILTAETNHPTWVEAIEKIYNKASFTWKNVNKPINSNIMLNK
FT                   LKPNSSYNIVNFNNSWAYSIHLMTSALSVSRKELFSDTWFDIIEHNMFKLKPKVEISDK
FT                   STFIVCVARLVWVYVYRLNDTLNNTIKKLDNLFNLLFFNSSATSKKQQWLVADKNLINA
FT                   LVEFIRIIGFQHLNYALDNVLTKLLKLSFNGVSLENAYPEKIMLVVKSYLTILEDYEHG
FT                   DKPCFPTDDVFNSLSVSQNHNASSTSKFVKSRDKRFKSNEIMLIAKNSTNAFSHEEICR
FT                   NLAVLLKLLDGQYGSGIWSSDSSSSSTPLSSTSKSQATFSAFHFGIDFSYQPTKDLHME
FT                   LFATLIEAIPWTLVPFNGEKSSACGLPFKNVVDILTRNAVHANPVVSKAALGSLKKLAS
FT                   RKNPNSLITIFAKFAFQFSDKPGPSYNSDYINSSESHKLLKVYVELLSCWLKQFNKIEE
FT                   DEGNKKSSNPLAQDDELMNKDVLNDLYQINYKSEDLSNSNIVKAKRSDELEWKTIITVI
FT                   EEIEGNGLFFLCSQDSQTRHYGISILKLVEQFDQAIYNMSDTVQKQNEPTGVTRNRLSK
FT                   GHSRSSSKFAADVGTRLIHVLEDTDFLGLIKPFKNELSMPERSRLTKLKNKKNILVKLA
FT                   ESDYGIDSTLWFRLYPKLLDIFFERCPMPVAMCRSIVCVRMVQMYEFVFEFSESYKNYT
FT                   SSLFGKSSANIPPEVLVNQWRLYLIFACCSLTSTNEQKISFPSQPTHGRKKSMQMFIQH
FT                   QKITSAKSVFRMVLPFLRSQQPMVRDAVISGLTCININIFKTLLENLPESVNEWNINSK
FT                   GRDEAEDRLRIEVIHILCNITNRFKSDVFIYSDEWMIANLVSIIKNVKSFLSVPLVQTD
FT                   VEFQRLRRYFCGFLENVFIGLQDNSDLDKWLPFEARIGCFNFLKEWCGVGDSADVTEDR
FT                   YNTMVKRVKQLKETTSTVAILEVEKKALQFASLSTMAILCSGPIKQKIEVVGKIAVMSF
FT                   DISELMDWVRALICSDDEKINEMGEMALKNILQLNLNNDELYQKVLRQCYSRQSSSKVT
FT                   VSFFTIFVDIIMKLKQFDGIPFDIICLSTVMIGHEEYDVRFSAIKLLVFLEEKFYNSSV
FT                   VDSFSECVCSKSKLVYQKALFDISTHFASLHPESAYIRISHLTMFFDDVDDWSRRNTLT
FT                   CLRPWISTIELKRTEDTQDIPDQNSKSKSLTNKLDIPSVMVLNNLIEITVKFSSTVSNE
FT                   VEALWVALGSNLNNFDKIFEFIMNNCLEGKNPLMVKLSCQIVDYLTFCQPNPVSIVDKF
FT                   MENLQPKAMVPSQPSTNYLTSVASPEFPYISNLWDIIPYNEKDAVFSSGQLSMVFLVDV
FT                   FTIQNDRMIERLPLLLHVAFSLLDHYLNIVQESAGSLLIHLIHTLAPKEPKSAETIEAL
FT                   RQRDHFKYLWVYDDLNNDKKGARTPKNMDLLARNILEILTPVVPTLQDDWSRVSLHWAT
FT                   TCAVRHIACRSFQIFRSLLSFLDQGMLKDMLHRLSNTISDETLDIQGFAMQILMTLNAI
FT                   TAELNSEKLIDFPQLFWSSVACLSTVHEQEFVEVLSTMSKFVSKIDLDAPDTVSCLIST
FT                   FPPKWEGKFEGLQQIVMVGLRSATAWEASMKFLDKLNHLKDSEIIGTGDSRLLMSVLAN
FT                   LPRFLHALDQKTISKDIEETANVMSKMADNCGKPALARILVSLSKNRFRSKKDFLVQTV
FT                   SSINNIFFPEYEAQVLVLLLGFLSNRTPWIKLETMNLLKHIFPLVDLERDEFVGVGADL
FT                   ISPLLRLLLTDYAEPALEVLDEAVIISGSQLDKDVLRMSLGNSSMKKEYEKTATLFGIP
FT                   EESGWAVPMPVVTAASTRNNVYAVFSTCTEATYVDENDEESNDDENIQFHMEDYYAPVV
FT                   DHGDAASASVEEPDASLSNMWAALDDFDSFFTKDTDQNGPLPISTLAARRDSYNHHIHS
FT                   ASIDTKYSNSSDPTTFMDSAPQVYDNKASLILNRSLARTKSNTSFKNNLADSIGASEHV
FT                   SPGASTMYKKSYIPFRHSKHPIKTKNESYITPKMPTSSTFDPEYTISPKSLSLSNSTLS
FT                   PYEDEASSPIIKNMESTSPSINETPTRFENLIGGSKRKTKKTNRFSPNYNNATASPNAP
FT                   HHYWGSNKHADASLVSNSSTPPSSTQTSQRLIQKSKDKKKRVA"
FT   gene            <777336..>778358
FT                   /locus_tag="DEHA2A09240g"
FT                   /old_locus_tag="IPF_7015"
FT   CDS_pept        777336..778358
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09240g"
FT                   /old_locus_tag="IPF_7015"
FT                   /product="DEHA2A09240p"
FT                   /note="similar to uniprot|Q12000 Saccharomyces cerevisiae
FT                   YOR091W RBF46"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65393"
FT                   /db_xref="GOA:B5RST7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR032378"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST7"
FT                   /protein_id="CAR65393.1"
FT                   /translation="MAPKKKPQISDKNKAKAKTKAVGDKTFGLKNKNKSKKVQGQINQI
FT                   EAGADGGLAKKKEAEAKRRAAEKKAAEEAKKETAALYGIQQPKVPFGVDPKSVLCEFFR
FT                   KGVCAKGPKCKFSHDLNVGRKDLKKDLYTDARTEKEEDTMDKWDEEKLRKVILSKHGNL
FT                   KTTTDIVCKYFIDAVENGKYGWFWVCPNGGNECKYRHSLPPGFALKTKEQKRLERLASE
FT                   SAPKISLEEFLELERGKLDRSKFTPITLDTFAEWKKKQIAKKADEKKREEERNGRKVLT
FT                   GREIILNKFADKFYTEEDNTDQGTEWDLSEFRKNLPETEDSFKDYGDGIVDFEKKPNQE
FT                   "
FT   gene            complement(<778503..>780509)
FT                   /locus_tag="DEHA2A09262g"
FT                   /old_locus_tag="DEHA0A09471g"
FT                   /old_locus_tag="DEHA-IPF7017"
FT                   /old_locus_tag="DEHA-CDS0981.1"
FT   CDS_pept        complement(778503..780509)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09262g"
FT                   /old_locus_tag="DEHA0A09471g"
FT                   /old_locus_tag="DEHA-IPF7017"
FT                   /old_locus_tag="DEHA-CDS0981.1"
FT                   /product="DEHA2A09262p"
FT                   /note="similar to CA1501|IPF13217 Candida albicans
FT                   IPF13217"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84691"
FT                   /db_xref="InterPro:IPR017210"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI7"
FT                   /protein_id="CAG84691.2"
FT                   /translation="MQRNGSPPDTSREQTEPPTPTPQSPNLSRRQRLLGLAKATRDSYM
FT                   PKISSIASGVSSRALGGDYYDENGNVRLPKDATIALFPAYTRKTEDGKYHVDVKGWLSC
FT                   PGVMSRKNRLILSLAKQITRYSSNPTTAKQAINELENDKLEPDVITPSDDASSDLESIN
FT                   SKDSSINTISQNENKPLQASVTNSSVRSSTPSFNDDLLKERLSNFIARSIASAELVISI
FT                   GSQDRLDLNELEHNSVITDGYGHFEACVEVNYEPSVIQVKAATDESIFSFQDIMLIPSE
FT                   GLGLISDIDDTIKLTGVTGDKRELMRNLLLNDVSSWSIPPVVKWYSQLYDHKCISFHYV
FT                   SNSPWQLFSSIHKYFEEVKLPLGSVHLKQYTGSFISSLMEPSSSRKKRALSKIAEDFPK
FT                   KKFICVGDSGEHDLEAYADLARSYPSRIIAIYIRCVEDSLSDIDDKKILKELTRLTSKK
FT                   KPKAISKQLSSKPNNDEIENLIDLTDDTPHFAADRSKKLPPMIPHKPITLQGNKLGRKP
FT                   PLPIRDELKKSHTDTELAHSNSTDSTSSNGKESSWKDLTTIQKDSDDSPPPTPLRRPTS
FT                   FTSKANAEGFTTASNHDYNVFDNLQDVYDTHNYYELEDVDKKGAQWIRRVVTALEALEG
FT                   TDTRIKFFTDDEHDFFTSSIDIVKDYVHRNNSN"
FT   gene            <781271..>783115
FT                   /locus_tag="DEHA2A09284g"
FT                   /old_locus_tag="DEHA0A09493g"
FT                   /old_locus_tag="DEHA-IPF7019"
FT                   /old_locus_tag="DEHA-CDS1548.1"
FT   CDS_pept        781271..783115
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09284g"
FT                   /old_locus_tag="DEHA0A09493g"
FT                   /old_locus_tag="DEHA-IPF7019"
FT                   /old_locus_tag="DEHA-CDS1548.1"
FT                   /product="DEHA2A09284p"
FT                   /note="similar to uniprot|P38822 Saccharomyces cerevisiae
FT                   YHR114W BZZ1 SH3 domain protein implicated in the
FT                   regulation of actin polymerization"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84692"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR035459"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI6"
FT                   /protein_id="CAG84692.2"
FT                   /translation="MSLQEVSIGNDLKDSFKPTSKWVNNGINWINDIEEFYRERATIEK
FT                   EYASKLSELCKKHFEKKAKNSTSLSVGDEPQITPGSLESASLVLWNEVLTQTEAIAEEK
FT                   VSFSREINTKLGDNFSSLKNKTGRIAKQIESIDEYLVSEKTKTEDEVNKAKKQYDSLCE
FT                   STESARQKTEKSSSEKHQQKLQEKEVAMNIGKNEYLIKINIANRLKDKYFYQDVPELLD
FT                   YFQELNETRVGLLNKLLKNASIIERNSNDRIKEKLHIIDSTIDQNNPKLDVAMFIKHNA
FT                   FDWKEPQDFYFIPCAIWHDDESLITKEPELTELKRRLNVCSSDIAKYEDSCIESKQSLE
FT                   ELTASRKAELTNLTLKFDTKFNNSLSLLQRFLKTDSERIKNEVEIEVIQNFAGDKDLSY
FT                   FEVREKKKSKFGFLRGKKHSSSSSGGAVANDNSSDIHSLHTVKSGTSQKSHAGLFSLRR
FT                   NRGQSNASSASTGPKGKALYQYDATGDDEASISPGEQFDVVDEDDGSGWTMIRTNQGNE
FT                   GLVPTAYIEVTMGAPSAPSVNSGGKKKGPSVAPKRGAKRVQYVEALYDYQADGDDELTI
FT                   TAGDKIALVQADTDGSGWTEGELNGVTGMFPTSYVKEA"
FT   gene            complement(<783407..>783973)
FT                   /locus_tag="DEHA2A09306g"
FT                   /old_locus_tag="DEHA0A09515g"
FT                   /old_locus_tag="DEHA-IPF7020"
FT                   /old_locus_tag="DEHA-CDS5493.1"
FT   CDS_pept        complement(783407..783973)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09306g"
FT                   /old_locus_tag="DEHA0A09515g"
FT                   /old_locus_tag="DEHA-IPF7020"
FT                   /old_locus_tag="DEHA-CDS5493.1"
FT                   /product="DEHA2A09306p"
FT                   /note="highly similar to uniprot|P26786 Saccharomyces
FT                   cerevisiae YOR096W RPS7A Protein component of the small
FT                   ribosomal subunit or uniprot|P48164 Saccharomyces
FT                   cerevisiae YNL096C RPS7B Protein component of the small
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84693"
FT                   /db_xref="GOA:Q6BYI5"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI5"
FT                   /protein_id="CAG84693.1"
FT                   /translation="MSAASKILSEKPSELELQVAQAFVDLEGQSDLKAELRPLQFKSIK
FT                   EIDVNGGKKALAVFVPCPSLAAYRRVQTRLTRELEKKFPDRHVVFLAERRILPKPSRRS
FT                   RQQQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDSTAVDYK
FT                   LDSFQQLYQKLTGKQVVFEIPSDVY"
FT   gene            <784462..>785220
FT                   /locus_tag="DEHA2A09328g"
FT                   /old_locus_tag="DEHA0A09537g"
FT                   /old_locus_tag="DEHA-IPF7022"
FT                   /old_locus_tag="DEHA-CDS4936.1"
FT   CDS_pept        784462..785220
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09328g"
FT                   /old_locus_tag="DEHA0A09537g"
FT                   /old_locus_tag="DEHA-IPF7022"
FT                   /old_locus_tag="DEHA-CDS4936.1"
FT                   /product="DEHA2A09328p"
FT                   /note="similar to uniprot|Q12189 Saccharomyces cerevisiae
FT                   YOR095C RKI1 Ribose-5-phosphate ketol-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84694"
FT                   /db_xref="GOA:Q6BYI4"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYI4"
FT                   /protein_id="CAG84694.2"
FT                   /translation="MLKRIISARYIRNMSSGASLVEKAKKSAAYQAVDENFPEGAKVVG
FT                   VGSGSTVIYVAERISQLKNKESFVCVPTGFQSKQLIIDAGLRLGTIEQYPEVDIAFDGA
FT                   DEVDTELNLIKGGGACLFQEKLVAAAASKFVIVADFRKRSPSKLGIQWRKGVPIEIVPC
FT                   AYAKVSKDLEAMGAKKVELRQGGSAKAGPVVTDNNNFLIDADFGEIEDPAKLHTDIKQL
FT                   VGVVETGLFVQMAYKTYFGEESGEVKCWSK"
FT   gene            complement(<785380..>785985)
FT                   /locus_tag="DEHA2A09350g"
FT   CDS_pept        complement(join(785380..785892,785971..785985))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09350g"
FT                   /product="DEHA2A09350p"
FT                   /note="similar to uniprot|P40994 Saccharomyces cerevisiae
FT                   YOR094W ARF3 or to YDL192W uniprot|P11076 Saccharomyces
FT                   cerevisiae YDL192W ARF1,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84695"
FT                   /db_xref="GOA:Q6BYI3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI3"
FT                   /protein_id="CAG84695.1"
FT                   /translation="MGLLVSKLFKNREMRILMLGLDNAGKTTILYKLKLGKASTTVPTV
FT                   GFNVETVKHKNVSFAVWDCGGQERIRPLWRHYFTGTNALIYVVDSSDHTRLEESKTELL
FT                   RVISDKELSGCLLIVLANKQDVPGAIKPKELIDRFDLHNLPGQHTWSVIPTVAIDGTGL
FT                   IETLNWISKHDT"
FT   gene            complement(<786440..>788731)
FT                   /locus_tag="DEHA2A09372g"
FT                   /old_locus_tag="DEHA0A09581g"
FT                   /old_locus_tag="DEHA-IPF7026"
FT                   /old_locus_tag="DEHA-CDS0938.1"
FT   CDS_pept        complement(786440..788731)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09372g"
FT                   /old_locus_tag="DEHA0A09581g"
FT                   /old_locus_tag="DEHA-IPF7026"
FT                   /old_locus_tag="DEHA-CDS0938.1"
FT                   /product="DEHA2A09372p"
FT                   /note="highly similar to uniprot|P53131 Saccharomyces
FT                   cerevisiae YGL120C PRP43 RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84696"
FT                   /db_xref="GOA:Q6BYI2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI2"
FT                   /protein_id="CAG84696.1"
FT                   /translation="MGEDRSYKKQKVEDSKAEEVAEAAEESLRLHPHPRERTPLVHHDD
FT                   GEFSNLTRHTTTSLQASKLEDGPKNPFSGKQLSSKYFDILKVRRDLPVHAQREEFLKMF
FT                   QSTQIMVFVGETGSGKTTQIPQFVLYDDMPHLMGTQVACTQPRRVAAMSVAKRVADEMD
FT                   VELGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMDDHDLTKYSCIILDEAHERTLAT
FT                   DILMGLLKQVSVRRPDLKIIIMSATLDAEKFQNYFHNSPLLAVPGRTFPVEIYYTPEFQ
FT                   RDYMDAAIRTVLQIHATEDEGDILLFLTGEEEIEDACRKISLETDELIRDQGCGPCAVY
FT                   PLYGSLPPHQQQKIFDPAPEPFRPGGRPGRKIIISTNIAETSLTIDGIVYVVDPGFSKQ
FT                   KVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSHPEIL
FT                   RSSLASTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLQCLSDEGDLTALGRMA
FT                   SQFPLDPMLAVMLIGSPAFKCSNEILSIVALLSVPNIFVRPASARKRADECKLAFAHPD
FT                   GDHLTLLNVYEAFNSDEAHNLGLHQWCRDNFLSYRSLLSARSVRSQLQRIMERYDLELV
FT                   STDFEDKSYWTNVRKALAAGFFMQVAKKKSGNKGYLTIKDNQDALIHPTTVLASESEWV
FT                   IYNEFVLTSKNYIRTVTSVKPDWLVELAPNYYNLEHFSKGDVKLSLERVIDRVQTMKKL
FT                   EKKKSKKSKK"
FT   gene            <789881..>791548
FT                   /locus_tag="DEHA2A09394g"
FT                   /old_locus_tag="DEHA0A09603g"
FT                   /old_locus_tag="DEHA-IPF7027"
FT                   /old_locus_tag="DEHA-CDS1922.1"
FT   CDS_pept        789881..791548
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09394g"
FT                   /old_locus_tag="DEHA0A09603g"
FT                   /old_locus_tag="DEHA-IPF7027"
FT                   /old_locus_tag="DEHA-CDS1922.1"
FT                   /product="DEHA2A09394p"
FT                   /note="similar to uniprot|P27697 Saccharomyces cerevisiae
FT                   YGL119W ABC1 Protein required for ubiquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84697"
FT                   /db_xref="GOA:Q6BYI1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYI1"
FT                   /protein_id="CAG84697.2"
FT                   /translation="MSVSKNIYELTAMANTMKKIAWDSVSVVERDATRVYEYSFLNKQL
FT                   KKCSGSSMWSDAMATAEAARHGIRMGGAVNQRRMYSTNSFSHPSLTPEQNMPNETQRKE
FT                   IIGVKKPEEFQMSSSEVPSTRLARIFHYGSLAAGMGLGAATQGIKHYASGNKTSISMKS
FT                   LILSPQNIERMAKKFSKMRGAALKIGQMMSFQDSSILPAEIQQILLRVQNSAHYMPPGQ
FT                   LERVMVNDLGNNWRERLFTSFEDVPVAAASIGQVHNAVTEDLTPVVVKVQYPGVVDSID
FT                   SDLNNLLTLLTASAILPAGLFLDKTIANARVELKWECDYIREAQNLIRFRDMIKDDPVF
FT                   EVPRVFHNLCGEHVLTMERMRGLEITKGNWDQNTRDWIATNIMRLCLLEIKHFKFMQTD
FT                   PNWANFLYNESTGKIELLDFGAAREFGDEFIENYILILKAAIKKDRDQIAHYSKKLGYL
FT                   TGLESPAMTEAHVDSILVLGEAFSPVDNKGKPFNFKDQTITDRVRGNVGIMLSERLTPP
FT                   PEETYSLHRKLSGVFLLCARLGATVPCEDLFKEIIGHD"
FT   gene            <791856..>794954
FT                   /locus_tag="DEHA2A09416g"
FT                   /old_locus_tag="IPF_7031"
FT   CDS_pept        791856..794954
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09416g"
FT                   /old_locus_tag="IPF_7031"
FT                   /product="DEHA2A09416p"
FT                   /note="similar to CA1713|IPF19743 Candida albicans
FT                   IPF19743"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65394"
FT                   /db_xref="GOA:B5RST8"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST8"
FT                   /protein_id="CAR65394.1"
FT                   /translation="METDDNIQSVNNKAPSSNRSLRHTNTTDDIKNLLSSPPERPKKFN
FT                   RQSSVILANTGERVHRTISLTNSSYESFDEDNLTERDSLLPQSNSNTSQRSISIYLNWK
FT                   YLRQVYHNDIFRSVLKCSVAYLIASMGVYYTPFNEFLGQTDSKHLVATVAVYFHPSRSK
FT                   GSMFQTLIFVVISLLFSFSVSFACRSIAGSFFKSGEDEISYSVDLIVSSISLGVIAFMK
FT                   QKVNKQTFNTACSLASISVVACIVKEGSLNAADIPIERLRSTAHVVVTGCVITVAMCYL
FT                   LWPVSAVDKLRNNLNDSYNIMSSLLSIIPNRILNGDKFTNQDAEYFNALKINIAQLNSS
FT                   FEESKFELKFKGREQELAIFAEIVNVTISLTRNLQALRSSTEMSWKLLHEENLEQNNES
FT                   HSSTSSLKSYDNEYMRLSRSTEYLTHINTQGVSGDSSNIDYTAINSTQLFDLFVYYLAP
FT                   SMKSFIFTLKGVLSEIPFENKSSPNTFVNTTNYQNSLKSALELFHDKQTKSFEKIYAQE
FT                   IFKPPSDFFSKADQEEVTACCGNFSSLLKLFAEDLIEFLQLAEDYEKSRKSSRTWHWLK
FT                   FWRHHPEINASVINENANLEHSLNEALINFQNHLGSGNISHVSRSPRAIERWSFSLWKA
FT                   LKVFRRIDVQFGIRVGLGAFFLSIFAYHPLTKHTFNLWRGEWALTIYCIMMNKSLGGTT
FT                   MTVKWRFIGTFLGAIAAYIIWILTDGNVYALSITGFLLSIPCFYIIIYWKKNNAFGRFI
FT                   LLTYNLTALYSYSMTQKDAEDGNEGGDEPIIGEIAFHRYVAVSVGILWALTMASCFLPN
FT                   SARGRLKNGLAILWLRMGVIWDSDPLDYVYDSSAKGSCLIGLKDQKGINDLLTECETLL
FT                   KQAPIEFRLKGSFPRVTYEKLLKSTSTIIDAFQNMNHMVRVDPKLSENEQYVLKYIAAE
FT                   RSELEDRIFLIFYMVASAMKLNFPLPVKPASMEHARDRMLYKLSEIRSYNATESELALK
FT                   NEDYFLLYSYTLVTSSISEELHKIVEIIKELLGELSEDMFQFV"
FT   gene            <795308..>796753
FT                   /locus_tag="DEHA2A09438g"
FT                   /old_locus_tag="DEHA0A09680g"
FT                   /old_locus_tag="DEHA-IPF7033"
FT                   /old_locus_tag="DEHA-CDS2478.1"
FT   CDS_pept        795308..796753
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09438g"
FT                   /old_locus_tag="DEHA0A09680g"
FT                   /old_locus_tag="DEHA-IPF7033"
FT                   /old_locus_tag="DEHA-CDS2478.1"
FT                   /product="DEHA2A09438p"
FT                   /note="similar to uniprot|P32505 Saccharomyces cerevisiae
FT                   YGL122C NAB2 Nuclear polyadenylated RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84701"
FT                   /db_xref="GOA:Q6BYH9"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH9"
FT                   /protein_id="CAG84701.2"
FT                   /translation="MSGFDPEGPIGQQLKASLVVELSNKFNIADDAEDVSEFILVLIGS
FT                   NKTASEISSEVRELVDIPIDEAFVNTIFAEIQRLMTQGQGVQQQPASEQAQPPSQQPIE
FT                   QQQIPQQVPQQVPQQVPQPAQQLIQQPTEQPVQQSSEVDQLEHSMEDAQVQPQQHDMLM
FT                   NLPTGPKGLQNRNQHTNNKFNNRGGINKNTNNRNGLKKSFAMQNPGNFEKVLAMSNSNV
FT                   TNLKQFVQKPAKGRCRDFPYCNNKECQFSHPTKLCFAFPNCSNPPGTCNYLHPVEDDEL
FT                   MAKLAKSKQEYMEKKKNTESAGTIGICKFGMLCSKDICPFGHPTPANKEAKVLVLQWCP
FT                   DGKTCQDVNCTKAHPSPNYQAPQVEMKPKPKPAQPELTLEQCKFGPSCTNLKCPRRHAT
FT                   TPVVCREGANCVRIDCFFSHPIDEDCRFGINCTNKTCMFRHPEGRNLPNPSNTWSKVPE
FT                   NATNERSFAVPEDQVMEQARQES"
FT   gene            complement(<797166..>797924)
FT                   /locus_tag="DEHA2A09460g"
FT                   /old_locus_tag="DEHA0A09702g"
FT                   /old_locus_tag="DEHA-IPF7034"
FT                   /old_locus_tag="DEHA-CDS4780.1"
FT   CDS_pept        complement(797166..797924)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09460g"
FT                   /old_locus_tag="DEHA0A09702g"
FT                   /old_locus_tag="DEHA-IPF7034"
FT                   /old_locus_tag="DEHA-CDS4780.1"
FT                   /product="DEHA2A09460p"
FT                   /note="highly similar to uniprot|P25443 Saccharomyces
FT                   cerevisiae YGL123W RPS2 Protein component of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84702"
FT                   /db_xref="GOA:Q6BYH8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH8"
FT                   /protein_id="CAG84702.1"
FT                   /translation="MSTEAAAPKRNFARSNRGGKPRRGGRRDEEKGWTPVTKLGRLVKA
FT                   GKITSVEEIYLHSLPVKEYQIIDQLLPELKDEVMKIRSVQKQTRAGQRTRMKAVVVIGD
FT                   SNGHVGLGIKTAKEVASAIKAAIIIAKLSIIPIRRGYWGTNLGAPHSLPTKVTGKCGSV
FT                   AVRLIPAPRGKGIVASPAVKKLMQLAGVEDVYTSSSGSTRTTENTLKAAFIAIGNTYAF
FT                   LTPNLWTEAPLAPSPLDVYAEEAAGSKRRY"
FT   gene            <798616..>799164
FT                   /locus_tag="DEHA2A09482g"
FT                   /old_locus_tag="DEHA0A09724g"
FT                   /old_locus_tag="DEHA-IPF7036"
FT                   /old_locus_tag="DEHA-CDS5575.1"
FT   CDS_pept        798616..799164
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09482g"
FT                   /old_locus_tag="DEHA0A09724g"
FT                   /old_locus_tag="DEHA-IPF7036"
FT                   /old_locus_tag="DEHA-CDS5575.1"
FT                   /product="DEHA2A09482p"
FT                   /note="similar to CA1716|IPF17237 Candida albicans
FT                   IPF17237"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84703"
FT                   /db_xref="GOA:Q6BYH7"
FT                   /db_xref="InterPro:IPR039454"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH7"
FT                   /protein_id="CAG84703.1"
FT                   /translation="MSTYADAAASSGPIGAEKIPEPPKVKNTSNPNGNVETLDEDEFEE
FT                   FKKKTNAAVERGAKKVKDFSKEANENGEAYLNKFIASVKTGIDNVTKSVRDFTANFGDN
FT                   STQLVAKASEEFKNPVVITQALVGISGLVAGYMTYLERHRIHSDNRVVLATHGAIITGL
FT                   IVADGYLFQKYYPQYKSKK"
FT   gene            <800593..>802065
FT                   /locus_tag="DEHA2A09504g"
FT                   /old_locus_tag="IPF_7040"
FT   CDS_pept        800593..802065
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09504g"
FT                   /old_locus_tag="IPF_7040"
FT                   /product="DEHA2A09504p"
FT                   /note="similar to CA2718|IPF7374 Candida albicans IPF7374"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65395"
FT                   /db_xref="UniProtKB/TrEMBL:B5RST9"
FT                   /protein_id="CAR65395.1"
FT                   /translation="MDFMIYGKMVEPEYTQYDDTRTSYEEPADFFEDSVMGIGSNSGTM
FT                   LTGHSNCGNTYNSNPWVTDVATSTQAQSGPYLSYPTNGGYGGSIYRCDNRMTQGSMDLS
FT                   GAIGNEVNGTYMDPTIELSGYNYNMDALPMPNHYTQNSLLPFNSTSSLNSMNSVNALNT
FT                   YTSASELGAEGYSASGGSMAPGGSMTLGYPSPISHRQSPLQIQQQKARLKIKTEKTDTK
FT                   KRYRIIRGVSAGGCSTRPPKYLVDSNALYLPIELHINGALVEEICYPPWNASEKEDRRR
FT                   IIRIERVQNGHKLSANFSIVGGANENPITLPAPPDTDVIEVSCLECTTILSEADVQSAS
FT                   DDDSTIPINGVRDGKYNQYYITSVEVIEIVELLIGTQSMDPADRRKERGRIRSNLVPFW
FT                   SRKPISSRMQDIPSTHTSRSPNYLGKDTHLTNQDYRFELAKRIMAYEIRKPRGFDKEVR
FT                   ILRWDKLIPALKRALQTYYTEIPGSDSSIDFS"
FT   gene            <804166..>807750
FT                   /locus_tag="DEHA2A09526g"
FT                   /old_locus_tag="DEHA0A09779g"
FT                   /old_locus_tag="DEHA-IPF7044"
FT                   /old_locus_tag="DEHA-CDS0237.1"
FT   CDS_pept        804166..807750
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09526g"
FT                   /old_locus_tag="DEHA0A09779g"
FT                   /old_locus_tag="DEHA-IPF7044"
FT                   /old_locus_tag="DEHA-CDS0237.1"
FT                   /product="DEHA2A09526p"
FT                   /note="weakly similar to uniprot|Q5YCZ3 Candida albicans
FT                   BNI4"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84706"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH4"
FT                   /protein_id="CAG84706.2"
FT                   /translation="MSGSGISNQDNFEDFLLSNQFYVGPSNSQNHITNLRKSVQIPNSM
FT                   SNTSIHAGLSNESVGANQQRTSIMKVSPSMKALESILSEKNNSAPAIVSERIVEEDEDQ
FT                   GQFPPSSGLSANYTTEDPNRGSTYSVQTFETAHSENSFSDTINMNANESLHKSQKSMST
FT                   IDDGYNTNDDTPVLVNPAQFQTFTQVNGSNKNSIHPIRVVHESSVEDLDGQSTDVSNGT
FT                   LDNKDIEQDDTLVGNEGVLKSQYEQQQQKFKQRQKELVEEQRIQRELQQKEAEIQELKK
FT                   QRDAQEQRKQKEFFELEQKKHEQQTITNPVSSLLLPETGKAVKKPAVKQQEKGSSINTT
FT                   TAYPEPLKRSPHTRSNSTFSLSFTKNKEQPPLPGTHKRSSTFSDLSAVSKGAEKPSTAK
FT                   RFSFKNLFKSRSKTTKNEDDDLVSKPRKLSSKSYSTPNIAGFNNEPNVIEGAKKMTTTN
FT                   KNRKSEKVVSGSYDKQSPLPQPPQEKPSHKPSMSSSASLLSVFKKDKTSEISSKSIKSE
FT                   NQEQVSKKAKPNQNDVEEEEEEEEEEEEEEEEVTPTTNFLNKNPSNSIPNVNFIREVND
FT                   DDYNPNKNYPTPTITETNYDNNNIISNHNSQTLKSKEVEASNDELLIPESDTLLNNDSL
FT                   FGSPFKVDYRPSTNTPKLETPHNKLTSLSKEEKSKAKPDVNDQLLGETLFPKSLSVQEV
FT                   ESIVSLERSRSMRSIKSNKRNSFINYDGSDENIIQYGGTRTNSPNLDSTNMSRSNSILK
FT                   NSNSKKNLNVENMNSINAQMLNDESMENYDDLIEFTDYIDLDNLDFSISPKEIVEKSPV
FT                   IMSSSPSLLSEKFDSFQQKNQQPLMNGYVDNKLSGSSDKEFDSSSIQEIPPPVGYLRPS
FT                   EAPPIILNTPPPSQDDDPEQHILLSQTDEEQAKVPVEEIESNEPVQGPLTPNLEIINAT
FT                   QIPESPESINDSAEPTNLVEKSPILATSYQNSPMVNENGKNIMNNRPISMSFRGLKGPS
FT                   FGGKLAMHDLRSSDSHQSFNMSFGDEEVDEEENSHEARVSEVGGGFGSSDEEDDDSFDR
FT                   AEDKENEYSNPVIAHQQVSSKFGQENNFSPLAPPHPLPIFTHNKIPSISSNSSSPKSFS
FT                   SMFSRKFKKSPTIQSSARAAAIKNEVRFSSRIILYDTYNCDEYDRHPDNATCNQLTPAL
FT                   AQQIKDELNDFKSEMSIHEHSRCHTHFF"
FT   gene            complement(<807895..>808131)
FT                   /locus_tag="DEHA2A09548g"
FT                   /old_locus_tag="DEHA0A09801g"
FT                   /old_locus_tag="DEHA-IPF7045"
FT                   /old_locus_tag="DEHA-CDS7864.1"
FT   CDS_pept        complement(807895..808131)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09548g"
FT                   /old_locus_tag="DEHA0A09801g"
FT                   /old_locus_tag="DEHA-IPF7045"
FT                   /old_locus_tag="DEHA-CDS7864.1"
FT                   /product="DEHA2A09548p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84707"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH3"
FT                   /protein_id="CAG84707.1"
FT                   /translation="MSEYPEYINGEPPVITLEEYDVAPWGKTTCVDSRPDGYVIVIMEK
FT                   PEVVVARIDKSGDETLDKIFRSAKQTHAEQSAK"
FT   gene            <808318..>809214
FT                   /locus_tag="DEHA2A09570g"
FT                   /old_locus_tag="DEHA0A09823g"
FT                   /old_locus_tag="DEHA-IPF7046"
FT                   /old_locus_tag="DEHA-CDS4260.1"
FT   CDS_pept        808318..809214
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09570g"
FT                   /old_locus_tag="DEHA0A09823g"
FT                   /old_locus_tag="DEHA-IPF7046"
FT                   /old_locus_tag="DEHA-CDS4260.1"
FT                   /product="DEHA2A09570p"
FT                   /note="similar to uniprot|P53859 Saccharomyces cerevisiae
FT                   YNL232W CSL4 Subunit of the exosome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84708"
FT                   /db_xref="GOA:Q6BYH2"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH2"
FT                   /protein_id="CAG84708.2"
FT                   /translation="MPHEQKFAIPGQYIIPTHKVAAEKVVEKYVPGKGTTISSIDVEAD
FT                   QVKSIPVIVATIIGKIVIREIVVSDKEDEKDEADSKDSHIKIKNFVVNVIPKSNTYMQY
FT                   QEEVGEEAIPEVGNISINLPQEGDVVLARITRLNPRQAFCEILTVEGHGNVLNDSGLGA
FT                   NGENAHRSIPAGGGSQSLSSHTTIASQASSINAVASDLGETFKGIIRTQDVRSTDRDRV
FT                   KIIECFKPGDIVRAVIISLGDGSNYYLSTAKNDLGVVFARSEGGAGGLMYAVDWQNMIC
FT                   PETGVIEKRKCAKPFTS"
FT   gene            complement(<809310..>810356)
FT                   /locus_tag="DEHA2A09592g"
FT                   /old_locus_tag="DEHA0A09845g"
FT                   /old_locus_tag="DEHA-IPF7047"
FT                   /old_locus_tag="DEHA-CDS3693.1"
FT   CDS_pept        complement(809310..810356)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09592g"
FT                   /old_locus_tag="DEHA0A09845g"
FT                   /old_locus_tag="DEHA-IPF7047"
FT                   /old_locus_tag="DEHA-CDS3693.1"
FT                   /product="DEHA2A09592p"
FT                   /note="similar to uniprot|P53860 Saccharomyces cerevisiae
FT                   YNL231C PDR16 Phosphatidylinositol transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84709"
FT                   /db_xref="GOA:Q6BYH1"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH1"
FT                   /protein_id="CAG84709.1"
FT                   /translation="MFSKLRGKDSKTETKKEQKVLGEKLYLPLTKASSKCTIPEAIGLN
FT                   GEEQEKYDKVLKYFQQEDFKVAVSEANQKDKDSSKYKELSESEKAWLTRECFLRYLRAT
FT                   KWHYEDTISRIELTLAWRREFGIAGCYDSENEVNGKLCSPENETGKEVILGYDNDTRPC
FT                   LYLKPGRQNTKTSLRQVQHMVYMLERVIDYMPSGQDSLALLIDFKASPLGTEGGKIPPV
FT                   GTGRQVLHILQTHYPERLGKALLTNIPWLGWTFLKIIHPFIDPLTREKLVFDQPFPEYV
FT                   PIEQLDKDFGGDLNFEYDHEKYWPEMIKIAESNKQKYMKRFENFGSKIGLSEYDLRGES
FT                   EELVYPVA"
FT   gene            <810632..>811879
FT                   /locus_tag="DEHA2A09614g"
FT                   /old_locus_tag="DEHA0A09867g"
FT                   /old_locus_tag="DEHA-IPF7051"
FT                   /old_locus_tag="DEHA-CDS3045.1"
FT   CDS_pept        810632..811879
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09614g"
FT                   /old_locus_tag="DEHA0A09867g"
FT                   /old_locus_tag="DEHA-IPF7051"
FT                   /old_locus_tag="DEHA-CDS3045.1"
FT                   /product="DEHA2A09614p"
FT                   /note="weakly similar to CA1631|IPF19582 Candida albicans
FT                   IPF19582"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84710"
FT                   /db_xref="GOA:Q6BYH0"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYH0"
FT                   /protein_id="CAG84710.2"
FT                   /translation="MASVDQSYNNPRNRKKVLSLVEIAINKCIQHVAKLEDVGATPFHL
FT                   LVPVLRRMNAKQLGQIEELSPQITPDSDELWTNLVSKEFPDRPILANSIRTSKVKSKRA
FT                   NLVAPAGRTLMFCNMPMKSLYFQYSDERESFRQDSAERLRKITQRLKKEKSANSIVPVP
FT                   ELLRDPTVRRRRFEGGSGYNRSEASYGPKNSILNKARKETRNRSLMFPNYAQKVKKYDP
FT                   YEAFKYKDTPSVQPGPPISHSLHQPRQQPRFPKSQQSAQPSTHPAAPRYAPRFNHDRAE
FT                   ISPQLGRPPTIFNGQPIQHSTNMPRPIEPVPKFVSAANSNSSSPKPASPPSHSSLSEPH
FT                   SPPTSISSSSSPSPRAVSEAIRKRKAEPSIFLTGNRNKRPMRVPRAQMKGSAPSNDSNT
FT                   QPPNKKITLIKSSIFN"
FT   gene            complement(<811994..>812941)
FT                   /locus_tag="DEHA2A09636g"
FT                   /old_locus_tag="DEHA0A09889g"
FT                   /old_locus_tag="DEHA-IPF7053"
FT                   /old_locus_tag="DEHA-CDS4073.1"
FT   CDS_pept        complement(811994..812941)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09636g"
FT                   /old_locus_tag="DEHA0A09889g"
FT                   /old_locus_tag="DEHA-IPF7053"
FT                   /old_locus_tag="DEHA-CDS4073.1"
FT                   /product="DEHA2A09636p"
FT                   /note="similar to uniprot|P38786 Saccharomyces cerevisiae
FT                   YHR062C RPP1 Subunit of both RNase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84711"
FT                   /db_xref="GOA:Q6BYG9"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG9"
FT                   /protein_id="CAG84711.2"
FT                   /translation="MLFDLNVPWPSNNYAATPTSQQITTLLNTITTLGTLGYTHIAINF
FT                   TLSENVRFPSNQQDINPIQIKMIKDYFKDNFPRLKLFTRLTLVINDPSQCQGLSKVQNS
FT                   FDLIAVQPTSEKGLQLATTNLDIDVISFNMASKLPFFLKHKTIGSALEKGIRFEICYSP
FT                   MISGPAGYSIQTANDNMSLSKTALLVRKYFFSNVLQLIRASRSKGLIVSSGATQPLQVR
FT                   NSSDILILLKTVGLDNSRAKSCVTDNPEKVLVNGRLKIKSYKQTIVVGNDNDKSDILYN
FT                   NDEEDNVKKTDSAGYKKKLSDSSGGSLLKKQRVK"
FT   gene            <813131..>813979
FT                   /locus_tag="DEHA2A09658g"
FT                   /old_locus_tag="DEHA0A09911g"
FT                   /old_locus_tag="DEHA-IPF7055"
FT                   /old_locus_tag="DEHA-CDS4439.1"
FT   CDS_pept        813131..813979
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09658g"
FT                   /old_locus_tag="DEHA0A09911g"
FT                   /old_locus_tag="DEHA-IPF7055"
FT                   /old_locus_tag="DEHA-CDS4439.1"
FT                   /product="DEHA2A09658p"
FT                   /note="similar to uniprot|P53899 Saccharomyces cerevisiae
FT                   YNL155W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84712"
FT                   /db_xref="GOA:Q6BYG8"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG8"
FT                   /protein_id="CAG84712.2"
FT                   /translation="MSQAGVNKNLFVNETKTHPDQGIMNIGKQCHKCQQVDFLPFHCEY
FT                   CNFTYCSKHRNLESHQCPAKPQEKTRANQQYDATAASLFPDREKDKLKLENSINNATPK
FT                   ATNILGRNGAQGTVLAKFSKFLRLQKNKKKSDNKVMGIFKKKSVPQARSKVAEMAILRR
FT                   EAKGDTKVGDTDKIYLWCLYINPKQVSENAEEDIFSNIDVDMEKKAVWVSKQWSVGRAL
FT                   DSIADNLNIVNINNRTRESDERLCICKVNDDDSPAMVETADRCSKALKNADVIYLVRGS
FT                   I"
FT   gene            <815000..>816397
FT                   /locus_tag="DEHA2A09680g"
FT                   /old_locus_tag="DEHA0A09933g"
FT                   /old_locus_tag="DEHA-IPF7057"
FT                   /old_locus_tag="DEHA-CDS2876.1"
FT   CDS_pept        815000..816397
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09680g"
FT                   /old_locus_tag="DEHA0A09933g"
FT                   /old_locus_tag="DEHA-IPF7057"
FT                   /old_locus_tag="DEHA-CDS2876.1"
FT                   /product="DEHA2A09680p"
FT                   /note="similar to uniprot|P23292 Saccharomyces cerevisiae
FT                   YNL154C YCK2 membrane-bound casein kinase I or
FT                   uniprot|P23291 Saccharomyces cerevisiae YHR135C YCK1
FT                   membrane-bound casein kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84713"
FT                   /db_xref="GOA:Q6BYG7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG7"
FT                   /protein_id="CAG84713.2"
FT                   /translation="MSNRAQLSNPAALAAAAASHNPSSSNSSNNSVVGLHYKIGKKIGE
FT                   GSFGVIFEGTNIINGVAVAIKFEPRKTEAPQLRDEYRTYKHLQGSEGIPSAYYFGQEGL
FT                   HNILVIDLLGPSLEDLFDWCGRRFSVKTVAQIAIQMLSLIEEVHRHDLIYRDIKPDNFL
FT                   IGRQGLVDENHVHLVDFGMAKQYRDPRTKQHIPYREKKSLSGTARYMSINTHLGREQSR
FT                   RDDLEALGHVFFYFLRGQLPWQGLKAPTNKQKYEKIGDKKRTTPALQLCDGLPRQFAEY
FT                   LDSVRSLAFDAEPAYEEYRMLFLSILDDLGQACDEDFDWLHLNNGKGWDSSINKKPNLH
FT                   GYGHPNPPNERDRRHRDQRRSRQHHASHHPQAPASQQAQPPSTQMTTAQLHQQKLQHLV
FT                   NRPLPPIKQESQTGMNANAMDESALKAPQSKNYENTAANRQNQYDQQQMVDDNEETKGF
FT                   WSKLCCH"
FT   gene            complement(<817118..>817831)
FT                   /locus_tag="DEHA2A09702g"
FT                   /old_locus_tag="IPF_7058"
FT   CDS_pept        complement(817118..817831)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09702g"
FT                   /old_locus_tag="IPF_7058"
FT                   /product="DEHA2A09702p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65396"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU0"
FT                   /protein_id="CAR65396.1"
FT                   /translation="MSIIEPFVLESSNGSITVDGINQLECFIPESHRFKEKYVKNTMES
FT                   SNLSIGEQIAYQWTKPETGGFYQNEEFGSLGMKYHLWIDERIEMDDDENFDKAELAELF
FT                   TSNSAISSLSHTLFRQNKKIEPTEHNGITTSIIPAIFDCSSDDVDIKCLFFTRNNKYDI
FT                   QSMLKLQDWENILRITLSQLINDGYVGGKVTVLPSDKSFEISLKLGLALEPKVLEEEYI
FT                   NSKSMKLRETILNEI"
FT   gene            <818366..>819319
FT                   /locus_tag="DEHA2A09724g"
FT                   /old_locus_tag="IPF_7059"
FT   CDS_pept        818366..819319
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09724g"
FT                   /old_locus_tag="IPF_7059"
FT                   /product="DEHA2A09724p"
FT                   /note="weakly similar to uniprot|O94628 Schizosaccharomyces
FT                   pombe SPBC1347"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU1"
FT                   /protein_id="CAR65397.1"
FT                   /translation="MTEDQHKLAIEANIKVFDSKMAEDYDKRDAMQFLSIFFAKSLLEF
FT                   DVSSPRKTPEESNKLIGDPEQPYNGFSPDKSLPDPHTFGTQFPGSVFKPGMKMMDFACG
FT                   TGILTQYFAPYLATNSDQTSDIIGVDINSTFLAKYNEKASHVNATYDGVAMTSYLCDIL
FT                   DPTAQEVVSQFEGSMDLITCTLSYHHIDNYEKVTQKLSTFLRPGGWLFIVDFYNEDVET
FT                   SVSATKSASEAVRHMGGLKVDALNKTLGEYSNLANVSSAREARVYLWQEQPFIEHHLPD
FT                   EINEKLKNNQLRSKISNGTTVYLVETSLILAIGQKK"
FT   gene            <819766..>820494
FT                   /locus_tag="DEHA2A09746g"
FT                   /old_locus_tag="DEHA0A09999g"
FT                   /old_locus_tag="DEHA-IPF7063"
FT                   /old_locus_tag="DEHA-CDS4903.1"
FT   CDS_pept        819766..820494
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09746g"
FT                   /old_locus_tag="DEHA0A09999g"
FT                   /old_locus_tag="DEHA-IPF7063"
FT                   /old_locus_tag="DEHA-CDS4903.1"
FT                   /product="DEHA2A09746p"
FT                   /note="similar to uniprot|P33296 Saccharomyces cerevisiae
FT                   YER100W UBC6 Ubiquitin-conjugating enzyme involved in ER-
FT                   associated protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84716"
FT                   /db_xref="GOA:Q6BYG4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYG4"
FT                   /protein_id="CAG84716.2"
FT                   /translation="MASRQSQKRLTKEYKAITLNPPPYVSAKPNDENILEWHYVITGPP
FT                   HTPFEEGQYHGILRFPSEYPFKPPSISMITPNGRFACNTRLCLSMSDYHPDTWNPAWSV
FT                   ATILTGLLSFMTGDESTTGSITTSDNVKKRLARSSKEWNNAENQRFTKQFPDLVAQNKV
FT                   DVAARNAREQAAATTDSTDPEKPFDVRENIDSLDPEDRARLLVEQDDHSTPSFGVQRFT
FT                   LVGVVVAAFIAAYFNFFSRT"
FT   gene            <821125..>823002
FT                   /locus_tag="DEHA2A09768g"
FT                   /old_locus_tag="DEHA0A10021g"
FT                   /old_locus_tag="DEHA-IPF7070"
FT                   /old_locus_tag="DEHA-CDS1492.1"
FT   CDS_pept        821125..823002
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09768g"
FT                   /old_locus_tag="DEHA0A10021g"
FT                   /old_locus_tag="DEHA-IPF7070"
FT                   /old_locus_tag="DEHA-CDS1492.1"
FT                   /product="DEHA2A09768p"
FT                   /note="similar to uniprot|P34226 Saccharomyces cerevisiae
FT                   YBL061C SKT5 Activator of Chs3p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84717"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG3"
FT                   /protein_id="CAG84717.2"
FT                   /translation="MSSHPYRQKAASTNAPYPVEDYGEPSPPREVGNNHSGHESSGSLG
FT                   QAPGSGYQTPVQEMDIPAPLGVLGGASNEADGAAGTKAPYPVYESSTPPPVFTQKEPPL
FT                   MSPNSNPLSTTSSVTNLNLNQNALDSQIFSKSENNLVASAPDFAKFGHNRSVSSTSSFF
FT                   HDRSDNASMVDFSQNIIQQYLGDNSSQLLPRIKTIELYRKNAKRSNDPSVLFQYAQYML
FT                   QTALMLDSTDAGLSSTNTPQGQSIENSPKKGPLEKENNGSSLTLGSDIFKKSHNKSRSA
FT                   ASLDFSGSDINLDDKKLKRALLKEALFYLKKLADKGYVDSQYLLADAYSSGALGKIENR
FT                   EAFVLFQSAAKHGHVESAYRTSYCYEEGLGTGRDARKAVDYLKMAASKNHPAAMYKLGV
FT                   YSFYGRMGLSSQVNTKKIGIKWLTRASNVANELIAAAPYELGKIYFNGFQDIVIADKKY
FT                   ALELYAQAAALGHVQSAAILGQCYEFGDILPQDSNLSIHYYTTAALGGDPESMLAMCAW
FT                   YLVGSDPYLPKDDTEAFEWAKRAAMCELPKAQFALANFYEKGIGCIKNVHESQHWYQKA
FT                   AENGDEKSLSRITNKELASSIEKKAKKRFPSSRAPASANGAQEKDCVIM"
FT   gene            <823903..>824640
FT                   /locus_tag="DEHA2A09790g"
FT                   /old_locus_tag="DEHA0A10043g"
FT                   /old_locus_tag="DEHA-IPF7071"
FT                   /old_locus_tag="DEHA-CDS4866.1"
FT   CDS_pept        823903..824640
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09790g"
FT                   /old_locus_tag="DEHA0A10043g"
FT                   /old_locus_tag="DEHA-IPF7071"
FT                   /old_locus_tag="DEHA-CDS4866.1"
FT                   /product="DEHA2A09790p"
FT                   /note="weakly similar to CA5650|IPF7109 Candida albicans
FT                   IPF7109"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG2"
FT                   /protein_id="CAG84718.1"
FT                   /translation="MSANDFYSSGDQGSYEPRRDQQQGQQGQQGQQGQQGQQGEDGDRG
FT                   LISTLAGGSIGAFGGSKLGGNHSTLGGIGGAIAGAIGANKVEDRFENHGSSNNNHGHSQ
FT                   QGGGLMSGLSSFLGGDKHEGRNDGYGGSQGGYGGNQGGYGGSHSGRHDGGRHEGGRHEG
FT                   GYGGGQGGFGSGNNGGNQGGYGGGQGGYSGGQGGYGGGQGGYGGGQGGYGGGQGGYGGG
FT                   QGGYGGGQGGYGGGQGGNQGGRW"
FT   gene            complement(<824797..>827577)
FT                   /locus_tag="DEHA2A09812g"
FT                   /old_locus_tag="IPF_7076"
FT   CDS_pept        complement(824797..827577)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09812g"
FT                   /old_locus_tag="IPF_7076"
FT                   /product="DEHA2A09812p"
FT                   /note="weakly similar to uniprot|P53086 Saccharomyces
FT                   cerevisiae YGL216W KIP3 Kinesin-related motor protein
FT                   involved in mitotic spindle positioning"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65398"
FT                   /db_xref="GOA:B5RSU2"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU2"
FT                   /protein_id="CAR65398.1"
FT                   /translation="MNATGTVASSSGLNSSRESSITVAVRVRPFTPGEENNLIKLNNEE
FT                   FFLGDGSLSTNNAATDTPSKKSNLMPRGIRKIINVVDDRMLIFDPPETNPLIQMQRNAF
FT                   PNTKATSRIREHRFVFDKLFDIQATQEDVYNNTTRPLLDSVLDGFNATVFAYGATGCGK
FT                   THTISGTPLDPGVIFLTMKELYEKIEGLADTKLFDVSMSFLEIYNETIRDLLNPETNFK
FT                   RLVLREDANKKISVSNLSSHKPKSVQEVMDLILVGNQNRTSSPTEANATSSRSHAVLQI
FT                   NVVQRNRTADISEEHTYATLSIIDLAGSERAAATKNRGARLNEGANINKSLLALGNCIN
FT                   ALCDPRRRNHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSQHYDETLNTLKYADRAK
FT                   EIKTKLIRNQHNLDRHVGSYLKMITQQKQEIEDLRAREQKVVESTIAKQNTLSQKCLNV
FT                   TMDNISNLKASLSKQHQEKWKKYFFLAKRKLLLLQKLEMESLVKYLHKLSKSGNINGFQ
FT                   NIVNLSEQLISKITTGISDLESQYSRPNEIDYIFNESTLQMLKKLKEQEGWSDHNTVVF
FT                   DSLVACLRDSLEREILFNSSILFDHLVHEIRGFDFFPKSFIDMLATYSHSEKENMHEYT
FT                   TASLSNAINGLTKTLEEILDGEYDTAIENVTSSFMQRKLKEQEMQANKVNNHSIDPSIV
FT                   IPKPRDCKRGSNSPLKSSPPRDFKKSITKKNGSSISPAMLQKQGKKVRWDVPNQDSTLA
FT                   ESDVSIDEQNTILKSDYEDDSPIGNNIIDKTNMIDDLDLKFDPTLDSPPLAQLLKDSMN
FT                   RSLMADLSKGRNKHRKFQPLTNRKLSTNENSEPLTKLPLLNKQASTKITNSMQPTTPNE
FT                   VPESSPNYLPGTQTNTKFKMNTLGAPSRVINRYNTYVEDDEDSRDIESNGSEKVE"
FT   gene            <827864..>829213
FT                   /locus_tag="DEHA2A09834g"
FT                   /old_locus_tag="DEHA0A10087g"
FT                   /old_locus_tag="DEHA-IPF7078"
FT                   /old_locus_tag="DEHA-CDS2843.1"
FT   CDS_pept        827864..829213
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09834g"
FT                   /old_locus_tag="DEHA0A10087g"
FT                   /old_locus_tag="DEHA-IPF7078"
FT                   /old_locus_tag="DEHA-CDS2843.1"
FT                   /product="DEHA2A09834p"
FT                   /note="similar to uniprot|P40501 Saccharomyces cerevisiae
FT                   YIL088C AVT7"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84720"
FT                   /db_xref="GOA:Q6BYG0"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYG0"
FT                   /protein_id="CAG84720.2"
FT                   /translation="MPTVDLHQGASMVSSAINLMKTIIGAGLLSMPYTYSTDGSIIGTV
FT                   IILLAALTSGYGLFLQGYVSKYAPLGHATFFNICSITYPSLSVVFDIAIAVQCFGCAIS
FT                   YLVLIGDLMPTIITSISFVSDEHYRTFWILVSTVICVPLSFMKNLSSLQYTSILGLVAI
FT                   FYMALLVITHFLIDDIPDSSKGEIKLFPPNILGMFSTFSIAVFAFTGHQNMFSIINEAK
FT                   DKSLKSITELINIAIIVSSVLFIVVGLAGYSTFGDKVNGNVILSYPNSWTTTLGRLCIV
FT                   FMVVFSFPLMLHPARISVNNIYHTVYSKIMEKEDHGDTDDETTALLDDASQEIHESGSV
FT                   SEDLSMKTTIVPFSRNVFLAITTILLITGYTFAITIKSFAFVLAIIGATGSTAISFILP
FT                   GLFGYKLIGSEVDYPSKTDLLLKSCSLALVIWGFGVMFLCLYTTLFMDSY"
FT   gene            complement(<829411..>830565)
FT                   /locus_tag="DEHA2A09856g"
FT                   /old_locus_tag="DEHA0A10109g"
FT                   /old_locus_tag="DEHA-IPF7079"
FT                   /old_locus_tag="DEHA-CDS3324.1"
FT   CDS_pept        complement(829411..830565)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09856g"
FT                   /old_locus_tag="DEHA0A10109g"
FT                   /old_locus_tag="DEHA-IPF7079"
FT                   /old_locus_tag="DEHA-CDS3324.1"
FT                   /product="DEHA2A09856p"
FT                   /note="similar to CA5652|IPF19815 Candida albicans
FT                   IPF19815"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84721"
FT                   /db_xref="GOA:Q6BYF9"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF9"
FT                   /protein_id="CAG84721.2"
FT                   /translation="MSSSSQTKPVDTSPIIKKHNEKYHNSYLAMVERNQIPLSRALLCG
FT                   IHLFNYIFPGGFASKFIRLQHRTGTSYSGSALYDIGIDDGYYIVHWVILLTFLRSFLMQ
FT                   WCFEPFASYFCNIHSRKAKVRFSEQSWSFVYYSFSFTYGAYLYYNSSYWLNFDQIFANW
FT                   PHYQLGSLFKKYYLISMGFWLQQIFVLNIEERRKDHFQMFSHHIITCLLLTGSYYYYYN
FT                   RIGHLILMIMDSVDIFLAAAKLLKYSGYNNACDYMFVFFMVSWVVLRHGLYNYLFYQSW
FT                   HNASSLMSNSECIPGQFQKRCWTPTILNSFFFLLGGLQVITMIWMYLISKVAYKVISGK
FT                   GAEDVRSDEDDSDYEEDSNIAPDGHHSSNKRRDYPNIGSDINIK"
FT   gene            complement(<830893..>831996)
FT                   /locus_tag="DEHA2A09878g"
FT   CDS_pept        complement(join(830893..831752,831819..831996))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09878g"
FT                   /product="DEHA2A09878p"
FT                   /note="similar to uniprot|P47821 Saccharomyces cerevisiae
FT                   YNL025C SSN8 Component of RNA polymerase II holoenzyme,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84722"
FT                   /db_xref="GOA:Q6BYF8"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYF8"
FT                   /protein_id="CAG84722.2"
FT                   /translation="MSADFWSSSQRNRWQLTRHSLLESRRKLLLLEKKMIQNGFIKDYP
FT                   NVEYDANTRIYLHNLLIKLGRRLNVRQIALATAEIYMSRFLIKVSLKEINVYLLVTTCL
FT                   YAACKIEECPQHIRLITSEARNLWPEYIPQDVTKLAEFEFYLIEEMDSFLVLHHPYRSL
FT                   LQIRDYLNENFALYGFSLSDDELQNSWSLINDSYITDLHLLLPPHIIAIATIYITIVLK
FT                   KNISSLRLGANSMSNDTVGMDPHTKPNSNSIHAEDLMALATGGSAINDIGNPSSGTNGF
FT                   HDIELDENTIKINKFMTFLDHSHVNLNEVVEAIQDIITLYAIWNRYNEMSVKKVLQDML
FT                   LNRSV"
FT   gene            complement(<832241..>833001)
FT                   /locus_tag="DEHA2A09900g"
FT   CDS_pept        complement(join(832241..832461,832523..832722,
FT                   832775..832826,832908..832920,832978..833001))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09900g"
FT                   /product="DEHA2A09900p"
FT                   /note="similar to uniprot|P14832 Saccharomyces cerevisiae
FT                   YDR155C CPR1,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84723"
FT                   /db_xref="GOA:Q6BYF7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF7"
FT                   /protein_id="CAG84723.1"
FT                   /translation="MNPVVFLDVNKGDVPLGRIKLKLFASELPKTCENFRQFCTGEYRE
FT                   NNRPKGYKGCTFHRVVKGFMIQGGDFVRGNGLGSISIYGGNTFDDEGFPYDHKKYSVSM
FT                   ANSGPNSNGCQFFICCKEVPHLDGKHVVFGEVVEGFDIVDQIEKTKVGVLDKPYPDITI
FT                   TNCGEM"
FT   gene            <833131..>834171
FT                   /locus_tag="DEHA2A09922g"
FT                   /old_locus_tag="DEHA0A10175g"
FT                   /old_locus_tag="DEHA-IPF7084"
FT                   /old_locus_tag="DEHA-CDS3720.1"
FT   CDS_pept        833131..834171
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09922g"
FT                   /old_locus_tag="DEHA0A10175g"
FT                   /old_locus_tag="DEHA-IPF7084"
FT                   /old_locus_tag="DEHA-CDS3720.1"
FT                   /product="DEHA2A09922p"
FT                   /note="similar to uniprot|P40506 Saccharomyces cerevisiae
FT                   YIL083C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84724"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF6"
FT                   /protein_id="CAG84724.2"
FT                   /translation="MTPKSPQQKKYHTSNPIAETAIDRTIPDLPIAQLSDEDKYFRTHQ
FT                   APPYLSEIEQQVTAFIEFHAANTGKRIALVTSGGTTVPLENNTVRFIDNFSAGTRGATS
FT                   AEYFLENGYAVIFLHREFSLLPYSRHYSHTTNCFLDYMTEVNNKVEINPDFADEMLVVL
FT                   RKYKEAKESQSLLLIPFTNVNQYLYTLKLMAILLQKIEDKALFYLAAAVSDFFLPQSRM
FT                   PQHKIQSQAAGKLIIDLEQVPKFLRRLVDNWAPSAMIVSFKLETDHSILIEKSKGALER
FT                   YQHQLVIGNLLQTRKKEVVFVHSDGSELWIKLTDKQKEDHMDIEGLIIPAVIKEHSEWV
FT                   VKHHSK"
FT   gene            complement(<834240..>835697)
FT                   /locus_tag="DEHA2A09944g"
FT                   /old_locus_tag="IPF_7085"
FT   CDS_pept        complement(834240..835697)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09944g"
FT                   /old_locus_tag="IPF_7085"
FT                   /product="DEHA2A09944p"
FT                   /note="similar to CA5656|IPF14683 Candida albicans
FT                   IPF14683"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65399"
FT                   /db_xref="GOA:B5RSU3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU3"
FT                   /protein_id="CAR65399.1"
FT                   /translation="MSLEHDDQMIDRLSSNFQEVKSKEEKTLEELQHSKQELMTKQNKE
FT                   FLEELFKDNASTPINIKNIQVTNSQSFRNTFLQKQLQPLLSNNLTTLTKLTENIDQVTH
FT                   NFTKLGLVENLLVSLNPIPKTYFNRGKPSIDLVPIFNIIPVKRFYAKTGTNIGNGEGDG
FT                   YIQFQIKNIFGGAENLTFDAITGTRTQSSYLLNYNQPIFNNANYIWENLAYLNVKKLHW
FT                   LNSDLDVKGITNKIYTQYKSPINHELILENCWRCLTNNQSKSLDVLNQSGNNFKSSIMY
FT                   NWRYETRNNMHLPTSGKFIRLGIEYSGLWSFNSSHFIKSVMESQFAYKFNKLHSVILSC
FT                   KSGLIFSTDNATPLLDRFYIGGPNDVRAFTLNGLGPKNYNSSIGGDVFLNGGISLISKF
FT                   PRVSDDSNFKIHNFINFGKLLPLDKSKTSLETVKNLTTEFSVGYGFGVLYNHPMARFEL
FT                   NFVLPIASHERDYIRKGLQYGIGISFL"
FT   gene            complement(<836219..>838000)
FT                   /locus_tag="DEHA2A09966g"
FT                   /old_locus_tag="DEHA0A10230g"
FT                   /old_locus_tag="DEHA-IPF7087"
FT                   /old_locus_tag="DEHA-CDS1667.1"
FT   CDS_pept        complement(836219..838000)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09966g"
FT                   /old_locus_tag="DEHA0A10230g"
FT                   /old_locus_tag="DEHA-IPF7087"
FT                   /old_locus_tag="DEHA-CDS1667.1"
FT                   /product="DEHA2A09966p"
FT                   /note="some similarities with CA5657|IPF14682 Candida
FT                   albicans IPF14682"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84727"
FT                   /db_xref="GOA:Q6BYF5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF5"
FT                   /protein_id="CAG84727.2"
FT                   /translation="MSNEIKSEEDQLYDILNLSPPVDIKLNSPINMAGQGHYNPVGESQ
FT                   YPKPENEDLFIKPVMGVPVNALPMQPAMQSGSQGTSHTNSNSSISAGKNQHNGEMYDGM
FT                   FNKNVNLNLGNNAGMSLNSNNLQQLNGELLSPPNMFGNSSHLHPQSPSVYSSHSLYSDT
FT                   SSNPGSPYIDAASHFSNAYSDMPQPPRQQVQYLDSNNQGHFNTFDTEIALGGSISSTNL
FT                   MGMSENHIQQPVPQFNYSVTQAYNGHPEQYNGNNNLASNNHNYNYQQNINSMNKLTENN
FT                   LINYNTMQEESQREVSISIEQAPEEVAAKTPSLFSNSSHNSSNNSPHKPNSGNELIPNY
FT                   QLTPTSPGSVISDVSDQQSSLLNPDEFQTIKRGRKRNHVAKTSRSRSNSRSGSKSLPQE
FT                   EDMDDEGGSVVSKNGVVSSREKMLELASPNQSSKRTQKHPSVYACHLCDKRFTRPYNLK
FT                   SHLRTHTDERPFICNVCGKAFARQHDRKRHEDLHTGEKKFQCKGFLKDGTPYGCGRKFA
FT                   RADALRRHFQTEAGKECIRLLVEEDEKDRGDGPPRDPGSIGEAGMSNEYLSPTSALISS
FT                   TTNSMHSIPQVAISPPD"
FT   gene            complement(<838758..>840005)
FT                   /locus_tag="DEHA2A09988g"
FT                   /old_locus_tag="DEHA0A10252g"
FT                   /old_locus_tag="DEHA-IPF7090"
FT                   /old_locus_tag="DEHA-CDS3102.1"
FT   CDS_pept        complement(838758..840005)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A09988g"
FT                   /old_locus_tag="DEHA0A10252g"
FT                   /old_locus_tag="DEHA-IPF7090"
FT                   /old_locus_tag="DEHA-CDS3102.1"
FT                   /product="DEHA2A09988p"
FT                   /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
FT                   YML005W TRM12"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84728"
FT                   /db_xref="GOA:Q6BYF4"
FT                   /db_xref="InterPro:IPR026274"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF4"
FT                   /protein_id="CAG84728.2"
FT                   /translation="MMTRCIVVGIENSTHIKPVKVFLEELGLFNRNKKINRSGNLHQLY
FT                   TTCKKIEELEGIPRNDVEIGYYEKEESDKSTLEGVVRGFLTNMGFGGNVEKLLEHLPKK
FT                   WSVYPPMILLNSGTFDSDVWRGFFEDGGLKDEFFGYVLSSGVFPAGLTHIAVNKPIIEQ
FT                   DIMRRPFNILPVYGDFGPEPTEEMFDSPSEQDFEQAFWCSAVQNGIYQTWAPRYTMFSR
FT                   GNIKEKKRVLEQCKDANKKCVFDLYAGIGYFTLSYLKNGATVFCWEINPWSIKGLIKSV
FT                   SKNGYSYKLIRRQESLDHASYNKYDKDGVSVYIFHESNEYAMDRYSQIGKTLPLAHINL
FT                   GLLPTSTPSWSITKALTRKSSTSTVIHVHENVHVEDFAQVGQKVADYFEGNVVAINKVK
FT                   TFAPDIWHVVIDVSLD"
FT   gene            <840463..>841854
FT                   /locus_tag="DEHA2A10010g"
FT                   /old_locus_tag="DEHA0A10274g"
FT                   /old_locus_tag="DEHA-IPF7091"
FT                   /old_locus_tag="DEHA-CDS2621.1"
FT   CDS_pept        840463..841854
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10010g"
FT                   /old_locus_tag="DEHA0A10274g"
FT                   /old_locus_tag="DEHA-IPF7091"
FT                   /old_locus_tag="DEHA-CDS2621.1"
FT                   /product="DEHA2A10010p"
FT                   /note="similar to uniprot|P32588 Saccharomyces cerevisiae
FT                   YNL016W PUB1 Poly(A)+ RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84729"
FT                   /db_xref="GOA:Q6BYF3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF3"
FT                   /protein_id="CAG84729.1"
FT                   /translation="MSDQPSTEPVKHTEAAEQPTVEPQAQESEEQEVSESPVPVSEEEH
FT                   SASEEQPNEQPNEQQQQQQPHAGQQAQQQKANEQAVDTNPASAVEGGREVSNKILYVGG
FT                   LHKSVSDEMLKDLFAVAGAIQSVKILNDKNRPGFNYAFIEFENTQSADMALHTLNGRII
FT                   NNSEIKINWAYQSSTISSLNPDEPTFNIFVGDLSPEVDDETLNKSFSKFPSLKQAHVMW
FT                   DMQTSRSRGYGFVSFGQQADAELALQTMNGEWISGRAIRCNWASHKQLNNNNNYRNNNR
FT                   HHQNNRQFRPFNNAIPQQLQNQNNGMPIGNGQFNPNQQGNMPPSQQQLHNVPQANNSNN
FT                   GNQANIPVMSPQSYDIVLRQTPSWQTTVYLGNIAHFTQQTDLIPLLQNFGFIVDFKFHP
FT                   ERGCAFVKYDSHERAALAIVQLAGFTINGRPLKCGWGKDRPPMGQFQNFGRGVPPPPMY
FT                   NQGRP"
FT   gene            <842244..>844466
FT                   /locus_tag="DEHA2A10032g"
FT                   /old_locus_tag="DEHA0A10296g"
FT                   /old_locus_tag="DEHA-IPF7095"
FT                   /old_locus_tag="DEHA-CDS0980.1"
FT   CDS_pept        842244..844466
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10032g"
FT                   /old_locus_tag="DEHA0A10296g"
FT                   /old_locus_tag="DEHA-IPF7095"
FT                   /old_locus_tag="DEHA-CDS0980.1"
FT                   /product="DEHA2A10032p"
FT                   /note="weakly similar to uniprot|P25037 Saccharomyces
FT                   cerevisiae YDL122W UBP1 Ubiquitin-specific protease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84730"
FT                   /db_xref="GOA:Q6BYF2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF2"
FT                   /protein_id="CAG84730.2"
FT                   /translation="MTSYISKESIAFFVLIIIFVVPLLDQTLLDKVLPVTFFNNIIPGG
FT                   NINSISKFIKSNRLPLSTASTLVLLSIVLSVYYGRHPLSYSLPEFVNRAFSNMNSGYRY
FT                   MTSNKSRFGPSRQSRETRFAVKNGGELGGISNDGNTCFMNSVLQSLASSKHLLKFIDSY
FT                   LYSEIEISGEPTPTTVKSNTPKPDLVFTAALRRFLEGINGSYGSRGKEFSAKPLLNKMP
FT                   NGPKQNFFTGYNQEDAQEFYQLVMNLVETEYKKDSKSRQSSPEPDSSEKSPSDKFVDSA
FT                   LVPNLISGCEELGRLGKVYVPASQVDPNLLEIDHKVYPLDLVTPVDGISVERIGCLACG
FT                   EVGGIRYSVNSGLSLNLPNKSSYSGYDLDSLMNDWIAPEIIEDVNCNRCGLVQTKAFLL
FT                   SKISEANNEKIIGQFQNRADEIEKELLQPHITDEVFEKLSIKQMIRKTKKSKQISLSRP
FT                   PPLLTIHINRSVFDPKTYMIVKNPSNVSFPSRLDLTSYVTEPKDINMDARLPFRKQDER
FT                   TINIPLADINKPSNSSESESSNTVSMSDQDNFEDKELSQSDRYSNSTSDSSENQDNCIA
FT                   LNPKLLYNLKAVISHFGTHNYGHYICYRRLRGSWWRISDESVYVVTENEVLNSQGTFML
FT                   FYEYNDGVNEILQHLDDDEEEDQESESAHGNSQCALDSESYEKNNTPTKLEDDDYLNNR
FT                   DDDDSQSSGLSDDGDIGLPNENLDSERNGNLSMDDYNVEEGRAFHI"
FT   gene            <844650..>845618
FT                   /locus_tag="DEHA2A10054g"
FT                   /old_locus_tag="DEHA0A10318g"
FT                   /old_locus_tag="DEHA-IPF7096"
FT                   /old_locus_tag="DEHA-CDS4000.1"
FT   CDS_pept        844650..845618
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10054g"
FT                   /old_locus_tag="DEHA0A10318g"
FT                   /old_locus_tag="DEHA-IPF7096"
FT                   /old_locus_tag="DEHA-CDS4000.1"
FT                   /product="DEHA2A10054p"
FT                   /note="similar to uniprot|P40493 Saccharomyces cerevisiae
FT                   YIL096C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84731"
FT                   /db_xref="GOA:Q6BYF1"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYF1"
FT                   /protein_id="CAG84731.1"
FT                   /translation="MAKKLKGKLVNSKGLKGALARLTTKEEIIKKTEKSMEIQKDKQAL
FT                   KEKSIKSGKRNKKKAQNQQIQQKGLQPFNIDDKLLLVGEGDFSFAVSIIKENFIKPENL
FT                   IATSFDSKDEIIQKYPTVEQNLNFLIDEGVQLLHSIDATDLVSSLKLNTTAKNKKKAKA
FT                   RLFSDNRNLDYIMFNFPHTGKGIKDVDRNIIDHQKLVLNYFKSCRAVFNLVNNDMENDF
FT                   AGYASSAVNENKGKILLTLFEGEPYTSWNIKILGRSEDYKVERSGKFSWQMFPDYHHRR
FT                   TNSVRDTTKPASERDARIYVFEQFTKKDDKRKKTDDSDSDN"
FT   gene            complement(<845724..>847259)
FT                   /locus_tag="DEHA2A10076g"
FT                   /old_locus_tag="DEHA0A10340g"
FT                   /old_locus_tag="DEHA-IPF7097"
FT                   /old_locus_tag="DEHA-CDS2258.1"
FT   CDS_pept        complement(845724..847259)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10076g"
FT                   /old_locus_tag="DEHA0A10340g"
FT                   /old_locus_tag="DEHA-IPF7097"
FT                   /old_locus_tag="DEHA-CDS2258.1"
FT                   /product="DEHA2A10076p"
FT                   /note="similar to uniprot|P40492 Saccharomyces cerevisiae
FT                   YIL097W FYV10"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84732"
FT                   /db_xref="GOA:Q6BYF0"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027714"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYF0"
FT                   /protein_id="CAG84732.2"
FT                   /translation="MSEPTVNFHIQTRLTEFKIPTELIKKNFKAVQKQIEKQKKSIGED
FT                   VAKVKKNNKLPTAMKIEMINKLIKSFEIFQKRLRTSINRDEVFRSRIIARLENLSELAN
FT                   YTVKTNVVLESNASPIDSDDNRDESSVTPKSMEDEDRPLDLHNVNLINWYRDQTNLLII
FT                   DYLIKSNTRSDQNIGLQLLKSISQTNPKFTKLIDYDLYDNFNKVFVSIIENHDLSLVIA
FT                   WFNENRSFLKKANSNLEFEINYCKFLSLIEEGDVNEAIKFSQVNLSPYGNKGNYQSQEF
FT                   MNHESNLNKLKEIGGLLVYMAINEKANAQIDKSIPFSSSLVINSPRFKEYKKLLSNERW
FT                   DSLSQCFIENFTKLYGISRNYPLFIYLSAGLSSLKTKSCYCNTENTIFKQYEESSESNK
FT                   NIYKKDLAVLTDKKYRGPNKYYKLLNKINHCPVCSPELYKLSKNLPYAQLITSIFNNPF
FT                   KLPNGNIYPFDKLLNPSEKYLSEKNTLLRMGKIKDPLTREIFLIDDCVRVYPA"
FT   gene            complement(<847519..>849966)
FT                   /locus_tag="DEHA2A10098g"
FT                   /old_locus_tag="DEHA0A10362g"
FT                   /old_locus_tag="DEHA-IPF7098"
FT                   /old_locus_tag="DEHA-CDS0784.1"
FT   CDS_pept        complement(847519..849966)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10098g"
FT                   /old_locus_tag="DEHA0A10362g"
FT                   /old_locus_tag="DEHA-IPF7098"
FT                   /old_locus_tag="DEHA-CDS0784.1"
FT                   /product="DEHA2A10098p"
FT                   /note="some similarities with uniprot|P40009 Saccharomyces
FT                   cerevisiae YER005W YND1 Yeast Nucleoside Diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84733"
FT                   /db_xref="GOA:Q6BYE9"
FT                   /db_xref="InterPro:IPR000407"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE9"
FT                   /protein_id="CAG84733.2"
FT                   /translation="MDFLEPRKQKKVITPGPIESKEGIPYDYIVVIDAGSKGSRVYVYN
FT                   WLNPVHILQNDIDLNDIADNRELKLVRRFFINSIGGRDNDEDSDSENEDNEENHNTDKE
FT                   KEKGKEKDKEKSKEKGKDRDKGKYKDKDNKTGKGGDQDKEKDKPKEPENENTRRLPLVG
FT                   AKKKWNKKIKPGISSFNSSPQKIGNHHLKHLLQLASIVVPKSQHSRTPIFLHSTGGMRL
FT                   LPPIEQQQILDNICKYITHNSDFFIPECSTHVNVIDGDVEGLYGWLSINYLIGALDNPQ
FT                   NHQHGKNHTTYGLLDMGGASTQVVFQPNFTEIEEHDKNLFKVKLVELPTPISGEQKKEQ
FT                   TGKNEDSIGSFNTPSDLNFDIYSDSFLGFGMYQAHNRYLSFLTEKYTEEHELNKPAYYG
FT                   RSHTPVPDPCLPKGYTTTSVINDDSVHFTGESDFNKCLTSIFPVLHNSTHNAGSGKDEN
FT                   CKEFKDSDESSSCLLNDLIPAFDFDVNHFVGVSGYWDAITNLLSYEDKSARNLARSSDK
FT                   KPGGKDAADTYDYKVIYNATSKLCSQSFSRLIELNNVRPEKNQMAEEELSDLCFKSSWI
FT                   LNFLHLGLGFPRFGIDKHATENSRFKSLELVERLGGSSFSWTLGRAILYANDEYVQAFN
FT                   NFTADTIGLSEEDRITSKTNIPRSGFYHSASSSVFHFGAEQSGIFPRPQFNPPVKDAKY
FT                   TIFDYETDYQPEYKESKWDIEPHRWYGSLVFISLIGFILWLLMGRSGRAALIDKTKNKL
FT                   NSIFNLVKGRTGNSSYFRLNNDAGNEGDLELADFELNESSHNLHGTSAEEADNQFKIDS
FT                   DED"
FT   gene            complement(<851102..>851650)
FT                   /locus_tag="DEHA2A10120g"
FT                   /old_locus_tag="DEHA0A10384g"
FT                   /old_locus_tag="DEHA-IPF7099"
FT                   /old_locus_tag="DEHA-CDS5576.1"
FT   CDS_pept        complement(851102..851650)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10120g"
FT                   /old_locus_tag="DEHA0A10384g"
FT                   /old_locus_tag="DEHA-IPF7099"
FT                   /old_locus_tag="DEHA-CDS5576.1"
FT                   /product="DEHA2A10120p"
FT                   /note="similar to uniprot|P25378 Saccharomyces cerevisiae
FT                   YCR027C RHB1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84734"
FT                   /db_xref="GOA:Q6BYE8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE8"
FT                   /protein_id="CAG84734.2"
FT                   /translation="MVKARKLAVVGSRSVGKSSMTVRYVEDHFVESYYPTIENQFSKTI
FT                   NYKNQDYAIEILDTAGQDEFSIMNEKHLIGIHGYLLVYSVTSRQSFELIKVIRDKILNS
FT                   IGTDQIPIVLIGNKSDLNYQRQVETEEGQALAKEFGYRFLETSVRDDVNIDTAFESLID
FT                   EIEAIQNPTIKQDDKCTIM"
FT   gene            complement(<851981..>853456)
FT                   /locus_tag="DEHA2A10142g"
FT   CDS_pept        complement(851981..853456)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10142g"
FT                   /product="DEHA2A10142p"
FT                   /note="similar to uniprot|P38355 Saccharomyces cerevisiae
FT                   YBR287W ZSP1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65400"
FT                   /db_xref="GOA:B5RSU4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU4"
FT                   /protein_id="CAR65400.1"
FT                   /translation="MPQKSLSYQSISYLTFEAILEVVIICFAGFVAAKSGILNTQAQKV
FT                   ISQLNVDLFTPCLVFTKLAPSLSFEKMVDILIIPVFYAVSTGISYGCSQVVGWMLRLNS
FT                   PETDFITAMAVFGNSNSLPVSLTLSLASTLPNLLWDDIEGDTPDKVASRGILYLLIFQQ
FT                   LGQVLRWSWGYNKLLRKRSQEELDSYSKLNHDDDQERDLDVGDEQRPLLSDPDMRGAHF
FT                   DTINGVDVDLNNSIAAKNDSKSLSYKPPRTDSSSSISSNGSQSLPEENVFVERISDDSD
FT                   ANSDQASTGIHKRRARIYQLWYALKRLPVIKEFLAFMNPPLYAMLISVVVACVPALQRE
FT                   FFVDEESFIHNTLSQSIHSLGSVSIPLILIVLGSNLYPSNDMPPPSRHYKRIVVGSLLS
FT                   RMILPPFILLPIITLCVKFFKVSILDDPIFLIVAFILTISPPAIQLSQITQLNNIYQKE
FT                   MSGVLFWGYVVLTLPTTIFIVVTSLEVLKWATT"
FT   gene            <854499..>856160
FT                   /locus_tag="DEHA2A10164g"
FT                   /old_locus_tag="DEHA0A10428g"
FT                   /old_locus_tag="DEHA-IPF7107"
FT                   /old_locus_tag="DEHA-CDS1930.1"
FT   CDS_pept        854499..856160
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10164g"
FT                   /old_locus_tag="DEHA0A10428g"
FT                   /old_locus_tag="DEHA-IPF7107"
FT                   /old_locus_tag="DEHA-CDS1930.1"
FT                   /product="DEHA2A10164p"
FT                   /note="similar to CA3143|IPF8295 Candida albicans IPF8295"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84736"
FT                   /db_xref="GOA:Q6BYE6"
FT                   /db_xref="InterPro:IPR038753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE6"
FT                   /protein_id="CAG84736.2"
FT                   /translation="MMGHTNTHSSTPSKRIEEAPLKWYNNRNHDDSENESLVNSSFDFD
FT                   MAGASTPLKMGKMPVGRGTGDISVSFSSPMKKLDNLHLESELDLDEGENHDELGNQTVV
FT                   GESDTDDEYGPVYGEDYEESSSGATGGTPSESNGHGRQPPRYVNRRKRHLDSPSDIDME
FT                   TPRQAQMTNTSVRSDMSICLNNSTNNTFKLSFSNSDSTPCPVQPRKKSKLKFKGSPSQQ
FT                   QTPSQTKLTKVKHLLNFENSIKTSVSQNPIMNKLSAMTNHDNDAWTHDDEEDEDDEDDY
FT                   LPRDSLISSPQQTSTLNTTVNSNQNIQSTPISQSTPANSRPPTPSHSPQVPIMDEFGDS
FT                   INGYKFVKPTRKPQHAYYNYQTPTNKILRSQELKTSYNRNEYDTHSAGNLNNGKYKIVG
FT                   DLPMSSAGLMDEAEVDLHVGDKRINDPYLQAVSETNSDQERISIRNLYFQSFNSSDLSQ
FT                   LKLPLLTMFRANTMSTEEIVKLINDRQPISSFYEYIKSEDEDVLDLLKRERLRWHPDKW
FT                   VSKLRSHLPKENLVINKQVIDSLSQSLNSIIENHKQ"
FT   gene            complement(<856258..>857052)
FT                   /locus_tag="DEHA2A10186g"
FT                   /old_locus_tag="DEHA0A10450g"
FT                   /old_locus_tag="DEHA-IPF7110"
FT                   /old_locus_tag="DEHA-CDS4653.1"
FT   CDS_pept        complement(856258..857052)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10186g"
FT                   /old_locus_tag="DEHA0A10450g"
FT                   /old_locus_tag="DEHA-IPF7110"
FT                   /old_locus_tag="DEHA-CDS4653.1"
FT                   /product="DEHA2A10186p"
FT                   /note="highly similar to uniprot|P32447 Saccharomyces
FT                   cerevisiae YJL115W ASF1 Nucleosome assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84737"
FT                   /db_xref="GOA:Q6BYE5"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR017282"
FT                   /db_xref="InterPro:IPR036747"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYE5"
FT                   /protein_id="CAG84737.1"
FT                   /translation="MSIVSLLGIEVLNNPAKFTDPYEFEITFECLEPLKEDLEWKLTYV
FT                   GSSRSLDHDQELDSILVGPVPVGINKFLFQADPPSPELIPASELVSVTVILLSCSYADR
FT                   EFVRVGYYVNNEYDSEELRENPPAKVQVEHVVRNILAEKPRVTRFNIVWDNEDGNADEY
FT                   PPEQQVDEEEEEEEEEEEEEDDEEEEEEKDVEGEEGEEGEDAEEAAEVEENGSKEASKE
FT                   EDIEEDIEEDIEEDIEEDIEIEDEEEAKNADQGETPIDKVQS"
FT   gene            <857237..>858118
FT                   /locus_tag="DEHA2A10208g"
FT                   /old_locus_tag="DEHA0A10472g"
FT                   /old_locus_tag="DEHA-IPF7112"
FT                   /old_locus_tag="DEHA-CDS4440.1"
FT   CDS_pept        857237..858118
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10208g"
FT                   /old_locus_tag="DEHA0A10472g"
FT                   /old_locus_tag="DEHA-IPF7112"
FT                   /old_locus_tag="DEHA-CDS4440.1"
FT                   /product="DEHA2A10208p"
FT                   /note="weakly similar to CA3680|IPF8395 Candida albicans
FT                   IPF8395"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84738"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE4"
FT                   /protein_id="CAG84738.2"
FT                   /translation="MSDIPGDGNKVMASDKNMAENQPKSVDENEEEEIHSKLDAKQADE
FT                   EPNKQQTEEYNDNEDGREPAHENEDENFKAENDDSDPEIEQGHVDNDAQDPASNKDYAK
FT                   LFEKYQERFYKVYSVSQKLFQSEVSQRQALSFYQRRNNALIDLLDKFESKEPVSPTTDQ
FT                   VLADSDKSRIENLITMNPRLKEVLAPLLAIDDSQQQFKETHKINLLINEAMPDLINDDM
FT                   GNFELNPQDIEPWVRRHYPNLVISKYKPLTISGNKFKETVDTGSTTTTKRKRKSSKDDE
FT                   NEEDPQSKKPKK"
FT   gene            complement(<858142..>861801)
FT                   /locus_tag="DEHA2A10230g"
FT                   /old_locus_tag="DEHA0A10494g"
FT                   /old_locus_tag="DEHA-IPF7115"
FT                   /old_locus_tag="DEHA-CDS0166.1"
FT   CDS_pept        complement(858142..861801)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10230g"
FT                   /old_locus_tag="DEHA0A10494g"
FT                   /old_locus_tag="DEHA-IPF7115"
FT                   /old_locus_tag="DEHA-CDS0166.1"
FT                   /product="DEHA2A10230p"
FT                   /note="similar to uniprot|P40061 Saccharomyces cerevisiae
FT                   YER093C TSC11 Binding Protein of TOR"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84739"
FT                   /db_xref="GOA:Q6BYE3"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028267"
FT                   /db_xref="InterPro:IPR028268"
FT                   /db_xref="InterPro:IPR029451"
FT                   /db_xref="InterPro:IPR029452"
FT                   /db_xref="InterPro:IPR029453"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE3"
FT                   /protein_id="CAG84739.2"
FT                   /translation="MNNRINPYTPQDPHPSGSTTSLQDLNNSKQQSSRYNDPRFPREMM
FT                   RSSKSENDFMNRDNRDRSSTMNSIDSLNINSIENSKMYKVHVDQDDMNELINESPANIK
FT                   SPTWLLSDILQSFSSIRDTDEYQIVSKGNDLVSILIKYPHLKNDIVLKSFLNKIQFMLY
FT                   HDVSEVRATGYRIMRYIISNYESLTMLIQSKILIFIIISLSTNSSLLEKEQALKLIREF
FT                   LNIPKGTDNLSIGVIKSLIAIIEISEPVANITDNFKKICIETICEIALLRPELIFHSSG
FT                   FKIIIETIVEDDSIELSGNCILVLMKVLDSENTRKFLRNGHDLNSLVSTFSSIDSGEED
FT                   KNIPTFKLQKAAFSLSIILKNWNGLMSFSHNNFACLKDLILNLKKKGPKLRDIIMDIIL
FT                   DMLRIEMLPWLKSSSIGDVIQCFNNYGHNSNYSFEYDEISPESFEFNLINHYLGLIIAI
FT                   LINHGIIDLLIEVIEENSNEANTKKATKLVTHIYSMANNFLPNELLQSKLILPSLRNEC
FT                   LEHSSTFKIWQSTRRSNEVTQASGFDPSNSSSKKLKLYIKNVSIGSRYNIDDTEFKNMV
FT                   NNIRILTIKEYEDWNWNLLFSFIQGPLRNPKRFDEILEKNPKFLKRLMSFYRPFKFRFC
FT                   NMPITHKNFKMYINIGCQLLETYLTLNQGIKYLSSNKLLPQVSEIFAQVDPYSGIVAKE
FT                   PILSKKRLENTLSIGYVKFIGTLSANSYGLKMLEQWQFINLFHNIIEGSRNSESNNYLI
FT                   INLLNSLDFTIDSQLRIVLSKAIGISNLKIRNFIIDNVIPKLIKIKECEHFVIKLLVNQ
FT                   LYDLDQEISDKSIDLLYDCYLSNDINILNHIISLRPSIVILSKHASGKMLLMNFMKTSI
FT                   GFKFLEDSGFIDAEFDKWINLIGFEYVKKIELLIQRRFFPYVSSIAFDEKLPVHFFNYL
FT                   LQTEEGLVYFQTLKQRNYLENLISNIEMISAKIAENNNDEISVDDGDEEEEDQSKLINK
FT                   LKQNLWIIGSIASAKYGIQLLDTAYTNMDKSVVSMILNLFYNSPSWQIRGISFYLIGSI
FT                   ASTIEGIEILDELNWYSVIDKYHNPMKLSYPKDLYTKDIFNVEINNPYRDIKYYSLFSG
FT                   GDENLETDRLFGDIDDDEFFDHEKIYEKILNLVKHSSSVLNRIARKATKQLMFIKKNSP
FT                   SVFENRNLFLKIIKLVDRGSYKFSIRKFIFELFLDTKVLENLVKRDKKNINIK"
FT   gene            <862607..>863518
FT                   /locus_tag="DEHA2A10252g"
FT                   /old_locus_tag="DEHA0A10516g"
FT                   /old_locus_tag="DEHA-IPF7117"
FT                   /old_locus_tag="DEHA-CDS4210.1"
FT   CDS_pept        862607..863518
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10252g"
FT                   /old_locus_tag="DEHA0A10516g"
FT                   /old_locus_tag="DEHA-IPF7117"
FT                   /old_locus_tag="DEHA-CDS4210.1"
FT                   /product="DEHA2A10252p"
FT                   /note="similar to uniprot|Q7S346 Neurospora crassa
FT                   NCU09169"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84740"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE2"
FT                   /protein_id="CAG84740.2"
FT                   /translation="MSKLLVVFGATGQQGSSVVSYVKERMSDKFKIRAITRDPSKPEAK
FT                   TLQESGVEVVKADLGDKQSIKQAFKGADTIFAMTALNFGGQTELEQGKLIADAAVEEKV
FT                   PNIIWSTLVNANEISNGEFPHVVHFDEKAEVEKYIRSLPINSSFFSPGCFMQNFLGMLK
FT                   PQPVGDGKYSMFNVLRPGSEVPFFDTEDTGKFVGAILNEPEKFHGKILYAANGMYSYET
FT                   IAKIISKDTGKKVNYQQIPGNTFKEQIPEPIAEEITEMFQFFDKYNLYGPETREKVEWG
FT                   MSQVSDKLSTFEGFFERNPLGL"
FT   gene            <864304..>865218
FT                   /locus_tag="DEHA2A10274g"
FT                   /old_locus_tag="DEHA0A10538g"
FT                   /old_locus_tag="DEHA-IPF7121"
FT                   /old_locus_tag="DEHA-CDS4195.1"
FT   CDS_pept        864304..865218
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10274g"
FT                   /old_locus_tag="DEHA0A10538g"
FT                   /old_locus_tag="DEHA-IPF7121"
FT                   /old_locus_tag="DEHA-CDS4195.1"
FT                   /product="DEHA2A10274p"
FT                   /note="similar to uniprot|Q7S346 Neurospora crassa
FT                   NCU09169"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84741"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE1"
FT                   /protein_id="CAG84741.2"
FT                   /translation="MSKILVVFGATGQQGSSVVSYVKERMSDRFKIRAITRDPYKPEAK
FT                   ALEESGVEVVKADLGDKQSIKQAFKGADTIFAMTAVSFGGQTELEQGKIIADAAVEEKV
FT                   PNIIWSTLPSANEISNGEFTHVVHFDEKAEVEKYIRSLPINSSFFSPGCFMQNFATSLK
FT                   PQPVGDGKYTMFNVMRPASEFPFFDTDDTGKFVGAILNEPEKFHGKILYAATDLYSYEV
FT                   IARIISKDTGKNVNYQQIPANAFREQIPKPIAEEITEMFQYVDKYNHYGSETREKVEWG
FT                   KQQVSEKLTTLEEYFKRNPLGLE"
FT   gene            <866347..>867079
FT                   /pseudo
FT                   /locus_tag="DEHA2A10285g"
FT                   /old_locus_tag="DEHA-IPF7122"
FT                   /old_locus_tag="DEHA-CDS8976.1"
FT                   /old_locus_tag="DEHA0A10560g"
FT                   /old_locus_tag="DEHA-IPF7124"
FT                   /old_locus_tag="DEHA-CDS7813.1"
FT                   /old_locus_tag="DEHA0A10571g"
FT                   /old_locus_tag="DEHA-IPF7125"
FT                   /old_locus_tag="DEHA-"
FT                   /old_locus_tag="CDS8087.1"
FT                   /old_locus_tag="DEHA0A10582g"
FT                   /note="similar to uniprot|Q7S346 Neurospora crassa NCU09169
FT                   frameshift pseudogene"
FT   gene            <869161..>870195
FT                   /locus_tag="DEHA2A10296g"
FT                   /old_locus_tag="DEHA0A10604g"
FT                   /old_locus_tag="DEHA-IPF7129"
FT                   /old_locus_tag="DEHA-CDS3746.1"
FT   CDS_pept        869161..870195
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10296g"
FT                   /old_locus_tag="DEHA0A10604g"
FT                   /old_locus_tag="DEHA-IPF7129"
FT                   /old_locus_tag="DEHA-CDS3746.1"
FT                   /product="DEHA2A10296p"
FT                   /note="weakly similar to uniprot|P40463 Saccharomyces
FT                   cerevisiae YIL135C VHS2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYE0"
FT                   /protein_id="CAG84745.2"
FT                   /translation="MASHNHNRNGLSLFSFKSGSNGSSKSSVKGGESTSPTNRSIENHQ
FT                   LSSPVNSPMLMGDETSDVVSEANSDIFERSVQDSCTDLHSTHSQPKCNRCTTNRSRSCT
FT                   HNSSLSLQGGLKNEDFIPPAIDATTSILSDEDMNLDDVEMVYSNRRNSSVIGLNMALGR
FT                   PFGSSRKSSTYSLQSSQPQAAQQTQSPISPPKLTSSKSSLSFYSYADMISNEEMQRRPS
FT                   FKQSYSYSQNSFPLKKKSHVGSIPPPYKKSGQSLLSKELSAKNPSTTASPNQSFSNQNF
FT                   LISPESSDSEHENYFQGKRKSISSNISSNSKPNNLRFDNDNESLVSSSVGDCLRQSTTE
FT                   INGN"
FT   gene            complement(<870603..>871457)
FT                   /locus_tag="DEHA2A10318g"
FT                   /old_locus_tag="DEHA0A10626g"
FT                   /old_locus_tag="DEHA-IPF7130"
FT                   /old_locus_tag="DEHA-CDS4423.1"
FT   CDS_pept        complement(870603..871457)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10318g"
FT                   /old_locus_tag="DEHA0A10626g"
FT                   /old_locus_tag="DEHA-IPF7130"
FT                   /old_locus_tag="DEHA-CDS4423.1"
FT                   /product="DEHA2A10318p"
FT                   /note="highly similar to uniprot|P53941 Saccharomyces
FT                   cerevisiae YNL075W IMP4 Component of the SSU processome
FT                   required for pre-18S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84746"
FT                   /db_xref="GOA:Q6BYD9"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYD9"
FT                   /protein_id="CAG84746.2"
FT                   /translation="MIRKQARERREYLYRKSLELQESSLTEKRQQLKAALASGKPLSKE
FT                   LAEDKELQKDFIYDESEQTEIDDEYSALSGISEPKVLITTSRNPSVKLLQFSKEIKLMF
FT                   PNSIKLNRGNYVITDLVATCQRVQISDLIILHEHRGIPTSLTISHFPHGPSIIFTLHNV
FT                   KLRHDLPEIGNSSESYPHLVFENFTSELGKRVVKIMKHLFPPGVKKDSSRVITFINNDD
FT                   FISVRHHMYVKTKDTVELSEVGPRFEMRLYELRLGLLDNKDSEVEWQLRRFIRTGNRKN
FT                   YLG"
FT   gene            complement(<871634..>874786)
FT                   /locus_tag="DEHA2A10340g"
FT                   /old_locus_tag="DEHA0A10648g"
FT                   /old_locus_tag="DEHA-IPF7133"
FT                   /old_locus_tag="DEHA-CDS0377.1"
FT   CDS_pept        complement(871634..874786)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10340g"
FT                   /old_locus_tag="DEHA0A10648g"
FT                   /old_locus_tag="DEHA-IPF7133"
FT                   /old_locus_tag="DEHA-CDS0377.1"
FT                   /product="DEHA2A10340p"
FT                   /note="similar to uniprot|Q9P851 Debaryomyces occidentalis
FT                   trk1 High-affinity potassium uptake transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84747"
FT                   /db_xref="GOA:Q6BYD8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004773"
FT                   /db_xref="InterPro:IPR015958"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD8"
FT                   /protein_id="CAG84747.2"
FT                   /translation="MNRVSKLWHSYKRHRVHGDTGLKIRNAIHRTTEKVYPYVKVVIPN
FT                   FRAAHYTYILFMTFLGSVIFYPIRNIRYIDALFFTGCASTQAGLNTVNLNRLALYQQIL
FT                   IYIITTLTTPIFIHGSLLFIRLYWFERHFDNIKESSKLNNKMRRNATLAARTQSLDPTR
FT                   LNTEVNRGLGLNNPQSSGPEPVIDEVAFSNSSSTSPASKHSSPPQNPSINSNNVNHISE
FT                   PSDTDISSGVAPDSRNPINLSRPESPPRSLDGIRFGNLPQPSKIRQKEIEPSDMYMSIA
FT                   MLQDNHKSERKDNGDEDDVLIIKSPNEIEKDSQNPIFTKKSQIHFNVNDKPIRKWKKKR
FT                   RFSRGRQPWSKLKKTFSNSGVSPRKHVRSLSFTSLSNDDDDQSIDSETNNRTTDTDADD
FT                   DNAIIDDDDDDDEDDGDDDDEDDGDDEDEDDDDEDDEDDDQDDEEDEYNRQNRHDDNLD
FT                   DIERAQSNLVIPSSDATGGKKFTKRSNTLDVTPGENHELSHSPTFEKMIKSKMKKKKKP
FT                   KQTKKQKLKYMKSPTVGLNSSLFSPNYNNGSDYDDSDDSDEDDDDEEEDGKSLSKVMST
FT                   NYLSWVPTVGRNSTFVHLSEEQKEELGGVEYRAIKLLIKIIVIYYIGFHILAFTCLLPY
FT                   ILYQPVYKADVINVGITPTWWAFFTAQSAFNDLGHTLTPNSMQSFDKSVYVMVIVAFFI
FT                   VIGNTGFPVMLRFIIWVLFKLSKPMSLFNESLGFLLDHPRRCFTLLFPSVPTWWLFIIL
FT                   VVLNAVDLILFIVLDLNNKYLESTPIGLRVMDGLFQAFSTRTAGFAVVDLSELHPAVQV
FT                   SYMLMMYISVLPLAISIRRTNVYEEQSLGVYLKDNNDDNDDAPDDKTPRNFIGAHLRNQ
FT                   LSFDLWFIFLGLFIICIAEGPKLNKNNYRFSIFTILFEIISAYGTVGLSLGYPGVDVSL
FT                   SGEFTVLSKLVMIAMVIRGRHRGLPYALDRAIMLPDDNMQKRDNLQENHAIRRHQTMET
FT                   SNSLDDGNAFRRAFTRRASSFGFDNTNILGRRKSSVRSSKPKPETPHYIVTTESHEMDD
FT                   LA"
FT   gene            complement(<875412..>877055)
FT                   /locus_tag="DEHA2A10362g"
FT                   /old_locus_tag="DEHA0A10670g"
FT                   /old_locus_tag="DEHA-IPF7135"
FT                   /old_locus_tag="DEHA-CDS1981.1"
FT   CDS_pept        complement(875412..877055)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10362g"
FT                   /old_locus_tag="DEHA0A10670g"
FT                   /old_locus_tag="DEHA-IPF7135"
FT                   /old_locus_tag="DEHA-CDS1981.1"
FT                   /product="DEHA2A10362p"
FT                   /note="weakly similar to uniprot|P38125 Saccharomyces
FT                   cerevisiae YBR180W DTR1 Multidrug resistance dityrosine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84748"
FT                   /db_xref="GOA:Q6BYD7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD7"
FT                   /protein_id="CAG84748.2"
FT                   /translation="MSSRSTSSLESAEESFHESQPNVFNETIPLELTSVTDEAVHRSIS
FT                   RIQSRRSSNSRLPGQDEDQRIEQHVSPYRDIEKALGDEKSNGSDIDATSKDTKTERFSN
FT                   RTKKICIFIAAVSGFLSPLSSLAFLPAIPEMAKEYNTTGEIINVSSAVYCVFMSLSPCV
FT                   FSPFSDIYGRRFSFLVCSCLFSVCSILVAVSPHLAMFFVFRSLTALVGTAFFSIGAHIV
FT                   GDLYIPTERGTYMSIIIMGAQFGTALGSVGGGIIVNFTSWRVIFFVLAGIGFVVMAMAF
FT                   VFLPETSLETKHQIVLREARKDNPNKKFVFITYNPLRIMTALKYPNLSIDGFITISVVF
FT                   TMYSLLTPIRYVMDPRFDLTSPILSALFYLPPGLGYLVGSLFGGRWADYTVKKYIKIKG
FT                   RRVPEDRLRTILIPIGVVYPACMIIYGWSVEKEKGGIAVPVIFMFISGVAQTCIFPAAN
FT                   TYCVDSMPELGGDGIGSSYFSRYIAAAVASATCLRSIDNIGVGWSCTISAFVLWVGAIC
FT                   GIVLIYFGESMRKKALIKYGLRTPESFNTN"
FT   gene            complement(<877737..>879410)
FT                   /pseudo
FT                   /locus_tag="DEHA2A10373g"
FT                   /old_locus_tag="DEHA-IPF7136"
FT                   /old_locus_tag="DEHA-CDS2908.1"
FT                   /old_locus_tag="DEHA0A10692g"
FT                   /old_locus_tag="DEHA-IPF7138"
FT                   /old_locus_tag="DEHA-CDS7635.1"
FT                   /old_locus_tag="DEHA0A10714g"
FT                   /note="weakly similar to uniprot|P38125 Saccharomyces
FT                   cerevisiae YBR180W DTR1 Multidrug resistance dityrosine
FT                   transporter stop in frame"
FT   gene            <880936..>887571
FT                   /locus_tag="DEHA2A10384g"
FT                   /old_locus_tag="IPF_7140"
FT   CDS_pept        880936..887571
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10384g"
FT                   /old_locus_tag="IPF_7140"
FT                   /product="DEHA2A10384p"
FT                   /note="highly similar to uniprot|P07259 Saccharomyces
FT                   cerevisiae YJL130C URA2 Multifunctional carbamoylphosphate
FT                   synthetase-aspartate transcarbamylase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84751"
FT                   /db_xref="GOA:Q6BYD4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD4"
FT                   /protein_id="CAG84751.1"
FT                   /translation="MAQISNPITPPMKSTGDRMMTLETQDGIAMQGYSFGAPVAAAGEV
FT                   VFQTGMVGYPESITDPSYEGQILVITYPLVGNYGVPDRSLKDDDVPELPKYFESNKIHI
FT                   AGLVVAHYTEEYSHFLAKSSLGQWLQEQGIPAIYGVDTRSLTKRLREKGSTLGRLALQK
FT                   ASSKSSEIIETSKWEQHFEIPEWDDPNVKNLVAKVSTKEPVLYTPKNDVKVGKNGKPLR
FT                   ILAVDVGMKYNQIRCFIRRGVELKVVPWDYDFSTEEYDGLFISNGPGDPSVMTSTVSTL
FT                   QKVLEAGKTPVFGICLGHQLLARATGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHG
FT                   YAVDTNTLSSGWKELFVNANDSSNEGIYHDSKPYFSVQFHPESTPGPRDTEFLFDVFIQ
FT                   SVVDFNKSGVQKAVEFPGGLLEENRAAHPKVDAKKVLVLGSGGLSIGQAGEFDYSGSQA
FT                   IKALKEEGIYTVLINPNIATIQTSKGLADKVYFLPVTADFVRKVIKHERPDGIYCTFGG
FT                   QTALGVGIKLKDEFEGLGVKVLGTPIDTVITTEDRELFSQAMDEINEKCAKSAAANNVS
FT                   EAIDAANSIGYPLIIRAAYALGGLGSGFADNEQELVALCNKAFATSPQVLVERSMKGWK
FT                   EVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIR
FT                   HLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLN
FT                   EIKNSVTKSTSACFEPSLDYVVVKIPRWDLKKFTRVSALLSSSMKSVGEVMSIGRTFEE
FT                   AIQKAIRSTDYQNLGFNKTSALMSIDIDNELQTPSDQRLFAIANALSDGYSVEKVWKLT
FT                   NIDKWFLNKLDGLIKFGNLVTTYGVKENLPVTVLKQAKQLGFEDRQIAKFLNSNEVAIR
FT                   RLRKEAGVIPFVKQIDTVAAEFPAFTNYLYITYNADSSDVSFDDHGVIVLGSGVYRIGS
FT                   SVEFDWCAVRAIRTLRENGTKTIMINYNPETVSTDYDEADRLYFETINLERVLDIYDLE
FT                   QSSGVVISMGGQTSNNIALPLYRQNVKILGTSPEMIDSAENRYKFSRMLDRIGVDQPAW
FT                   KELTSIDEAEDFAEKVTYPVLVRPSYVLSGAAMNTVYSRDDLASYLSQAVDVSPDYPVV
FT                   ITKYIENAKEIEMDAVAKDGKMIMHVVSEHVENAGVHSGDATLVVPPQDLDPETVGRIV
FT                   EATAKIGKALDITGPYNIQFIAKDNDIKVIECNVRASRSFPFISKVVGTDLIEMATKAI
FT                   MDMPFTPYPGEKLPEDYCAVKVPQFSFSRLAGADPVLGVEMASTGEVATFGKNKYEAYL
FT                   KSLISTGFKLPKKNILFSIGSYKEKQELLPSIRKLHELGYKIFATAGTADFIKEHSIPV
FT                   HYLEVLGEKEDQKSEYSLTQHLANNLIDMYVNLPSSNRFRRPASYMSKGYESRRMAVDY
FT                   SIPLVTNVKCAKLLVEALARNISLDVSEIDAQTSHKTAVIPGLVNINSFVSSFDEFEAT
FT                   TRASLASGFTFNTFLPQTSDCSTISNIETLADAIESATNSAYTDFSLSIAASETNSEEA
FT                   AYAAEDAGALFIPFNDFNKSKVSAISAHFASWPENKPIITDAKTTDLASVLLLASLHSR
FT                   SIHITGVSSREDLGLIIMAKEKELQVTCDVSVYALFLSQAEFPQLDFLPTKEDQNALWS
FT                   GLKNIDCFSIGVLPYLVSKALNKKFCPGLGTKETLPLLFNAVKEGRLTTQDIVERFHDN
FT                   PVRIFNIPKQESSVEFDIDRLAASTNDSEVLTIARANLQGAVNRVSFHNETVCLGGEIL
FT                   AVNALGHNGVEPRARFGSVTGIPSSPALSNKKARMSFNDGARRPSLLREQSSIPAEFEK
FT                   LGAELVSQPPTSSVSGDNNALINYIRKNNTFLRNSVLSVKDFTRSDLHSLFTVAQEMRL
FT                   AVERQGVLDILKGRLLATMFYEPSTRTSASFDAAMQRLGGRVVSVASASSSVKKGETLQ
FT                   DTIRTLTCYADAVVLRHPSEESVDIAAKYSPVPIINGGNGSKEHPTQALLDLFTIREEL
FT                   GTVNGITVTFMGDLKYGRPVHSLCHLLRHYQVRIQLVAPKELAMPENIKKMLQDNGMLV
FT                   VESEVLTPEIIAKSDVLYCTRVQEERFEDKEQYSRLKDTYIVDNKILSYAKQHMCVMHP
FT                   LPRTNEIREEVDFDQRAAYFRQMRYGLFVRMALLAMVIGVDF"
FT   gene            complement(<887853..>889562)
FT                   /locus_tag="DEHA2A10406g"
FT                   /old_locus_tag="IPF_7144"
FT   CDS_pept        complement(887853..889562)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10406g"
FT                   /old_locus_tag="IPF_7144"
FT                   /product="DEHA2A10406p"
FT                   /note="similar to uniprot|P35208 Saccharomyces cerevisiae
FT                   YJL127C SPT10"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65401"
FT                   /db_xref="GOA:B5RSU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015416"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU5"
FT                   /protein_id="CAR65401.1"
FT                   /translation="MAEFDDVMQPPHFRPQLEYNPVTVIDRYTVLLKDGETTATIYPMH
FT                   TLNELPPGLLAFLCDEFNMEIERGDTFPFFDTLHIESFQNYWFGSFAAVMVLGDSPTLE
FT                   GSRQWEKECLGTFYIKPNYPGRCSHICTAGFLVNAGIRGKGIGRTLADCYLQWAPRLGY
FT                   TYSIFNLVFESNAAARKIWESLNFKRIGRVKSAGILKGHDTAVDAIVYGRELINNSDPA
FT                   IGAYRFDKIKFYLETGRYPAMADRQEKSRLRSSASHYRLENGKLMLKGRQVIADPVRQL
FT                   QICTEVHMTNHGGINKTTAVVTEKYHWTRIKDTVATAIKNCPECRDPAKDPPLLKRSTI
FT                   PKKMATGNSIIRRNNKVLHSQPNNPNARNILKSRNSADDVDAMVAAAQLHNLPGHHRHD
FT                   ATESLLTHDLSGLDDGIIAAVEAAQRSQQQGHPNHQHHPTYAAAAAAAVAGDSNHYQHY
FT                   QNEYTNHHEYHQDSNDNQGYNNGGNSKERNRNNNIPVDPEVSAFDHHVDSAGEEIEIAR
FT                   ALIQANEDVQEEGHHQDVDELQNQSSNNDNNEKNGDSKRADDETNMFSKDNN"
FT   gene            complement(<889981..>890664)
FT                   /locus_tag="DEHA2A10428g"
FT                   /old_locus_tag="DEHA0A10802g"
FT                   /old_locus_tag="DEHA-IPF7148"
FT                   /old_locus_tag="DEHA-CDS5074.1"
FT   CDS_pept        complement(889981..890664)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10428g"
FT                   /old_locus_tag="DEHA0A10802g"
FT                   /old_locus_tag="DEHA-IPF7148"
FT                   /old_locus_tag="DEHA-CDS5074.1"
FT                   /product="DEHA2A10428p"
FT                   /note="similar to CA3375|IPF4684 Candida albicans IPF4684"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84755"
FT                   /db_xref="GOA:Q6BYD3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD3"
FT                   /protein_id="CAG84755.2"
FT                   /translation="MTVDEETYKRLEDLPFASKDGKNTPKITEPITFSLAKDPTGKVTL
FT                   FPIHDASQVPKTLLKVIQHEINYVIEEGTTYPYHEIMDFDQFVSYWFSAFVAVLIEGDH
FT                   QSLSDAHFQDQPEDFWRTHFLGTFYVKPNYTGRCSHVCNAGFVVNHEKRGLGLGKELGA
FT                   KYLVWGPQLGYVYSVFNLVFETNTASLRIWNSLGFDRIGYVKNVAVLKGHQSLVGAYMY
FT                   GKDLV"
FT   gene            <890914..>892000
FT                   /locus_tag="DEHA2A10450g"
FT   CDS_pept        join(890914..890950,891018..892000)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10450g"
FT                   /product="DEHA2A10450p"
FT                   /note="similar to uniprot|P40505 Saccharomyces cerevisiae
FT                   YIL084C SDS3,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84756"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD2"
FT                   /protein_id="CAG84756.2"
FT                   /translation="MEDHKRNGIFNDSLSKRDKKRQQIGSRLGKLDVMFSSDRDNFYKT
FT                   SLHNLQNTLATLQQGANENYLDKKENLEEERDYELTRLRLWEEYQVKRIEEEYKEDLIK
FT                   AQENHDKMIKLIKEKLYDKLQKQIKQLKEDKLLLNLVNANSWSSNIANDSSTAALNAVA
FT                   ANTLNLSDRRSLRKRELSSRLTAGEADDLSDGGVGSTTATGNVSTANGYISSSGKRRRH
FT                   YATRYSSNDEISSGITSTAASNKNSNGYGHNTLHNNAVGSGNESNLSDKDYDALNTLIM
FT                   GNEDGGVSLVLLDNAQANSNKPNTRGLNKQFTGLQGLKPEELNDDLTLLRNAIVKKEK"
FT   gene            complement(<892392..>894098)
FT                   /locus_tag="DEHA2A10472g"
FT                   /old_locus_tag="DEHA0A10846g"
FT                   /old_locus_tag="DEHA-IPF7151"
FT                   /old_locus_tag="DEHA-CDS2283.1"
FT   CDS_pept        complement(892392..894098)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10472g"
FT                   /old_locus_tag="DEHA0A10846g"
FT                   /old_locus_tag="DEHA-IPF7151"
FT                   /old_locus_tag="DEHA-CDS2283.1"
FT                   /product="DEHA2A10472p"
FT                   /note="similar to uniprot|P53838 Saccharomyces cerevisiae
FT                   YNL275W BOR1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84757"
FT                   /db_xref="GOA:Q6BYD1"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD1"
FT                   /protein_id="CAG84757.2"
FT                   /translation="MKNRGLPNCIRYIGYGIFNDVRSRIPHYKSDIQDAWNYRIIPSTL
FT                   FIFFANLLPAISFAQDMYDKTDQSYGVNETLMSSAIAGVVFGMFSGQPLCMVGVTGPIT
FT                   IFNYTVYELMKPRGTPFFPFMCWICLWSMVMHFIIAITNMVSYIKIITSYSADVFGFFV
FT                   CVVYLQKGVQILNNQFSVSLESGYCSVMISLLMVIFGVGCNVFGNNLHYFRGWFRKIFS
FT                   DYGMPLAVIFFTAFTYFGGNLSKTDLDKLPITEAFQPTYHGTDRSHGWFIHFWPPDNIA
FT                   VSDVFLAIPFAIDLTLLFYFDHNISSLMCQSKDFPLKKPSSFHWDFALLGLVTGISGLI
FT                   GLPAPNGLIPQAPLHTQSLVVHNYKTGEVISVVEQRVSNTIQGLLTFLMMSGPFLVVLG
FT                   LIPQAVLAGLFFIMGITGIHENAITNRLRYLFLNDDYVKNDPTCPLVFKEFDKYRNKKW
FT                   FYVYLVLLILGFGAEFAITLTKGTIGFPGVLLVLAICAKWVWPLIIPLEELQLLDSPVA
FT                   DEVTIKNLKIMDEIKLQENSSIQNKSDIEADVIGTQVKKSKLKLRNRNQNV"
FT   gene            <894941..>896713
FT                   /locus_tag="DEHA2A10494g"
FT                   /old_locus_tag="DEHA0A10868g"
FT                   /old_locus_tag="DEHA-IPF7152"
FT                   /old_locus_tag="DEHA-CDS1688.1"
FT   CDS_pept        894941..896713
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10494g"
FT                   /old_locus_tag="DEHA0A10868g"
FT                   /old_locus_tag="DEHA-IPF7152"
FT                   /old_locus_tag="DEHA-CDS1688.1"
FT                   /product="DEHA2A10494p"
FT                   /note="similar to uniprot|P53966 Saccharomyces cerevisiae
FT                   YNL029C KTR5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84758"
FT                   /db_xref="GOA:Q6BYD0"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYD0"
FT                   /protein_id="CAG84758.2"
FT                   /translation="MPAVKTNDQGSIKDSLEPHDTSDSDYDYSDDDDEYEVSFTEARLR
FT                   NIKSIVHTSRRIRLPKRSHRLWIMLLIIVLFIYSFTNMGFQGAKNNIQEDIGTFSDPLD
FT                   EAEGHFMSETRISSDIDSPFQIGCRVPDITQPRANAALVVLTRNSEVKKVIKSMKSMER
FT                   HFNQWFNYPWVFLNDEPFTDEFKNSVLKYTSSKVEFGTIPEKEWNFNEDIDKDELHEHI
FT                   ANQGDRRIMYGNSESYHKMCRFFSGYFYKHELVKKRDWYWRVEPDVEFFCDLTYDPFIE
FT                   MEKRNKKYGFNVLIGELYYTIPGLFKETRAFIRKNNVPLGNAWSLFITDYKYAVGKNAA
FT                   KYDGFKSKSDILREIEMNLTVKKFLSMKDKTDEQIPEYDSWLLDEVISKSKKPALYEDR
FT                   IDLEEYNMCHFWSNFEIARTDLFNSPRYEAYFDHLEKSGGFYKERWGDAPVHSLAIGML
FT                   LDLKDIHYFRDVGYRHSGLSHCPGNSRRYQLKYEPSERYYQKDLSKDSAWLSPDSPRSN
FT                   GIGCRCRCPKTKEIEDSSSSCVRSWADITSNRYIPPEPVDVDFWEEEIKNRLNKFLATG
FT                   GILGQNNIAEKLLS"
FT   gene            complement(<896801..>897112)
FT                   /locus_tag="DEHA2A10516g"
FT                   /old_locus_tag="DEHA0A10890g"
FT                   /old_locus_tag="DEHA-IPF7153"
FT                   /old_locus_tag="DEHA-CDS7258.1"
FT   CDS_pept        complement(896801..897112)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10516g"
FT                   /old_locus_tag="DEHA0A10890g"
FT                   /old_locus_tag="DEHA-IPF7153"
FT                   /old_locus_tag="DEHA-CDS7258.1"
FT                   /product="DEHA2A10516p"
FT                   /note="highly similar to uniprot|P02309 Saccharomyces
FT                   cerevisiae YNL030W HHF2 histone H4 proteins and highly
FT                   similar to uniprot|P02309 Saccharomyces cerevisiae YBR009C
FT                   HHF1 histone H4 proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84759"
FT                   /db_xref="GOA:Q6BRZ4"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BRZ4"
FT                   /protein_id="CAG84759.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRGVLKTFLENVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   gene            <897665..>898075
FT                   /locus_tag="DEHA2A10538g"
FT                   /old_locus_tag="DEHA0A10912g"
FT                   /old_locus_tag="DEHA-IPF7154"
FT                   /old_locus_tag="DEHA-CDS6372.1"
FT   CDS_pept        897665..898075
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10538g"
FT                   /old_locus_tag="DEHA0A10912g"
FT                   /old_locus_tag="DEHA-IPF7154"
FT                   /old_locus_tag="DEHA-CDS6372.1"
FT                   /product="DEHA2A10538p"
FT                   /note="highly similar to uniprot|P61830 Saccharomyces
FT                   cerevisiae YNL031C HHT2 histone H3 proteins and similar to
FT                   uniprot|P61830 Saccharomyces cerevisiae YBR010W HHT1
FT                   histone H3 proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84760"
FT                   /db_xref="GOA:Q6BRZ5"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BRZ5"
FT                   /protein_id="CAG84760.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
FT   gene            <898310..>898798
FT                   /locus_tag="DEHA2A10560g"
FT                   /old_locus_tag="DEHA0A10934g"
FT                   /old_locus_tag="DEHA-IPF7155"
FT                   /old_locus_tag="DEHA-CDS5772.1"
FT   CDS_pept        898310..898798
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10560g"
FT                   /old_locus_tag="DEHA0A10934g"
FT                   /old_locus_tag="DEHA-IPF7155"
FT                   /old_locus_tag="DEHA-CDS5772.1"
FT                   /product="DEHA2A10560p"
FT                   /note="weakly similar to uniprot|P40502 Saccharomyces
FT                   cerevisiae YIL087C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84761"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC7"
FT                   /protein_id="CAG84761.1"
FT                   /translation="MARIDNYQQQVRRNEYSSMGEGHTLNIEGLTKSANELPNTPYPAW
FT                   FFSAVLLYKGVTTHKPIANSTGTSGGSAKFSQWLSLSKPSRLSCFTFGAAHLLGGWIIY
FT                   DGDLANGAGFNFAWSTLYLIVNGTSSVKSLTLGRLNPIGLSMLALGNVGMYGKKFFWH"
FT   gene            complement(<898864..>899676)
FT                   /locus_tag="DEHA2A10582g"
FT                   /old_locus_tag="DEHA0A10956g"
FT                   /old_locus_tag="DEHA-IPF7157"
FT                   /old_locus_tag="DEHA-CDS4576.1"
FT   CDS_pept        complement(898864..899676)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10582g"
FT                   /old_locus_tag="DEHA0A10956g"
FT                   /old_locus_tag="DEHA-IPF7157"
FT                   /old_locus_tag="DEHA-CDS4576.1"
FT                   /product="DEHA2A10582p"
FT                   /note="similar to uniprot|P53965 Saccharomyces cerevisiae
FT                   YNL032W SIW14 Tyrosine phosphatase that plays a role in
FT                   actin filament organization and endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84762"
FT                   /db_xref="GOA:Q6BYC6"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC6"
FT                   /protein_id="CAG84762.1"
FT                   /translation="MSEVLDDPFQMDEELPSYKENDSVHKDITPRYDDNEMMNDPSIMN
FT                   SDKRYIRSKLDQLKINEESTNNTGDDEPTYEEDIDDKFDGTFEPKETQESGDFADEIPQ
FT                   LTPPENFAPVINKIYRSSFPQPSNFPFVKKLKLKSILCLIPEDYPEEHEQFLEKENIKL
FT                   FQLGMSGNKEPFVKISHNLITEAIKIVLNPANQPILIHCNRGKHRTGCLVGVLRRLQKW
FT                   SLTIIFDEYRKFAAPKERPMDQQFIELYNEVELEEYAKENSLLPIPWD"
FT   gene            <899974..>900250
FT                   /locus_tag="DEHA2A10604g"
FT   CDS_pept        join(899974..899976,900038..900250)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10604g"
FT                   /product="DEHA2A10604p"
FT                   /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
FT                   cerevisiae YNL024C-A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84763"
FT                   /db_xref="GOA:Q6BYC5"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC5"
FT                   /protein_id="CAG84763.1"
FT                   /translation="MSALFNFQSLLQVILLLICTCTYIHATWPVILDKNKTGALGVFWK
FT                   FARIGERLSPYVAIGCFAMAFNVLRS"
FT   gene            complement(<900306..>902465)
FT                   /locus_tag="DEHA2A10626g"
FT                   /old_locus_tag="DEHA0A11000g"
FT                   /old_locus_tag="DEHA-IPF7161"
FT                   /old_locus_tag="DEHA-CDS1077.1"
FT   CDS_pept        complement(900306..902465)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10626g"
FT                   /old_locus_tag="DEHA0A11000g"
FT                   /old_locus_tag="DEHA-IPF7161"
FT                   /old_locus_tag="DEHA-CDS1077.1"
FT                   /product="DEHA2A10626p"
FT                   /note="similar to uniprot|P40498 Saccharomyces cerevisiae
FT                   YIL091C,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84764"
FT                   /db_xref="GOA:Q6BYC4"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BYC4"
FT                   /protein_id="CAG84764.2"
FT                   /translation="MPAPYKRKKHSGKRPEDSHDAKRPKQKHGRQEMRTITRTARRVRR
FT                   DEEGEEDEQVEENVNEELESQDDDIEDGGDIDDDKGKAYDALLTLLSGDHQEDTKKNTS
FT                   VRAEPEQTQESESESDEDSGDDEIAGANVDDDKDVDEEGPEEDDGDDDQQDPFEVHFNQ
FT                   VSDTFIEEQEKVLKDKPKWTFADKKSMEDAGYTYTFQVPPNPIKTGGKVKGQSVNNYSI
FT                   KQRLVSPFEKQHPESLNELEGVLLDSMVKYQDINYVYKTFDNESYKKLYVLHALNHIFK
FT                   TRDRILKNNNKLHSYQESMKKGKTNIEEPELRDQGFTRPKVLILLPTRNACYEIVELLI
FT                   KLCGSEQQENRKKFNKQFSSKETPPDSKPEDFKHSFKGNNNDFFCIGVKFTRKSLKLYS
FT                   SFYSSDIIIASPIGLSMILENPDKKKRQYDFLSSIEVLVVDRANQIEMQNWDHVNTVFK
FT                   YLNKIPKDFHDADFSRIRMWSINDQANLLRQNLVFSEFSTPNINNIVSSKSSNLSGKLR
FT                   FKPVTTSKNCIMNSIGLKLKQIFQRFESNSPMTDPESRFKFFINSVLPSLTRSTSYDDG
FT                   LLIFIPSYYDYLRIKNYMKTSTKFTFASIDEYTSQSKLSRNRQQFASGKIKIMLYTERL
FT                   HHFRRFEINGVKNLLMYGLPSNPIFYKELVRFIGKSVFREIADLDLSFIKILYSKWDAV
FT                   ALERIVGNERAPVLCNSVNEMYEFR"
FT   gene            <903096..>904592
FT                   /locus_tag="DEHA2A10648g"
FT                   /old_locus_tag="DEHA0A11022g"
FT                   /old_locus_tag="DEHA-IPF7163"
FT                   /old_locus_tag="DEHA-CDS2512.1"
FT   CDS_pept        903096..904592
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10648g"
FT                   /old_locus_tag="DEHA0A11022g"
FT                   /old_locus_tag="DEHA-IPF7163"
FT                   /old_locus_tag="DEHA-CDS2512.1"
FT                   /product="DEHA2A10648p"
FT                   /note="weakly similar to uniprot|P40499 Saccharomyces
FT                   cerevisiae YIL090W ICE2 Integral ER membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84765"
FT                   /db_xref="GOA:Q6BYC3"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC3"
FT                   /protein_id="CAG84765.2"
FT                   /translation="MRESMNRIKVRTFRVLRAVLSTVYLALIILSIPLAFDVGGITCGL
FT                   AFSFTTFTLYFVLTTIRIVTRKSRYFGWVSLLYYLQHIIIPSLLTLFLSYYRTNQPTTS
FT                   TAYHPHEIWRYFIVNSTPIFTILEGFCSLLLIQAIGETVNWLTVYKSDSWLIVSLMASG
FT                   STITAALYFLYRIYVFPFTIDMISASLLGSLLTLTAGLGLFGIVSGKGSMIESALLFAY
FT                   IVRCIYETFPILSEDASKTLTSIFTQTTFNLRNEIPKLPPQITNTVSQLLPFLASNLPG
FT                   SFKAIWEFLIMSIHKLPLPLLLNLAYRIGVFYAATKIIPSLYHDASYPFNTPPRTPSQN
FT                   RSPRPSSTNIPGLSQSVSNSQTPPNSHHNRTHETSSEEVIDTTEIQPLSRSQSSFARNS
FT                   FGKKREPRSTIIRLIYSYSPCIVIAVYTHLMMSYKGELGTELKIWGWWSPNSDIQVIVH
FT                   PWQFWNWVNMGTTLLLYTAELSGNDSNSGRTALTSHWKVE"
FT   gene            complement(<905778..>907037)
FT                   /locus_tag="DEHA2A10670g"
FT                   /old_locus_tag="DEHA0A11044g"
FT                   /old_locus_tag="DEHA-IPF7164"
FT                   /old_locus_tag="DEHA-CDS3000.1"
FT   CDS_pept        complement(905778..907037)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10670g"
FT                   /old_locus_tag="DEHA0A11044g"
FT                   /old_locus_tag="DEHA-IPF7164"
FT                   /old_locus_tag="DEHA-CDS3000.1"
FT                   /product="DEHA2A10670p"
FT                   /note="similar to CA2207|IPF12169 Candida albicans
FT                   IPF12169"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84766"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC2"
FT                   /protein_id="CAG84766.2"
FT                   /translation="MVAEPVQATWKALNYYYNWTSDFVATQQDKVVNSEYFDKLPELNP
FT                   FSTSKPDPKIIARKPPSSIYTKLSDHVCRNKIQYVSVFSIGIGTGSYYYYNNIYKSTQQ
FT                   QKSIKFKRRVPKLANGARGDVVLIVGSPTEPLTRLIALDFEKRGFVVYLTILDEKDFKY
FT                   IESNQITEDINYLNLNESYSFEVQISKFRQSLEIPVVPFPGADSHYLRLTSVIFAPSLY
FT                   FPIGPIENITVASWNKMNERFSTYLKLFSSGLVNLIRSQQSKIILINANIISCLDMPYH
FT                   APETIFSNSVRHLFTALSRELSQHNISVTQIRLGNLNISNQDGASESKIATIVNSEIRS
FT                   WNEDIKELYASNFSSSQYKANPIKSTGRGTSLRQLYHLMFDLIYAKGKNPPVVYCGTGA
FT                   RIYDWVSKIIPESILAWFLT"
FT   gene            complement(<907153..>907224)
FT                   /locus_tag="DEHA2A10692r"
FT                   /old_locus_tag="Deha0A.7"
FT   tRNA            complement(907153..907224)
FT                   /locus_tag="DEHA2A10692r"
FT                   /old_locus_tag="Deha0A.7"
FT                   /note="tRNA His (GTG) cove score=61.27"
FT   gene            complement(<907681..>908952)
FT                   /locus_tag="DEHA2A10714g"
FT                   /old_locus_tag="DEHA0A11088g"
FT                   /old_locus_tag="DEHA-IPF7165"
FT                   /old_locus_tag="DEHA-CDS2970.1"
FT   CDS_pept        complement(907681..908952)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10714g"
FT                   /old_locus_tag="DEHA0A11088g"
FT                   /old_locus_tag="DEHA-IPF7165"
FT                   /old_locus_tag="DEHA-CDS2970.1"
FT                   /product="DEHA2A10714p"
FT                   /note="similar to uniprot|P41816 Saccharomyces cerevisiae
FT                   YPL171C OYE3 NADPH oxidoreductase or uniprot|Q03558
FT                   Saccharomyces cerevisiae YHR179W OYE2 NADPH oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84767"
FT                   /db_xref="GOA:Q6BYC1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC1"
FT                   /protein_id="CAG84767.2"
FT                   /translation="MSGVQVAALKDTDLFKSLKVGEHTLSNKVVYPPTTRMRALSDHTP
FT                   SDLELEYYEERSKYSGSLLIAEATFVSEQAGLNGTVPSTWNSEAAGYVPGIWNDKHAQA
FT                   WKKITDRVHENGSFMSSQFWFLGRVGDPQLLKDRGLDYVAPSAIYPDEDFKKKALAAGN
FT                   PIRALTEDEIHDLIYKTYPNAARKAIAAGFDYIELHAAHGYLLDQFLQPTSNQRTDKYG
FT                   GSIENRARVVLELVDHLTTVVGAKKLAIRISPWATFQGMKADQDSTHAVTTFSYLLHEL
FT                   QKRADDGNELAYVSIVEPRVQGGDDVEKSQQVGDNTFVGQIWKGIILKSGNYTYDAPDF
FT                   KTLLHDISDNRTMVGFSRYYTSNPDLVKRLYEGWDLTPYDRSTFYGSSNWGYNTFDNYN
FT                   RKRQFTKDIESGKLPKAIEEIEVK"
FT   gene            complement(<909369..>910700)
FT                   /locus_tag="DEHA2A10736g"
FT                   /old_locus_tag="DEHA0A11110g"
FT                   /old_locus_tag="DEHA-IPF7166"
FT                   /old_locus_tag="DEHA-CDS2795.1"
FT   CDS_pept        complement(909369..910700)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10736g"
FT                   /old_locus_tag="DEHA0A11110g"
FT                   /old_locus_tag="DEHA-IPF7166"
FT                   /old_locus_tag="DEHA-CDS2795.1"
FT                   /product="DEHA2A10736p"
FT                   /note="weakly similar to uniprot|P06842 Saccharomyces
FT                   cerevisiae YFL026W STE2 Receptor for alpha-factor
FT                   pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84768"
FT                   /db_xref="GOA:Q6BYC0"
FT                   /db_xref="InterPro:IPR000366"
FT                   /db_xref="InterPro:IPR027458"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYC0"
FT                   /protein_id="CAG84768.2"
FT                   /translation="MDISSYDNINPQKIPLNYTLPLGNADDVYVVTFGVLDEYVASSFH
FT                   YIVVYSVAIGACLTLSLALWASCQNKRTPIFVLNQLTMAIMMIESALYLAFFMGPLSSL
FT                   SFSFTGILIPNTYGSYRVTVAANVFQTILVACIEVSMTYQIFIIFRSPEVKRLGAALTI
FT                   VAAAAGLTIVGFYINSTVSSARMFQDVFNHSTSTKRVGSWVTDIPFILFSASINLMSCM
FT                   LACKLFFAIKTRRYLGLKQFDSFHILFIMSTQTMFIPSILVLINYGVSEAKTNVLSAVS
FT                   VLLVVLSLPFSSMWASAANNNPTPTSSTLAFLNRSDSNNSDSSTIVGNRFSLFPGKLSK
FT                   SSTTDSSIEKTMKDLSHTTSNHQEDSPTTLTDFRLQNDQSFYFSNLSAPPSDIEQIIYG
FT                   VTNADPETSNKCLNYSSDRESIDRALDNASPDGFVAVTTHNVNQ"
FT   gene            <911301..>912392
FT                   /locus_tag="DEHA2A10758g"
FT                   /old_locus_tag="DEHA0A11132g"
FT                   /old_locus_tag="DEHA-IPF7167"
FT                   /old_locus_tag="DEHA-CDS3539.1"
FT   CDS_pept        911301..912392
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10758g"
FT                   /old_locus_tag="DEHA0A11132g"
FT                   /old_locus_tag="DEHA-IPF7167"
FT                   /old_locus_tag="DEHA-CDS3539.1"
FT                   /product="DEHA2A10758p"
FT                   /note="similar to uniprot|Q04739 Saccharomyces cerevisiae
FT                   YER027C GAL83 One of three possible beta-subunits of the
FT                   Snf1 kinase complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84769"
FT                   /db_xref="GOA:Q6BYB9"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030077"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="InterPro:IPR037256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB9"
FT                   /protein_id="CAG84769.1"
FT                   /translation="MSNSPAPDMRDVSMVDVSNTSDSITNDQKPQDVENEPPARRKSTM
FT                   ILTEENEAQADMDQGVKAKNNDNDQMHIDQTGVGEAQNAPAAPQETMPDPNVTLPIDIR
FT                   WTQGGEKVYITGSFTGWRKMIGLAKQPDNSFLITLGLPIGTHRFRFVIDNELRFSDFLP
FT                   TATDQMGNFVNYVEVTPEHVNSHLEKEQQKQLEEEELQQKQQAGRKSSVSSTRGRSDSM
FT                   WGLTNDDDDMGNGYSRYHDGDSADSGNNSQAFISDIPPIFTDPKVMEQYYIAIDKQAKN
FT                   QNGQQQAWLHPPQLPPHLENVILNNFNSMDRDNNSGALPIPNHVVLNHLATTSIKHNTL
FT                   AVASIVRYKRKYVTQVLYAPLQQ"
FT   gene            complement(<913067..>914223)
FT                   /pseudo
FT                   /locus_tag="DEHA2A10769g"
FT                   /old_locus_tag="DEHA-IPF7168"
FT                   /old_locus_tag="DEHA-CDS7366.1"
FT                   /old_locus_tag="DEHA0A11154g"
FT                   /old_locus_tag="DEHA-IPF7169"
FT                   /old_locus_tag="DEHA-CDS5654.1"
FT                   /old_locus_tag="DEHA0A11165g"
FT                   /old_locus_tag="DEHA-IPF7170"
FT                   /old_locus_tag="DEHA-"
FT                   /old_locus_tag="CDS7944.1"
FT                   /old_locus_tag="DEHA0A11187g"
FT                   /note="similar to uniprot|Q93JG7 Streptomyces coelicolor
FT                   SCO7705 SCBAC12C8 Putative oxidoreductase stop in frame
FT                   frameshift pseudogene"
FT   gene            complement(<915036..>916616)
FT                   /locus_tag="DEHA2A10780g"
FT                   /old_locus_tag="DEHA0A11209g"
FT                   /old_locus_tag="DEHA-IPF7174"
FT                   /old_locus_tag="DEHA-CDS2138.1"
FT   CDS_pept        complement(915036..916616)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10780g"
FT                   /old_locus_tag="DEHA0A11209g"
FT                   /old_locus_tag="DEHA-IPF7174"
FT                   /old_locus_tag="DEHA-CDS2138.1"
FT                   /product="DEHA2A10780p"
FT                   /note="highly similar to uniprot|P39076 Saccharomyces
FT                   cerevisiae YIL142W CCT2 Subunit beta of the cytosolic
FT                   chaperonin Cct ring complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84773"
FT                   /db_xref="GOA:Q6BYB8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB8"
FT                   /protein_id="CAG84773.1"
FT                   /translation="MSVQILGDQATEERAENARMSSFVGAIAVGDLVKSTLGPKGMDKL
FT                   LQSSSNMDSAMITNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELL
FT                   KEAEKLIEKKIHPQTIIEGYRIACTTALEALSKAAVNNGSDQELFKKDLINIAKTTLSS
FT                   KILAQDKDHFSTLAVDAILRLNGSTNLNHIKVIKKVGGRLRDSFLDEGFILEKRFGINQ
FT                   PKKITNANILIANSSMDTDKVKIFGAKFKVDSTSKLADLEKAEKAKMKAKVEKIKKFNI
FT                   NCFINRQLIYDFPEQLFTDAKINSIEHADFDGVERLALVTGGDVVSTFDTPESVTLGHC
FT                   DTIEEILIGEDVMTKFSGVAAGEACTIVLRGSTEQGLDEAERSLHDALSVLSQTTRETK
FT                   TCLGGGCSEMIMSKAVEQAAANETGKKSLAIESFARALRQLPTILADNAGFDSSELVSK
FT                   LRSAIYNGMTTSGLDLNKGTIADMRETGVIESYKLKRAVVSSAAEASEVLLRVDNIIRA
FT                   KPRTADRNQ"
FT   gene            <917062..>918684
FT                   /locus_tag="DEHA2A10802g"
FT                   /old_locus_tag="DEHA0A11231g"
FT                   /old_locus_tag="DEHA-IPF7177"
FT                   /old_locus_tag="DEHA-CDS2038.1"
FT   CDS_pept        917062..918684
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10802g"
FT                   /old_locus_tag="DEHA0A11231g"
FT                   /old_locus_tag="DEHA-IPF7177"
FT                   /old_locus_tag="DEHA-CDS2038.1"
FT                   /product="DEHA2A10802p"
FT                   /note="weakly similar to uniprot|P48233 Saccharomyces
FT                   cerevisiae YNL083W SAL1 Probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84774"
FT                   /db_xref="GOA:Q6BYB7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB7"
FT                   /protein_id="CAG84774.2"
FT                   /translation="MSNFGRLNGSESQKGSIYEHGTDYEGIFRELDVNNSGQLTLDEFR
FT                   NISKVLRYPVGEGSEFIDKMFASIDKNDDKAIDLDDFRSYLIATDDQIIKGFKKIDRNN
FT                   DGKLNFEEFSNYMNETLNLNATREKMEIMFKKIAQKDTEYINFDEFRNFLLLVPRSGGS
FT                   RLKTAFMFLVNGLDISSDGDVNMNQSLLNGFGLFLAGGVAGVISRTCTAPFDRIKTFLI
FT                   SRSDLSSLVIRSKAEISKAIADNASPRVIEEAKQNHRAVKNAAKQVTNPKKIRSPLIQA
FT                   ARTLYLQGGLRAFFVGNGLNTVKIFPESAVKLGVFEATKRSLVTIEGVRDPSELSTIST
FT                   YLAGGIGGVSGQLTSYPIDTLKFRLQCSNIKSDIRGNELLIRIAKELYQEGGVRIYYRG
FT                   VLAGLGGMFPFAALDLGTFTTIKNWLVKRESIKSGIKEEDVKLPNYVILALGAFSGSFG
FT                   ASAVYPVNVLRTRLQAQGTHAHPYTYNGFFDVLRKTLAREGVSGLYKGLVPNLAKVAPA
FT                   VSISYYIYERLKFTFKLEKTQPI"
FT   gene            <919035..>920678
FT                   /locus_tag="DEHA2A10824g"
FT                   /old_locus_tag="DEHA0A11253g"
FT                   /old_locus_tag="DEHA-IPF7179"
FT                   /old_locus_tag="DEHA-CDS1982.1"
FT   CDS_pept        919035..920678
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10824g"
FT                   /old_locus_tag="DEHA0A11253g"
FT                   /old_locus_tag="DEHA-IPF7179"
FT                   /old_locus_tag="DEHA-CDS1982.1"
FT                   /product="DEHA2A10824p"
FT                   /note="weakly similar to uniprot|P48233 Saccharomyces
FT                   cerevisiae YNL083W SAL1 Probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84775"
FT                   /db_xref="GOA:Q6BYB6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB6"
FT                   /protein_id="CAG84775.2"
FT                   /translation="MSTMASSTSTSKSGGDKEKGSNEGSSNNNDYHSLFKKLDINRSGE
FT                   ITLQDFKKALKDLKHPLSESPEMIKKIFDSFDSNQDKVIDFNDFKLYLTTTDDQILKGF
FT                   NKIDQDNDGRLNKADFVHYLKKTLNLSPSDSKIDLIFKQIDYKNDGYVTYDEFRDFLLL
FT                   IPRLNGSRIKTAFHFIVEELDISSDGDVTLINQFLSGFGFFLAGGLSGVVSRTCTAPFD
FT                   RIKVFLIARTDLTSTVLHSKSEIARQIANGASSHVIEEARQKVIAAEAAAAKQAAEHPK
FT                   KIRSPLIQAARTLWKQGGFRTFYVGNGLNVLKVFPESAMKFGSFEATKRFLSRVEGVQD
FT                   TSQLSKVSTYLAGGIGGVCGQFTVYPIDTLKFRLQCSDLESSVRGNDLLFQTAKDLFKQ
FT                   GGLRIFYRGIFVGVSGIFPYAALDLGTFTTIKNWLVIRESKKKGIKEEDVKLPNYMVLS
FT                   LGALSGTFGATVVYPINLLRTRLQAQGTYAHPYTYNGFSDVLSKTIAREGYPGLFKGLL
FT                   PNLAKVAPAVSISYFMYENLKYFLRLDNSI"
FT   gene            complement(<920750..>921487)
FT                   /locus_tag="DEHA2A10846g"
FT                   /old_locus_tag="DEHA0A11275g"
FT                   /old_locus_tag="DEHA-IPF7180"
FT                   /old_locus_tag="DEHA-CDS5141.1"
FT   CDS_pept        complement(920750..921487)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10846g"
FT                   /old_locus_tag="DEHA0A11275g"
FT                   /old_locus_tag="DEHA-IPF7180"
FT                   /old_locus_tag="DEHA-CDS5141.1"
FT                   /product="DEHA2A10846p"
FT                   /note="similar to CA3178|IPF19974 Candida albicans
FT                   IPF19974"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84776"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB5"
FT                   /protein_id="CAG84776.2"
FT                   /translation="MGLPLTLPYVILTLKEFIIVWLNQVLYYNEIYPLEIYDKLKSFDT
FT                   IVYQSRNPALNKYVEDLVNEFLQILVNGDGHDNGGKVNQILILLYDVKSNKTKKKYVVK
FT                   FNEMINLGASINDLNFLYSVHEKDSESLLEPVIEIPSFTWDEIYSQFKSILFSQIEELK
FT                   VQKNGSENDDLFFKVIVDLEDSINLNVSINAETNSQHSNWVKTSVTSEDSKQRKTKVVP
FT                   IGEVSVGFICIDMYNEYTKRVNA"
FT   gene            <921599..>924478
FT                   /locus_tag="DEHA2A10868g"
FT                   /old_locus_tag="IPF_7189"
FT   CDS_pept        921599..924478
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10868g"
FT                   /old_locus_tag="IPF_7189"
FT                   /product="DEHA2A10868p"
FT                   /note="similar to uniprot|P14242 Saccharomyces cerevisiae
FT                   YNL082W PMS1 Required for mismatch repair in mitosis and
FT                   meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65402"
FT                   /db_xref="GOA:B5RSU6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU6"
FT                   /protein_id="CAR65402.1"
FT                   /translation="MAIQNINAGDIQRITSGQVIIDLVSIVKELVENSIDASSSKIEVL
FT                   FKNSGLDSIEIIDDGIGIGEDDFTSVCLKHCTSKLSTFEQLSEVNTLGFRGEALSSLCS
FT                   VSNLRITTCTKENYPRATELKYNAMGVLINKKKVIGGIKGTSILVSSLFHNLPVRQKNL
FT                   QKNLKREYNKAVSLLINYIIINPNIRFTVYNINPKTSKKNLIIGTKGTGSSTILDNVVN
FT                   IFGSNGAYGLIPIDLSVDDIDVKFRLNRGDFPTHKKLNVQFKGYISNSSFGLGRSSGDR
FT                   QYLFINGRPIIFKKFLKTINEVYKSFNHVQFPVVILNVIIDTEFLDINVTPDKRVIMIQ
FT                   NEDLINDILRNEVTKFFDTQNTVIPKNKSSGISLSDEKSSVSSNSTQANKVTEVVSNVN
FT                   ETSREAEVQKNLMVTRKREHNENETDEEAGEKKVQEENDEEEEEEEEEEVEVEDVQETI
FT                   DEEEEEAEAEAEEAEEEQEDEEEEENEKEIMNLDEEVDEINDDSNSSRNKIIDNDLLVT
FT                   RGTRTIGIGNNHKTQRTRDKLLSDLGVVEVGSSSTNNRRNRNNNIENEQSSDNEDVSQI
FT                   LNERGVEKQHNNSLEFNDSNIHESTRISLKRNRDEQLFVSESDDEPKNGNKVLDLSSFK
FT                   NNASEPKRLSQQIQPDVTDNLRISIGDREVEERPIKRTKTMVSRDEITFNEDPAVITKH
FT                   TSKSYVHNLSTTLDVDLQHIYSELEKHEASGKSQEDSSRNIAIDNIESTKEAEEKLSYT
FT                   ISKSDFLEMRLIGQFNLGFILVTLNSSNNLFIIDQHASDEKYNFEKLTEITTFQNQTLV
FT                   IPKTIELNAIDEMIVMDNLSVFKQNGFVIQVEEDNPPGKRIKLISLPVSKNVLFDISDF
FT                   HELIHLINTHNSTSNEGIKCSKIRSLLAMRACRSSIMIGQHLNRKTMTKILTNLSKLDK
FT                   PWNCPHGRPTMRHLTELQKWSSFKDDYQL"
FT   gene            <924949..>927691
FT                   /locus_tag="DEHA2A10890g"
FT   CDS_pept        join(924949..925027,925083..927691)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10890g"
FT                   /product="DEHA2A10890p"
FT                   /note="similar to CA1121|IPF6730 Candida albicans IPF6730,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84781"
FT                   /db_xref="GOA:Q6BYB3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB3"
FT                   /protein_id="CAG84781.2"
FT                   /translation="MSLARPGVYSRIKERKSRRTHKNSRDGCPNCKAKRIKCTEELPSC
FT                   HNCIKKNYRCGYIEFPEEKLELLRKKNEKKKEEHNFMKGLPSGGFDPSTPQPQILHPNT
FT                   SGNSVPNSTTSDAISSLPTSLSPNFRGRQQQQTPHNQSYPPQEGIYDQRNFNQDEVIFK
FT                   NEFYNNKDSLRMSLFKDTIFRLSKGETGFSVPNATDESIVKAFPSDYESQSMHVNLEGD
FT                   LNSEENFRMASGQAQISYLDEMGPNDALFNQRTPSDYQAPLSFDWENTPGKFTSIGNEA
FT                   QFKASNNLSGNKVNFNPLPNAIISRTTFPKLVQAKRLRNTYLERYLNDSNRNVKSLVNL
FT                   EFNSIFSPVWTNANADSFWVSVYNQAVVLEVYFSFFMDRSLNVLLKTCNVTLNGEIFSN
FT                   LSESPSYSSISASDTSLSSNASSDDGFFFTKKDLDILTQKSYRYYGALIKDLRKSITDI
FT                   HIEYPLKISLFSAWSIFFHTQATVETLCLMYNGTSSLLVKVFNDSTSIRDITPTIQVTL
FT                   ETLNGHASAALIPDYNFNIISDIYEDFKEFKTFFMDAQATYIKRYAEGNSEDGRKMRLR
FT                   SNLEKHDCLELESFLENLVTVIFPTINYINCYYRTNNNVKDTNSNNIYFTSVRLIFDLL
FT                   VSWFKNYPSDALSMSSSASPVKKTFYLFYSVIGRALTNIISPVRSVLLVDPCNLFCPRV
FT                   DFDPEIYKVEQINITTDEFHYLRTLSEKMLRTVSFFDYRVLFYSYFLSTNTILNAEYVK
FT                   PFNIPIQNDNDHYNDIVQLLPKKLDIQEDQIDNFSDITLNANHFPIFDIFHANDEYRSI
FT                   LSHEKQNQQLRKQQLPNEFNYKTGLLTHDFNPSSLFNALKINQQSYWNSNQPTLEETRI
FT                   RVQNFDYGRQAVANTVKNSLVSNT"
FT   gene            <928659..>931052
FT                   /locus_tag="DEHA2A10912g"
FT                   /old_locus_tag="DEHA0A11407g"
FT                   /old_locus_tag="DEHA-IPF7192"
FT                   /old_locus_tag="DEHA-CDS0841.1"
FT   CDS_pept        928659..931052
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10912g"
FT                   /old_locus_tag="DEHA0A11407g"
FT                   /old_locus_tag="DEHA-IPF7192"
FT                   /old_locus_tag="DEHA-CDS0841.1"
FT                   /product="DEHA2A10912p"
FT                   /note="similar to CA0471|CaECM22 Candida albicans CaECM22"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84782"
FT                   /db_xref="GOA:Q6BYB2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB2"
FT                   /protein_id="CAG84782.2"
FT                   /translation="MERTNYQLDTDASAPDINDIMKDGLNFKDDASAIGKIPGTKNKET
FT                   EEKGDKGENETQGARRRKHKNSKNGCPNCKKRRVKCSETLPACSNCVRRKVRCGYLDYT
FT                   EEQLKDLTQSKFVLEQVDDLRGDQGKREDESRNSSLRSSETQYPSPSSLNALKTSNSFP
FT                   MGQGGAIDQISDTTYNHGFRWDDHLAGGYDMGVNNVLNFQGNLTFTEGDNLVSSSEYPV
FT                   IYPVYSIKNPNPHGSRIPGETDLHNMNPSFRPSRDVFNSGAFSSNKSPVSWNDSVISPH
FT                   TSDYFETSGSSIHSHEKALPGAIEKPTTFKRIDMPNINYNQLIHDLMLKFGPQLATGTC
FT                   SLEDNRYLYSIWLHSFIHYSFTQKLMFGCMINFTTNYLISNCWMPQYISGGFTALIDRT
FT                   KVRNLLISSSIRHYAMAIKELRVYLNKDTDPLVCSSASFVLSLTSIYDPSATLRSMNCF
FT                   RDGLFSILQHNVAYVTQNGEPLPFMLMMHLEVSKNIVRSVYLPAYNPTFLHEYRSMLKS
FT                   FGNLLSILGNSSTDAALDTNDIDTQKFIEAKFSDLIVFTNETIDTFLPTINNNLGNLDI
FT                   QQQALFDILHKWVRIFPAKCMFISNENDPVENILYFFYKCLKKALYAVFPQVKYFFVRE
FT                   FDSPVTVDISVPEEDFEIYSKGIENPETCCYSLQSYNQVKDQLKVLSSYSIRVNIFLQK
FT                   RMEILNRTVIFDWSIKEAFPIDDIKCFRNSVTDIAKLRNDFKSSVQIHELPISSFATTF
FT                   IKPEHYPRRYEYVINEMNNNEFREEVDLLTLTNNGLLVNDYEAQ"
FT   gene            <931250..>932488
FT                   /locus_tag="DEHA2A10934g"
FT                   /old_locus_tag="DEHA0A11429g"
FT                   /old_locus_tag="DEHA-IPF7193"
FT                   /old_locus_tag="DEHA-CDS3112.1"
FT   CDS_pept        931250..932488
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10934g"
FT                   /old_locus_tag="DEHA0A11429g"
FT                   /old_locus_tag="DEHA-IPF7193"
FT                   /old_locus_tag="DEHA-CDS3112.1"
FT                   /product="DEHA2A10934p"
FT                   /note="weakly similar to uniprot|P53934 Saccharomyces
FT                   cerevisiae YNL092W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84783"
FT                   /db_xref="GOA:Q6BYB1"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB1"
FT                   /protein_id="CAG84783.2"
FT                   /translation="MNGQLEQEEDQNLEEYKALTSTLSSFYNFHKWEYEELIKPRNIKQ
FT                   ASLSEQELELIPWYPKHTSDLEMAIGINEEFTKSLAMNIAADWGVSSNAQEWAACSDSD
FT                   YDKVRSTLLQLSREWSTDGEKEREITFGRIIKELTDRFPNEKERQNIKILVPGCGLGRL
FT                   VLDLVKEGFWCQGNEFSYHMLLTSNFMLNHCKFANNYSILPFVHKQSHVIKRLNQLRPI
FT                   TIPDVNPTSIHELATKNPEIPYGDLMSMTAGSFVDLYGPPNLMYSETYSSDPVANQFRN
FT                   ENHERFDVLTTCFFLDTASNIIDYLKAIFHCLKPGGIWINFGPLLWHFEDDSQTHFVTK
FT                   QLSKGGALQSIPTIMKGLELTREDLIELVKKIGFIFEKHESDIETSYSSDIRSLGTYVY
FT                   KCESWVCRKPSSI"
FT   gene            <932750..>933415
FT                   /locus_tag="DEHA2A10956g"
FT                   /old_locus_tag="DEHA0A11451g"
FT                   /old_locus_tag="DEHA-IPF7197"
FT                   /old_locus_tag="DEHA-CDS5142.1"
FT   CDS_pept        932750..933415
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10956g"
FT                   /old_locus_tag="DEHA0A11451g"
FT                   /old_locus_tag="DEHA-IPF7197"
FT                   /old_locus_tag="DEHA-CDS5142.1"
FT                   /product="DEHA2A10956p"
FT                   /note="similar to uniprot|P36017 Saccharomyces cerevisiae
FT                   YOR089C VPS21 Rab5-like GTPase involved in vacuolar protein
FT                   sorting and endocytosis post vesicle internalization"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84784"
FT                   /db_xref="GOA:Q6BYB0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYB0"
FT                   /protein_id="CAG84784.2"
FT                   /translation="MSFPNPATSVKLVLLGEAAVGKSSLVLRFVSNDFQENKEPTIGAA
FT                   FLTQKCTIGDRTIKYEIWDTAGQERFQSLAPMYYRNAQAALVVYDITKPASFIKARHWV
FT                   KELHEQASKDITIALVGNKYDLAENDNENEESLRKVSIEEGKNLAEEEGLLFFETSAKS
FT                   SYNVNDVFVGIGSKIPDTSANSGTASGLNVNGQSNNEGRIDLSAGSNNNRGGADACAC"
FT   gene            <933639..>934577
FT                   /locus_tag="DEHA2A10978g"
FT                   /old_locus_tag="DEHA0A11473g"
FT                   /old_locus_tag="DEHA-IPF7198"
FT                   /old_locus_tag="DEHA-CDS4196.1"
FT   CDS_pept        933639..934577
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A10978g"
FT                   /old_locus_tag="DEHA0A11473g"
FT                   /old_locus_tag="DEHA-IPF7198"
FT                   /old_locus_tag="DEHA-CDS4196.1"
FT                   /product="DEHA2A10978p"
FT                   /note="similar to CA3427|IPF11865 Candida albicans
FT                   IPF11865"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84785"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA9"
FT                   /protein_id="CAG84785.2"
FT                   /translation="MLKSFSRTMTVLKVAYIPEHFSTPLFFAQQENYYASKNLEIEFTP
FT                   VPEGTGRLIALLNSNEVDIAIGLTEGFVADIAKGNETYKVAGTYVESPLCWAISTGYNR
FT                   EDITKSEDLAGKKIGVSRIGSGSYIMSFVLGLQLKFPSPFFSDHPTCSNFKNLRESVSH
FT                   TYEDESKFSDAFMWEHFTSKKYYDNKEIKKIGEIYTPWPSWVVAVRENVLKNNYEDIKN
FT                   FTACVNEGVKHFLENPDKATSYISTNLDYSEEDAKAWLKTVKFNESLGQSEIDWESVVN
FT                   NTSKVLKTAGVLTDSDQLIQDRLEKGVIKNL"
FT   gene            <935081..>936016
FT                   /locus_tag="DEHA2A11000g"
FT                   /old_locus_tag="DEHA0A11495g"
FT                   /old_locus_tag="DEHA-IPF7199"
FT                   /old_locus_tag="DEHA-CDS3911.1"
FT   CDS_pept        935081..936016
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11000g"
FT                   /old_locus_tag="DEHA0A11495g"
FT                   /old_locus_tag="DEHA-IPF7199"
FT                   /old_locus_tag="DEHA-CDS3911.1"
FT                   /product="DEHA2A11000p"
FT                   /note="weakly similar to uniprot|P25044 Saccharomyces
FT                   cerevisiae YDL230W PTP1 Phosphotyrosine-specific protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84786"
FT                   /db_xref="GOA:Q6BYA8"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA8"
FT                   /protein_id="CAG84786.2"
FT                   /translation="MVSPSFLKLPIPDQKVNFTTHNAVESERIREALNSPDKSDWSISD
FT                   AVSRKSVQRNRYSNVFPWNKSRVKLPVEQGHSDYINASYISMGNKVRYIAAQGPLEATI
FT                   HHFWSMCYNESEKQKNDTVIIAMVTPLTEGGMKKCSQYWPTKTNPVLNVTTLLQGDGIE
FT                   IPGLTVHFVSETYIEKGDYLLTEMELRSKTQVKKVYHFYYYKWADARVPPSVSPLISLS
FT                   QEIRALKKSVTNEPVPIVHCSAGVGRTGTFIALDQLFNELSPDILDPANDQFDPIEAIV
FT                   TQLRSERMMMVQTVYQYCFLYDTMREVYAK"
FT   gene            <936265..>937428
FT                   /locus_tag="DEHA2A11022g"
FT                   /old_locus_tag="DEHA0A11517g"
FT                   /old_locus_tag="DEHA-IPF7201"
FT                   /old_locus_tag="DEHA-CDS3262.1"
FT   CDS_pept        936265..937428
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11022g"
FT                   /old_locus_tag="DEHA0A11517g"
FT                   /old_locus_tag="DEHA-IPF7201"
FT                   /old_locus_tag="DEHA-CDS3262.1"
FT                   /product="DEHA2A11022p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84787"
FT                   /db_xref="GOA:Q6BYA7"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA7"
FT                   /protein_id="CAG84787.2"
FT                   /translation="MSLQPTPNGSSDRIYCPESTSTLASAENESRSINRMSSSSIVGSQ
FT                   ECYSESYVDADDEWIFSSLYLYNTLWIEYSEIKNSYIYGKSPGDSSLISIDKLQEKTDH
FT                   NDPSKQVRVRICSKQIIQFLSELNKNYEAEIFFEQSHSFNDNRAWVMCKKLCVDEWMVS
FT                   LAPIKNKSMKQILATMARLHFESALYIDFFVSTSRVMQMKSYICKNAPNLSCLYESTFN
FT                   GDVIRIHPNYSSNSKLPTENDTFESISELLDVMDSNYNDIIIHNPLYEFPSCPRSIVSL
FT                   TTTLRKKIKVCEIPQPTDIIRKVLSLKKHEVSFLMGFQGTRINSIRKSSACVVKVLPYS
FT                   TTMDATFIPLKNTPQDLVICGTPANVQYSINLIQNYLMDYRDSNSCP"
FT   gene            <937770..>939611
FT                   /locus_tag="DEHA2A11044g"
FT                   /old_locus_tag="DEHA0A11539g"
FT                   /old_locus_tag="DEHA-IPF7202"
FT                   /old_locus_tag="DEHA-CDS1557.1"
FT   CDS_pept        937770..939611
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11044g"
FT                   /old_locus_tag="DEHA0A11539g"
FT                   /old_locus_tag="DEHA-IPF7202"
FT                   /old_locus_tag="DEHA-CDS1557.1"
FT                   /product="DEHA2A11044p"
FT                   /note="highly similar to uniprot|P40150 Saccharomyces
FT                   cerevisiae YNL209W SSB2 Ribosome-associated molecular
FT                   chaperone or uniprot|P11484 Saccharomyces cerevisiae
FT                   YDL229W SSB1 Ribosome-associated molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84788"
FT                   /db_xref="GOA:Q6BYA6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA6"
FT                   /protein_id="CAG84788.1"
FT                   /translation="MADGVFPGAIGIDLGTTYSCVATYDSAVEIIANEQGNRVTPSFVA
FT                   FTNEERLIGDAAKNQAALNPKNTVFDAKRLIGRAYDDESVQKDLKTWPFKVIDANGNPQ
FT                   IEVEYLEETKSFSPQEISAMVLTKMKEVAEAKIGKTVEKAVVTVPAYFNDAQRQATKDA
FT                   GAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNITGGVFTV
FT                   KATAGDTHLGGQDFDTNLLDFFKADFKKKTGLDISGDARALRRLRTACERAKRTLSSVT
FT                   QTTVEVDSLFDGEDFSANLTRARFEDINSALFKSTLDPVEQVMKDAKISKSSVDEVVLV
FT                   GGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDDTKDLLLLD
FT                   VIPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCTENT
FT                   LLGEFDLKNIPPMQAGEPVLESIFEVDANGILKVTALEKSTGRSANITISNSIGRLSSD
FT                   EIEKMIEDAEKFKSSDDAFAKRHEQKQKLEAYVASVESTVTDPVLSAKLKKSAKDKIEV
FT                   ALSDALAALELEESSADDYRKAELALKRAVTKGMSTR"
FT   gene            complement(<939773..>941056)
FT                   /locus_tag="DEHA2A11066g"
FT                   /old_locus_tag="DEHA0A11561g"
FT                   /old_locus_tag="DEHA-IPF7204"
FT                   /old_locus_tag="DEHA-CDS2932.1"
FT   CDS_pept        complement(939773..941056)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11066g"
FT                   /old_locus_tag="DEHA0A11561g"
FT                   /old_locus_tag="DEHA-IPF7204"
FT                   /old_locus_tag="DEHA-CDS2932.1"
FT                   /product="DEHA2A11066p"
FT                   /note="similar to uniprot|P40160 Saccharomyces cerevisiae
FT                   YNL207W RIO2 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84789"
FT                   /db_xref="GOA:Q6BYA5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA5"
FT                   /protein_id="CAG84789.2"
FT                   /translation="MKLDTSHMRYLTAEDFKVLQAIEQGSRNHELVPTQMIHSIGGLKS
FT                   PSGTNRAIGDLAKLKLVARLRNAKYDGFRLTYNGFDYLALKSMLNKNTLYSVGSIIGVG
FT                   KESDIYSVSDPNGQQKVLKIHRLGRTSFTTVKNNRDYLRNRQTSNWMYLSHLAAHKEYE
FT                   FMVILYNNGFSVPEPFDYSRHTVMMEWIKGIPMKHLRIHDNFKKLYCELMNFIVKLANH
FT                   GLIHCDFNEFNIIIRDKEDVPKHEFDFVVIDFPQCVSIDHTDAKVYFDRDVASIRSFFS
FT                   KKFRYDPEHDPTMFDTEGYGDGYKYAYPNFKRDVSRVKSLDVEVQASGYARKRTGNRED
FT                   KDLEAAVSGMRVNVEDDEEDDRSEIDSDYEHDEEEEEEEDEEDSIDEYDSEEEFKDDQE
FT                   ENEQIIEALSSGLKQLKMDKLGNYILEE"
FT   gene            <941229..>942731
FT                   /locus_tag="DEHA2A11088g"
FT                   /old_locus_tag="DEHA0A11583g"
FT                   /old_locus_tag="DEHA-IPF7206"
FT                   /old_locus_tag="DEHA-CDS2336.1"
FT   CDS_pept        941229..942731
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11088g"
FT                   /old_locus_tag="DEHA0A11583g"
FT                   /old_locus_tag="DEHA-IPF7206"
FT                   /old_locus_tag="DEHA-CDS2336.1"
FT                   /product="DEHA2A11088p"
FT                   /note="weakly similar to CA3536|IPF5414 Candida albicans
FT                   IPF5414"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84790"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA4"
FT                   /protein_id="CAG84790.2"
FT                   /translation="MLRSRNRNKKSKRYGSKTNRLLLKKAKKDESWTSKSPFGKDLSKI
FT                   GIKNDLFKDSSSSTTYPWTRLAPLSDYNLIEVPRSRKGIPSLKSICSKKIAENADSLES
FT                   SFLDTASWMVWRTVWEEILSLNNDSPRVFNLFAGKFFLSDGFKCHKLSLPLDVNLGSSK
FT                   WEKLLKARNEGISSVIIPRTRNHRIENLFSNINVLEIVKFIHRLSYRPWVLLDVSLMTQ
FT                   KYDREDHLKLFNITNLIALDLSNSQIVDDLFLYNMSVSISKDGKLSKLTILKINNCPKV
FT                   TSKGLQYLLCLSNDADARCSLSYIESDVKISSSNFAAKLQNIKSESPDFIDGTRWFVLD
FT                   DGSESKFIRKLPLALKLHCLYKNYSNRITKDPIVTDFPSYTTNSMSYLFSVRNSIVLDI
FT                   MVHENTFTSAENDFEKLEEVWATRIHFRNSRAQSKIYCYVIDNKYEFSGQMANIERHEE
FT                   NKKDDSVMFRASEKKLPSKYIAKPKRRRPVARKVDANSFFDM"
FT   gene            complement(<942868..>945663)
FT                   /locus_tag="DEHA2A11110g"
FT                   /old_locus_tag="DEHA0A11605g"
FT                   /old_locus_tag="DEHA-IPF7210"
FT                   /old_locus_tag="DEHA-CDS0551.1"
FT   CDS_pept        complement(942868..945663)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11110g"
FT                   /old_locus_tag="DEHA0A11605g"
FT                   /old_locus_tag="DEHA-IPF7210"
FT                   /old_locus_tag="DEHA-CDS0551.1"
FT                   /product="DEHA2A11110p"
FT                   /note="weakly similar to uniprot|P53550 Saccharomyces
FT                   cerevisiae YNL118C DCP2 Protein required for the decapping
FT                   of mRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84791"
FT                   /db_xref="GOA:Q6BYA3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA3"
FT                   /protein_id="CAG84791.2"
FT                   /translation="MSIQLTDGLANQSVDLVLEDLLVRFLVNVPDEDLSSIERVFFQIE
FT                   EAQWFYTDFVRQLNPLLPSMKMKSFATKLLKKCPLIWKWGDPADAISRFGKYKSTIPVR
FT                   GVALFNKDLTKVVLVKGTESNAWSFPRGKISKDETDIDCAVREAEEETGFNARDLVNEN
FT                   DVIERTIKGKNYKIYLVKNVPEDYNFEPLARNEISKIQWHDMKSIQKKSRSNPNNFFIV
FT                   SAILKPMLGWINKNKGVLNEEELMLQAEIKLKSLLGISQPKLENLDAGRELLNILQGVI
FT                   PRDSQVGNNTQAMPAAYDQIIQMNLPQHLHKQFPFFNNQPIQPQPYPIPNQPFFVPQMP
FT                   PNAFAPMNMSPVRSQPAHYQPMPPQAPHIPREQDSLSNDYINQQPNPSSLQKPTSIANR
FT                   RPSGVNSKEFLSILNKPRNKEDENTKLSDESRSNDHVNNRSKAQHLLSLFNKDKKTASD
FT                   DAKFTEGMQSDARGKSKNGSSNGYDHDFVSPHEASNELEESLIGSDDKTNRKEAGKKLT
FT                   LLKRPTDAGSELMSSNSSASADILRMLGSAPKAEPKKETEDVKQNQSNEILGLLKGDKK
FT                   EPEQNPNNRATAKELLGLINQKSTDNRKVEDQTQSFNTQPEPEINTSPEEEDFDDFEDF
FT                   EDFENLDEYLSRHGPVSNVTSHNFDIASDDEDIYETPQNSSINAINEIQDTHAEKPVPD
FT                   SKKNKIRLLKPGESLNDIIGKPDRALQQSVDSTAVSKIQDTTQKKDNVNDGRSLLDILN
FT                   GGKNQNKKEVNQGPPKDYNYSPNSMDFGSVYGPPPTNNQPSPGYFSPNSAAERTAFSPF
FT                   ENSNSGFPINSQTDSPSTVQSHNNSNPASASLLSLLGKKPPAQSSYEPSPKTQSPQPAS
FT                   ALTLDEIEGAQLGHMLPQPVAPPQTHSYTSEDASSPKSRPAEGQASSARTLLDLLKGGR
FT                   S"
FT   gene            <945898..>946758
FT                   /locus_tag="DEHA2A11132g"
FT                   /old_locus_tag="DEHA0A11627g"
FT                   /old_locus_tag="DEHA-IPF7211"
FT                   /old_locus_tag="DEHA-CDS4549.1"
FT   CDS_pept        945898..946758
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11132g"
FT                   /old_locus_tag="DEHA0A11627g"
FT                   /old_locus_tag="DEHA-IPF7211"
FT                   /old_locus_tag="DEHA-CDS4549.1"
FT                   /product="DEHA2A11132p"
FT                   /note="weakly similar to uniprot|P18496 Saccharomyces
FT                   cerevisiae YLR393W ATP10 Mitochondrial inner membrane
FT                   protein required for assembly of the F0 sector of
FT                   mitochondrial F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84792"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA2"
FT                   /protein_id="CAG84792.2"
FT                   /translation="MIKIQTRTFSQVSRLLNVKAPRFTQTLKEASKPALTKSHSITRPF
FT                   GLDSGVMINQTNHGSGGSIQDKIFGSEAKERRQKQLDYEIAHSPFYESKSFTNTNGKIF
FT                   TPPVSFFKREKSKYFPNFGGATVDGRDQTLFGLLEGKVSIVRLYSTVSGEKCSETYFNV
FT                   EGKKYLTSGYGAFEAEHPMSQIIDINIPQNWLKGLLVKLSSGSIKRSLPQQRQSKYFIV
FT                   SDKLFSFDIKQKLMCDNTCSGYIYVLDHQGRIRWATSGYADPAELSLMWKCVRGLEKEL
FT                   KSLSV"
FT   gene            <947827..>948177
FT                   /locus_tag="DEHA2A11154g"
FT                   /old_locus_tag="DEHA0A11649g"
FT                   /old_locus_tag="DEHA-IPF7212"
FT                   /old_locus_tag="DEHA-CDS6846.1"
FT   CDS_pept        947827..948177
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11154g"
FT                   /old_locus_tag="DEHA0A11649g"
FT                   /old_locus_tag="DEHA-IPF7212"
FT                   /old_locus_tag="DEHA-CDS6846.1"
FT                   /product="DEHA2A11154p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA1"
FT                   /protein_id="CAG84793.1"
FT                   /translation="MKFLSVATLVTIALAVFVEAENFDDKREDLKDDHDDEVENLSKDY
FT                   YPNKVCDRYCNQVYSYGKKYEHSKNWKKYLCSRDFHRDLDRCKYGCRKNYYHNHWSKYI
FT                   DPYYKKNCGRYI"
FT   gene            <949444..>949677
FT                   /locus_tag="DEHA2A11176g"
FT                   /old_locus_tag="IPF_45354"
FT   CDS_pept        949444..949677
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11176g"
FT                   /old_locus_tag="IPF_45354"
FT                   /product="DEHA2A11176p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65403"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU7"
FT                   /protein_id="CAR65403.1"
FT                   /translation="MTVMITKMITKTMMTTTATQKNGSPNDATEYVTKLSRWVKSVKNR
FT                   GILNMSSLKAIPEGTCKDYGCENNYKKNWGKY"
FT   gene            <950502..>950858
FT                   /locus_tag="DEHA2A11198g"
FT                   /old_locus_tag="DEHA0A11671g"
FT                   /old_locus_tag="DEHA-IPF7215"
FT                   /old_locus_tag="DEHA-CDS6789.1"
FT   CDS_pept        950502..950858
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11198g"
FT                   /old_locus_tag="DEHA0A11671g"
FT                   /old_locus_tag="DEHA-IPF7215"
FT                   /old_locus_tag="DEHA-CDS6789.1"
FT                   /product="DEHA2A11198p"
FT                   /note="highly similar to uniprot|P38701 Saccharomyces
FT                   cerevisiae YHL015W RPS20 Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84794"
FT                   /db_xref="GOA:Q6BYA0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BYA0"
FT                   /protein_id="CAG84794.1"
FT                   /translation="MSAPINKEKVQDQEQEILKIRITLTSTKVKQLENVSANIIRNAVQ
FT                   NKIVKKGPVRMPTKVLKITTRKSPNGEGSKTWDTYEMRIHKRVIDLQAEASIVKKITQI
FT                   TIEPGVDVEVTIAA"
FT   gene            <951379..>953154
FT                   /locus_tag="DEHA2A11220g"
FT                   /old_locus_tag="DEHA0A11693g"
FT                   /old_locus_tag="DEHA-IPF7216"
FT                   /old_locus_tag="DEHA-CDS1681.1"
FT   CDS_pept        951379..953154
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11220g"
FT                   /old_locus_tag="DEHA0A11693g"
FT                   /old_locus_tag="DEHA-IPF7216"
FT                   /old_locus_tag="DEHA-CDS1681.1"
FT                   /product="DEHA2A11220p"
FT                   /note="similar to uniprot|Q12511 Saccharomyces cerevisiae
FT                   YOR090C PTC5 Mitochondrially localized type 2C protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84795"
FT                   /db_xref="GOA:Q6BY99"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY99"
FT                   /protein_id="CAG84795.1"
FT                   /translation="MVFILAVRPRLLYIANRQIQSNKRLISSSTQKLLQSSNTLSNASK
FT                   VNRQVTEKTNKFFKKRHVALVSGIIIIGSYISFNQSNYYNLDTVPPIGGGGRSGISPKL
FT                   FPPSNTTVIGDDSRYFSTSTNSMHQKNSIGNQQQKQGVFLLNDEQVSERLRQFEESYSV
FT                   NRGKGVTRYDICQLPSNSPIEDDRAEEIVQVPILQDNNIKTSTDWMFFGVFDGHGGWTT
FT                   SSKLRDQLISYIVHELGTIFKPTNEDNLRYVPNGATIDQAIKNGFLKLDHEVVNKNMEK
FT                   LLNDNNKAKAAELLMPALSGSCALLSFYDTNSKLLKVAVTGDSRALLGSFKDNHWTVRQ
FT                   LSIDQTGSNPTEVARIISEHPDEPNVVRNGRVLGTLEPTRAFGDCRYKLPASIQERIYK
FT                   QFFGRRLPNNLKSPPYVTAEPVITTTKINPENNDFLVMASDGLYEMLSNEEIIGLVVKW
FT                   MEKERMVKPQKSFWNYFGSTENKLPEISDITNDKSSKQPFRKNKQSSGYGGFLLDDRNV
FT                   STHLIRNALSNGGSREQTSMLISIPNPVSRRYRDDLTVTVVFFGKDLRGENEAGKLEIN
FT                   ADATAGGIDSAKPKL"
FT   gene            <953371..>957102
FT                   /locus_tag="DEHA2A11242g"
FT                   /old_locus_tag="DEHA0A11715g"
FT                   /old_locus_tag="DEHA-IPF7219"
FT                   /old_locus_tag="DEHA-CDS0209.1"
FT   CDS_pept        953371..957102
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11242g"
FT                   /old_locus_tag="DEHA0A11715g"
FT                   /old_locus_tag="DEHA-IPF7219"
FT                   /old_locus_tag="DEHA-CDS0209.1"
FT                   /product="DEHA2A11242p"
FT                   /note="similar to uniprot|P35207 Saccharomyces cerevisiae
FT                   YLR398C SKI2 antiviral protein and putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84796"
FT                   /db_xref="GOA:Q6BY98"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040801"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY98"
FT                   /protein_id="CAG84796.2"
FT                   /translation="MVETTDIKAGETILDTCNNVRDPLTKTKFLEPEVSREDTNKEISD
FT                   ELLTPSNQLSWDLLDLVQSLPEVNQNKLYDGLLNIPSPISRTSFRFKRSGIAGTVDGYK
FT                   EELRLSDLDNANSSNSLSVNRKFTSKSDALRGKSTFLPFQPGGLLDKKSMINAAKDESA
FT                   FLHRNEMGLFDIPQGLSRGLNISDSTVSDDNIVNLEQSKEPQDSQPEESTLEDKNFIES
FT                   SNLSDQGSKSDNRLPFESEDIDGIIPSDYASMKQSMDEAPEHKKSWAHVVDLDHKLENF
FT                   KEVIPNMAREWPFELDTFQQEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMATRNMTK
FT                   AIYTSPIKALSNQKFRDFKETFKDIDVGLITGDVQINPEANCLIMTTEILRSMLYRGAD
FT                   LIRDVEFVIFDEVHYVNDIDRGVVWEEVIIMLPDHVKYILLSATVPNTYEFANWVGRTK
FT                   QKDIYVISTPKRPVPLEIFIWAKDHLFKAIDANRKFSDIEFKKHKEILEKGNKKEPPHV
FT                   TMGAGSRGGRGGTARGGNRGGGQVANRGRGNFSGGRGGLTRDGPNKNTWVSLVQYMKQH
FT                   NLLPAVIFVFSKKKCEEFADTLSNVDFCNAREKSEVHMFIDRAVSRLKKEDRELPQIIK
FT                   IRDLLSRGIAVHHGGLLPIVKECIEILFARSLVKVLFATETFAMGLNLPTRTVVFNTYR
FT                   KHDGRGFRNLLPGEFTQMSGRAGRRGLDDTGTVIVMSFNEPLSPTDFKDVTLGTPTKLS
FT                   SQFRLTYNMILNLLRIEALRVEEMIKHSFSENSTQTLLPEHEVTVKRLSEELNETKVED
FT                   CSICNLKNIEETYNLLTDYENLYGQIVEEIQKSPIVRNTLMRVGRLLCFRDKNDTLRLG
FT                   FFIRSNVSDNALLVLTFDLGEEYERDSATYKLPWIPHSYYLSHFMKKMVYSGSLRIESV
FT                   PYNNIGFIGRYFLKANIKSILQNDSKVIAEAVEQIQILLKFQNKWDEVGFYQATQLSLH
FT                   ELLEKKMPILERLNELESFECKNFKVHYQQMHRQDEIKSEITTLQRLISDENLELLPDY
FT                   EQRLNVLQSLGFIDKNQNVVLKGRVACEVNSGWELIITELVLDNFLGDFEPEEIVALLS
FT                   CFVYEGKTNEEEEPPITPRLEKGKTRILAIAEKLMKVYAEHQVLLTSEEEEFLERKRFA
FT                   LVNVVYEWARGLSFNEIMQMSVEAEGTIVRVITRLDEICREVKSAALIVGDSTLHSKMS
FT                   EAQEKIKRDIVFCASLYL"
FT   gene            complement(<957213..>958154)
FT                   /locus_tag="DEHA2A11264g"
FT                   /old_locus_tag="DEHA0A11737g"
FT                   /old_locus_tag="DEHA-IPF7220"
FT                   /old_locus_tag="DEHA-CDS3840.1"
FT   CDS_pept        complement(957213..958154)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11264g"
FT                   /old_locus_tag="DEHA0A11737g"
FT                   /old_locus_tag="DEHA-IPF7220"
FT                   /old_locus_tag="DEHA-CDS3840.1"
FT                   /product="DEHA2A11264p"
FT                   /note="some similarities with CA5107|IPF1358 Candida
FT                   albicans IPF1358"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY97"
FT                   /protein_id="CAG84797.2"
FT                   /translation="MLSKTNRGIQLRIRSASKALLSYTNNGAKRNVVDSALISSRDLYK
FT                   ENPQINSHKKIPYQGVRPSFYRRAATDFDSEYLDRKGLGNNRILEVLDSDEDFESKISP
FT                   RAEHIQQFVGEEFPLSLNEKLSILCGLSNFSLVLEQRGKYDATSFDKTPSNVSSQGLFP
FT                   EVRTGEEYTTEKLRSIGKTIFDLHLGLSTVFTDEKYLSLPSESLEQTMNLFNDEEKIIP
FT                   LFMKRNYIYDCILPYQGTTRRGVIHSSEKYTEKKKKIQDVTSIGSFYTMIGLLSVKFNM
FT                   EDMLDKVVYGKIINGQAGLVTLATETLTKLRT"
FT   gene            <958405..>960783
FT                   /locus_tag="DEHA2A11286g"
FT                   /old_locus_tag="DEHA0A11759g"
FT                   /old_locus_tag="DEHA-IPF7222"
FT                   /old_locus_tag="DEHA-CDS0859.1"
FT   CDS_pept        958405..960783
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11286g"
FT                   /old_locus_tag="DEHA0A11759g"
FT                   /old_locus_tag="DEHA-IPF7222"
FT                   /old_locus_tag="DEHA-CDS0859.1"
FT                   /product="DEHA2A11286p"
FT                   /note="similar to uniprot|P32794 Saccharomyces cerevisiae
FT                   YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84798"
FT                   /db_xref="GOA:Q6BY96"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY96"
FT                   /protein_id="CAG84798.2"
FT                   /translation="MSSKTSSSASKKKATSTPASESSTKKVKIPKNYIVRPSPNNSARS
FT                   SNKVFINSEILQALEISNGSIVYISKVSGGEAGVLGTIHSDNDIIDKNVIGISSSLRCL
FT                   GGLLLGDRIQIDKYLSQPEYATSVDLRIENDQNESIKIEGKVSKALEKLFNEIGIVFPG
FT                   LKLTKVSIPNNEGGNEEEDIKMSCTIKVIDVSGKESLEDSLNKLSINEEKESEICNSST
FT                   VSPAYIFSKGKTQINTSVIREPLRSKFPQLPQPVGYSQVGGLSRPIALLQSTIELPLHN
FT                   PTLFSDFGISPPRGILLHGPPGTGKTMLLRCVANETNAHVLTVNGPSIVSKYLGETENA
FT                   IRDIFEEARKFQPSIIFLDEIDSLAPNRNSDDSGETESRVVATLLTMMDGMGDTGRIVV
FT                   VGATNRPNSIDPALRRPGRFDQEVEIGIPDVEARGDILIKQFDKMDKSKFDLTKEEINS
FT                   IASKTHGYVGADLTALCRESVMKAINRSLKASIPQREIKLELRDVEEALPEIRPSAMRE
FT                   IFLEMPKVYWSDIGGQEELKQKLTEVVQLPLEAADTFNKLGVSAPKGVLLYGPPGCSKT
FT                   LTAKALATESGLNFLAVKGPEIFNKYVGESERTIREIFRKARAASPSIIFFDEIDAISG
FT                   DRESSGTSASQNVLTSLLNEIDGVEELKGVVIVGATNRPTEIDPALLRPGRLDRHIYVS
FT                   PPDYDARLQILTKGCSKFNLDGREVNLSTLADLTNGCSGAEVALLCHEAGLSAVMEDKQ
FT                   ATCVEQRHFDHALKGISKGITQDMLDYYKTFSSRSGLSI"
FT   gene            complement(<960836..>961813)
FT                   /locus_tag="DEHA2A11308g"
FT                   /old_locus_tag="DEHA0A11781g"
FT                   /old_locus_tag="DEHA-IPF7223"
FT                   /old_locus_tag="DEHA-CDS4074.1"
FT   CDS_pept        complement(960836..961813)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11308g"
FT                   /old_locus_tag="DEHA0A11781g"
FT                   /old_locus_tag="DEHA-IPF7223"
FT                   /old_locus_tag="DEHA-CDS4074.1"
FT                   /product="DEHA2A11308p"
FT                   /note="weakly similar to uniprot|Q07418 Saccharomyces
FT                   cerevisiae YDL065C PEX19 Chaperone and import receptor for
FT                   newly-synthesized class I peroxisomal membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84799"
FT                   /db_xref="GOA:Q6BY95"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="InterPro:IPR038322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY95"
FT                   /protein_id="CAG84799.1"
FT                   /translation="MSLSSENKDSVKSNEKRDQSTGQAKQAVPTSTNAGDEDDLDDLDD
FT                   LLDDFADDVLNKPPGSAVGTETQEKEEVKTSADEPLNDEFKTRIEDLVKDLNIEDPETK
FT                   VQFEQLVKQFDEDHKEEAAAASQPQNFDNVMKETMERLKKSGDTIDEQIKNDQSSGKPE
FT                   DMLTQLLAGLGGPGAGGDGDLDMSKLLVDMLEQLSSREVLCEPIKDLHSKFPDYLKEKK
FT                   GKISEEEHANYTKQYEISGEILAIFEATDYDDEDKEKREKVNSLLESLQELGQPPTELV
FT                   GDSGDFPGFGGMGGGALGGNGLDFNDKDLPPDLEKGLEEGCKQT"
FT   gene            complement(<961941..>962126)
FT                   /locus_tag="DEHA2A11330g"
FT                   /old_locus_tag="DEHA0A11803g"
FT                   /old_locus_tag="DEHA-IPF7224"
FT                   /old_locus_tag="DEHA-CDS7945.1"
FT   CDS_pept        complement(961941..962126)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11330g"
FT                   /old_locus_tag="DEHA0A11803g"
FT                   /old_locus_tag="DEHA-IPF7224"
FT                   /old_locus_tag="DEHA-CDS7945.1"
FT                   /product="DEHA2A11330p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84800"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY94"
FT                   /protein_id="CAG84800.1"
FT                   /translation="MVTTRRLTVRHTPYCFHEKYKINTTGSADFQRTNKENIFQNLPFG
FT                   SNEWLYKSSAIFKRVI"
FT   gene            <962390..>962866
FT                   /locus_tag="DEHA2A11352g"
FT                   /old_locus_tag="DEHA0A11825g"
FT                   /old_locus_tag="DEHA-IPF7225"
FT                   /old_locus_tag="DEHA-CDS5918.1"
FT   CDS_pept        962390..962866
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11352g"
FT                   /old_locus_tag="DEHA0A11825g"
FT                   /old_locus_tag="DEHA-IPF7225"
FT                   /old_locus_tag="DEHA-CDS5918.1"
FT                   /product="DEHA2A11352p"
FT                   /note="highly similar to uniprot|P50623 Saccharomyces
FT                   cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved in
FT                   the Smt3p conjugation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84801"
FT                   /db_xref="GOA:Q6BY93"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="InterPro:IPR027230"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY93"
FT                   /protein_id="CAG84801.1"
FT                   /translation="MSLCKTRLQEERKQWRKDHPFGFYAKPSKAADGSLDLTQWTAGIP
FT                   GRSNTLWQGATYPITISFPEEYPSKPPKIKFPTGFYHPNVYPSGTICLSILNEEQDWRP
FT                   AITIKQVVMGIQELLDSPNPDSPAQEPAWKAFSKDLATYEKKVKEQAKRYATAS"
FT   gene            complement(<963118..>964503)
FT                   /locus_tag="DEHA2A11374g"
FT                   /old_locus_tag="DEHA0A11847g"
FT                   /old_locus_tag="DEHA-IPF7226"
FT                   /old_locus_tag="DEHA-CDS2635.1"
FT   CDS_pept        complement(963118..964503)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11374g"
FT                   /old_locus_tag="DEHA0A11847g"
FT                   /old_locus_tag="DEHA-IPF7226"
FT                   /old_locus_tag="DEHA-CDS2635.1"
FT                   /product="DEHA2A11374p"
FT                   /note="similar to uniprot|P32604 Saccharomyces cerevisiae
FT                   YJL155C FBP26 Fructose-2 6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84802"
FT                   /db_xref="GOA:Q6BY92"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY92"
FT                   /protein_id="CAG84802.1"
FT                   /translation="MPVYSISHVENVRVCVVMVGLPARGKSLIAQKIVRYLSWLSIKSK
FT                   CFNVGTYRRKLVPCESTTAEFFDPHNEKGLKYREEALNSAMKDMMNWFTEDNGVVGILD
FT                   ATNSTRARRDKILKLCRENYIEPMFLESWCDDKDLVLQNIADVKTTSTDYVNKDEDYAT
FT                   KDFLQRIKYYEDIYETMDRDTDSDLTFIKLVNVNSQVILNKIESYLESRIVYYVMNLHI
FT                   KPRCIWLSRHGESEFNLTGQIGGDANLSERGRRYAKKLPELVLKSFGEENKHTNLTVWT
FT                   STLQRTQQTASFLPYKKKLQWKALDELDAGECDGMTYEEIEQKFPEDFKARDDNKYEYR
FT                   YRGGESYRDIVIRLEPIIMELERQENILIITHQAVLRCLYAYFMNVPQEESPWMSIPLH
FT                   TLIKIEPGAYQTLVSRIKADIPAVSTYKEKGTSQLGELATGSTIKSRDLIKDSECVRNS
FT                   MQQ"
FT   gene            <964783..>967359
FT                   /locus_tag="DEHA2A11396g"
FT                   /old_locus_tag="DEHA0A11869g"
FT                   /old_locus_tag="DEHA-IPF7227"
FT                   /old_locus_tag="DEHA-CDS0694.1"
FT   CDS_pept        964783..967359
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11396g"
FT                   /old_locus_tag="DEHA0A11869g"
FT                   /old_locus_tag="DEHA-IPF7227"
FT                   /old_locus_tag="DEHA-CDS0694.1"
FT                   /product="DEHA2A11396p"
FT                   /note="weakly similar to uniprot|P47002 Saccharomyces
FT                   cerevisiae YJL156C SSY5 Component of the SPS plasma
FT                   membrane amino acid sensor system"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84803"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR012985"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY91"
FT                   /protein_id="CAG84803.2"
FT                   /translation="MKCRVMSLTQNITKFSIKGSKFIIDRQIYVKTIKMPMKNLLNRTT
FT                   KSEYKERDTPDAEERAVLDIKPVTSSTMSTSTEESQDSIHQLRPMFSSPLAKAEDETKS
FT                   NSQKFNFMHDTNLNLNPSISNTNSAPSVMTKDSEYMVNSMYSDSKKTYSTKQSSYLTQN
FT                   SQKKTGASSAARNLEYGQPLQILNIAEESSENPDIKGTVVDKLHELYEDVLFIMNQYNN
FT                   SSINLSTTVINTIDCFKKFVSFAESFGSDSESWDITTFNNGDMRRIMKIYLHFYDNLLA
FT                   SDVYIKLKLLLVKNFNDFATTLNSRDKPANKPMQNMVKPQNYAIGIDPDKSLPNEDLIE
FT                   KIMKKIASTSISVKEQNGSFIAPIARGISNDLNILCLYFGYPNPTDSHSKLIQSLHGLY
FT                   DDIHVVVMKNQIELASIMAESASIPFPNYNASESVLPSTQVENVVRKFKLPFRNPTDSS
FT                   RPPISLSLSVENASRLSGTMGGYIYPQIDLEKQPHLESYTNSKFAISCGHVCLDNNDED
FT                   VNYPHVSAPSAVLISLYKKALWTQYQKFSQQGNNVSTMEERIAYGSVLKNLDKVFPLKK
FT                   VKVPYSSKREGHEIRNLPEHRFGQIIWGERTLINSKGSDKASQDVENKLSDLAIIKVNK
FT                   NLKCDQNFLGDDIAFNEYDPALMFDNLYVRKVINLERESKELNINEVDSVASANSNYSG
FT                   LSIFKYGSTTKFTRGNLNGIKLVYWLDGAIHSSEFVINSVESNTAFAAGGDSGSWILTK
FT                   LEDCTSESNSKGLGVLGMLHSYDGEHKQFGLFTPMCEILERLETVTNIKWGVVGVPQKD
FT                   ERISGHEVYSGSSATDSDSDNSDSVDDTEYESGAEELEGACPPEID"
FT   gene            complement(<967633..>968373)
FT                   /locus_tag="DEHA2A11418g"
FT                   /old_locus_tag="DEHA0A11891g"
FT                   /old_locus_tag="DEHA-IPF7229"
FT                   /old_locus_tag="DEHA-CDS4850.1"
FT   CDS_pept        complement(967633..968373)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11418g"
FT                   /old_locus_tag="DEHA0A11891g"
FT                   /old_locus_tag="DEHA-IPF7229"
FT                   /old_locus_tag="DEHA-CDS4850.1"
FT                   /product="DEHA2A11418p"
FT                   /note="some similarities with CA2885|IPF7204 Candida
FT                   albicans IPF7204"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY90"
FT                   /protein_id="CAG84804.2"
FT                   /translation="MRISTILSIVALAAATSAAPADPVAPGEPTPGAPDVSGTITLDDP
FT                   IPPTGTITLDDPTSELPSGTITSDDPIPPTGTITLDDPTSELPSGTITIDDPTSSGTIP
FT                   SVSITVNATLPTLSVSSFPTPNPPPTFYPNTTTTVTGSVTVTDFVTFCPYPTTVTVTTC
FT                   RSNVCLPHTVTVPEATTLTVTGSCLVPTTYTTETCHECTKTQEPTTTPGPSSVSSIPTV
FT                   SEGSAPKNIAGVLAGIVAIAAVLF"
FT   gene            complement(<969302..>971260)
FT                   /locus_tag="DEHA2A11440g"
FT                   /old_locus_tag="IPF_7233"
FT   CDS_pept        complement(969302..971260)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11440g"
FT                   /old_locus_tag="IPF_7233"
FT                   /product="DEHA2A11440p"
FT                   /note="similar to uniprot|Q07395 Saccharomyces cerevisiae
FT                   YDL063C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65404"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU8"
FT                   /protein_id="CAR65404.1"
FT                   /translation="MGKLKRGRKNQKARVNPIANNSKKNFDKQEIKDENTRNSKILPLI
FT                   NNLKSSVPNDKTMALGAITVLCEDERMRKLLLKEKLVSIIMEQCLNDSNDEIVVESFGL
FT                   LRNIGIEEGYEVTKFYWRSNIWTAIEAALKKIETSFKFLEESKSLPLAATEDDEKKAQG
FT                   KKTSDKSKEQLLFDFTENILSLIVVMASGSEDLYDNVFQKIDPVLKLVVDLINWNIPTM
FT                   KTTVKLFNSLLDFIYEFASESTEFVQNLHENSQFDLHRLIEYLASPAQSKNTLGKVYIE
FT                   GIKFHLYEALNQADNKDAASTEILNNLISCITTINLDNLKKNLSVIDNAKEPIQKKAPE
FT                   EIKDIDQQIGGDTPETAQAKVDVQTLEIAIDLITSIWEYIAFNEANPQDPVTLSTDLVQ
FT                   VILQLAYPSLIELLKFEMQNKEALELLDKIIVCLNNMCWLFLSSENIPVEWYSDALQLW
FT                   DLIVNISSNKDNLLIQKDCLSICWGITKTLGGEIKSKVNYSMIESLISRCDDLTKHNPT
FT                   EDNATSLEFFLCAVGFLGSLAPVIDNTEVTSHISQFLLSSTELFATNQTDEPKANEIPI
FT                   ECLNLIYQIFGDMSYSYDYEIYVKNNYHEKLQALEPSIKSMYKKIDKNRYPHLKIRAEE
FT                   TWATLGRFIQYKQSERD"
FT   gene            complement(<971472..>971814)
FT                   /locus_tag="DEHA2A11462g"
FT                   /old_locus_tag="DEHA0A11935g"
FT   CDS_pept        complement(join(971472..971667,971723..971814))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11462g"
FT                   /old_locus_tag="DEHA0A11935g"
FT                   /product="DEHA2A11462p"
FT                   /note="some similarities with uniprot|Q06011 Saccharomyces
FT                   cerevisiae YLR390W ECM19"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84806"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY88"
FT                   /protein_id="CAG84806.1"
FT                   /translation="MSSAGGKAITICLVAGLSWYTGVKFWQPLIIERLQQDGNLRDDVY
FT                   IRDTSDQPKSWSDLKEKVKTTLHPNNPSIGKEELIKEFNKEKQETIDSSK"
FT   gene            complement(<972813..>973169)
FT                   /locus_tag="DEHA2A11484g"
FT                   /old_locus_tag="DEHA0A11957g"
FT                   /old_locus_tag="DEHA-IPF7235"
FT                   /old_locus_tag="DEHA-CDS6790.1"
FT   CDS_pept        complement(972813..973169)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11484g"
FT                   /old_locus_tag="DEHA0A11957g"
FT                   /old_locus_tag="DEHA-IPF7235"
FT                   /old_locus_tag="DEHA-CDS6790.1"
FT                   /product="DEHA2A11484p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY87"
FT                   /protein_id="CAG84807.1"
FT                   /translation="MSILIYIFNQNQKIIGADKEENDFLNNGIEYVLVDKIENIKKDMR
FT                   TQNKKEYVEDYGIITKNNECRIQNRNRDFNDHTILENEYLVSLLQNISIEHLDIDTMID
FT                   DHMLEHNEETCTIN"
FT   gene            complement(<973962..>974132)
FT                   /locus_tag="DEHA2A11506g"
FT                   /old_locus_tag="DEHA0A11979g"
FT                   /old_locus_tag="DEHA-IPF7236"
FT                   /old_locus_tag="DEHA-CDS8639.1"
FT   CDS_pept        complement(973962..974132)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11506g"
FT                   /old_locus_tag="DEHA0A11979g"
FT                   /old_locus_tag="DEHA-IPF7236"
FT                   /old_locus_tag="DEHA-CDS8639.1"
FT                   /product="DEHA2A11506p"
FT                   /note="highly similar to uniprot|P41058 Saccharomyces
FT                   cerevisiae YDL061C RPS29B Protein component of the small
FT                   (40S) ribosomal subunit or uniprot|P41057 Saccharomyces
FT                   cerevisiae YLR388W RPS29A Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84808"
FT                   /db_xref="GOA:Q6BY86"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BY86"
FT                   /protein_id="CAG84808.1"
FT                   /translation="MAHESVWFSHPRNFGKGSRQCRVCSSHSGLIRKYDLNICRQCFRE
FT                   RASDIGFNKFR"
FT   gene            <974890..>977229
FT                   /locus_tag="DEHA2A11528g"
FT                   /old_locus_tag="DEHA0A12001g"
FT                   /old_locus_tag="DEHA-IPF7239"
FT                   /old_locus_tag="DEHA-CDS0897.1"
FT   CDS_pept        974890..977229
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11528g"
FT                   /old_locus_tag="DEHA0A12001g"
FT                   /old_locus_tag="DEHA-IPF7239"
FT                   /old_locus_tag="DEHA-CDS0897.1"
FT                   /product="DEHA2A11528p"
FT                   /note="similar to uniprot|Q07381 Saccharomyces cerevisiae
FT                   YDL060W TSR1 Protein required for processing of 20S pre-
FT                   rRNA in the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84809"
FT                   /db_xref="GOA:Q6BY85"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY85"
FT                   /protein_id="CAG84809.2"
FT                   /translation="MAKGGHSHRSTLKNDHKPFKSKHASKGQLKNQYKGKVEKTGAGNG
FT                   KANKVMSKTERKNAARQMKENKIHETKVIRKLFDGSQGAEKIVTVISLTKDISTQDIVS
FT                   RLVNNVKEESDEEFVVGLPSVSSAKINRFKTNLKFIVPDQNNLLSILDAAKISDYVVFG
FT                   ISANEEVDKEYGEQILRALIAQGIASVIGVLPNVVSAYPKKNLQLDIRRSLFSFFTHFF
FT                   PNEEKLYALEYDTECLNCIRTICQRFPKSVTWRDSRPYLLADKTSWMASENDASMGHIV
FT                   VEGTVRGVGFNANRLVHIPGFGDFQVDRIEKLFKSRVNKKSEMDIDTEENDVFLPNENR
FT                   ETLEELNPEEIDMEGEEWDDEDEFGVRMEGKHYFEDGKDGGYSSRSKLPRGTSEYQGRW
FT                   LLDDVLENASDLESEDEDIDVDIEQNNDDEMQMEDAQSEYAPTEAGDNQSEMFVDLPPE
FT                   EEERQLHEFRESVKEDLEFPDELELDPSESAKERLASYRGIKSLGNCDWDYDEEDVEAP
FT                   SIWKRLLRISNFKATRNKVCKDVIKDVQLNIGNKARIFIKAPSYVMEKVNCEQQPFVVY
FT                   GLLEHEHKLAVVNFSFESWEDYDEPIPNKDTLIVQYGPRRQVIQPLFNQGSNNANNVHK
FT                   SENYAHQGKLSIATCVAPVLFSNAPVIFFRQATDGSLQLVGQGTFLNCDHTRIVAERAV
FT                   LTGHPVKIHKRVVTIRYMFFNPEDINWFKAIPLFTKTGRSGFIKESLGTHGYFKATFDG
FT                   KLDASDTIAMSMYKRVWPEISTGWTD"
FT   gene            <977419..>978732
FT                   /locus_tag="DEHA2A11550g"
FT                   /old_locus_tag="IPF_7240"
FT   CDS_pept        977419..978732
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11550g"
FT                   /old_locus_tag="IPF_7240"
FT                   /product="DEHA2A11550p"
FT                   /note="similar to uniprot|Q06709 Saccharomyces cerevisiae
FT                   YLR387C REH1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84810"
FT                   /db_xref="GOA:Q6BY84"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040025"
FT                   /db_xref="InterPro:IPR041661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY84"
FT                   /protein_id="CAG84810.1"
FT                   /translation="MTSFMPHGSNPLTSSFTCNTCDIRFVTADLQRQHMKTDWHRYNLK
FT                   RRVAQLPSISSEMFAEKVLSQQNQSDEDEEDEFGFHINHRKSSKGSKQLTKKFLKKQAK
FT                   FNELRKAREEDKESHVRAVSPASISSEFSQFSLGDSENLSVNNDTDTGSELNYTDTSEF
FT                   TDLDITADDEEYSDSDMESNEELDVTPITYCFFCGVNNKEIETNVKHMFNSHGLYIPER
FT                   SFLVDLEGLLAFLSEIFTADLECLVCGFLGKNLESIRQHLRSKGHCRIPYESKEEKAII
FT                   AEFYDFYVDESNTKSKTNKKVTFTESSDSDDGVLVDVPSSSLDLDDSQANINDNYSVVH
FT                   VDKSGVELTLPTGSRIGHRSMARYYRQNIAVPRDLAESEKTVAVVDRRFAPGLSYHDVS
FT                   KQEKETRRLAQHSKNDYIRKSKSYRMNYQPHYRDELLQ"
FT   gene            <979250..>981022
FT                   /locus_tag="DEHA2A11572g"
FT                   /old_locus_tag="DEHA0A12045g"
FT                   /old_locus_tag="DEHA-IPF7241"
FT                   /old_locus_tag="DEHA-CDS1689.1"
FT   CDS_pept        979250..981022
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11572g"
FT                   /old_locus_tag="DEHA0A12045g"
FT                   /old_locus_tag="DEHA-IPF7241"
FT                   /old_locus_tag="DEHA-CDS1689.1"
FT                   /product="DEHA2A11572p"
FT                   /note="weakly similar to uniprot|P25491 Saccharomyces
FT                   cerevisiae YNL064C YDJ1 mitochondrial and ER import
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84811"
FT                   /db_xref="GOA:Q6BY83"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY83"
FT                   /protein_id="CAG84811.2"
FT                   /translation="MVLETHLYDILLVSPDASTEEISKGYRKVALKCHPDKTNHDPELT
FT                   EQFKEVTRAYEILKNEKARDVYNHYGEAGLNGSCETKRGNSGVKKYNDSYNVRTATDVF
FT                   SNVFSDINSMFNRDPLGGGFDSFSSFPMNMNMNMNPNMNMNMNFNIGSSRGDFRKHVQP
FT                   APNGNKNKMVRGHDIHHTCKVGLEDLYVGKIVKFQLPKNSRCYTCIGLGGMNPKSCRVC
FT                   QGNGQVFETLYNQFSQFQELRSCRQCSGTGIYIAPKDRCCECDNGYVKEKKIIKINILP
FT                   GFKNGDKVILQGEGDEGRNIIPGDVVIHLEEMPHPYLTRRFNDLYMDYDIDLRTALLGG
FT                   PIILNDFLKKDQDLKININVHGNEDLNKGAGDNIQEGEIVGTINSGIPKIVKNLGMPIN
FT                   DLDIKGIFYQSTEAIDETCDMFDLKEYGKGDLFIRFNVIMPTVSDFKDDKSLFTLANIL
FT                   PTTIPQVSKTGPKKTLEAHLSNIPNFDGDSCPGPTNPVYSSGSSEDSLDYKHGHKKLKK
FT                   SNYGYTVDDLSNSEYDYDDINVEDDNVDGNETEEEQFYANEWNKEKDGRGKKRKKDDDL
FT                   MDGSNSMHDSGIQC"
FT   gene            <981296..>984394
FT                   /locus_tag="DEHA2A11594g"
FT                   /old_locus_tag="DEHA0A12067g"
FT                   /old_locus_tag="DEHA-IPF7245"
FT                   /old_locus_tag="DEHA-CDS0410.1"
FT   CDS_pept        981296..984394
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11594g"
FT                   /old_locus_tag="DEHA0A12067g"
FT                   /old_locus_tag="DEHA-IPF7245"
FT                   /old_locus_tag="DEHA-CDS0410.1"
FT                   /product="DEHA2A11594p"
FT                   /note="weakly similar to uniprot|Q06708 Saccharomyces
FT                   cerevisiae YLR386W VAC14 Activator of Fab1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84812"
FT                   /db_xref="GOA:Q6BY82"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY82"
FT                   /protein_id="CAG84812.2"
FT                   /translation="MEEGNVLDSSIIKDLSNNIYEKRKATSFQIESLTKSALARNDSQI
FT                   IFKIIAELTELTNDGTNSAKMGAITALGSVSVALGSFAIAYFLEEIIKPIFATFRDTDA
FT                   RVRYYACESLYNIAKIARGEILLYFNEVFDILCILVTDTESSVKNAADILDRLIKDIVS
FT                   AKSTNYVSILHQDNIIESGQSNDISSHIIDPTGVAIQVNQVQDTHKAFSLPKFIPTLLE
FT                   RMYTIDPFAKKFLISWLELFDDIPALELITFLPNFLEPLIKFLMNTAPSDVRIETQNLL
FT                   NVFLKEIKAINRVKIEAKRKALEKEIAKKKADKKLKDTQENTNDSITADDESQDESSGI
FT                   QREGAQDDAQDENKDDSYTTDQASIQSNSTTIIRQRKDDESEHLQELNELSELSDSQFL
FT                   SGQDIFIDYSKIIDILLSFLRFPLSNSSNKNDYKINDISNETHEIYSEVQFTVLKWLQE
FT                   ILVISPTSIAKFLPDCVSINMKNISIADDNKDSDLRNQFLKFNLSLQNFLVNLNESGSK
FT                   GEVREKKIPKKDAKNKDEKRKSESKEITEYKKKKDESTEEDGDSEYDNIDENLINGLNK
FT                   DVYDEFFEAYLGPTLKSIMTECLTCVNELSRITSLDWLIFLYSLNPSSFFKPSFKGSDD
FT                   KDDKTFDMSALLHSSIDASNEVVLKVLQLSSKISETDQEFFKNFMIELMRFFEDEVQES
FT                   ATTSKQNQIHGPTASPLTRSKIEFIIRKLCVTLTSEKIFKTLSEVVVSHEEQNLDFMNM
FT                   MIVMLNNILLTTQELAGFRKKLKNIDVYKVDDWSLFATLFQSWCHNAPSALSLCLLTSN
FT                   YELAYLIIKSFSESEVSFQLLTQLDILVQLLESPIFLKLRLQLLEPEKHPYLYKTLYGL
FT                   LMILPQSSTFTTLKKRISLVSGVNSLNTPSGSSGPITTPVATPGATTTSSSVGNQLSIK
FT                   RKRIHEMLDKFTKVQEKHEEFQMTKKLNEATLALNTDNPTNKPYSKSNGLDSYTSNTNR
FT                   ILSHDSTVSDKKDYFSHDHSVQAGSDPKTQKRSSSKRFGLHRF"
FT   gene            <984548..>985924
FT                   /locus_tag="DEHA2A11616g"
FT                   /old_locus_tag="DEHA0A12089g"
FT                   /old_locus_tag="DEHA-IPF7246"
FT                   /old_locus_tag="DEHA-CDS2662.1"
FT   CDS_pept        984548..985924
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11616g"
FT                   /old_locus_tag="DEHA0A12089g"
FT                   /old_locus_tag="DEHA-IPF7246"
FT                   /old_locus_tag="DEHA-CDS2662.1"
FT                   /product="DEHA2A11616p"
FT                   /note="similar to CA5118|IPF1321 Candida albicans IPF1321"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84813"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY81"
FT                   /protein_id="CAG84813.2"
FT                   /translation="MSTSDLKSTILQESTRAQNVHHAAEALRIATQSTHHQVHNQQHVQ
FT                   QIDKEQGNNIHEFSEYDLKSRDSKYKRWSPKMDQFLIKLLSDVVHSYPKGAEAEMTKKA
FT                   WAYVTGQLRAANPETVYSTYTKYSCQQHLFNVNHHRFKIWYILMLHSKNNQTTDGYSYR
FT                   WNPDGGRFQIIDNTNGGIIQDERQVKSLLYSDSMSLPSLSSFNKGNLIVTDFFLTDHLG
FT                   YMSTYHNEVLPLLIRLDNRYADGLGDLYHEIPKFEYRDSNKEYFKPLVQAKSIKLGTND
FT                   ASKTKKRTHSESNQSHNSQGDVPLFTNSLSSMQHDPEVGDEDTVDPALKRSRNINTPET
FT                   NSNATTTEFENALATAAIAAINTPSVTNGRDIQPIYIKDRKWFNRLVSLNESGLITPNE
FT                   VLVVCEGVRDGKIPLFMLNILDQSYYPTRSAEDITPDETPDEEAAKKIREFMLPMTFNS
FT                   "
FT   gene            complement(<985988..>988087)
FT                   /locus_tag="DEHA2A11638g"
FT                   /old_locus_tag="IPF_7249"
FT   CDS_pept        complement(985988..988087)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11638g"
FT                   /old_locus_tag="IPF_7249"
FT                   /product="DEHA2A11638p"
FT                   /note="weakly similar to CA5117|IPF1323 Candida albicans
FT                   IPF1323"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65405"
FT                   /db_xref="UniProtKB/TrEMBL:B5RSU9"
FT                   /protein_id="CAR65405.1"
FT                   /translation="MAGMTENLSLELREGEPFRNGDSLMEFEKMQYHNSNSEEAKRSNP
FT                   FDVLYEPHKVHSPSHYNTPLSQSFRYLEMEHNNVINRDQGVNDTSYNNIVTVIDSTDSV
FT                   NRTGSMISRSATLRNRNRIKTRSKMVRKNDIDSDPEKAKRKSKLAFLFPVRRERSLKQK
FT                   PKYVPLNRSPKFTNAQEFQQFFDKSNAANVLAEMLPPKMNHFKYKRLFLPDSKLITSNA
FT                   YYQITRNNSFIINPKTQASKMIISSPIKDTFTKNGVKNEPDLDQHLPPDFGSEAYNKYR
FT                   ISVFSNKLSTIPTFYQLFPEEAKLGMLNASELEQINKKLLFEVLLRRTVAAKIGYRLKH
FT                   NGYFNRKSNNNASSNGDSSSESHSGPSSDNERFDNQNLPKLSKSHTNSSSYDESINTDE
FT                   LLKQNASLYSGVLPSPQISYSSRIELDCLVSEISDSPNFLPLHKSIDKNNYSSSSVYST
FT                   PKTNKFLNNGKFTPMAYFESPESLYIATFRKQINNEGNPSTRRSFPTSTNPHQTILPES
FT                   HSKFLQPMTQPNEPEVNFLGSPNNSLKSKPKHKSQTSSNTSILQDLEDLSSELSSFAIG
FT                   HEDMVQNFQYSARDKSLNIPLQKHHNLIQSIEESKDSVGLRSTNSTHPIRSESPVADIK
FT                   SMRASISIIGTLSDSSSNSSSNKKVSLRDAINAHNLNSIKANISTVALKSISSNKGAKL
FT                   NNPTI"
FT   gene            <988776..>989516
FT                   /locus_tag="DEHA2A11660g"
FT   CDS_pept        join(988776..988793,989049..989516)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11660g"
FT                   /product="DEHA2A11660p"
FT                   /note="similar to uniprot|P40414 Saccharomyces cerevisiae
FT                   YIL138C TPM2 Tropomyosin isoform 2,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84814"
FT                   /db_xref="InterPro:IPR000533"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY80"
FT                   /protein_id="CAG84814.1"
FT                   /translation="MDKLKEKINNLKLDAEKWQEKSDEYSDRVKELEQENLDKDNQIQS
FT                   LTRKNQVLEEQVEKLETDLTEIKQTADESHSLKTSNENYTKKHQVLEEELEEADKNLKE
FT                   TTEKLRETDIKAEQLERKVASLESEKEEWENKFEQLTEQHNAAKAELEEISQQLEAI"
FT   gene            <989886..>990977
FT                   /locus_tag="DEHA2A11682g"
FT                   /old_locus_tag="DEHA0A12133g"
FT                   /old_locus_tag="DEHA-IPF7253"
FT                   /old_locus_tag="DEHA-CDS3489.1"
FT   CDS_pept        989886..990977
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11682g"
FT                   /old_locus_tag="DEHA0A12133g"
FT                   /old_locus_tag="DEHA-IPF7253"
FT                   /old_locus_tag="DEHA-CDS3489.1"
FT                   /product="DEHA2A11682p"
FT                   /note="weakly similar to uniprot|P53938 Saccharomyces
FT                   cerevisiae YNL080C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG84815"
FT                   /db_xref="GOA:Q6BY79"
FT                   /db_xref="InterPro:IPR021100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BY79"
FT                   /protein_id="CAG84815.2"
FT                   /translation="MALMESIRKRFSHRLESHQIDEDYTTPSRSSSSVRDSTQPNNIPN
FT                   TINPNANNVDRSTNSFVYNVVDPYDPSEMVPSYETSQLLYEQQQRAPDRNGSIPNSSNI
FT                   SRTISRTNSFATITPLTQNQGPNANQSSNNGSHKNNTKNSLKMLGLKFLNARQHFMLAC
FT                   CRDISLIPCLIGLIQSWNRVFLNSGSMHNFVDDNLSLVAQETGNETLYLSMTSARLSEH
FT                   FLTGVWCIVAGYLSFSVLDGLMIRWIVTYSTLAAIVRMLSMSTIMITIEQYLLSTFTAD
FT                   GYKYGLHIWILISCCLTLLYIGQNFVTSNLDLKGNTRARFFDFYNIAVFAVVPVGLASF
FT                   ITMIGLLRSLLILRLDIDQNGLP"
FT   gene            <991251..>991736
FT                   /locus_tag="DEHA2A11704g"
FT   CDS_pept        join(991251..991301,991422..991736)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2A11704g"
FT                   /product="DEHA2A11704p"
FT                   /note="similar to uniprot|P53937 Saccharomyces cerevisiae
FT                   YNL081C SWS2 Putative mitochondrial ribosomal protein of
FT                   the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2A