(data stored in ACNUC9543 zone)

EMBL: CR382137

ID   CR382137; SV 2; linear; genomic DNA; STD; FUN; 2007515 BP.
XX
AC   CR382137;
XX
PR   Project:PRJNA13832;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 12)
XX
DE   Debaryomyces hansenii CBS767 chromosome E complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Debaryomyces hansenii CBS767
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Debaryomyces.
XX
RN   [1]
RP   1-2007515
RA   Genoscope - CEA;
RT   ;
RL   Submitted (10-SEP-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -FRANCE
RL   (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-2007515
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
RN   [3]
RP   1-2007515
RA   Casaregola S., Val M.E., Neuveglise C., Talla E., Martin T., Durrens P.,
RA   Barbe V., Bleykasten C., Bon E., Despons L., Fritsch E., Groppi A.,
RA   Iragne F., Jauniaux N., Leh V., de Montigny J., Pottier S., Straub M.L.,
RA   Wirth B., Wincker P., Sherman D.J., Gaillardin C., Souciet J.L.;
RT   "The second release of the complete genome of Debaryomyces hansenii type
RT   strain CBS767";
RL   Unpublished.
XX
DR   MD5; aeddfbc453796cc5991ab7ebf8e7f42b.
DR   BioSample; SAMEA3138183.
DR   CABRI; CBS 767.
DR   EnsemblGenomes-Gn; DEHA2E02310r.
DR   EnsemblGenomes-Gn; DEHA2E02442r.
DR   EnsemblGenomes-Gn; DEHA2E02486r.
DR   EnsemblGenomes-Gn; DEHA2E02684r.
DR   EnsemblGenomes-Gn; DEHA2E02706r.
DR   EnsemblGenomes-Gn; DEHA2E03014r.
DR   EnsemblGenomes-Gn; DEHA2E03080r.
DR   EnsemblGenomes-Gn; DEHA2E03102r.
DR   EnsemblGenomes-Gn; DEHA2E03432r.
DR   EnsemblGenomes-Gn; DEHA2E04114r.
DR   EnsemblGenomes-Gn; DEHA2E04620r.
DR   EnsemblGenomes-Gn; DEHA2E04818r.
DR   EnsemblGenomes-Gn; DEHA2E05280r.
DR   EnsemblGenomes-Gn; DEHA2E07216r.
DR   EnsemblGenomes-Gn; DEHA2E07700r.
DR   EnsemblGenomes-Gn; DEHA2E08272r.
DR   EnsemblGenomes-Gn; DEHA2E08844r.
DR   EnsemblGenomes-Gn; DEHA2E10032r.
DR   EnsemblGenomes-Gn; DEHA2E10230r.
DR   EnsemblGenomes-Gn; DEHA2E10340r.
DR   EnsemblGenomes-Gn; DEHA2E11638r.
DR   EnsemblGenomes-Gn; DEHA2E12100r.
DR   EnsemblGenomes-Gn; DEHA2E12562r.
DR   EnsemblGenomes-Gn; DEHA2E13134r.
DR   EnsemblGenomes-Gn; DEHA2E15532r.
DR   EnsemblGenomes-Gn; DEHA2E15554r.
DR   EnsemblGenomes-Gn; DEHA2E15642r.
DR   EnsemblGenomes-Gn; DEHA2E15818r.
DR   EnsemblGenomes-Gn; DEHA2E16148r.
DR   EnsemblGenomes-Gn; DEHA2E16192r.
DR   EnsemblGenomes-Gn; DEHA2E16896r.
DR   EnsemblGenomes-Gn; DEHA2E17336r.
DR   EnsemblGenomes-Gn; DEHA2E17534r.
DR   EnsemblGenomes-Gn; DEHA2E18150r.
DR   EnsemblGenomes-Gn; DEHA2E18172r.
DR   EnsemblGenomes-Gn; DEHA2E18678r.
DR   EnsemblGenomes-Gn; DEHA2E20108r.
DR   EnsemblGenomes-Gn; DEHA2E20196r.
DR   EnsemblGenomes-Gn; DEHA2E20240r.
DR   EnsemblGenomes-Gn; DEHA2E20306r.
DR   EnsemblGenomes-Gn; DEHA2E20438r.
DR   EnsemblGenomes-Gn; DEHA2E21406r.
DR   EnsemblGenomes-Gn; DEHA2E21538r.
DR   EnsemblGenomes-Gn; DEHA2E21758r.
DR   EnsemblGenomes-Gn; DEHA2E22374r.
DR   EnsemblGenomes-Gn; DEHA2E22682r.
DR   EnsemblGenomes-Gn; DEHA2E22836r.
DR   EnsemblGenomes-Gn; DEHA2E23012r.
DR   EnsemblGenomes-Gn; ENSRNA049507055.
DR   EnsemblGenomes-Gn; ENSRNA049507072.
DR   EnsemblGenomes-Gn; ENSRNA049507092.
DR   EnsemblGenomes-Gn; ENSRNA049507108.
DR   EnsemblGenomes-Gn; ENSRNA049507117.
DR   EnsemblGenomes-Gn; ENSRNA049564708.
DR   EnsemblGenomes-Gn; ENSRNA049564794.
DR   EnsemblGenomes-Gn; ENSRNA049564881.
DR   EnsemblGenomes-Gn; ENSRNA049564931.
DR   EnsemblGenomes-Gn; ENSRNA049565059.
DR   EnsemblGenomes-Gn; ENSRNA049565103.
DR   EnsemblGenomes-Gn; ENSRNA049565186.
DR   EnsemblGenomes-Gn; ENSRNA049565292.
DR   EnsemblGenomes-Gn; ENSRNA049565369.
DR   EnsemblGenomes-Gn; ENSRNA049565488.
DR   EnsemblGenomes-Gn; ENSRNA049565565.
DR   EnsemblGenomes-Gn; ENSRNA049565603.
DR   EnsemblGenomes-Gn; ENSRNA049565686.
DR   EnsemblGenomes-Gn; ENSRNA049565750.
DR   EnsemblGenomes-Gn; ENSRNA049565862.
DR   EnsemblGenomes-Gn; ENSRNA049565928.
DR   EnsemblGenomes-Gn; ENSRNA049566009.
DR   EnsemblGenomes-Gn; ENSRNA049566146.
DR   EnsemblGenomes-Gn; ENSRNA049566240.
DR   EnsemblGenomes-Gn; ENSRNA049566297.
DR   EnsemblGenomes-Gn; ENSRNA049566414.
DR   EnsemblGenomes-Gn; ENSRNA049566550.
DR   EnsemblGenomes-Gn; ENSRNA049566650.
DR   EnsemblGenomes-Gn; ENSRNA049566718.
DR   EnsemblGenomes-Gn; ENSRNA049566816.
DR   EnsemblGenomes-Gn; ENSRNA049566877.
DR   EnsemblGenomes-Gn; ENSRNA049566958.
DR   EnsemblGenomes-Gn; ENSRNA049567041.
DR   EnsemblGenomes-Gn; ENSRNA049567114.
DR   EnsemblGenomes-Gn; ENSRNA049567199.
DR   EnsemblGenomes-Gn; ENSRNA049567284.
DR   EnsemblGenomes-Gn; ENSRNA049567431.
DR   EnsemblGenomes-Gn; ENSRNA049567509.
DR   EnsemblGenomes-Gn; ENSRNA049567597.
DR   EnsemblGenomes-Gn; ENSRNA049567700.
DR   EnsemblGenomes-Gn; ENSRNA049567794.
DR   EnsemblGenomes-Gn; ENSRNA049567878.
DR   EnsemblGenomes-Gn; ENSRNA049567938.
DR   EnsemblGenomes-Gn; ENSRNA049568044.
DR   EnsemblGenomes-Gn; ENSRNA049568109.
DR   EnsemblGenomes-Gn; ENSRNA049568210.
DR   EnsemblGenomes-Gn; ENSRNA049568287.
DR   EnsemblGenomes-Gn; ENSRNA049568354.
DR   EnsemblGenomes-Gn; ENSRNA049568424.
DR   EnsemblGenomes-Gn; ENSRNA049568517.
DR   EnsemblGenomes-Gn; ENSRNA049568573.
DR   EnsemblGenomes-Gn; ENSRNA049568657.
DR   EnsemblGenomes-Tr; DEHA2E02310r-1.
DR   EnsemblGenomes-Tr; DEHA2E02442r-1.
DR   EnsemblGenomes-Tr; DEHA2E02486r-1.
DR   EnsemblGenomes-Tr; DEHA2E02684r-1.
DR   EnsemblGenomes-Tr; DEHA2E02706r-1.
DR   EnsemblGenomes-Tr; DEHA2E03014r-1.
DR   EnsemblGenomes-Tr; DEHA2E03080r-1.
DR   EnsemblGenomes-Tr; DEHA2E03102r-1.
DR   EnsemblGenomes-Tr; DEHA2E03432r-1.
DR   EnsemblGenomes-Tr; DEHA2E04114r-1.
DR   EnsemblGenomes-Tr; DEHA2E04620r-1.
DR   EnsemblGenomes-Tr; DEHA2E04818r-1.
DR   EnsemblGenomes-Tr; DEHA2E05280r-1.
DR   EnsemblGenomes-Tr; DEHA2E07216r-1.
DR   EnsemblGenomes-Tr; DEHA2E07700r-1.
DR   EnsemblGenomes-Tr; DEHA2E08272r-1.
DR   EnsemblGenomes-Tr; DEHA2E08844r-1.
DR   EnsemblGenomes-Tr; DEHA2E10032r-1.
DR   EnsemblGenomes-Tr; DEHA2E10230r-1.
DR   EnsemblGenomes-Tr; DEHA2E10340r-1.
DR   EnsemblGenomes-Tr; DEHA2E11638r-1.
DR   EnsemblGenomes-Tr; DEHA2E12100r-1.
DR   EnsemblGenomes-Tr; DEHA2E12562r-1.
DR   EnsemblGenomes-Tr; DEHA2E13134r-1.
DR   EnsemblGenomes-Tr; DEHA2E15532r-1.
DR   EnsemblGenomes-Tr; DEHA2E15554r-1.
DR   EnsemblGenomes-Tr; DEHA2E15642r-1.
DR   EnsemblGenomes-Tr; DEHA2E15818r-1.
DR   EnsemblGenomes-Tr; DEHA2E16148r-1.
DR   EnsemblGenomes-Tr; DEHA2E16192r-1.
DR   EnsemblGenomes-Tr; DEHA2E16896r-1.
DR   EnsemblGenomes-Tr; DEHA2E17336r-1.
DR   EnsemblGenomes-Tr; DEHA2E17534r-1.
DR   EnsemblGenomes-Tr; DEHA2E18150r-1.
DR   EnsemblGenomes-Tr; DEHA2E18172r-1.
DR   EnsemblGenomes-Tr; DEHA2E18678r-1.
DR   EnsemblGenomes-Tr; DEHA2E20108r-1.
DR   EnsemblGenomes-Tr; DEHA2E20196r-1.
DR   EnsemblGenomes-Tr; DEHA2E20240r-1.
DR   EnsemblGenomes-Tr; DEHA2E20306r-1.
DR   EnsemblGenomes-Tr; DEHA2E20438r-1.
DR   EnsemblGenomes-Tr; DEHA2E21406r-1.
DR   EnsemblGenomes-Tr; DEHA2E21538r-1.
DR   EnsemblGenomes-Tr; DEHA2E21758r-1.
DR   EnsemblGenomes-Tr; DEHA2E22374r-1.
DR   EnsemblGenomes-Tr; DEHA2E22682r-1.
DR   EnsemblGenomes-Tr; DEHA2E22836r-1.
DR   EnsemblGenomes-Tr; DEHA2E23012r-1.
DR   EnsemblGenomes-Tr; EFT00001977229.
DR   EnsemblGenomes-Tr; EFT00001977230.
DR   EnsemblGenomes-Tr; EFT00001977232.
DR   EnsemblGenomes-Tr; EFT00001977233.
DR   EnsemblGenomes-Tr; EFT00001977234.
DR   EnsemblGenomes-Tr; EFT00001977235.
DR   EnsemblGenomes-Tr; EFT00001977237.
DR   EnsemblGenomes-Tr; EFT00001977239.
DR   EnsemblGenomes-Tr; EFT00001977240.
DR   EnsemblGenomes-Tr; EFT00001977241.
DR   EnsemblGenomes-Tr; EFT00001977242.
DR   EnsemblGenomes-Tr; EFT00001977243.
DR   EnsemblGenomes-Tr; EFT00001977244.
DR   EnsemblGenomes-Tr; EFT00001977246.
DR   EnsemblGenomes-Tr; EFT00001977247.
DR   EnsemblGenomes-Tr; EFT00001977249.
DR   EnsemblGenomes-Tr; EFT00001977251.
DR   EnsemblGenomes-Tr; EFT00001977253.
DR   EnsemblGenomes-Tr; EFT00001977254.
DR   EnsemblGenomes-Tr; EFT00001977255.
DR   EnsemblGenomes-Tr; EFT00001977257.
DR   EnsemblGenomes-Tr; EFT00001977259.
DR   EnsemblGenomes-Tr; EFT00001977260.
DR   EnsemblGenomes-Tr; EFT00001977261.
DR   EnsemblGenomes-Tr; EFT00001977263.
DR   EnsemblGenomes-Tr; EFT00001977264.
DR   EnsemblGenomes-Tr; EFT00001977267.
DR   EnsemblGenomes-Tr; EFT00001977269.
DR   EnsemblGenomes-Tr; EFT00001977271.
DR   EnsemblGenomes-Tr; EFT00001977272.
DR   EnsemblGenomes-Tr; EFT00001977274.
DR   EnsemblGenomes-Tr; EFT00001977276.
DR   EnsemblGenomes-Tr; EFT00001977277.
DR   EnsemblGenomes-Tr; EFT00001977278.
DR   EnsemblGenomes-Tr; EFT00001977280.
DR   EnsemblGenomes-Tr; EFT00001977282.
DR   EnsemblGenomes-Tr; EFT00001977284.
DR   EnsemblGenomes-Tr; EFT00001977287.
DR   EnsemblGenomes-Tr; EFT00001977288.
DR   EnsemblGenomes-Tr; EFT00001977290.
DR   EnsemblGenomes-Tr; EFT00001977291.
DR   EnsemblGenomes-Tr; EFT00001977293.
DR   EnsemblGenomes-Tr; EFT00001977295.
DR   EnsemblGenomes-Tr; EFT00001977296.
DR   EnsemblGenomes-Tr; EFT00001977297.
DR   EnsemblGenomes-Tr; EFT00001977300.
DR   EnsemblGenomes-Tr; EFT00001977302.
DR   EnsemblGenomes-Tr; EFT00001977303.
DR   EnsemblGenomes-Tr; EFT00001977304.
DR   EnsemblGenomes-Tr; EFT00001977306.
DR   EnsemblGenomes-Tr; EFT00001977308.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00475; snosnR69.
DR   RFAM; RF00479; snosnR71.
DR   RFAM; RF01184; snR79.
DR   RFAM; RF01201; snR40.
DR   RFAM; RF01214; snR51.
DR   RFAM; RF01218; snR41.
DR   RFAM; RF01263; snR191.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 120222; 0.
XX
CC   This is an updated version of the complete genome sequence. The
CC   Debaryomyces hansenii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium.
CC   For more information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007515
FT                   /organism="Debaryomyces hansenii CBS767"
FT                   /chromosome="E"
FT                   /strain="CBS767"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Deha2E"
FT                   /db_xref="taxon:284592"
FT   gene            <1349..>2491
FT                   /locus_tag="DEHA2E00110g"
FT                   /old_locus_tag="IPF_5817"
FT   CDS_pept        1349..2491
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00110g"
FT                   /old_locus_tag="IPF_5817"
FT                   /product="DEHA2E00110p"
FT                   /note="similar to CA5047|IPF4504 Candida albicans IPF4504
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65731"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTR9"
FT                   /protein_id="CAR65731.1"
FT                   /translation="MLTEEVINGSKAHDLPKEIVENEIATLLKGIEIKEEFNPHQPFDP
FT                   EKHILYKENDFEKVRIHKLKELGIDKTHVPSISDVAVTDPFPLFTEDACNIMKWEAFQT
FT                   KNVEKYGKIPIMSKGTTSTDFQVCGYTKNSPFTVAAWKHPKTQEIVNKFAGVRLKIMFD
FT                   YEIAHINASLISSKYGSGHRETNENGANPEEDSKAVFDWHYDSNSFSAVLMLSTNDKME
FT                   GGKTGLKTGSEDVVYVDGPRIGYVTIIQGRVVKHIATKPKTNDERISSIVGYVPESLDV
FT                   PDTTVLTTFRPSVSPRSLHNEYYPQWMEYRFKRIEDRLARKRKELIRNSEHGKIFEQLE
FT                   VVEFCEDISNYLSKSWNEFESVVDNEIFPPKIFSTPYNEL"
FT   gene            <3005..>3905
FT                   /pseudo
FT                   /locus_tag="DEHA2E00121g"
FT                   /old_locus_tag="IPF_5816"
FT                   /old_locus_tag="IPF_5815"
FT                   /old_locus_tag="IPF_5814"
FT                   /note="some similarities with uniprot|Q05016 Saccharomyces
FT                   cerevisiae YMR226C NADP(+)-dependent dehydrogenase"
FT   gene            complement(<4201..>4359)
FT                   /locus_tag="DEHA2E00132g"
FT                   /old_locus_tag="IPF_43419"
FT   CDS_pept        complement(4201..4359)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00132g"
FT                   /old_locus_tag="IPF_43419"
FT                   /product="DEHA2E00132p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65732"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS0"
FT                   /protein_id="CAR65732.1"
FT                   /translation="MGVQGCADGYIGDHISLAPSFVVTRIDIMEICTKVVKSIEELRQE
FT                   LISEGNL"
FT   gene            <4934..>6952
FT                   /locus_tag="DEHA2E00154g"
FT                   /old_locus_tag="IPF_5813"
FT   CDS_pept        4934..6952
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00154g"
FT                   /old_locus_tag="IPF_5813"
FT                   /product="DEHA2E00154p"
FT                   /note="weakly similar to uniprot|P40971 Saccharomyces
FT                   cerevisiae YDR034C LYS14 Transcriptional activator involved
FT                   in regulation of genes of the lysine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65733"
FT                   /db_xref="GOA:B5RTS1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS1"
FT                   /protein_id="CAR65733.1"
FT                   /translation="MEDETNTENSNSIRKRSYSRKGCNECKKRKLKCDETKPCCLKCSK
FT                   SSKVCSYKQIAKFCDSRTATLGNILLTKQNKIFKNSCSNLSPSVDSTKVDNRKENKAQA
FT                   IQLNKDNRDVLRHDTSKSKVFPCIHKDDEFSIKHRKPKYSAINEPKISNESPSEVIIQE
FT                   STTPGSLNRILDKYNRHDQTLLNDASSLTHGLNDIAIIDMLDEMPNVMDEIKHKSSIGM
FT                   NRAQSNLIKDTDSKINNLILFYDLNADHKNYLSLFYNKYSIWLMPFSSGTKNICNETLM
FT                   NLALEFPFLLNAIFSITARYENFCVSNSVDEYYQKYYFIMCCKGFASMFEDKTQISKYI
FT                   EPLILTTLILVTDAVAFVNGDWRSHLKVAHNLFSKYVSIYKRTSNSILLSTIWFAALEI
FT                   LAVVSNPLGGAINSQAEFDTMMSAGVNLKDNSLSIQLGLTLPNGYNVFLGYSEEAVTMF
FT                   TTFVRITLRMKENSIHRVSSDDLTSLFCKIKDADRYYLASHDCVISQDNPYHPNNKAGM
FT                   LLPIATYGYNNNIIFSWFDISHKLHVHALYLKILTDKHFLNLPEDSPLVHDVVKKILGL
FT                   CHFFQGIDFESTSFTIAEQLEENKNTPLWSDRRLLTVHWPLLTCGLCCVDKLERLKIKL
FT                   YFKSLIQMGARSLERSLKNVENKWSGGSGISDYVPFV"
FT   gene            complement(<7639..>9939)
FT                   /locus_tag="DEHA2E00176g"
FT                   /old_locus_tag="DEHA0E00198g"
FT                   /old_locus_tag="DEHA-IPF5810"
FT                   /old_locus_tag="DEHA-CDS1084.1"
FT   CDS_pept        complement(7639..9939)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00176g"
FT                   /old_locus_tag="DEHA0E00198g"
FT                   /old_locus_tag="DEHA-IPF5810"
FT                   /old_locus_tag="DEHA-CDS1084.1"
FT                   /product="DEHA2E00176p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87513"
FT                   /db_xref="GOA:Q6BR36"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR36"
FT                   /protein_id="CAG87513.2"
FT                   /translation="MLIRNNAKEIIKNWENLAYQAFESTRSYNHKFNRTLQAFQTIVDQ
FT                   QDNRKVMIGSVRFSTSDLGKLVRCLVREYHTTVRNLLPDGMLMVDELYEEFRKHAKDMF
FT                   SCMDLGYSVFYGTNELNKLSYQQRRTYEEAVGDKWKNQKYMRSMFDQFTRLNLNLFVCI
FT                   LITCGSPFRVTELLTLTFANPTDLVRTMYYSNGHIQINLLYNKNTHSSMRYSNHTKMLP
FT                   IEVSKIVIHYVSIIKYLEVAIVEEHGWAKSKSDMSVADDWEDDAEFDESDGNDSEDEAS
FT                   LLASKALSKRDEIKTLLFMYKLGPRNGGQVFKYLESVSEKYIREKYTPRILRQALVYFT
FT                   RTLLGEAKHQGVGILNRIDSIAGHRSETADLQYGVTHSNMYLPSAARNNIDIQISFAWH
FT                   KILELEEKEVKDEPAPSNRQELKKLLSMVDVGKEEIEEVGRRLYGNFKFGSMGQVHTVY
FT                   DAFHSVKDLMVISPTGSGKSNAYKMPILMEKKLRLPFVSFIICPFISLLEDVKVKLKEL
FT                   GELEVEIFDSDMAHEYYSNCDIIVLQLEKVSDAAGLVRYFESGSVFRRVRRLIMDEAHA
FT                   LIEHREFRGQSVSRVRDVFGESIPKLFLTATFPKAMERELCPMFGISDRRVHREDTIRK
FT                   NIEHVVVREHVDVKRALRTIYAKEIRPRRTKGIVFVYSREMAKDLGERLRWMVFHGHMV
FT                   PEEKAKAYKEFADTESAMMVATSAFSHGVDVEGISHVIAIGSVPNRAGSEAGFSERSDV
FT                   QPLIIKKKKNRMK"
FT   gene            complement(<9940..>10935)
FT                   /locus_tag="DEHA2E00198g"
FT                   /old_locus_tag="DEHA0E00220g"
FT                   /old_locus_tag="DEHA-IPF5806"
FT                   /old_locus_tag="DEHA-CDS3902.1"
FT   CDS_pept        complement(9940..10935)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00198g"
FT                   /old_locus_tag="DEHA0E00220g"
FT                   /old_locus_tag="DEHA-IPF5806"
FT                   /old_locus_tag="DEHA-CDS3902.1"
FT                   /product="DEHA2E00198p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87514"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR35"
FT                   /protein_id="CAG87514.1"
FT                   /translation="MESHELRIREVGGVSILVHKDKIVNPLAEKFANKYLPRLIESSEI
FT                   RSTILSEIKSYYQEHSKQHYLLKQIIAVTDDSEVPGVKESKLNVCKLCFNHASKSHINH
FT                   HLRTEHRVNCNFQRHVFRTTGYAIPNQKCGFSYIYREKEDTKPPTSMTTIEGPHTHLRH
FT                   EDKFLRTINANLYYGKGYPQYLHSENKEESIPVFEAVKKYILQDRPHLKGTHPIYNRML
FT                   REGILKVPVLFTTQVIYANYAGRFFYTFAKLCDNRIIEEVVTNPTDEVVKRAVMETIEK
FT                   YIVVEEDTTETFMKAVIISLMLPDDRFAQSKVRAKIFDGINYFLKLAIAD"
FT   gene            <11802..>14636
FT                   /locus_tag="DEHA2E00220g"
FT   CDS_pept        11802..14636
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00220g"
FT                   /product="DEHA2E00220p"
FT                   /note="no similarity,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS2"
FT                   /protein_id="CAR65734.1"
FT                   /translation="MICRCCGKEKKTASQKKTCKKCRQKSKRRRISKAQAFDMSNNSSW
FT                   FDSSSPQLDESKPRPIISNKPNNDKAYLKNEEFDSQRTIDIPDSQLTVEMSSQNDYGDP
FT                   VYDEVSSEQNTGEQSNYEVSIQIQQDEVLRMKGIDLVEKTQEGLEDIEDDNNSMDESNF
FT                   EIEYDNFQDDYSDPSYIESESQDSIENSIDVEETLPEPSNNGANLPTIGEIEELLEGSD
FT                   ISIDNWAKVAVNKKTGNIIDIHTTERWLKYIVPTASIYSKALAKEMVLKAVPENNYQII
FT                   KSGFIPRPINFAKMYDLQYCPDCTRLKSIQNHFSHRIPSSSRDKCTYRGPFKLGQGHRI
FT                   GLTYIMLSNVHEFPEISSSIKNKLTNPQLTRELTEYISSGNKYLEDINFKQNIFDKYHK
FT                   EFKFLLLQLPTASDKINELRQSLVDRMVEISEYARSNHEVGQSLFKKFRNVRKETVIMY
FT                   TNIVFKILYTMIKLQDLGYLRLFDINDKAEDIGCIEVVTNYFDNKLMLYKINPVGYEFQ
FT                   TSPFIVALWLNHLDPVDHCLRDESGIQHLFDATQLFMKLELINYCRTNHKNMELEYKEY
FT                   FKATEDYTTIYKILRIMKGRLFDFRTIVSNYYDVYFTKKYTTMLYKEKEIHLSDVPEFV
FT                   VFLIESFCNTILPILPDHFKIKDFIERVYDPNFYSSLSCFAPLHSFRERLPFVLLETAD
FT                   DLRRVLCFNFFKLNKLIILIMYFTGGLPFRMTEVLGLQFNDKKRNIFFRGGKMVCTYTY
FT                   NKTDNISNKTKLISRGYPIIVSKIVFFYINYVRYYELRLMEQLKQLDNNKSRWETLQER
FT                   CTRYLFVDISGIVQSEDMYALFMQMSTKFIKTRLGIRDWRQIMVQFVKKNVSSTSMLSS
FT                   SFIHKFLEMQAGHGSTVALNSYEKTTTRDYENGIVEAQQLMSERWHEIINLPLSLNELE
FT                   NFKPNIQLSSKEIN"
FT   gene            <15670..>16791
FT                   /locus_tag="DEHA2E00242g"
FT   CDS_pept        15670..16791
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00242g"
FT                   /product="DEHA2E00242p"
FT                   /note="weakly similar to uniprot|P47145 Saccharomyces
FT                   cerevisiae YJR107W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87516"
FT                   /db_xref="GOA:Q6BR33"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR33"
FT                   /protein_id="CAG87516.1"
FT                   /translation="MKACPIIYFIAAITISFVDAYNNVIYNLAVDMAEYCRISYCIKGF
FT                   GNYDFLVDAPLLKIGDLPLACPTLTFCQDNKDIEIVQILNPNIKEAQMSGSGYVAINHA
FT                   KKHIVVVSRGSYTIQDWVSDFEFALVPYKRCSLCAVHKGVYAATEVIKKQAWNTIKNLL
FT                   KEYPDYELIATGHSLGGGLTVLVGLEMQLDFKKRVTVISLAGLKIGNNHLAGFIDKTFN
FT                   SSKYLEEVNKDANKTQFGGFLRVVHEADIVPLIPPTPLYAHGGIELYINKVRLPHPQGS
FT                   TEIKGMYKFEPLSSQLFNIITQKTLQETLTIYEHNNYFMYIYGCNSTSIFDFIPGPNPQ
FT                   DEGNITAAALRATIINRSTSYSQSTSAVSITTF"
FT   gene            <17495..>17833
FT                   /locus_tag="DEHA2E00264g"
FT   CDS_pept        17495..17833
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00264g"
FT                   /product="DEHA2E00264p"
FT                   /note="no similarity,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65735"
FT                   /db_xref="GOA:B5RTS3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS3"
FT                   /protein_id="CAR65735.1"
FT                   /translation="MEMSTDKFRDRYRAPLDHALRKSSIRSRLLSESYWYPLGDVLDRE
FT                   HDIQDYFSEVSMPIRRLYGDVFELPGLKKSASQIGITYAICSKQYLPLLFLCLVILSSP
FT                   RQKSREKK"
FT   gene            complement(<18006..>18125)
FT                   /locus_tag="DEHA2E00286g"
FT                   /old_locus_tag="DEHA0E00308g"
FT                   /old_locus_tag="DEHA-IPF5799"
FT                   /old_locus_tag="DEHA-CDS9002.1"
FT   CDS_pept        complement(18006..18125)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00286g"
FT                   /old_locus_tag="DEHA0E00308g"
FT                   /old_locus_tag="DEHA-IPF5799"
FT                   /old_locus_tag="DEHA-CDS9002.1"
FT                   /product="DEHA2E00286p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87518"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR31"
FT                   /protein_id="CAG87518.2"
FT                   /translation="MPIDEWNMDSVYEFIKARLNELHSLGISHNDVRQANIHV"
FT   gene            complement(<18469..>18753)
FT                   /locus_tag="DEHA2E00308g"
FT                   /old_locus_tag="DEHA0E00330g"
FT                   /old_locus_tag="DEHA-IPF5798"
FT                   /old_locus_tag="DEHA-CDS7465.1"
FT   CDS_pept        complement(18469..18753)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00308g"
FT                   /old_locus_tag="DEHA0E00330g"
FT                   /old_locus_tag="DEHA-IPF5798"
FT                   /old_locus_tag="DEHA-CDS7465.1"
FT                   /product="DEHA2E00308p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87519"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR30"
FT                   /protein_id="CAG87519.2"
FT                   /translation="MTIDYYNINNSETVAHGITLGSAIVGVFYKNVTDTYDTKSKLLSQ
FT                   FELACKTDGPDPFKNVLPRQTSEPSRGLSMRLVDFRRVCSVMSLQKIWT"
FT   gene            complement(<18928..>19143)
FT                   /locus_tag="DEHA2E00330g"
FT                   /old_locus_tag="DEHA0E00352g"
FT                   /old_locus_tag="DEHA-IPF5797"
FT                   /old_locus_tag="DEHA-CDS8113.1"
FT   CDS_pept        complement(18928..19143)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00330g"
FT                   /old_locus_tag="DEHA0E00352g"
FT                   /old_locus_tag="DEHA-IPF5797"
FT                   /old_locus_tag="DEHA-CDS8113.1"
FT                   /product="DEHA2E00330p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87520"
FT                   /db_xref="InterPro:IPR022167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR29"
FT                   /protein_id="CAG87520.1"
FT                   /translation="MIRSPLDRRRIVKPDIARILKKGSFLNLQTPDLCFAIGDYRKGTY
FT                   NLAQGFEELRVAINDHKQNLLNKKQV"
FT   gene            complement(<19159..>19431)
FT                   /locus_tag="DEHA2E00352g"
FT                   /old_locus_tag="DEHA0E00374g"
FT                   /old_locus_tag="DEHA-IPF5796"
FT                   /old_locus_tag="DEHA-CDS7567.1"
FT   CDS_pept        complement(19159..19431)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00352g"
FT                   /old_locus_tag="DEHA0E00374g"
FT                   /old_locus_tag="DEHA-IPF5796"
FT                   /old_locus_tag="DEHA-CDS7567.1"
FT                   /product="DEHA2E00352p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87521"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR28"
FT                   /protein_id="CAG87521.1"
FT                   /translation="MPLMHLVVYVANSLMTSEFGEMSSDEFKESYLAPFDEVLKDTNIS
FT                   DNFLTKRYKYPFGDATHVDDDIQEYFNEIAIPIRGLYRDVGDMDN"
FT   gene            complement(<19486..>19668)
FT                   /locus_tag="DEHA2E00374g"
FT                   /old_locus_tag="DEHA0E00396g"
FT                   /old_locus_tag="DEHA-IPF5795"
FT                   /old_locus_tag="DEHA-CDS8467.1"
FT   CDS_pept        complement(19486..19668)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00374g"
FT                   /old_locus_tag="DEHA0E00396g"
FT                   /old_locus_tag="DEHA-IPF5795"
FT                   /old_locus_tag="DEHA-CDS8467.1"
FT                   /product="DEHA2E00374p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87522"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR27"
FT                   /protein_id="CAG87522.1"
FT                   /translation="MSCMYFSGEESESTTYDDPENRCVRIIPSLYATVQNDNQQNRRVF
FT                   LDTHLLRKRDDADEQ"
FT   gene            complement(<20292..>20414)
FT                   /locus_tag="DEHA2E00396g"
FT                   /old_locus_tag="IPF_43408"
FT   CDS_pept        complement(20292..20414)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00396g"
FT                   /old_locus_tag="IPF_43408"
FT                   /product="DEHA2E00396p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65736"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS4"
FT                   /protein_id="CAR65736.1"
FT                   /translation="MDKLKALITTVSFSNRIQSQYLISMKKLNTNVLNYIPVFS"
FT   gene            complement(<21648..>22118)
FT                   /locus_tag="DEHA2E00418g"
FT                   /old_locus_tag="DEHA0E00418g"
FT                   /old_locus_tag="DEHA-IPF5792"
FT                   /old_locus_tag="DEHA-CDS5956.1"
FT   CDS_pept        complement(21648..22118)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00418g"
FT                   /old_locus_tag="DEHA0E00418g"
FT                   /old_locus_tag="DEHA-IPF5792"
FT                   /old_locus_tag="DEHA-CDS5956.1"
FT                   /product="DEHA2E00418p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR26"
FT                   /protein_id="CAG87523.2"
FT                   /translation="MKFYDIIPINVLKNNGNGAKSMFFSKAYNPSIASREGLSYFVFEI
FT                   SDPSFTLRIFHIPKKISKIMKFVTFLLFFLVSTYASNFPTKQEIANTGDLPRVTILISN
FT                   ISKEAEGYLSGGNGNKMPDELFKTSVVTDEFKQMIQSFGRDNRLDPFAFDFK"
FT   gene            <23679..>25160
FT                   /locus_tag="DEHA2E00440g"
FT                   /old_locus_tag="DEHA0E00440g"
FT                   /old_locus_tag="DEHA-IPF5788"
FT                   /old_locus_tag="DEHA-CDS2393.1"
FT   CDS_pept        23679..25160
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00440g"
FT                   /old_locus_tag="DEHA0E00440g"
FT                   /old_locus_tag="DEHA-IPF5788"
FT                   /old_locus_tag="DEHA-CDS2393.1"
FT                   /product="DEHA2E00440p"
FT                   /note="similar to uniprot|Q8X1X4 Cryptococcus neoformans
FT                   SSC1 Sodium-hydrogen antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87524"
FT                   /db_xref="GOA:Q6BR25"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR25"
FT                   /protein_id="CAG87524.1"
FT                   /translation="MAPTYLPFEEPGAITLLIYSSFLLFLNGLNYILNKFLFCGLVGQI
FT                   LLGVCYGVPGTNWLSKHSQESIMELGYIGLLLMVYEGGLSTSFNVLKANIHIALLVAFT
FT                   GVSLPIALSFSIIGYSNATPVAAFAAGAALSSTSLGASFTVLLTSGFKQSRVGIILTSA
FT                   AVLDDIFGLVMIKIISNLGDGSFNAISVIRPVFVSIALIVIVGVVAKFFMLPFALWFRK
FT                   QKRTFPRILRILLKTKKYYFVLHTIALIGLITGATYAGASNLTAAYVFGAALSWLDETI
FT                   ISVEFESEAKEEKFNFNQGSMTNNLESPITEFSIDINGKEKFENYDQELIFTGSEVFDE
FT                   FYSQVMNKILQPFFFASIGFSIPITQMFIGRLIWKGFIYALVMIVSKFACGLWLIRFKD
FT                   EKNKFSIQNLYPTSMLGLAMVARGEIGFLISSLAEAKGVFSPNSEPKEGSSDIYIIVTW
FT                   AIVLCTFLGPVCVGFLVRRIKKLVSLDKHPLGIWG"
FT   gene            complement(<28017..>28499)
FT                   /pseudo
FT                   /locus_tag="DEHA2E00473g"
FT                   /old_locus_tag="DEHA0E00484g"
FT                   /old_locus_tag="DEHA-IPF5783"
FT                   /old_locus_tag="DEHA-CDS5882.1"
FT                   /note="no similarity"
FT   gene            complement(<29946..>30926)
FT                   /locus_tag="DEHA2E00484g"
FT                   /old_locus_tag="DEHA0E00539g"
FT                   /old_locus_tag="DEHA-IPF5779"
FT                   /old_locus_tag="DEHA-CDS3954.1"
FT   CDS_pept        complement(29946..30926)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00484g"
FT                   /old_locus_tag="DEHA0E00539g"
FT                   /old_locus_tag="DEHA-IPF5779"
FT                   /old_locus_tag="DEHA-CDS3954.1"
FT                   /product="DEHA2E00484p"
FT                   /note="weakly similar to uniprot|Q8ZEZ4 Yersinia pestis
FT                   YP1849 Hypothetical protein YPO2002"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87529"
FT                   /db_xref="GOA:Q6BR22"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR22"
FT                   /protein_id="CAG87529.1"
FT                   /translation="MSFLGHYTTETVTYPSHGENIAGVLYRPNNVSNPPAVVIIGPYSF
FT                   VKEQAPMQYGTRLANQGYAALIFDPRTVGESTGEPRRLENPKMKNEDAIAGIDYLVQRG
FT                   DIDKAKIFLVGVCQGGPESLDIASYDDRVAGVASVSGYYRDLETDIYMICAGCVDWKPG
FT                   ADVATMKMPTPEQGKVLYDARIERAKKARELYDTTGEVVYQPLVDPKVADPNTGSLAGL
FT                   PGPVIWSWYGPWTLKKFDNRYAIMSDLDHFSYSTVEGVARLTKPALIIHGDNCMNHAAA
FT                   RRHFESIPTDRKKLIWNDKSHFQHYDQPDVVDQDVGEIAAWFQII"
FT   gene            <31431..>33566
FT                   /locus_tag="DEHA2E00506g"
FT                   /old_locus_tag="DEHA0E00561g"
FT                   /old_locus_tag="DEHA-IPF5778"
FT                   /old_locus_tag="DEHA-CDS1099.1"
FT   CDS_pept        31431..33566
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00506g"
FT                   /old_locus_tag="DEHA0E00561g"
FT                   /old_locus_tag="DEHA-IPF5778"
FT                   /old_locus_tag="DEHA-CDS1099.1"
FT                   /product="DEHA2E00506p"
FT                   /note="weakly similar to uniprot|P35995 Saccharomyces
FT                   cerevisiae YKL222C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87530"
FT                   /db_xref="GOA:Q6BR21"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR21"
FT                   /protein_id="CAG87530.2"
FT                   /translation="MNRSNCELNSRTKFSYSCGRCRKRKIKCDRQLPYCSSCLEKGETV
FT                   TCKYDSNPWQRELMVYEPGNAQLRKELGILKTTVSSLENMVGNQKAALDEMRRNTTIEQ
FT                   SVRNGLEDQKLKVNMSNFHSLLLKNLRLTYYGPTSYLSLLMNDQYGIKVLAKYAELQEE
FT                   KVLETGGNDLDASVSNHNRIVPVTEDCSRIPEPMQLEMPCLPPYETLIYLVERFFQVCY
FT                   PLAPFLDKDVFMKNISPLSEDRGYSSENISPIKCGILSALLIMLRFAALTLSSESDPTE
FT                   PKITIPSSYIEYSKMLLLSPEGSGRINLDIIQAILLLRTYKTICPEDDSESSDTRVLLG
FT                   IAIDMSVIQGLSLNIRVNSFISKQELYIRRKIWLQLLYDDSFNSFNFGIQPSISEFDTE
FT                   EFSKGLEEGGTVFEVEEEFIIRQLRLKLLGVSIIKKVVLLMNNRKQEISLLHVSTILDD
FT                   FDKLLYREMYNFQELINSDIGFTNSHKSYGVVEFIMRIDLYYKSFMLYYFLFLVWNDEI
FT                   SSGYCKAHFLHLALEKGMILSLLGDYFTKDTTLFFGIEFEKLIGTSIWSSLAKVIPPMI
FT                   CLLCRSLDGEYNLSTAVKSFESSDFDIRSWANIDIMDNTISVKNIVIKYKDLYQKCIQL
FT                   HAKYFITYKVGVCLQFSLDFIQNTYPTLFQDSLLSVNSDFIEEIDKFLDADNYDTFKNF
FT                   IDYDFDYNLFSSFLEEN"
FT   gene            <33625..>35229
FT                   /pseudo
FT                   /locus_tag="DEHA2E00517g"
FT                   /old_locus_tag="DEHA0E00583g"
FT                   /old_locus_tag="DEHA-IPF5775"
FT                   /old_locus_tag="DEHA-CDS8550.1"
FT                   /old_locus_tag="DEHA0E00605g"
FT                   /old_locus_tag="DEHA-IPF5774"
FT                   /old_locus_tag="DEHA-CDS2694.1"
FT                   /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
FT                   YLL055W Hypothetical ORF stop in frame"
FT   gene            <36355..>38091
FT                   /locus_tag="DEHA2E00528g"
FT                   /old_locus_tag="DEHA0E00627g"
FT                   /old_locus_tag="DEHA-IPF5771"
FT                   /old_locus_tag="DEHA-CDS1757.1"
FT   CDS_pept        36355..38091
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00528g"
FT                   /old_locus_tag="DEHA0E00627g"
FT                   /old_locus_tag="DEHA-IPF5771"
FT                   /old_locus_tag="DEHA-CDS1757.1"
FT                   /product="DEHA2E00528p"
FT                   /note="similar to uniprot|P53341 Saccharomyces cerevisiae
FT                   YGR292W MAL12 Maltase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87533"
FT                   /db_xref="GOA:Q6BR20"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR20"
FT                   /protein_id="CAG87533.2"
FT                   /translation="MTVIELNKALKPSWWKETTVYQVYPSSFQDSNGDGIGDLPGITSR
FT                   LDYIKSLGVDAIWLSPCFDSPQVDMGYDISDYKKIYPAYGTMEDADELIKGVHERGLKI
FT                   LMDLVVNHTSDQHPWFKKSRSSIENSYRDWYIWRKPRYDSEGNRQPPNNWAAAFGGSAW
FT                   TFDETTQEYYLHLFAVEQPDLNWENENVRAAVHDIMRFWLDKGADGFRMDVINFISKDQ
FT                   RFPDAEVKHPNAKYQDGSPYFACGPRLHEYLQGIGQILIEYDAFSVGEMPACNDPEEII
FT                   KAVNIDRHELNMIFNFELVDIDHGNEGKFTAGSWKLADAYKIINKWQTFMQENGGWNAI
FT                   YLENHDQPRSVSRFAEDSPEFRKISAKMVSTFLALQQGTLFVYQGQELGLKNVPETWDI
FT                   SNYRDLEVLNHYNELKEDGASPEILKAAMAEYQKKSRDNARYPVQWDTSANAGFSSSTP
FT                   WIDVNEDYLEWNAAEEEKDPESVLNYWRSILKIRKEWKDILIYGRFEMVTSIEDEKVLA
FT                   FKRTTSDKSAIVICNFSSDAVSWTIPEEFENSKVILSNYDRSKVSGPSVELKPYEAFTL
FT                   LK"
FT   gene            complement(<38411..>40159)
FT                   /locus_tag="DEHA2E00550g"
FT                   /old_locus_tag="DEHA0E00649g"
FT                   /old_locus_tag="DEHA-IPF5770"
FT                   /old_locus_tag="DEHA-CDS1735.1"
FT   CDS_pept        complement(38411..40159)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00550g"
FT                   /old_locus_tag="DEHA0E00649g"
FT                   /old_locus_tag="DEHA-IPF5770"
FT                   /old_locus_tag="DEHA-CDS1735.1"
FT                   /product="DEHA2E00550p"
FT                   /note="similar to uniprot|P38156 Saccharomyces cerevisiae
FT                   YBR298C MAL31 Maltose permease high-affinity maltose
FT                   transporter (alpha-glucoside transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87534"
FT                   /db_xref="GOA:Q6BR19"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR19"
FT                   /protein_id="CAG87534.2"
FT                   /translation="MSRLSFIVKNEVEPNIEIENKTKYEQVNFEVDPTADKDINDYIEK
FT                   FLDISDNARNNDKQEKEMSLLEGLKTYPKAAAWSVILSTALVMEGYDTSLMGSLYGMPA
FT                   FAEKFGMFEPSSQSYQIPAKYQTIMGTCGNASSIIGLWFAGILADRFGYRKTIIANLIL
FT                   VAIFIFIVFFAKNIGMLMAGNILLGFPWGAFQTLSVAYASEVCPMVLRIYLTTYSNICW
FT                   IFGQLLSAGVMRAFVTSTSEQSYKVPFAIQWVWPVPIIIGVFFAPESPYWLVKNDKYKE
FT                   AKRSIERLITENKNVDKNILSEAMLQKMQMTVKGEQQEKKLPSYLECFKGVELRRTRIA
FT                   ALTWLTQNLCGATLLSYSSYFYIQAGMAPEMSFTFTIIQFALGIVGTIGSWFLSKRFGR
FT                   FTIYFGGLCALAVILMVIGGLGCSTDKNSMWGVGTLLIIYVMVYDLTVGPLCYCIVAEI
FT                   PSVRLRAKSIIIARNLYNISGIVLSILTPYMLNPGAWDWSAKVGFFWSGFTIVCAVWCF
FT                   FDLPETKGKTFADLDYLFQQNIKSRDFKNTEASVFDAESYIHKLGDDGIKQLVEQNEFA
FT                   NNTGKV"
FT   gene            <42402..>42596
FT                   /locus_tag="DEHA2E00572g"
FT                   /old_locus_tag="DEHA0E00693g"
FT                   /old_locus_tag="DEHA-IPF5768"
FT                   /old_locus_tag="DEHA-CDS8326.1"
FT   CDS_pept        42402..42596
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00572g"
FT                   /old_locus_tag="DEHA0E00693g"
FT                   /old_locus_tag="DEHA-IPF5768"
FT                   /old_locus_tag="DEHA-CDS8326.1"
FT                   /product="DEHA2E00572p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87536"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR17"
FT                   /protein_id="CAG87536.2"
FT                   /translation="MHSSLKELVSSYFIIFSNSSLDCKIALAFYERKNIVSEEFENIYQ
FT                   RPSVSSTGCSKVFSALKES"
FT   gene            <43345..>44967
FT                   /pseudo
FT                   /locus_tag="DEHA2E00583g"
FT                   /old_locus_tag="DEHA0E00715g"
FT                   /old_locus_tag="DEHA-IPF5767"
FT                   /old_locus_tag="DEHA-CDS6091.1"
FT                   /old_locus_tag="DEHA0E00726g"
FT                   /old_locus_tag="DEHA-IPF5766"
FT                   /old_locus_tag="DEHA-CDS4356.1"
FT                   /old_locus_tag="DEHA0E00737g"
FT                   /old_locus_tag="DEHA-"
FT                   /old_locus_tag="IPF5765"
FT                   /old_locus_tag="DEHA-CDS6869.1"
FT                   /note="similar to uniprot|Q92341 Schizosaccharomyces pombe
FT                   str3 Siderophore iron transporter 3 frameshift pseudogene"
FT   gene            <46365..>48023
FT                   /locus_tag="DEHA2E00594g"
FT                   /old_locus_tag="DEHA0E00770g"
FT                   /old_locus_tag="DEHA-IPF5763"
FT                   /old_locus_tag="DEHA-CDS1942.1"
FT   CDS_pept        46365..48023
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00594g"
FT                   /old_locus_tag="DEHA0E00770g"
FT                   /old_locus_tag="DEHA-IPF5763"
FT                   /old_locus_tag="DEHA-CDS1942.1"
FT                   /product="DEHA2E00594p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87541"
FT                   /db_xref="GOA:Q6BR16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR16"
FT                   /protein_id="CAG87541.2"
FT                   /translation="MISFKVSKNNSNSSSSIYSAAISHLEEGKMKGLVEHVETVETGPH
FT                   GKGKLHLRDGDNIDEERVDKDILAYMEDSAIEIDDTTNKRLRSMINKRILPCMIVTYFL
FT                   QALDKGTLSFASIMGIREDAGLVGQQYSWLTTCTYLAVLFWEWPTNWIIQKLPIAKYLA
FT                   FNIIAWGIVLSCHALGKNFAILVVVRTLLGFFECCCQPCFILMSAMWYKRSEQASIIAL
FT                   WYMMNGGQQIVGGLLSYCFSLIDGAALRNWEILFLTYGCITVVWGVFVLWWTPDSPMKA
FT                   KCFSETDKKLMVERVRSNQTGIQNKEFKKYQLYEALSDPQTYCYFFIQFLTSLPTSGLG
FT                   AFANIIISSFGFSVLQTQLLAMVLGAYLIVLLLSSAWLSSRFNQNILFMICYVVPSIIG
FT                   TVVLMTVTYTGMDTDSYEYKLRRGVLLFCYYLTLSFWGVANLGLSLLSRNIAGQTKKSF
FT                   CTALNFVGWAVGNCVGPQVFRDQDSPRYLTAFATHMGCYAALIILLLCMRLWLMKENFR
FT                   KDKLIERGEAVADSKLKHAFEDLTDMENVNFRYAY"
FT   gene            complement(<48357..>49475)
FT                   /locus_tag="DEHA2E00616g"
FT                   /old_locus_tag="DEHA0E00792g"
FT                   /old_locus_tag="DEHA-IPF5762"
FT                   /old_locus_tag="DEHA-CDS3433.1"
FT   CDS_pept        complement(48357..49475)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00616g"
FT                   /old_locus_tag="DEHA0E00792g"
FT                   /old_locus_tag="DEHA-IPF5762"
FT                   /old_locus_tag="DEHA-CDS3433.1"
FT                   /product="DEHA2E00616p"
FT                   /note="similar to uniprot|Q7SH74 Neurospora crassa NCU02654
FT                   Hypothetical protein B16B8.040"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87542"
FT                   /db_xref="GOA:Q6BR15"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR15"
FT                   /protein_id="CAG87542.1"
FT                   /translation="MPAQLHDIEANHVDKLVNTLIQNLISIKDESGKFLMKIPDGRIID
FT                   TKGWITGWEWTHGIGLYGMWHYYELKNDPEILKHIENWFEVQMFGPEGTTSKNINTMAV
FT                   FLPLSYIYERHGTKKYLPYLDAWGEWAMYDLQKTKCGGFQHTTYLTENYDQMWDDTLMM
FT                   TIMPLAKIGLLLDRPYYVEEAKKQVLLHIKYLSDRKTGLWFHGYTFDGNHNFANALWAR
FT                   GNSWVTIVIPEFIELLELRPGDYLRDFLAETLEAQVSKLSEVQDEHSGLWHTLLDDPSS
FT                   YLESSATAGFAYGILKGIRMRILDSKYKSVAIKAIKGVIGQIDEKGELLNTSFGTGMGD
FT                   TLQFYKDISLTSMPYGQAMAIMALVEFSKLYL"
FT   gene            <50582..>51927
FT                   /pseudo
FT                   /locus_tag="DEHA2E00627g"
FT                   /old_locus_tag="DEHA0E00814g"
FT                   /old_locus_tag="DEHA-IPF5758"
FT                   /old_locus_tag="DEHA-CDS6266.1"
FT                   /old_locus_tag="DEHA0E00825g"
FT                   /old_locus_tag="DEHA-IPF5757"
FT                   /old_locus_tag="DEHA-CDS5332.1"
FT                   /old_locus_tag="DEHA0E00847g"
FT                   /old_locus_tag="DEHA-"
FT                   /old_locus_tag="IPF5756"
FT                   /old_locus_tag="DEHA-CDS6391.1"
FT                   /note="weakly similar to uniprot|Q8RJP2 Erwinia
FT                   chrysanthemi rhiE Rhamnogalacturonate lyase precursor
FT                   frameshift pseudogene"
FT   gene            complement(<52253..>54454)
FT                   /locus_tag="DEHA2E00638g"
FT                   /old_locus_tag="DEHA0E00869g"
FT                   /old_locus_tag="DEHA-IPF5755"
FT                   /old_locus_tag="DEHA-CDS1017.1"
FT   CDS_pept        complement(52253..54454)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00638g"
FT                   /old_locus_tag="DEHA0E00869g"
FT                   /old_locus_tag="DEHA-IPF5755"
FT                   /old_locus_tag="DEHA-CDS1017.1"
FT                   /product="DEHA2E00638p"
FT                   /note="weakly similar to uniprot|Q7S2U2 Neurospora crassa
FT                   NCU09033 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87546"
FT                   /db_xref="GOA:Q6BR14"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR14"
FT                   /protein_id="CAG87546.2"
FT                   /translation="MHRLTNSPINKAQLQNQKFLPYDNNVKISRSCDYCKLKKVKCDQT
FT                   KPNCNYCIKHNESCVYSKTRKPGIKPGYGQHVLDKLENIETTLRTESSTTRNEMNLFKQ
FT                   KISELEQKIVTLESKKDFTDTFGTQRIGSNKERLSNGNDSTDNESVRITNAPGKEGIAD
FT                   VKNANTFVDPRSFPTVEQTEKLIEIFFDKVHPIFPILYPVSTIPKLLASMTGSPEPQLY
FT                   GVILCALRFANEMLQEEEIMKYYSYCKSKIISNFIGLGSIEELQAMSLLAFDLFGKSNN
FT                   PETWSVISMISSGAIHLNLTKDNDYQYNSYGISKPCRSQGNKCFSIRNISTTHDPTAWS
FT                   DKESRRNLFWEIYILDKLSSLSNSFPFKIPENEINCLLPARLDLWISGNREGSAGLINL
FT                   VQDRKLAIVNDHIIASDIYDSNCFLIEVMHILGEVHSFMRQSLDVHNEEDVSAWQVKFN
FT                   QLEQKVSTWRKTIPKSFIDLLDNNNCLFKNTFTVKDVLFHALYHTMIIRLNSTPGFPYF
FT                   SSEYFPPSELARSKCLGSASHIVKLSRQFPLMFNNTGGDIYEMCGPQYAFAVWVSARLI
FT                   FVNAVNTHVDIPPELDYLVGLLTKMGSRWEGSLRYANILKFLKDEALLAKKNGSSFYGR
FT                   TKNLQANVDTYNDTDNDDLNEDVKDHSKNVRIISDMRLNAYSLDVLLYNKIEKFKQNEN
FT                   EAASESNENDFMDMFEWFKFPETNFGNNTNTLITSNMTP"
FT   gene            complement(<54761..>55711)
FT                   /locus_tag="DEHA2E00660g"
FT                   /old_locus_tag="DEHA0E00891g"
FT                   /old_locus_tag="DEHA-IPF5753"
FT                   /old_locus_tag="DEHA-CDS4060.1"
FT   CDS_pept        complement(54761..55711)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00660g"
FT                   /old_locus_tag="DEHA0E00891g"
FT                   /old_locus_tag="DEHA-IPF5753"
FT                   /old_locus_tag="DEHA-CDS4060.1"
FT                   /product="DEHA2E00660p"
FT                   /note="similar to uniprot|Q7RX51 Neurospora crassa NCU05037
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87547"
FT                   /db_xref="GOA:Q6BR13"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR13"
FT                   /protein_id="CAG87547.2"
FT                   /translation="MTTGEDTTIPEGIYSPVPTFYKNDANYSLDIETQIKHAKMLYSNG
FT                   INGLVVAGSMGEASHLTRDERSILFKSIREAIPDTNFKIIGGVPPLNIQDTVADIEAAS
FT                   NSRADYSIVLVPGYFGPSLTSQQGIIDYFVAVADKSPLPIIIYNYPGVSNNVDIKTETF
FT                   EKLSLHPKIVGVKLTHFNLDKYTLLTGNTKLNKINNFRSFTGLGQVLVPSLSIGAFGAI
FT                   DGLSGIFPKCMLRIFSLYKDKQYEKAAELQYLVTKVDQMIMDLNLVGVKHALNAVYGFG
FT                   EVLTGRPPLNVKIDIDVWKKHESAFNDLLNVERAL"
FT   gene            complement(<56199..>56540)
FT                   /locus_tag="DEHA2E00682g"
FT                   /old_locus_tag="DEHA0E00913g"
FT                   /old_locus_tag="DEHA-IPF5751"
FT                   /old_locus_tag="DEHA-CDS6930.1"
FT   CDS_pept        complement(56199..56540)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00682g"
FT                   /old_locus_tag="DEHA0E00913g"
FT                   /old_locus_tag="DEHA-IPF5751"
FT                   /old_locus_tag="DEHA-CDS6930.1"
FT                   /product="DEHA2E00682p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87548"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR12"
FT                   /protein_id="CAG87548.1"
FT                   /translation="MNYSEYACMFILSGFSKSKNNNGYDINVPGSKISKFTKWLCENRG
FT                   VNGFLCGNEIVHSRFDYNNCNSKTQTYTRYTIIKRVYILMIFDVSGPMKLCDVFLKLQL
FT                   QGSLFLTLY"
FT   gene            <56850..>59540
FT                   /locus_tag="DEHA2E00704g"
FT                   /old_locus_tag="DEHA0E00935g"
FT                   /old_locus_tag="DEHA-IPF5750"
FT                   /old_locus_tag="DEHA-CDS0615.1"
FT   CDS_pept        56850..59540
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00704g"
FT                   /old_locus_tag="DEHA0E00935g"
FT                   /old_locus_tag="DEHA-IPF5750"
FT                   /old_locus_tag="DEHA-CDS0615.1"
FT                   /product="DEHA2E00704p"
FT                   /note="weakly similar to uniprot|Q12139 Saccharomyces
FT                   cerevisiae YPR022C protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87549"
FT                   /db_xref="GOA:Q6BR11"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR11"
FT                   /protein_id="CAG87549.2"
FT                   /translation="MTEAPQLSHLKNGNQNMPIFCDEPGCNKSFKRTDHLTRHKRNHVS
FT                   KNLFTCTWSGCTKSFVRRDVWSKHMQRHVARQEKQKQDLQNGPIQFLEIYTPNSNFDEV
FT                   ARKRRKSSNISSISKNHDENHSSNDHQWVHIPNHKFQNEQIPLLANSKKSDISESSLSD
FT                   RQKNTEVSCSSDEFQELNSQTNEENIDMEISRTANYRCSTNTDVNSATKNLTNSTVNNA
FT                   KYSENTEGYSNIDNNKRPASMDFGNLICGPETNKDTPTELIHWMLNGHASYSEPFHKYL
FT                   DYSPDSPLKNLLNISSPFPISNYQVDISDTTKSKLVEFIPSLSCNPDFNIRHIKECLGS
FT                   YWNIFHVQYPILHKPSFSTLEAHPLLLLSMISMGASLRSRNNRFDCNSFKNIHKLADEI
FT                   AEPLRWLIFSTSELTAHITPWVIQSLLIVECYENSCSNRRLHQRAYLHHGLKIQLLRRS
FT                   PLLGGNSSRNTNSDDGLTDEVDAWKKWIDIESLKRCAFMAFLIDAIHATIYGHETILFT
FT                   HQIKLSLPCDEILWEMTDFKSNYLPPRTETPKFLNALSKSLHKEKFETGAFNKRILFAG
FT                   LLTTMFGMEQRDIQIKEFEWESVKSSWKETIFGAIEFWFEDMCHGSCCNITTGYYVPSD
FT                   FETLPASLKVDDTTCKLAMYHLSQAFLRVQQYDCIIYAGAPSRMNVRTNYSDYEIVKKR
FT                   IHEWANSYNGRISVVHAYLFISEMLLSSNESRENILLSYDPNEDPILYRPNVVASLLFV
FT                   IWCYNYCLEGPESNTYPNPNQTTSTLTLNSQKTGSNFDMATKLSTKYLPEKVNGYRYIS
FT                   RINASFKSCSIGPVKSTFVDIYAKALDQVMEKNCTVGLLRLFKDKYENCNSQICQEYGK
FT                   LLENCIQRSLGKTDVICDNMYENSS"
FT   gene            complement(<60005..>61669)
FT                   /locus_tag="DEHA2E00726g"
FT                   /old_locus_tag="DEHA0E00957g"
FT                   /old_locus_tag="DEHA-IPF5749"
FT                   /old_locus_tag="DEHA-CDS1929.1"
FT   CDS_pept        complement(60005..61669)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00726g"
FT                   /old_locus_tag="DEHA0E00957g"
FT                   /old_locus_tag="DEHA-IPF5749"
FT                   /old_locus_tag="DEHA-CDS1929.1"
FT                   /product="DEHA2E00726p"
FT                   /note="similar to uniprot|Q871C4 Neurospora crassa B8G12
FT                   Related to hexose transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87550"
FT                   /db_xref="GOA:Q6BR10"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR10"
FT                   /protein_id="CAG87550.2"
FT                   /translation="MKIVIIRDIMDTRLNMSDKDISLENSRNDSVKTPKNVYTLADVTP
FT                   KFEKIWFKYPWLLQLNIFLLGGILAQVTSGYDGSMMNNLQTLPSWRNYFDQPTGSILST
FT                   MANGVTIGTLISIPFTWFVCDYFGRRITIMFGCIVVIIGAAIQGGAVNFGMFTAARVLL
FT                   GIGSCFASAAASPLLAETSYPSQRPVVTALLLASWPFGSFVASVVTWGPYHSSMKYNNW
FT                   SWRIPSILQCAFPAIELLLAFFGPESPRWLIDKGRSDEAEAFFIKYHAGGDSSSPLVSY
FT                   EMAEIKAIIEQEKVQKKSKWSEWFRTKQRLRRLFIVLAVPAMAQLCGNALISYYLQIVL
FT                   TNIGITETNDQLKINIGMTVYGLVWSVGCATFVDKFKRKHTFIGGYILMCITYVVWTIL
FT                   SAINQQGDFENKGLGRGVVAMIYLFSGFYHIVSPVSMTFVMEVCPFHLRAQGATLYQLS
FT                   GNVIGFFNNYVNNIAMQAITWRYYIVWCIWLVVQMNIVYWIFPETKGLGLEEVAQVFGE
FT                   DVTAGYKAGDHALEYGIEEVNKDDVSVEHIEEKVDKN"
FT   gene            complement(<62306..>64189)
FT                   /pseudo
FT                   /locus_tag="DEHA2E00737g"
FT                   /old_locus_tag="DEHA0E00979g"
FT                   /old_locus_tag="DEHA-IPF5748"
FT                   /old_locus_tag="DEHA-CDS4590.1"
FT                   /old_locus_tag="DEHA0E01001g"
FT                   /old_locus_tag="DEHA-IPF5744"
FT                   /old_locus_tag="DEHA-CDS3692.1"
FT                   /note="similar to uniprot|Q92W30 Rhizobium meliloti
FT                   Hypothetical protein RB0515 frameshift"
FT   gene            complement(<64590..>65825)
FT                   /locus_tag="DEHA2E00748g"
FT                   /old_locus_tag="DEHA0E01023g"
FT                   /old_locus_tag="DEHA-IPF5743"
FT                   /old_locus_tag="DEHA-CDS3087.1"
FT   CDS_pept        complement(64590..65825)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00748g"
FT                   /old_locus_tag="DEHA0E01023g"
FT                   /old_locus_tag="DEHA-IPF5743"
FT                   /old_locus_tag="DEHA-CDS3087.1"
FT                   /product="DEHA2E00748p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87553"
FT                   /db_xref="GOA:Q6BR09"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR09"
FT                   /protein_id="CAG87553.1"
FT                   /translation="MAATDAKKKLQQIENKLYGDSTIAKIWGVAVEYLDQSKPPKKTPE
FT                   YSFGRYQFRDIDHWTAGFFPGSLYCLLERCNNYPSRFPTDKVDRTKLEYAARWWAEGLF
FT                   EQAPRRDTHDLGFIIQPAFQREYEYSKSSRSFDCLVTAAEALASRFDETVGCIRSWDSA
FT                   VNKRYNITNKNTDFIVIIDNMCNLDMLYYVASKTGDLRLSTIATTHAEVTLKNHFRDPE
FT                   WSSFHVVNYDLKDGSVKAKITNQGYADETTWSRGQSWAILGFIETYSWTKQRKFLEASV
FT                   GLAKYFVSKLPDDGVPAWDFGAPDKDIKDTSAAMICALGLIKIYEATNDSEYLISGLKL
FT                   VSNTISFAYTNESSFRKDGTVDLGDRDTILANATINNNPDTYERLVNHGLVYADYYFLA
FT                   IGNKLLQLGLIQ"
FT   gene            <66313..>67581
FT                   /locus_tag="DEHA2E00770g"
FT                   /old_locus_tag="DEHA0E01045g"
FT                   /old_locus_tag="DEHA-IPF5741"
FT                   /old_locus_tag="DEHA-CDS2976.1"
FT   CDS_pept        66313..67581
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00770g"
FT                   /old_locus_tag="DEHA0E01045g"
FT                   /old_locus_tag="DEHA-IPF5741"
FT                   /old_locus_tag="DEHA-CDS2976.1"
FT                   /product="DEHA2E00770p"
FT                   /note="weakly similar to uniprot|Q7SD34 Neurospora crassa
FT                   NCU00990"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87554"
FT                   /db_xref="InterPro:IPR039469"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR08"
FT                   /protein_id="CAG87554.1"
FT                   /translation="MSIVNNIELGIDPNGWRINCCSFQQDAILTFGRYQYVSLYVPSYK
FT                   DDPSSSRMTTIGRRKLPDGQWKFLTFRDYYQIKNDGHNIISMGISGDGIIHMAWDMHGD
FT                   GIHYRQSRERLALSETEEDWCISSFGKVLDSLQGHGKEYVFHEITYPRFLTLPCGDILL
FT                   EFRVGRSGLGDEYLYRFSSTTHTWYEVVTPLIQGVGNNAYIHGLDYGTDKKLHMSWTYR
FT                   DFIEDRVGVNDRETSQAGPNGPENNHDLHYVYSPDEGCTWYNGKHEKLNLPINVSSPTL
FT                   AIKIPKHSGIMNQEGQCVDGNGGFHVLGRENGYYFHYYLNPINGQWLRRKINNYIGKLF
FT                   GARGKIVCHNSNPNAIHALIPLDGEKFVILRSQVQDEKNLIYSGSNIDWKILQTFEGLD
FT                   GEPLYDRYRKDNIISILQRVGIH"
FT   gene            complement(<67995..>69527)
FT                   /locus_tag="DEHA2E00792g"
FT                   /old_locus_tag="IPF_5736"
FT   CDS_pept        complement(67995..69527)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00792g"
FT                   /old_locus_tag="IPF_5736"
FT                   /product="DEHA2E00792p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane subject to glucose-induced inactivation strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87558"
FT                   /db_xref="GOA:Q6BR07"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR07"
FT                   /protein_id="CAG87558.1"
FT                   /translation="MISFKMFGTSKIICYGKNLRLLITFCSCTGFLLLGYDQGLMGTII
FT                   GADNRFGRDFNHPDSTVQGLLTSVYDLGCVGGSIICFFIGEKYGRRSMMFCGGLIMIIG
FT                   TIILAASQSRGQFYAGRIITGIGNGFNSSTIPVYQSECALASNRGSMLTWQAVVTIFGV
FT                   VIAYWVGYGTSYTESPFQWRFPVAFQGIFAISLTLETFLLPETPRWLVTKNRKAEATQV
FT                   LAAILDKDVNDRVVIYEKDEIEKAVELEGAGGPFQFKELFGGGDIQNFRRLLLTIGIMI
FT                   MQQFTGSNMINYYAPVVYQSTMKLSRNTSLILAGCTEIVYLAASFFPLWAVERFGRRPL
FT                   LLYSSAGLSFCFIVVSILLSIGTYGCGVGAACFIFIYQIFMGVGWLPVPWFYPSEINVT
FT                   RLRSRNQAIGSAFNWLSVFAVVQITPISINNIGWKTFIIFAILNAVWIPIIYCFYPETK
FT                   GLELEDIDHIFEKPGITRGVFSSRGKPIDPNEKHSYEDSIIEKESIIHIEKV"
FT   gene            <70451..>71206
FT                   /locus_tag="DEHA2E00814g"
FT                   /old_locus_tag="DEHA0E01144g"
FT                   /old_locus_tag="DEHA-IPF5734"
FT                   /old_locus_tag="DEHA-CDS4789.1"
FT   CDS_pept        70451..71206
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00814g"
FT                   /old_locus_tag="DEHA0E01144g"
FT                   /old_locus_tag="DEHA-IPF5734"
FT                   /old_locus_tag="DEHA-CDS4789.1"
FT                   /product="DEHA2E00814p"
FT                   /note="similar to CA3771|CaSOU1 Candida albicans CaSOU1
FT                   Sorbitol utilization protein Sou1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87559"
FT                   /db_xref="GOA:Q6BR06"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR06"
FT                   /protein_id="CAG87559.2"
FT                   /translation="MTLILKGKVALITGGSAGLGAAVARQLAAEGVNLAINYNNSEERA
FT                   SKVAESLASEFGIKTVIIKGDIFDTSVGSKLVSETVNKLGGLDIVISNAGWTKIVPYDD
FT                   LEALDDELWDGCFNVNVKAHFYLFKAAKKIFDQNEDGGTFIVSASVAGRIVYGSSIPYA
FT                   VSKAALIHLVKMLSKTQGPKVRMHAVCPGLLMTEWGQRFSPERIEDTKNMSPINTLADV
FT                   DETAAQFVLLSKLTTTTGSIVSMDGGISI"
FT   gene            complement(<71307..>73154)
FT                   /locus_tag="DEHA2E00836g"
FT                   /old_locus_tag="DEHA0E01166g"
FT                   /old_locus_tag="DEHA-IPF5733"
FT                   /old_locus_tag="DEHA-CDS1898.1"
FT   CDS_pept        complement(71307..73154)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00836g"
FT                   /old_locus_tag="DEHA0E01166g"
FT                   /old_locus_tag="DEHA-IPF5733"
FT                   /old_locus_tag="DEHA-CDS1898.1"
FT                   /product="DEHA2E00836p"
FT                   /note="similar to uniprot|P00175 Saccharomyces cerevisiae
FT                   YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
FT                   oxidoreductase) component of the mitochondrial
FT                   intermembrane space required for lactate utilization"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87560"
FT                   /db_xref="GOA:Q6BR05"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="InterPro:IPR037458"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR05"
FT                   /protein_id="CAG87560.2"
FT                   /translation="MDDVELIICAIEFISPFHSSCAVQKCQSQVGQLSLLKSTISLGRN
FT                   ANFNHFKAKQLSMIGFRSTLLKHKPIGRLSYRSRLRFSTRALKSPFNGERKIKSGVWVP
FT                   SIILLGTITAFISKDDNIALDSKQTQGVTVEELRKHNSASEGIWVALNGQVYDLTDFLV
FT                   QHPGGADIITHYAGCDASLIFNKFHAKDVFSKYLSPENYLGPLIGEMEKAADITEDNDE
FT                   DRLERIENKPPLAAMFNLSDFEYVAKAILPKSAWSYYSGGSDDEVTMRENNNAFLRIFF
FT                   NPKVLIDTADIDMSTEMLGTKTDAPFYCSAAAAAKLGHPDGELSIADGCGSENIIQMIS
FT                   SAASYSFDEISDFAKKSTSQWFQLYVHKDRTSSYEMIDACEKKGIKAIFVTVDTPLFGR
FT                   REKDLRFKVGQTDDDESDETSGGGDDFILSYRDAGLCWDDIDKFKKATNLPIVIKGVQR
FT                   VEDVLLAIEHKVDGVVLSNHGGRQLDFARAPIEVLADVMPVLREKKLENEIEIYVDGGI
FT                   RRGSDVIKALCLGAKGVGLGRSFLYANSAYGKKGVVKACELLKDEIARDMKLLGVSKLE
FT                   DLKPELLDLRSLYSRPIYQSVVGSNYEPLYLPKFKNEDD"
FT   gene            <73674..>73847
FT                   /locus_tag="DEHA2E00858g"
FT                   /old_locus_tag="DEHA0E01188g"
FT                   /old_locus_tag="DEHA-IPF5731"
FT                   /old_locus_tag="DEHA-CDS8586.1"
FT   CDS_pept        73674..73847
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00858g"
FT                   /old_locus_tag="DEHA0E01188g"
FT                   /old_locus_tag="DEHA-IPF5731"
FT                   /old_locus_tag="DEHA-CDS8586.1"
FT                   /product="DEHA2E00858p"
FT                   /note="similar to gnl|GLV|CAGL0K05841g Candida glabrata
FT                   CAGL0K05841g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87561"
FT                   /db_xref="GOA:Q6BR04"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR04"
FT                   /protein_id="CAG87561.1"
FT                   /translation="MTKTTNSSVNKVQKDKHKFVLVEDAKISRSCDFCKSKKVKCDGNK
FT                   PSCNYCLNHGTY"
FT   gene            <73915..>75987
FT                   /locus_tag="DEHA2E00880g"
FT                   /old_locus_tag="DEHA0E01210g"
FT                   /old_locus_tag="DEHA-IPF5730"
FT                   /old_locus_tag="DEHA-CDS1183.1"
FT   CDS_pept        73915..75987
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00880g"
FT                   /old_locus_tag="DEHA0E01210g"
FT                   /old_locus_tag="DEHA-IPF5730"
FT                   /old_locus_tag="DEHA-CDS1183.1"
FT                   /product="DEHA2E00880p"
FT                   /note="weakly similar to wi|NCU09033.1 Neurospora crassa
FT                   NCU09033.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87562"
FT                   /db_xref="GOA:Q6BR03"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR03"
FT                   /protein_id="CAG87562.2"
FT                   /translation="MKKPGLKAGYGQQVFDRMSNLEGSFKKATANSKEEIELLKKRLSL
FT                   FEEKLNSIDSNNVIRNGPNQGGLGSGSNSLSNPVSNPAHSSESSTEFNTFQDSINAYDT
FT                   MLPSIDQIKMLIDIHFEKVNPMFPILCPTNTIPKLLEFSRTTTTPLLLGVILCALRFAG
FT                   SFMLKEEVKKYHSYCKGQIISTCIGMSNIEQLQSMTLLAFDLFGKSNNPETWSFISLIS
FT                   SGVVHLNLTKEKRQTQQIVIPSPDQEDNNKQLESRKRAIKNVKLLKSPIDWFEEESRRR
FT                   LFWEIYILDKLSSVSNSFPFKIPESEIDCLLPVGYNSWIADHNHRNDTTIRNSQHRILN
FT                   DSIINANMQNDLFFDKNIYDSTCFLIELIHFLGKIHAFMRHPIDIQSLKDVLNWQMKFS
FT                   EIDNEIQNWRKTVPKNYLNLLDNDTFDRSLTIKDVLFHALYHATIIRLNSAAGFPYFHS
FT                   NYFLSSEEARLKSLQSANHILNLSRKLPQSFNNDEAIYELCGPQYAFAVWVTARLILVN
FT                   AIHYGNSLPQELDYLINLLSKIGGIWESSMKYSEILSFLRMDEFESTVNDLNFMRSIET
FT                   SHSVNTYDGANDDDDDDDDEESDPNESKTQGQHLSKSARIISDMRLNAYIVDVILSKKI
FT                   EKFKQNENKVSTNSPNNQNDFSNIFEWFKLPIAHEFNVPFMANNEKDAYIEASQQ"
FT   gene            complement(<76281..>77900)
FT                   /locus_tag="DEHA2E00902g"
FT                   /old_locus_tag="DEHA0E01232g"
FT                   /old_locus_tag="DEHA-IPF5729"
FT                   /old_locus_tag="DEHA-CDS2045.1"
FT   CDS_pept        complement(76281..77900)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00902g"
FT                   /old_locus_tag="DEHA0E01232g"
FT                   /old_locus_tag="DEHA-IPF5729"
FT                   /old_locus_tag="DEHA-CDS2045.1"
FT                   /product="DEHA2E00902p"
FT                   /note="weakly similar to uniprot|P53048 Saccharomyces
FT                   cerevisiae YGR289C MAL11 Maltose permease inducible
FT                   high-affinity maltose transporter (alpha-glucoside
FT                   transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87563"
FT                   /db_xref="GOA:Q6BR02"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR02"
FT                   /protein_id="CAG87563.2"
FT                   /translation="MSKLIPSPKISEEKIDQELSQLVEETAVFQQTIEHKYTRYEAIRA
FT                   YPRTCVYILILLWVMILVGYETQAGGMVVSIPTFRRDFGYYFEGDYVLDGKWQSAISGG
FT                   PSGSVVIGGFLGSYMADSIGRKLTLLIAVGATIGFIVLEYVSTTIEVFFAGKFLNALSL
FT                   GIIAAVSTSLIAEITPLALRGLSVAAISLSLSLGPFVCYLIANTTSTRDDRMAYRSLFL
FT                   SQWAFSGTSFIMLFCIPESPYYYVLKNADEKALKQLRKLYKGEALAKHQLTVIKKTVEE
FT                   ARHTTISSSFVDCFRGINLKRTFIAISPFIMQPMSGVAYVGSYSTYFFQLAGYNTHSSF
FT                   QISVGQQALSILGCIASWFILDRFGRRHVMLYGMISLFVLNVITAGLGCSNKESYLTGA
FT                   SAFMTMYNFFYNPSIGPLSYVINAENPSSQLRVKTISIGLAANNGLQCMWQFVLPFMFN
FT                   PDQANMGSKINFIFAACCFISIFCFYFYLPETANRSFDEIDEMYIKKVPARKFRNFISD
FT                   TQIKATEQNDEKKGLEVEHIEA"
FT   gene            <78226..>78816
FT                   /locus_tag="DEHA2E00924g"
FT                   /old_locus_tag="DEHA0E01254g"
FT                   /old_locus_tag="DEHA-IPF5728"
FT                   /old_locus_tag="DEHA-CDS5400.1"
FT   CDS_pept        78226..78816
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00924g"
FT                   /old_locus_tag="DEHA0E01254g"
FT                   /old_locus_tag="DEHA-IPF5728"
FT                   /old_locus_tag="DEHA-CDS5400.1"
FT                   /product="DEHA2E00924p"
FT                   /note="weakly similar to gnl|GLV|YALI0A19250g Yarrowia
FT                   lipolytica YALI0A19250g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87564"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR01"
FT                   /protein_id="CAG87564.1"
FT                   /translation="MSIDACYKFWSSERLAFFLVVRGCDFPNGLTREELEGMVREKAKV
FT                   PILKVPVNETTLRQLIPDQLITWLFFRGYVVTPKAKPMLMVPEENTVPNYKEFLRVANK
FT                   DYKEKISNMDEASALEIKYQLAKILTTKYAFLLEPTEDWNFMEHRYRSKDLDIILELFG
FT                   VYDDDDSKVKCAELLTKQDLAKRSVDFFATGNL"
FT   gene            <79229..>81214
FT                   /locus_tag="DEHA2E00946g"
FT                   /old_locus_tag="DEHA0E01276g"
FT                   /old_locus_tag="DEHA-IPF5727"
FT                   /old_locus_tag="DEHA-CDS1305.1"
FT   CDS_pept        79229..81214
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00946g"
FT                   /old_locus_tag="DEHA0E01276g"
FT                   /old_locus_tag="DEHA-IPF5727"
FT                   /old_locus_tag="DEHA-CDS1305.1"
FT                   /product="DEHA2E00946p"
FT                   /note="weakly similar to uniprot|Q9C1M9 Aspergillus
FT                   aculeatus RhaA Alpha-L-rhamnosidase A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87565"
FT                   /db_xref="GOA:Q6BR00"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BR00"
FT                   /protein_id="CAG87565.2"
FT                   /translation="MVSFSKSVFDATPNNGSWDEYKFSPKQRTVYGKEIYNHEGTIHDV
FT                   EKLLSDDTKESTILYQNSLVTIDFGLNTCGLVSIEFGDSTNDQELNLSYSESRLFIDKY
FT                   TSDRSMDFFIEDGVHCISVKKGVFKTPWVKQRGAFRYLTLWTDKAGSIEIKNVNTHMTC
FT                   MPSLKKDLSNYSGYFYSNDDFVNTIWYAGAYTIQLSTMPSNSGRRHDIVMDNKSWFNDA
FT                   VASFGEEFLADGARRDRSIWSGDRSISVLTEFISFNSNSTINGSEWMLNEQLDNGQYPY
FT                   ACSPISTYGSDSYHLWTLVSLYQNYKLSGCSLEWVKNYWPAWKKAINFSWEKVDETGTL
FT                   CVSEPLDWGRNPLKGHVLSVNCILYHVLMKGSELALSLNDNEIQVQYLDRAKSLKNSIN
FT                   EYLWNENEGLFRDYEGSEIHSQDGNTIAIWFDVASNDKKELISDNLTKRWTKFGAVAPE
FT                   SPGMISPFISSIELFAHTLAGHPDRSFELFKNMWGYIWNSPYSVQSSLIEGYYHDGSCK
FT                   YPFTLYDPSYISHCHPWATGPTVFYSFYHVGLQFISPDHSQWNFIPKGVFSEGSLEFAQ
FT                   TGYTSKSVGFISAGWKKLTSNILELAIKAPKTSTGTIGVPNDKKLLKLELNGTEIDIYK
FT                   YDKNEEHVLVPNIHEGNNTLIATYKD"
FT   gene            <82619..>82849
FT                   /pseudo
FT                   /locus_tag="DEHA2E00957g"
FT                   /old_locus_tag="DEHA0E01298g"
FT                   /old_locus_tag="DEHA-IPF5726"
FT                   /old_locus_tag="DEHA-CDS9023.1"
FT                   /note="no similarity"
FT   gene            <83005..>83355
FT                   /locus_tag="DEHA2E00968g"
FT                   /old_locus_tag="DEHA0E01309g"
FT                   /old_locus_tag="DEHA-IPF5725"
FT                   /old_locus_tag="DEHA-CDS6842.1"
FT   CDS_pept        83005..83355
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00968g"
FT                   /old_locus_tag="DEHA0E01309g"
FT                   /old_locus_tag="DEHA-IPF5725"
FT                   /old_locus_tag="DEHA-CDS6842.1"
FT                   /product="DEHA2E00968p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87567"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS5"
FT                   /protein_id="CAG87567.4"
FT                   /translation="MIVSHTSGWASNDDVYVQAYDIAELMNRTFSDFLAPEGTNTFESQ
FT                   CHYAFPLSGTLGYYSNFVYMGDRYINPSLDNSEYFWAPIKVTNSGVSLMDAHTWKYKNK
FT                   EFTTDGSWNHTT"
FT   gene            complement(<83596..>83853)
FT                   /locus_tag="DEHA2E00990g"
FT                   /old_locus_tag="DEHA0E01331g"
FT                   /old_locus_tag="DEHA-IPF5723"
FT                   /old_locus_tag="DEHA-CDS7566.1"
FT   CDS_pept        complement(83596..83853)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E00990g"
FT                   /old_locus_tag="DEHA0E01331g"
FT                   /old_locus_tag="DEHA-IPF5723"
FT                   /old_locus_tag="DEHA-CDS7566.1"
FT                   /product="DEHA2E00990p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87568"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS0"
FT                   /protein_id="CAG87568.4"
FT                   /translation="MDAIKWKYYIVWCIWLIFQMNIVYWIFPETKGLGLEEVAQVFGED
FT                   VTRGYRAGDEALEYGTDAGLFKPEGSADHTEDKNKEKDLV"
FT   gene            complement(<84031..>84303)
FT                   /locus_tag="DEHA2E01012g"
FT                   /old_locus_tag="DEHA0E01353g"
FT                   /old_locus_tag="DEHA-IPF5721"
FT                   /old_locus_tag="DEHA-CDS7422.1"
FT   CDS_pept        complement(84031..84303)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01012g"
FT                   /old_locus_tag="DEHA0E01353g"
FT                   /old_locus_tag="DEHA-IPF5721"
FT                   /old_locus_tag="DEHA-CDS7422.1"
FT                   /product="DEHA2E01012p"
FT                   /note="some similarities with uniprot|Q871C4 Neurospora
FT                   crassa B8G12 Related to hexose transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87569"
FT                   /db_xref="GOA:W0TYS1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS1"
FT                   /protein_id="CAG87569.4"
FT                   /translation="MAQICGNALISYYLEIVLRNIGTTNSNDQLKIDIGMTVYALCWSI
FT                   LSALNVDKFKRKTMFMGGYILMCISYVGWTILSAINRQSGFKNKG"
FT   gene            complement(<84410..>84837)
FT                   /pseudo
FT                   /locus_tag="DEHA2E01023g"
FT                   /old_locus_tag="DEHA0E01364g"
FT                   /old_locus_tag="DEHA-IPF5720"
FT                   /old_locus_tag="DEHA-CDS8004.1"
FT                   /old_locus_tag="DEHA0E01375g"
FT                   /old_locus_tag="DEHA-IPF5719"
FT                   /old_locus_tag="DEHA-CDS7674.1"
FT                   /note="no similarity"
FT   repeat_region   84938..86749
FT                   /locus_tag="DEHA2E01034t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="relic of a LTR retrotransposon of the Ty3/gypsy
FT                   group"
FT   gene            <87744..>88703
FT                   /locus_tag="DEHA2E01056g"
FT                   /old_locus_tag="DEHA0E01430g"
FT                   /old_locus_tag="DEHA-IPF5716"
FT                   /old_locus_tag="DEHA-CDS4030.1"
FT   CDS_pept        87744..88703
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01056g"
FT                   /old_locus_tag="DEHA0E01430g"
FT                   /old_locus_tag="DEHA-IPF5716"
FT                   /old_locus_tag="DEHA-CDS4030.1"
FT                   /product="DEHA2E01056p"
FT                   /note="similar to uniprot|Q7RX51 Neurospora crassa NCU05037
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87574"
FT                   /db_xref="GOA:Q6BQZ9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ9"
FT                   /protein_id="CAG87574.1"
FT                   /translation="MSAPLPPPPPPPPPSPPLRGIYTPIPTFFKKDLVTIDFNSQVKHA
FT                   KFLKESGITGLVVMGSTGENSHLTRQERFSIISKLHSELPDFTLIGGVAQNSVEDALDE
FT                   IDSVKKAGAKYAVVLPSNYFGASIEQDGIFDWYTEVANKSSLPILIYVYPGVSNNIFID
FT                   PKTIKTLSYNPNIVGTKISHGDVSHHTLIGLDEDIANNNFSCFTGLGQILLPALVVGFK
FT                   GTIDALSGATPKIYIEILNLYNKGELKNAAQLQLVATRGEELVVKFGVIGIKKAILAAT
FT                   GIGETHLGRAPLNQDISEADWNQYSAHLSELISIEMTL"
FT   gene            <88880..>89902
FT                   /locus_tag="DEHA2E01078g"
FT                   /old_locus_tag="DEHA0E01452g"
FT                   /old_locus_tag="DEHA-IPF5715"
FT                   /old_locus_tag="DEHA-CDS3792.1"
FT   CDS_pept        88880..89902
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01078g"
FT                   /old_locus_tag="DEHA0E01452g"
FT                   /old_locus_tag="DEHA-IPF5715"
FT                   /old_locus_tag="DEHA-CDS3792.1"
FT                   /product="DEHA2E01078p"
FT                   /note="similar to uniprot|Q8X0J2 Neurospora crassa B11H24
FT                   Hypothetical protein B11H24.110"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87575"
FT                   /db_xref="GOA:Q6BQZ8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ8"
FT                   /protein_id="CAG87575.2"
FT                   /translation="MPSKKYKIIDSHVHLFAKRNFKLLKFDEAHPLHSDFRLDEYLKYS
FT                   MNEEFQIDGLVFIETDPIADLSKALEGCEYPIQEYLYVARNITGNLLPDEGETSELKQN
FT                   FIKAIVPWAPMPLGKSSVSSYVEMLKSRSSTDEFNLVKGFRYLVQDKLPNTMLQRDFVE
FT                   SLKWLDDNNFIFDWGIDLRCGGLWQFEETIEVLKQVPNLKYVINHLTKPNLSIDPTKIE
FT                   ENDEFLQWKNYMKQIFVNSPNSYMKLSGGFSELPSEIIENRDKCAEYIYPWFKVCFDLW
FT                   NVDRTIWASNWPVCTLTAGEDLTSKWFEVTEMLFDKIELNEESRKKIYGTNYLKAYNLI
FT                   "
FT   gene            complement(<89920..>90684)
FT                   /locus_tag="DEHA2E01100g"
FT                   /old_locus_tag="DEHA0E01474g"
FT                   /old_locus_tag="DEHA-IPF5713"
FT                   /old_locus_tag="DEHA-CDS4756.1"
FT   CDS_pept        complement(89920..90684)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01100g"
FT                   /old_locus_tag="DEHA0E01474g"
FT                   /old_locus_tag="DEHA-IPF5713"
FT                   /old_locus_tag="DEHA-CDS4756.1"
FT                   /product="DEHA2E01100p"
FT                   /note="similar to uniprot|Q5KLC5 Cryptococcus neoformans
FT                   var CNB05760 Glucose 1-dehydrogenase putative"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87576"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ7"
FT                   /protein_id="CAG87576.2"
FT                   /translation="MYGLLEGKTVAITGGVTGIGRAIAIGMAKNGANVVVNHLPNQSEL
FT                   VKSLQEEIGEDKFLGVAGDISKPENCEELIVRTVEKFHEINVFVSNAGICEFKEFTEIE
FT                   PETYYKTIDINLNGAFFSIQAAAKQMKKQGKGGSIIGISSISALVGGAYQAHYTPTKAG
FT                   ILSIIQSTACALGPYGIRCNALLPGTIKTALNGEDLSNDEKKKYMENRIPLTRLGEPED
FT                   MAGPSVFLASDLSKYVNGAQLLVDGGLFVNLQ"
FT   gene            complement(<90958..>92256)
FT                   /locus_tag="DEHA2E01122g"
FT                   /old_locus_tag="DEHA0E01496g"
FT                   /old_locus_tag="DEHA-IPF5711"
FT                   /old_locus_tag="DEHA-CDS2893.1"
FT   CDS_pept        complement(90958..92256)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01122g"
FT                   /old_locus_tag="DEHA0E01496g"
FT                   /old_locus_tag="DEHA-IPF5711"
FT                   /old_locus_tag="DEHA-CDS2893.1"
FT                   /product="DEHA2E01122p"
FT                   /note="similar to uniprot|Q7S2U1 Neurospora crassa NCU09034
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87577"
FT                   /db_xref="GOA:Q6BQZ6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ6"
FT                   /protein_id="CAG87577.2"
FT                   /translation="MSVKEFPKIKSVKTYILNGKGIGGDYHNVERGHWLIDNSISNPMS
FT                   KFPEYRSSRVSWGINVLGSFCVEIEATDGTRGFATGFGGPPACWMVQNHFLRFLEEADP
FT                   RDINILWDKMFRASMFYGRKGITIAVISVIDLALWDLMGKIRNEPVYKLIGGATRDKLE
FT                   FYCTGSKPEAAKEMGFWGGKVALPYGPDEGHKGLQKNVKFLRDHREKVGPDFPLMVDCY
FT                   MSLNVSYAIDLAKATEDLNINWFEEVLHPDDIEGYAQLKRAFPRIKWTTGEHEYTRYGF
FT                   RKLIEGRNIDILQPDVMWVGGLTEILKVAAQAAAYDIPVVPHASGPYSYHFVVSQQNTP
FT                   FQEYLANSPDSTSVLPVFGGLFTDEPVPVNGYLDVSTFDKPGFGLTLNPKIELIDADFL
FT                   LSPAPEKPLKLADGNANGHKNGYSNGKANGTAK"
FT   gene            complement(<92885..>93334)
FT                   /locus_tag="DEHA2E01144g"
FT                   /old_locus_tag="DEHA0E01518g"
FT                   /old_locus_tag="DEHA-IPF5710"
FT                   /old_locus_tag="DEHA-CDS6108.1"
FT   CDS_pept        complement(92885..93334)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01144g"
FT                   /old_locus_tag="DEHA0E01518g"
FT                   /old_locus_tag="DEHA-IPF5710"
FT                   /old_locus_tag="DEHA-CDS6108.1"
FT                   /product="DEHA2E01144p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87578"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ5"
FT                   /protein_id="CAG87578.1"
FT                   /translation="MSTVPESFKAQINQGVPGPVKARPDPLPVGKKIAPNKKAPCSFDT
FT                   SFEEATTKATINGRQNEVATAFEEIEQALSKGEFSQAIRALWYLKLSTFYNEDSANVWA
FT                   YIAFAFAHLGFGEHVGFSLKKLKEAGLDQTVLKQDVMVELKKISK"
FT   gene            complement(<93894..>95531)
FT                   /locus_tag="DEHA2E01166g"
FT                   /old_locus_tag="DEHA0E01540g"
FT                   /old_locus_tag="DEHA-IPF5709"
FT                   /old_locus_tag="DEHA-CDS1998.1"
FT   CDS_pept        complement(93894..95531)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01166g"
FT                   /old_locus_tag="DEHA0E01540g"
FT                   /old_locus_tag="DEHA-IPF5709"
FT                   /old_locus_tag="DEHA-CDS1998.1"
FT                   /product="DEHA2E01166p"
FT                   /note="similar to uniprot|O74713 Candida albicans HGT1
FT                   High- affinity glucose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87579"
FT                   /db_xref="GOA:Q6BQZ4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ4"
FT                   /protein_id="CAG87579.2"
FT                   /translation="MGYEEKLVAPALKLRLFLDKLPNIYNIYVIATISCISGLMFGIDI
FT                   SSMSAFLSNDAYLKYFGTPEPDMQGFITAAMSLGSFFGSLASAFCSEPFGRRASLLLCG
FT                   FFWSVGAAIQSSSQNVAQLIIGRFISGFGIGFGSSVAPVYGSELAPRKIRGLIGGLFQL
FT                   SVTLGILIMFYICYGLGKIQAVGSFRTAWGLQIIPGLILILGCFFIPESPRWLAKQNYW
FT                   EEAEDIVARVQAKGNREDPEVLIEMAEIRDQISTLDKVKSFTYIDLFKKKYLLRTVTAI
FT                   FAQIWQQLTGMNTLMYYIVYVFEMAGYHGDANLVASSIQYCINFAMTIPALYLMDKVGR
FT                   RPVLLTGAALMMAWQFAIGGLLATYAEPTDIFGGNNTVKISIPEDESPAAKAVIACCYL
FT                   FVVSFASTWGVGIWVYCAEVWGDSASRQRGACVATAGNWIFNFAIAMFTPHAFSTITWK
FT                   TYMIFATFCACMFLHVFFFFPETKGKRLEEIGQMWDEHVPAWKSASWQPHVPLVSDNEI
FT                   HGKMDSAHDEHSSRSESTGEKVVADHIA"
FT   gene            complement(<97221..>98878)
FT                   /pseudo
FT                   /locus_tag="DEHA2E01177g"
FT                   /old_locus_tag="DEHA0E01562g"
FT                   /old_locus_tag="DEHA-IPF5706"
FT                   /old_locus_tag="DEHA-CDS4394.1"
FT                   /old_locus_tag="DEHA0E01573g"
FT                   /old_locus_tag="DEHA-IPF5702"
FT                   /old_locus_tag="DEHA-CDS4412.1"
FT                   /note="weakly similar to uniprot|P53388 Saccharomyces
FT                   cerevisiae YPL265W DIP5 Dicarboxylic amino acid permease
FT                   mediates high-affinity and high-capacity transport of
FT                   L-glutamate and L-aspartate"
FT   gene            complement(<99505..>100746)
FT                   /locus_tag="DEHA2E01188g"
FT                   /old_locus_tag="DEHA0E01606g"
FT                   /old_locus_tag="DEHA-IPF5700"
FT                   /old_locus_tag="DEHA-CDS3065.1"
FT   CDS_pept        complement(99505..100746)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01188g"
FT                   /old_locus_tag="DEHA0E01606g"
FT                   /old_locus_tag="DEHA-IPF5700"
FT                   /old_locus_tag="DEHA-CDS3065.1"
FT                   /product="DEHA2E01188p"
FT                   /note="similar to uniprot|Q5KKQ7 Cryptococcus neoformans
FT                   var CNC02180 Sulfonate dioxygenase putative"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87583"
FT                   /db_xref="GOA:Q6BQZ3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ3"
FT                   /protein_id="CAG87583.1"
FT                   /translation="MAPTAEVLRPNSTNFDLEEAVLNIARLNTSSKKRDVRSSYKGGFA
FT                   DSWVEHLPSTTRTRLEKAGIDLSQGYPERPPTEDIPIFLDQAEAIRNSETPYIERGKDA
FT                   DPEKRALFGAAKEVRDLTKHIGTEIIGLQLKDLNDQQKDELALLIAERVVVFFRDQDLS
FT                   PQKQLELGSYWGTVEKHAQQVHVPGLHGITVIWQDLFRRNGLDINFKNAIGQGTSIWHT
FT                   DLTHELQPPGITHLHNDAIPGVGGDTVWSSGYAAYDKLSPAFQKFLEGKNAVYISANKY
FT                   VDRENPLRGSANIEREHPIIRTHPATGWKSLFVNRSMTRRIVGLEPEESKVILEYLFEV
FT                   FEKNLDIQVRFNWKPTIDGLGTSALWDNRVSQHFAIWDHEGKEARHGTRVSSLAEVPYF
FT                   DSESRSQREALGLN"
FT   gene            complement(<101533..>103146)
FT                   /locus_tag="DEHA2E01210g"
FT                   /old_locus_tag="DEHA0E01628g"
FT                   /old_locus_tag="DEHA-IPF5699"
FT                   /old_locus_tag="DEHA-CDS2058.1"
FT   CDS_pept        complement(101533..103146)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01210g"
FT                   /old_locus_tag="DEHA0E01628g"
FT                   /old_locus_tag="DEHA-IPF5699"
FT                   /old_locus_tag="DEHA-CDS2058.1"
FT                   /product="DEHA2E01210p"
FT                   /note="weakly similar to uniprot|P39709 Saccharomyces
FT                   cerevisiae YAL067C SEO1 Putative permease member of the
FT                   allantoate transporter subfamily of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87584"
FT                   /db_xref="GOA:Q6BQZ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQZ2"
FT                   /protein_id="CAG87584.2"
FT                   /translation="MPETAQKSFDIKENDVKNNNYDSVESSPKKTTEIVNERGIAPSDS
FT                   NDDDDTPYIDLSLNLSEEEKFYRKNSKWYKLKLFLWDSVDKHPTEKKFLMKLDFFLISS
FT                   SMLGYFIKQLNASNVKTAYINGMDEYYNMNQNQYNYLNTLWTVGYIIGQIPSNLILHRI
FT                   SARYYLGGLEIIWAILTVLMITCKSLNGLYAIRFFVGLTESGYFPGLEYLVGSWYGKEE
FT                   LSKRSTFFAVAGVASGLVSGPLQSTILNNFSASSLPPFKWMFVFDAVISFPIGIYTMFV
FT                   DPNTPSTTNAWYWTNDDKLVALERRRRIGAQLNTRGKYTWKKVKSFFNTWHIYVFPLVF
FT                   LAYNNSCAAIGQPTFEGWMKLALKEPQEVYNRMPAVISGVGIAVAIIISYFADFIGGKK
FT                   NHYFVFAYFFCLLIGCSLLSGWYIPRGLHWFSYFLVGVPTSWGQPQIFSWVNRLLFEDD
FT                   MKRNFVVVCTNTLAYVTGAFVPIFVWNTNDSPRYFIGFTYTACLSAFGLVMTGIAVHFI
FT                   RRDEKIKERYAIDDLDMVLD"
FT   gene            complement(<103865..>104500)
FT                   /locus_tag="DEHA2E01232g"
FT                   /old_locus_tag="IPF_5697"
FT   CDS_pept        complement(103865..104500)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01232g"
FT                   /old_locus_tag="IPF_5697"
FT                   /product="DEHA2E01232p"
FT                   /note="similar to uniprot|P79022 Candida sp.HN95 MnSOD
FT                   Mn-Superoxide Dismutase protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87585"
FT                   /db_xref="GOA:Q6BQZ1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQZ1"
FT                   /protein_id="CAG87585.1"
FT                   /translation="MSNSPAFGKNKIELPQLDWAYDSLEPYISGKINEIHHKKHHQTYV
FT                   NGYNSAIEQLIEAESQGDVKKAIVIQQNIKFHGGGHTNHVLFWKSLAPNSQNGGKHPGS
FT                   DTNLGKKIIEQYGSIDNLISITNAKLASIQGSGWAFIVKNKQNGGNLDVVTTYNQDTVT
FT                   DPLVPLIAIDAWEHAYYLQYQNVKADYFKAIWNVINWEEASKRFDSHL"
FT   gene            complement(<105212..>105382)
FT                   /locus_tag="DEHA2E01254g"
FT                   /old_locus_tag="DEHA0E01694g"
FT                   /old_locus_tag="DEHA-IPF5694"
FT                   /old_locus_tag="DEHA-CDS8632.1"
FT   CDS_pept        complement(105212..105382)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01254g"
FT                   /old_locus_tag="DEHA0E01694g"
FT                   /old_locus_tag="DEHA-IPF5694"
FT                   /old_locus_tag="DEHA-CDS8632.1"
FT                   /product="DEHA2E01254p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87587"
FT                   /db_xref="InterPro:IPR035237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY9"
FT                   /protein_id="CAG87587.1"
FT                   /translation="MSRDEAIKNNAFHGEMFWNAYGGIGGFCNNDNNDIKIIKTINFIN
FT                   YFLAYNFPYIS"
FT   gene            complement(<106516..>108057)
FT                   /locus_tag="DEHA2E01276g"
FT                   /old_locus_tag="DEHA0E01716g"
FT                   /old_locus_tag="DEHA-IPF5693"
FT                   /old_locus_tag="DEHA-CDS2245.1"
FT   CDS_pept        complement(106516..108057)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01276g"
FT                   /old_locus_tag="DEHA0E01716g"
FT                   /old_locus_tag="DEHA-IPF5693"
FT                   /old_locus_tag="DEHA-CDS2245.1"
FT                   /product="DEHA2E01276p"
FT                   /note="similar to uniprot|P53388 Saccharomyces cerevisiae
FT                   YPL265W DIP5 Dicarboxylic amino acid permease mediates
FT                   high-affinity and high-capacity transport of L-glutamate
FT                   and L-aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87588"
FT                   /db_xref="GOA:Q6BQY8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY8"
FT                   /protein_id="CAG87588.2"
FT                   /translation="MFGKSIESSEKVSDQISITDLEEIKDPVKSHDNLARNFKERHVSM
FT                   LTLASAIGTGLIIGSGTALKRGGTISIFLAYCFTGSLLLVVIFSLAEMASFLPMQKGFS
FT                   GYCTKYVDPAIGFAAGWNYFFKYAIVLSANLTAAGLVVQFWRDDLNVAIWISVLYVLVI
FT                   ASNYFSVRIYGEIEYWLAASKLLVLVIIFIVCIVITCGGTPNHETIGFRFWRETGFLPY
FT                   LVDGKKGQFLGWWACVIQSIFGFVGSEMVGIIFGEAPNPKKTIPKASRQVIFRICFFYI
FT                   FGVFLLGLAVSPKNPLLVNANGTNANASPYVIAIKSSGIKVLPSFINACLLIFISSSAN
FT                   TDLYICSRQIYGLAKDGAAPKIFLKLNRFDVPFIGCSFAAVFGLLAYMNTKESAAEVFG
FT                   YITSTVSVFGIINWIYILVAYIGYHRSIKAQNIGREEIPFRMWFQPYTSYVTLFLIAIV
FT                   TIFNGYSAFIISFHYKLFITSYIGIAVNIFLILGYKIFYKTKLIHPLEVDLNTPY"
FT   gene            complement(<108454..>110091)
FT                   /locus_tag="DEHA2E01298g"
FT                   /old_locus_tag="DEHA0E01738g"
FT                   /old_locus_tag="DEHA-IPF5690"
FT                   /old_locus_tag="DEHA-CDS1997.1"
FT   CDS_pept        complement(108454..110091)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01298g"
FT                   /old_locus_tag="DEHA0E01738g"
FT                   /old_locus_tag="DEHA-IPF5690"
FT                   /old_locus_tag="DEHA-CDS1997.1"
FT                   /product="DEHA2E01298p"
FT                   /note="similar to uniprot|O74713 Candida albicans HGT1
FT                   High- affinity glucose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87589"
FT                   /db_xref="GOA:Q6BQY7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY7"
FT                   /protein_id="CAG87589.1"
FT                   /translation="MGYEDKLLGPALKFRNFLDKFPNIHNVYIVVGISCISGMMFGIDI
FT                   SSMSLFIGDDKYLDYFNSPDSTLQGFITASMSLGSFFGALFSAFISEPFGRRMSLMFCA
FT                   FFWCVGAAIQSSSQNVVQLIIGRFISGFGVGFGSSVAPVYGTELAPRKIRGLIGGLFQL
FT                   SVTLGILVMFYVCYALHYINGVASFRLSWGLQIVPGLLLFIGCFFIPESPRWLAKQGCW
FT                   EEAEYIVAMIQAKGNREDPDVMIEITEIKDQILTEENIKAFTYADLFKRKYLLRTVTAT
FT                   FAQIWQQLTGMNTLMYYIVYVFDMAGYQGDANLIASSIQYVLFFVMTAPSLYLMDKLGR
FT                   RPILLSGAAFMMIWQFAVGGLLSTYAEPTNDVGGNDTVRLRIPADNSTAAKGVIACCYL
FT                   FVVSFAYSWGVCIWMYCAEVWGDSASRQRGACFTTSANWIFNFAIAMFTPSAFKNITWK
FT                   TYMIFATFCGCMFLHVFFFFPETKGKRLEEIGQMWDEGIPAWRTAAWEPSIPFLSDNDL
FT                   REKLEVKHVEDSNSSNSDAEKPSAVHIA"
FT   gene            complement(<110858..>111391)
FT                   /locus_tag="DEHA2E01320g"
FT                   /old_locus_tag="DEHA0E01760g"
FT                   /old_locus_tag="DEHA-IPF5686"
FT                   /old_locus_tag="DEHA-CDS5641.1"
FT   CDS_pept        complement(110858..111391)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01320g"
FT                   /old_locus_tag="DEHA0E01760g"
FT                   /old_locus_tag="DEHA-IPF5686"
FT                   /old_locus_tag="DEHA-CDS5641.1"
FT                   /product="DEHA2E01320p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87590"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY6"
FT                   /protein_id="CAG87590.1"
FT                   /translation="MITMRSFSIVALCAFVCSALACRQFELLIVNYGSDLNYVPITKHK
FT                   EYNELYAGNNTTVDPLGDIVRFTLNDDGTLQNEVGVKVSVIPGDEYNAPFGLSLDKDKD
FT                   PTDGFSISDGRLAFQGNTGFSACPFFARNKYENYLSTNLECSAGTIISLHAVEDIHTAT
FT                   TSTPSPTLLPTSVN"
FT   gene            <115691..>115858
FT                   /locus_tag="DEHA2E01342g"
FT                   /old_locus_tag="DEHA0E01892g"
FT                   /old_locus_tag="DEHA-IPF12694"
FT   CDS_pept        115691..115858
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01342g"
FT                   /old_locus_tag="DEHA0E01892g"
FT                   /old_locus_tag="DEHA-IPF12694"
FT                   /product="DEHA2E01342p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87596"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY5"
FT                   /protein_id="CAG87596.1"
FT                   /translation="MQSCNNQSLKLNFERLFLACLLYYSTIARVATRENILGNNGAYKS
FT                   RKCCEGLFVN"
FT   gene            <116364..>118052
FT                   /locus_tag="DEHA2E01364g"
FT                   /old_locus_tag="DEHA0E01914g"
FT                   /old_locus_tag="DEHA-IPF5677"
FT                   /old_locus_tag="DEHA-CDS1869.1"
FT   CDS_pept        116364..118052
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01364g"
FT                   /old_locus_tag="DEHA0E01914g"
FT                   /old_locus_tag="DEHA-IPF5677"
FT                   /old_locus_tag="DEHA-CDS1869.1"
FT                   /product="DEHA2E01364p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87597"
FT                   /db_xref="GOA:Q6BQY4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY4"
FT                   /protein_id="CAG87597.2"
FT                   /translation="MVLKIWDRTNTFGLRGRSLRLAITVTAVTGFSLFGYDQGLMSGII
FT                   TGDDFSKEFPAVTNEGAGSEHWATVNQGGVVSCYEIGCFFGALFALFRGDRFGRRPMVI
FT                   IGSLLIILGTIISTASFGAHWGLGQFIIGRVITGLGNGMDTATIPVWQSEVSRAENRGF
FT                   LVNLEGSVVAFGTFIAYWLDFGLSYVEGEHASVQWRFPVAFQIFFAAVLFVGIINLPES
FT                   PRWLIAHGYKDEANYVLASLNDVEIDDDLVIAESTVITDGVNRFARSQVGFKELFSGGK
FT                   SQHFSRMVIGASTQFFQQFTGCNASIYYSTVLFERLGMADTYEKLPLVMGGVFSTVYAL
FT                   MTIPSFFLIDRLGRRALFLIGAAGQGLAFTIAFVSLIPEDGDSDGGKKAAAVGIFLFIA
FT                   FFAFTILPLPWVYPPEINPLRTRTVASAISTCTNWLTNFAVVMFTPLFMAESQFGCYLF
FT                   FALFNYLFIPIIFFFYPETAGRTLEEIDIIFAKAYVDKRQPWRVAATLPHLSLQEQEDE
FT                   GNKLGIFDEFDKEGFEQSENISSNSSNKSPEDGSNDEPLVKPAEV"
FT   gene            <118585..>120234
FT                   /locus_tag="DEHA2E01386g"
FT                   /old_locus_tag="DEHA0E01936g"
FT                   /old_locus_tag="DEHA-IPF5676"
FT                   /old_locus_tag="DEHA-CDS1963.1"
FT   CDS_pept        118585..120234
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01386g"
FT                   /old_locus_tag="DEHA0E01936g"
FT                   /old_locus_tag="DEHA-IPF5676"
FT                   /old_locus_tag="DEHA-CDS1963.1"
FT                   /product="DEHA2E01386p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87598"
FT                   /db_xref="GOA:Q6BQY3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY3"
FT                   /protein_id="CAG87598.2"
FT                   /translation="MYKIWSKTNTMGLRGKPLRVAITICCTIGFSLFGYDQGLMSGIIT
FT                   GKQFNEEFPPTHGTDQHATVIQGAVTSCYELGCFFGALFALFQGDKYGRRPMIIVGSSL
FT                   IVIGTVIAVSAFGPQWGLGQFVIGRVITGLGNGMDTATIPVWQSEISKAENRGLLVNLE
FT                   GSMVAVGTFIAYWLDFGLSYVDTSVQWRFPVAFQIVFALFLFLGVAQLPESPRWLIAHG
FT                   LKDEAHYVLATLNDVDIDDEFVIEESAIITDGVNRFARTQIGFKELFSGGKQQNFARMI
FT                   IGASTQFFQQFTGCNASIYYSTVLFENSIGLTGKLPLILGGVFATIYALSTIPSFFLID
FT                   RLGRRALFLIGATGQGISFTITFACLIPDNGQNKETAKGAAVGIFLFIVFFAFTILPLP
FT                   WIYPPEINPLRTRTVATAVSTCTNWLTNFAVVMFTPIFIGASSYGCYLFFAIMNFLFIP
FT                   VIFWFYPETAGRELEEIDIIFAKAYVDNRLPWRVAATLPHLNFKEQEQEGIKLGLYDDF
FT                   EKEAPEHVNTLSDASGSEDGSNEAASVKPAEV"
FT   gene            complement(<120488..>122218)
FT                   /locus_tag="DEHA2E01408g"
FT                   /old_locus_tag="DEHA0E01958g"
FT                   /old_locus_tag="DEHA-IPF5675"
FT                   /old_locus_tag="DEHA-CDS1770.1"
FT   CDS_pept        complement(120488..122218)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01408g"
FT                   /old_locus_tag="DEHA0E01958g"
FT                   /old_locus_tag="DEHA-IPF5675"
FT                   /old_locus_tag="DEHA-CDS1770.1"
FT                   /product="DEHA2E01408p"
FT                   /note="weakly similar to uniprot|Q07959 Saccharomyces
FT                   cerevisiae YLR023C IZH3 membrane protein involved in zinc
FT                   metabolism member of the four-protein IZH family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87599"
FT                   /db_xref="GOA:Q6BQY2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY2"
FT                   /protein_id="CAG87599.2"
FT                   /translation="MSSMSTSDTTTTTLLRNRFDKSIPDQNEKTTEELLIEKLDKFLSS
FT                   IESRLDSFEQYFKVSKGDIDEDLSVPEESDKSRRNSNASLSSIRSFSVNNLNMIYQRLG
FT                   FIKDSVLKSSFTNLENLYNTLDDQYNYLFNSSTPIDDEKIGSNSKEMLSVKIITTIQYF
FT                   DEKLLQVDNLIQDRTIQGTADYKAPTFKHLGFYNFNRALKAAENKYLHYYQLPLRWREN
FT                   RYIVYGYRYSMKHSNMLKSVFKLNHNESMNIWTHLIGFLLFLYICFWHYPGTETFQRNS
FT                   FQDNAAMYTFLAAAVGCLGCSVIFHTYTSFANIATKSNCACVDYTGITVLITASIMSAE
FT                   YCSLYHYPSLLRIYMIFSSICGLTGFTFNWSPYFDKPECRSLRIGFYVGLAFLGFTTII
FT                   CQIFYEGFVSSMKFFFPMVYKSLIWYAIGVIFYGSLFPERWRYDVVIIEDETCNHAHNS
FT                   SDILKGNPENSGNEELEQIENDIKQEAEQYNHYCDEDDCKSIDDEKDLVEEEENKYRDI
FT                   IDKHFPLEPIKTPYNKDFFSLWWVDYCFSSHNIWHICVVLGVIGHYYTIIEMFDKIANL
FT                   "
FT   gene            complement(<122529..>124964)
FT                   /locus_tag="DEHA2E01430g"
FT                   /old_locus_tag="DEHA0E01980g"
FT                   /old_locus_tag="DEHA-IPF5673"
FT                   /old_locus_tag="DEHA-CDS0801.1"
FT   CDS_pept        complement(122529..124964)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01430g"
FT                   /old_locus_tag="DEHA0E01980g"
FT                   /old_locus_tag="DEHA-IPF5673"
FT                   /old_locus_tag="DEHA-CDS0801.1"
FT                   /product="DEHA2E01430p"
FT                   /note="weakly similar to uniprot|P36044 Saccharomyces
FT                   cerevisiae YKL201C MNN4 putative positive regulator of
FT                   mannosylphosphate transferase (Mnn6p) involved in
FT                   mannosylphosphorylation of N-linked oligosaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87600"
FT                   /db_xref="GOA:Q6BQY1"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQY1"
FT                   /protein_id="CAG87600.2"
FT                   /translation="MMVNYSLPRIITSKTTVKWAKFLIAAIVLIHVTYFSIYNFTEYKI
FT                   EDISKVYSSYTSGDDSNQPQQPINNLAEDSNGMTLQRKIKKKFAQIEKDKNRFWLAQTG
FT                   LTETELDVSIKPFLSTYDDENSWKNKNELFYDPRFTLSIYLNEIKQQALSQSGTASTDS
FT                   YGKIDFKTVKPITLPFSWADWMDLRRLNDELNKPMNERITCQYIKDRTNNNPDTSYFCL
FT                   ENEKLTDEKVKELGFKHREQLPGFLIHGHSSHDDRPYNDIRVLESKAYALTHLPKPNRV
FT                   ILLNGDAKGGTFEFMVDQSDNSRLATSNMVTNYLKSNNINPEKVEDDTVLKFDHTEELK
FT                   GLLEKVTPKYLPDEEDKHHMYKILRRQKNPKASREMVLTKEMFHYPPAMISSQINFYEK
FT                   KSDIPLADITRQERMYYDGLKDCANYNDDNEPTYFKMATIRIDDDKNRDHEWGWHYDWR
FT                   FFNGALNYKRNGWSKSELIIRTNIILDRLLRNWNRFAEEKGIITWIMHGPLLSWYWDGL
FT                   MFPFDVDIDIQMPMMELARLAKDYNQTLVLEDPKEGYGKYLIDVGTYIHNRGISKQSNH
FT                   IDARFVDIDSGIYIDITGLSKSKANTPEEYVNNELVNIDKGFHDEQVEIYNDRRKHFYK
FT                   LEQLSPLKYSMMGGVPVYIPSTITDRLIFEYSKGLSSYEFNDWYFVHKINLWLRKEQIA
FT                   DVFDETEIRNNEGNIDKDKLLLRISKMTDAQVLRLLEDDLILVEYYLTKQYTDIHARER
FT                   KYLFDHLGRDNTALKGDKRSKQEYNKLTSTFKMKKPLRKALFDFENIERLKHHIADTD"
FT   gene            complement(<125226..>128138)
FT                   /locus_tag="DEHA2E01452g"
FT                   /old_locus_tag="IPF_5672"
FT   CDS_pept        complement(125226..128138)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01452g"
FT                   /old_locus_tag="IPF_5672"
FT                   /product="DEHA2E01452p"
FT                   /note="similar to uniprot|Q06839 Saccharomyces cerevisiae
FT                   YPR097W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65737"
FT                   /db_xref="GOA:B5RTS5"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR024554"
FT                   /db_xref="InterPro:IPR024555"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS5"
FT                   /protein_id="CAR65737.1"
FT                   /translation="MANTTPEIVIEMNNDIINELNPTQEHFLKKYLLENRLTHELHLLS
FT                   QPNCCQLFGPPFKYTPDQMEEYQFPLLRFFFNSFIGTFPFIVSNKAEDQLSFWQDTVQE
FT                   FLESFNSKDISDSQERQDNTTKRRQINKKMLSSLLLFFNSMLITRQDLEYLHNEHLKPS
FT                   ETGALDKIRKKPSSLENGVSLEDFGGLDEYEKMKFTNDLNLNIVAVKHIKEQNGSGSDS
FT                   AGASRWNIFKEVSRLSPYNSNPVRHNYEFVIQFTKRETDKEGTYHYTSYFIPRPYHDFK
FT                   KLEHDLKKKYPGLMSTDVPKLPQKLKRDDGVLKKRDFESSQSLPRSDSFDTLENDNHDD
FT                   SSFKTASSSNSTSATPEPQSLAREKLRLALRGYLNNLIKHNEIIHSDVFHHFVFNPHLQ
FT                   YGKLSPTEVQDYENRLQHEKAKAETQFEFQKQTANAILELGKNFDEFKQKLIMNPEALT
FT                   EIFEEIGKSPKVENLSPLLKTFVEWSKLEVAATLYQVFLSVDNSSEWLSKCRKFHALFP
FT                   YNIVYGILKFTNPMKMVSRIIDLLLANFPSFSLPSFGFSGSKELSDASKSTKARNLLSL
FT                   MFIMLLDEDLNDFKKELKNLKEEKLSGNMKYEPFLQRIENYVNIVDDSVVEEIKEDSRD
FT                   SGKDLLLTLLSTDSLEPVLNAQDQNTYNDIARSYESYEEIDDKEKLSESELYFNLKQYW
FT                   LILLRKKDKDLMKQLWQEPELTKLIKKFLTIFYQPLMRVFAKCDIHLVFKDFQRFMDDL
FT                   LNELTQLSEGDMYYMSPFEIFERSRAVFDRHENVLWGFIHNLYVKDDEKLFLNIIKWIE
FT                   KFLFMLRIKFTDPQKVTIDLKAAMPQDVDQNILFQQLNQKISKTLQKRAILKHYLNKKA
FT                   QSDEVVNTQDAIDNQWNYVNDGMLPEISGGDFGINDDDIDDFNLLHKESEANADSALDK
FT                   DLHMKLSKLEKELDAFGTSEIDKFDDLLRTHLDDLLTKIQ"
FT   gene            <128377..>130447
FT                   /locus_tag="DEHA2E01474g"
FT                   /old_locus_tag="DEHA0E02024g"
FT                   /old_locus_tag="DEHA-IPF5669"
FT                   /old_locus_tag="DEHA-CDS4335.1"
FT   CDS_pept        join(128377..129189,129653..130447)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01474g"
FT                   /old_locus_tag="DEHA0E02024g"
FT                   /old_locus_tag="DEHA-IPF5669"
FT                   /old_locus_tag="DEHA-CDS4335.1"
FT                   /product="DEHA2E01474p"
FT                   /note="similar to uniprot|P53742 Saccharomyces cerevisiae
FT                   YNR053C NOG2 Putative GTPase that associates with pre-60S
FT                   ribosomal subunits in the nucleolus and is required for
FT                   their nuclear export and maturation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87602"
FT                   /db_xref="GOA:Q6BQX9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR024929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX9"
FT                   /protein_id="CAG87602.2"
FT                   /translation="MGTQKKEKSRRVRQNDVRDGNLRVKGENFYRDSKKVKHLQMYKTG
FT                   RAVRNAKGEIIQAAALQSTDLPTARVDPNRKWFGNTRVIAQDALSHFREAMGDKKNDSY
FT                   QVLLRRNKLPMSLLDEKDQTESPTSKILETETYEQVFGPKQQRKKPRYLAVSNLEELAQ
FT                   LTEEDSKTYEEKQELDSTLGLMGGSILDKDDFTQEAKEAIFHKGQSKRIWNELYKVIDS
FT                   SDVVIHVLDARDPLGTRCQSVEKYIREECSHKHLVYVLNKCDLVPTWVAAAWVKHLSKS
FT                   YPTLAFHASITNSFGKGSLIQLLRQFSSLHSDRKQVSVGFIGYPNTGKSSIINTLRRKK
FT                   VCTVAPIPGETKVWQYITLMKKIFLIDCPGIVPPSSKDTESDILFRGVVRVEHVSNPEQ
FT                   YIPDMLTKCERKHLERTYEIKGWANFEENPELLETASTQFIELIARKGGRLLKGGEPDE
FT                   SGVSKQVLNDFNRGKIPWFVPPPKDEEEKSGEDKKASYKRKRAEREEKKEAKKHKAEAT
FT                   DATDATATDDGQWEGIKD"
FT   gene            complement(<130607..>132109)
FT                   /locus_tag="DEHA2E01496g"
FT                   /old_locus_tag="DEHA0E02068g"
FT                   /old_locus_tag="DEHA-IPF5665"
FT                   /old_locus_tag="DEHA-CDS2334.1"
FT   CDS_pept        complement(130607..132109)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01496g"
FT                   /old_locus_tag="DEHA0E02068g"
FT                   /old_locus_tag="DEHA-IPF5665"
FT                   /old_locus_tag="DEHA-CDS2334.1"
FT                   /product="DEHA2E01496p"
FT                   /note="weakly similar to uniprot|P39008 Saccharomyces
FT                   cerevisiae YNR052C POP2 RNase of the DEDD superfamily
FT                   subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA
FT                   deadenylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87604"
FT                   /db_xref="GOA:Q6BQX7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX7"
FT                   /protein_id="CAG87604.1"
FT                   /translation="MNINPHLQYLQQQQQSQQPMNASVQSPQISQLQLQQQQQLQQQRQ
FT                   QLLNHHLQQQPQQQLGTPNASQVSTNPLLSAINASNQSGGSVNAGAGTSSNQTVNTALQ
FT                   IQLQQQLQQHQQQIFQQQLQGQHNHPVQQQQVPIIKEVWSHNLEQEFHALRSFVNDNKS
FT                   SPVYIAIHQEIPGIVARPVGTFKSSSDYHFQTLRSNSDLLNLIQLSLCVTKVNKNNEIR
FT                   SSIIWQFNFLYDLTKEMYNEEHLTMLSQTSQINFQLHMTQGIPHFAFAELITESGLLLD
FT                   TSINWISYHAGYDLGFLISLLINDNLPLDEKDFYWWCSKYFPNFYDLKLIGNQLVNNFS
FT                   NNNSNSNNSKSNGNSINNGPSNSVEMPTGGSNSDSSKNMISNNKPSIEYLAEELHLLPI
FT                   SPVIRQYFASSNSHFPGQQHQQMTSTLHAYLSMECFKELLRQAGYDNSILEKFKGVIWG
FT                   LGSVYGSSTSEMTQQNGSVSNTTPSTPGTSAKSGVVHFGRPL"
FT   gene            complement(<132415..>133647)
FT                   /locus_tag="DEHA2E01518g"
FT                   /old_locus_tag="DEHA0E02090g"
FT                   /old_locus_tag="DEHA-IPF5664"
FT                   /old_locus_tag="DEHA-CDS3092.1"
FT   CDS_pept        complement(132415..133647)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01518g"
FT                   /old_locus_tag="DEHA0E02090g"
FT                   /old_locus_tag="DEHA-IPF5664"
FT                   /old_locus_tag="DEHA-CDS3092.1"
FT                   /product="DEHA2E01518p"
FT                   /note="similar to uniprot|P25656 Saccharomyces cerevisiae
FT                   YCR094W CDC50 Endosomal protein that regulates cell
FT                   polarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87605"
FT                   /db_xref="GOA:Q6BQX6"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX6"
FT                   /protein_id="CAG87605.1"
FT                   /translation="MNFLRNRRTSDSDDDDNDELNNNNVSSIHKSRKPPNTAFRQQRLK
FT                   AWQPLLTPKSVIPLLLILTVIFAPLGIAIINTVYNVEVLSIDYSHCNSLHSDDFKSVPG
FT                   KYTSHHFKKKNDDPEFQWKVVNSTDKFDDLKQTCLIRFNLPKDIKPPVYLYYKLTNFFQ
FT                   NHRKYVESYDLEQLKGIAVTRGDLSDGCKPLRFIDDKIVYPCGLISNSYFNDTISSPVL
FT                   LNARSGSNNETYELTDEEISWSSDRNHKYKKTKYDPKDIVPPPNWYKMYPDGYTQDNLP
FT                   DLATWEHLQNWMRTAGLATFYKLYGKNETETLSSGTYEISIEMNYPVSIFGGTKTMVIT
FT                   TNSIFGGRNMSLGVIYIIVAVICLVLGIAFLLQHLIKPRRIGDHNFLQNNSAAPRDGPR
FT                   LGNPTNFREQL"
FT   gene            complement(<133865..>135556)
FT                   /locus_tag="DEHA2E01540g"
FT                   /old_locus_tag="DEHA0E02112g"
FT                   /old_locus_tag="DEHA-IPF5662"
FT                   /old_locus_tag="DEHA-CDS1863.1"
FT   CDS_pept        complement(133865..135556)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01540g"
FT                   /old_locus_tag="DEHA0E02112g"
FT                   /old_locus_tag="DEHA-IPF5662"
FT                   /old_locus_tag="DEHA-CDS1863.1"
FT                   /product="DEHA2E01540p"
FT                   /note="weakly similar to uniprot|P53741 Saccharomyces
FT                   cerevisiae YNR051C BRE5 Ubiquitin protease cofactor forms
FT                   deubiquitination complex with Ubp3p that coregulates
FT                   anterograde and retrograde transport between the
FT                   endoplasmic reticulum and Golgi compartments"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87606"
FT                   /db_xref="GOA:Q6BQX5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039539"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX5"
FT                   /protein_id="CAG87606.2"
FT                   /translation="MTTSPATPSTPQLSNQGQALTSDRAASIGWYFIESYYDFYNKSIE
FT                   SIYKLYHSNAFVSHANFPNKNDDSRTLHKASGIEAIKKRFLNDAALKEGNNRIVVTSAD
FT                   IQVCLQDKILIVVFGEWSKNNSPFWQFTQTFLLCPGKNENTFDLANDNLRFVDFEEYKK
FT                   PTKEEIIVDPKEVSKEKSTAVETKGEAIKPVKPQEPKSAAPTSNGELKQEKEKVEDAKK
FT                   ESKDIKKAETNAPEQKQNLHTELKSEISAEPKTELKDEPKTEQKAEPKTEQKVEPKAEQ
FT                   KAEQKAEQKAEQKVEKKVEQKVEQKAEPKVEQKTEPKPEQKPEAKPKQKPEQKPEQKPE
FT                   QKPEVKTQTTTSDSHNETKTESETEQKPEPTNEEFSQASSRPISWAALAAQQPPPSAKP
FT                   SVMSPAKTPATLAVKKTPPMAHTQQTQPPVQPQQPQPTSNGKYKKEDWFPIYIRGVKDI
FT                   DEDKLKNHLTKKFGEIKFFRVFVNIALCDFVEGDAQKKALEAKETEVDGYVIQLEVRES
FT                   KTHTGNKANIKNPKDKVSNGTTNEKRGRNDKKQNSKKNRSSSRNLD"
FT   gene            complement(<135773..>136435)
FT                   /locus_tag="DEHA2E01562g"
FT                   /old_locus_tag="DEHA0E02134g"
FT                   /old_locus_tag="DEHA-IPF5658"
FT                   /old_locus_tag="DEHA-CDS5153.1"
FT   CDS_pept        complement(135773..136435)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01562g"
FT                   /old_locus_tag="DEHA0E02134g"
FT                   /old_locus_tag="DEHA-IPF5658"
FT                   /old_locus_tag="DEHA-CDS5153.1"
FT                   /product="DEHA2E01562p"
FT                   /note="similar to uniprot|P21734 Saccharomyces cerevisiae
FT                   YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
FT                   selective degradation of short-lived and abnormal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87607"
FT                   /db_xref="GOA:Q6BQX4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015368"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX4"
FT                   /protein_id="CAG87607.1"
FT                   /translation="MSRVRRIAKELEECGQDTQSGVSLQLVNETDLTHLSGFFRGPPGT
FT                   PYEGGLFQVDINIPNEYPFKPPQMKFATKIYHPNISSVTGAICLDILKDAWTPILTLKS
FT                   SLISLQSLLQSPEPNDPQDAEVAKHYLTNKKGFEETATYWTKIYASDGDKAGKSDLSDS
FT                   ALYGIDDDIVTQFENMGFPRDKTIEVLRRMGVKSFNGVSNKSDLENKILEELLRECQ"
FT   gene            complement(<137261..>143251)
FT                   /locus_tag="DEHA2E01573g"
FT                   /old_locus_tag="DEHA0E02156g"
FT                   /old_locus_tag="DEHA-IPF5656"
FT                   /old_locus_tag="DEHA-CDS0021.1"
FT   CDS_pept        complement(137261..143251)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01573g"
FT                   /old_locus_tag="DEHA0E02156g"
FT                   /old_locus_tag="DEHA-IPF5656"
FT                   /old_locus_tag="DEHA-CDS0021.1"
FT                   /product="DEHA2E01573p"
FT                   /note="similar to uniprot|P25655 Saccharomyces cerevisiae
FT                   YCR093W CDC39 Component of the CCR4-NOT complex, NOT1
FT                   General negative regulator of transcription subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01573g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87608"
FT                   /db_xref="GOA:Q6BQX3"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR024557"
FT                   /db_xref="InterPro:IPR032191"
FT                   /db_xref="InterPro:IPR032193"
FT                   /db_xref="InterPro:IPR032194"
FT                   /db_xref="InterPro:IPR032195"
FT                   /db_xref="InterPro:IPR038535"
FT                   /db_xref="InterPro:IPR040398"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX3"
FT                   /protein_id="CAG87608.2"
FT                   /translation="MSFKELLLEIGPEHLLPEKLLPSFLQLKPTEIDQSIALILAEILI
FT                   PGSQGLSNTNGGVTGLTLANNLPEANAKGAQLQACLRSIDSDFKFNIDWYKVFSHVQEN
FT                   LFDSSKRNLQPSVANITQLLSSLDFKVGIIDVFLNFDWWFSKTLLYILKTLDPQQGGYD
FT                   VTASKNITLCFDNDDDNDNDNDDNKQPQQRRNILRFVNIGKLELLVLTKVSQQNQQTQN
FT                   QVPEKERKLNIYLSQVFEHDYRVYPEYLIAAALTIVDKNTFIIDLIDTLFTLLMDSNTP
FT                   ALDKVLVKFKELDVQLALNKLIDYYTKRATPEAINKIVKTATKLDLIDELLEKLLPLNF
FT                   KLGLTFAIDATNYGYDCKPIIQANFQDMQQRGPLCQSLLEILEARATQDYERSQQPQIN
FT                   NDLYKVLRIPVVYYLLENLKSSNGLIDADRLKNLQLSLLTTYPRLINFGCGHDEAILAN
FT                   GEEYNLFPPQVEQEMKSYYSKMYNKEMEIKDIVDMLVRMKVSDNPHDQDVFACMIHSLL
FT                   DEYRFFSEYPLTALASTSLLFGALLQKDLIQGTTLTVALNFIWESCNQPQDSHLFKFAV
FT                   QSLYNFKSRLHEYPIYCKHLLECQSLSAHAKMFQIVKDAANGIPCPESSAPSGSQPQSA
FT                   DGTGASTKTPENSAPLYQSITVSDKQIGSIQQEKPAESISDKLLFFVNNMTDDNLASKL
FT                   PEIKDLLTENYFLWFANYLVADRAKAEPNNHKLYATLVETLDNAIFYEYVLNFSLKEAE
FT                   HIIRNFKDSSIERVQLKNLGSWLGKITLANDRPLRRDQIALKFLLVESFDFKSLHLIIP
FT                   FVCRILDQAQYSKIFNLPNPWLLGIIKVLAELYECADLKLNLKFEIEVLLNVFKKKLKD
FT                   IEPSTIVRSHNPNPTALAAMFGIRPETVTLTSDMSRLALDSSEPFAPEGPNVQLQQLQL
FT                   QQQGHAQGVPPALQQARGSIDEVTSAAGGTVPGQNAPTTTQLDTSFSTLIGNTIFTQNP
FT                   NLRRAFQASLSRAVRECAVPILSRVSEAVLTTTEAMIRKDFACEPDVAKFRKGYQNLAY
FT                   QLSHSMVVCSGRKILSETIEATMLQLLGNQINPNELPLAELSLAVQSNVDLCVEIVDKI
FT                   AAGNISELIDEKMQKYILIREKRNPNEPFIEEGTSDYALKLPQPLGLKQDGLNASQLRI
FT                   YETFGTNGPVANTDSNLSGQAPVQAVASTIPEASPAVMGAAVPVGQLTPQQQISLLQQE
FT                   DTTASIDQLFTAITQNCEKAIQLLKDAKETQLAELTPEHPIMIALTHALTIAQSNALKY
FT                   PELLLKAAQYTVNCLFTQGHENPMSNEIYVVVLDKLCEYSPSTAKDVTWWLVHSSDQRK
FT                   FNMPVIFSLLRVQLVQPIKLDASIGRLINESNSPVVAKFAANLLLNVFSSEELRPIALR
FT                   SEFGFTLDALSKYDGDDSTEEHKLAKQARDNLFELLDKSALPSSTATETQPELYGQMGY
FT                   IFAEWIKLLAHGDNSESLQSQFIESLLHNEILTDPDYFEIFFKAATEISVTSFATEHEL
FT                   RTRTQRETYLAVDALAILIVKIVLSFEKEHSYEALEYLKNIIGIVILVLTNDHETFKGS
FT                   WNERAYFRIFSSLLCTWNDASMLDEKATIHLDDQFYPFIGEVFNSLQPIVYPGFTFAWI
FT                   FLVSHRMFLPRLLELPERRGYSIVVKLLTGILKFESIYSKDEFVQHDVINVIFKAINRI
FT                   FTGLAHDYPEFLVECHYQLVTAIPDNYIQLKNIILSATPSNIPVIDPFTQGLKVERLPE
FT                   IHDSPVIAYKPVEDLVKVGLKKPVDNFLRIPAPALMRSIYTGMKLNHPRDSADFGFDTV
FT                   HYNVKLINTLVLHVGISAVADRLPNNRGFNTKSSNVTLLVDLMNHGSSEFKFHLINAIA
FT                   NQLRYPNSHTHWFIGIILHFFSSNSIWGSAATKTTVQELITRVLLERHIVNKPHPWGLT
FT                   IVFTELVKNGDYGFFDLPFVKAAPNELKVVFEALARNVKGGVPLPAQSATQSHPSSLSE
FT                   APAS"
FT   gene            complement(<144482..>146179)
FT                   /locus_tag="DEHA2E01584g"
FT                   /old_locus_tag="DEHA0E02178g"
FT                   /old_locus_tag="DEHA-IPF5655"
FT                   /old_locus_tag="DEHA-CDS1854.1"
FT   CDS_pept        complement(144482..146179)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01584g"
FT                   /old_locus_tag="DEHA0E02178g"
FT                   /old_locus_tag="DEHA-IPF5655"
FT                   /old_locus_tag="DEHA-CDS1854.1"
FT                   /product="DEHA2E01584p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87609"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX2"
FT                   /protein_id="CAG87609.2"
FT                   /translation="MNMSFSVDWESLLEFEESLSSSFSKTNALLLHNLELKIESNRTSS
FT                   NYDLPANDYGIEKLENDMKDYDYCSDEFTTCSNCGQSLYDNSAYKNCCKKFVSFQGVIS
FT                   SSLEKSFWISFINNPSSTINTLPNYTELLFLRQGLPFQLRSTIWKKLFLISQGNVIPET
FT                   SRLVFDNFQHSYSLEISKQISKDLSRTFPLVEFFKNEETINNLSTILNVYANYDVELGY
FT                   CQGLLFLVGVLYYHFKSDSTLTFHALVTIMESEPELHDIFTSTTMSYTLNKWKFEFSAI
FT                   LREIDNELYEHLNKFVDMQVFLYQWWLSFISSHTPDLSIVNRVMDFCLLQGWKTGMFKI
FT                   SLGLLLVNKPILMTLDTGDEEVIYQHLLNESKWGIAVKDLNAFFGDLLLSWDDSIFMEL
FT                   PKYEETLFPKPIKSHKRTSSAMMSKFKNLSINLSRNRSNSSSSQVDRYASSERLSSGYS
FT                   AVSVFSSKSVNRIDNNSELDSIYSDITTNSELSSSPPKSFSEHLKIPYYTKFSKHEQML
FT                   EDNESTDINNGLIDDNIRLKILLKRAYDMINDNEPEASALKCEISQLI"
FT   gene            <146577..>147293
FT                   /locus_tag="DEHA2E01606g"
FT                   /old_locus_tag="DEHA0E02200g"
FT                   /old_locus_tag="DEHA-IPF5653"
FT                   /old_locus_tag="DEHA-CDS4943.1"
FT   CDS_pept        146577..147293
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01606g"
FT                   /old_locus_tag="DEHA0E02200g"
FT                   /old_locus_tag="DEHA-IPF5653"
FT                   /old_locus_tag="DEHA-CDS4943.1"
FT                   /product="DEHA2E01606p"
FT                   /note="weakly similar to uniprot|P40206 Saccharomyces
FT                   cerevisiae YMR132C JLP2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87610"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR039730"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX1"
FT                   /protein_id="CAG87610.1"
FT                   /translation="MVYYFKAEVQSEKGSSEYDDFALGPEEDNAEAVIFMGKDKFENEH
FT                   LLKHSHPKNIWFHVDNHSSAHLYLQLSNEDQLLTFDALKINESVLKQLAQLTKANSIKA
FT                   NKLNNITIIYTPVDNLYTDGSMDAGTVTFHNPKKVKRILVAKKENAIVNKLNRTKYEIT
FT                   TEEFIKNQQALQRQYLTDKKNRERELQNQERELAKQYEDQKKRNTDPYADLFSEQNKDL
FT                   NSNEFRNENWVEEEFW"
FT   gene            complement(<147531..>147779)
FT                   /locus_tag="DEHA2E01628g"
FT                   /old_locus_tag="DEHA0E02222g"
FT                   /old_locus_tag="DEHA-IPF5651"
FT                   /old_locus_tag="DEHA-CDS7748.1"
FT   CDS_pept        complement(147531..147779)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01628g"
FT                   /old_locus_tag="DEHA0E02222g"
FT                   /old_locus_tag="DEHA-IPF5651"
FT                   /old_locus_tag="DEHA-CDS7748.1"
FT                   /product="DEHA2E01628p"
FT                   /note="similar to uniprot|Q01519 Saccharomyces cerevisiae
FT                   YLR038C COX12 Subunit VIb of cytochrome c oxidase which is
FT                   the terminal member of the mitochondrial inner membrane
FT                   electron transport chain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87611"
FT                   /db_xref="GOA:Q6BQX0"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQX0"
FT                   /protein_id="CAG87611.1"
FT                   /translation="MALDPENFKFETPQFDPRFPNQNQTKHCAQAYVDYHKCINAKGEE
FT                   FEPCQIFWKTFTSLCPVDWVDKWNDQREAGKFPINLD"
FT   gene            complement(<148008..>148550)
FT                   /locus_tag="DEHA2E01650g"
FT                   /old_locus_tag="DEHA0E02244g"
FT                   /old_locus_tag="DEHA-IPF5650"
FT                   /old_locus_tag="DEHA-CDS5595.1"
FT   CDS_pept        complement(148008..148550)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01650g"
FT                   /old_locus_tag="DEHA0E02244g"
FT                   /old_locus_tag="DEHA-IPF5650"
FT                   /old_locus_tag="DEHA-CDS5595.1"
FT                   /product="DEHA2E01650p"
FT                   /note="weakly similar to CA0937|IPF19892 Candida albicans
FT                   IPF19892"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87612"
FT                   /db_xref="GOA:Q6BQW9"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW9"
FT                   /protein_id="CAG87612.2"
FT                   /translation="MSANVIETDEDISKDIFEEEKNLFEVESHVLYQKIIGSKEPQTIT
FT                   SKNIAIINKNDSIKTRVTHIINLLQSQTKPVLIAGKSKAISKMLTVSELSKSTIRNDHP
FT                   TIQLKQYNKLTKQSSLNNPNYKQTNRTVKQRNNVDNFMNDASINGHKIYQLPILYILFV
FT                   PKDDSSLELSGWTHQDN"
FT   gene            complement(<148733..>150958)
FT                   /locus_tag="DEHA2E01672g"
FT                   /old_locus_tag="IPF_5649"
FT   CDS_pept        complement(148733..150958)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01672g"
FT                   /old_locus_tag="IPF_5649"
FT                   /product="DEHA2E01672p"
FT                   /note="weakly similar to uniprot|Q03088 Saccharomyces
FT                   cerevisiae YPL032C SVL3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65738"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS6"
FT                   /protein_id="CAR65738.1"
FT                   /translation="MSSDSHLHNRMDNPQTLLIGESSSLEYLTWALAEAKWQVTVVPLN
FT                   GQRAEMQDKWWHLLVETETFAYLPHLSIGDMSQLATVLENTVTIKFDVVVVTYKCYEEL
FT                   QSNVMVLERLIDNRTVFLVDSNEDIWIAAKFRDLFPNNVVLSVYSDADCRSISHNSNCF
FT                   RLMNDLTTIMVGFTSEITEGSSIAAVDGNGPAGETLIRLRNVFNDEHLQGKLVVLPAVY
FT                   HRRLSKIIWKNIVRVICFESLSIIFEEPDILSLAKQINVAPLMKGVFQEILTICNYLKI
FT                   KGLPSPYTESSKKLLQSSILLESNQRMKRTIACTNNREIYPQYLDATKLFYDFSRGIEI
FT                   NITSLLLKLLKVSDEFSIETPFLESTYSFMNRLITIRDGIDNNGNLCPSKLFQAKRISN
FT                   DSKTIREINGIPPNKNMMNFPPFNPPPLPQPPTQSFFNSNPLVFMSEIHSHNNNSNNKK
FT                   SSSNNNNKTHDLKKNGIPNALSCGLGDGPLNNTKSPYDKYYDAEAQINHKQQTETTMSD
FT                   TPCANYPYSQNNTLSQSHHDLPIHGIHNLPPKHQAGINSHAYYMHQNNQYYQSANPNCY
FT                   PHQQYQKPMYQPYNSSLSSFATLANTSQGTNYPNGNVSNEFVNRHGSFNIPKKRQTFFH
FT                   ASIPITRKTSSHKLRQSHASLLDMVQFDNLMDKTTSSRYGVELDTSSTVLNSANNSRGS
FT                   KASSSRTSSKLQSPQIQPAANGHANFNNNIDDGHIRNADPYNGRSRK"
FT   gene            <151437..>152597
FT                   /locus_tag="DEHA2E01694g"
FT                   /old_locus_tag="IPF_5647"
FT   CDS_pept        151437..152597
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01694g"
FT                   /old_locus_tag="IPF_5647"
FT                   /product="DEHA2E01694p"
FT                   /note="similar to uniprot|P43567 Saccharomyces cerevisiae
FT                   YFL030W AGX1 Alanine : glyoxylate aminotransferase
FT                   catalyzes the synthesis of glycine from glyoxylate which is
FT                   one of three pathways for glycine biosynthesis in yeast"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87615"
FT                   /db_xref="GOA:Q6BQW6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW6"
FT                   /protein_id="CAG87615.1"
FT                   /translation="MSSPCPYKQPEHKLTMIPGPIEFSDPVLYAMSTPSQAHTSPEFIK
FT                   TFQTTLQNLRKLFKSTDSKAQPYVLAGSGTLGWDVVGANLVNPGDKVLVLSTGFFSDSF
FT                   ADCLKVYDANVDVITADVGDVLPLDKIAEKLKSEKYTAITITHVDTSTAVVSDIKAISD
FT                   VVKKESPETLIVVDGVCSVGVENLEFDAWGIDFALTASQKAIGVPAGLSIFYASERAVT
FT                   KALDRKKDSSFFASMKKWTPIMKAYESGSGAYFATPAVQTITALKVSLDEILGESLKTR
FT                   FAKHEEISSQFKNHLAKSGLKILPVNDKVAAHGLTAVYFPEGINGADFLGKVAGKGFTI
FT                   AGGIHKALVGKYFRVGHMGFSVYEGHVDKLTKAIDEALAEVGYKKQ"
FT   gene            <152748..>153605
FT                   /locus_tag="DEHA2E01716g"
FT                   /old_locus_tag="IPF_5646"
FT   CDS_pept        152748..153605
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01716g"
FT                   /old_locus_tag="IPF_5646"
FT                   /product="DEHA2E01716p"
FT                   /note="some similarities with uniprot|P39102 Saccharomyces
FT                   cerevisiae YLR090W XDJ1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65739"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS7"
FT                   /protein_id="CAR65739.1"
FT                   /translation="MAIPFPDIEPYDILEVTKSSTPIEIKKSYKRLCLKYHPDKIQQAS
FT                   SIEDREFFPKLQFSYSILSDSIKRQRYDNTGSLGIGEDDIDDEYFNWKDYFDSMNEKIT
FT                   IDMIEEDKLKYQHSTEEKDDILHNFVYYEGDFIKLFEVIPHLDFDEASEGRVFRLIEDA
FT                   INNQDFDAELVQATLKSWEKYKKSRKTKVKQMLKKLAKEAKEAEELEKQIKDKGKRSLK
FT                   NENDLKSLIQSRQSNRMDSLIEKLETKYADKKGKKRKPTEISDDEFERIQNSLGGNKNR
FT                   KTKG"
FT   gene            <154002..>158237
FT                   /locus_tag="DEHA2E01738g"
FT                   /old_locus_tag="DEHA0E02343g"
FT                   /old_locus_tag="DEHA-IPF5644"
FT                   /old_locus_tag="DEHA-CDS0134.1"
FT   CDS_pept        154002..158237
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01738g"
FT                   /old_locus_tag="DEHA0E02343g"
FT                   /old_locus_tag="DEHA-IPF5644"
FT                   /old_locus_tag="DEHA-CDS0134.1"
FT                   /product="DEHA2E01738p"
FT                   /note="similar to uniprot|P06786 Saccharomyces cerevisiae
FT                   YNL088W TOP2 Essential type II topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87617"
FT                   /db_xref="GOA:Q6BQW4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW4"
FT                   /protein_id="CAG87617.2"
FT                   /translation="MSDGSVEFAPTAATKKKSSSKTPLSDSTNTPKVSNGKSSNASDQY
FT                   QKLSQLEHILKRPDTYIGSVERSPIEMWCFDPIAESMVYKEVNIVPGLYKIFDEILVNA
FT                   ADNKIKDPSMKNIKVKIDPENNLIEVMNDGKGIPVEIHDKEKIYIPELIFGNLLTSSNY
FT                   DDDEKKVTGGRNGFGAKLCNIFSTEFILETADLNTGFLYKQTWTNNMSNISKPKITKLK
FT                   SKREYTKVTFKPDLSKFGMTSLDEETLSVLTRRVYDLCGTVNNCNIYLNDKKLNIRNFK
FT                   AYVEMYVKAIKERNPDPEPMDGTIQNYTTIVHEVFNDRWEVAFAVSDGSFNQVSFVNSI
FT                   ATTAGGTHVKHVSDQIITKLIATLAKKEKGKKKLMIKTQEVKNNMFLFVNCLIENPAFT
FT                   SQTKEQLTTKVSQFGGKPSEKIAISEQFINKILKTSIVDKIRSIANANEDKALQKVDGS
FT                   RKSRIKGQVKLVDANRAGTKEGHKCTLILTEGDSALSLAVAGLAVVGRNYYGCFPLRGK
FT                   LLNVREASTDQVSKNVEINALKQIIGLQHKKHYSLENINTLRYGHIMIMTDQDQDGSHI
FT                   KGLIINFLETSFPGLLQVPGFLLEFITPIVKVTVNRRGSGKQVIPFYTMPEFEKWRDTE
FT                   GLTCRWTQKYYKGLGTSTDAEGREYFSALDKHLKTFHALQGDDQQLIDLAFSKKKADDR
FT                   KEWLQGFEPGTHLDPDLEEIPISDFINKELILFSMADNVRSIPSVLDGFKPGQRKVLYG
FT                   CFKRNLKSEIKVNQLAGYVSENTGYHHGEQSLVQTIIGLAQDFIGSNNLNILKPNGSFG
FT                   SRAAGGKDFSAPRYIFTEINEITRKIFNPLDNALYKYVQDDEQTVEPEWYLPVLPMLLV
FT                   NGSEGIGTGWSTNVPPFNPTDIVNNIKKLMNGEEMNEMSPWYRGWEGEIVANGKDRFRV
FT                   IGRIEQTDETEVEITEIPVKTWTNNMKEFLLNGLGTEKVKPWIKDMEEQHGMNIRFVVK
FT                   LSADEMAKSLKVGLLERFNLISSVSLTNMVAFDPMGKIKKYESPLEIMRDFYYVRLEYY
FT                   QRRKDHITDEMQHQLTKLSEQARFIKLIIDKELSISNKKRSVLVDILQKFKFVKFDKNS
FT                   KPVNDSKDPALFVNADELVEEEEEEVGDISQINAGGIPNEDNNEHKPETIYSHYDYLLG
FT                   MTIWSLTRERYEKLLKQKGDKESELNILLSKSAKDLWNEDLDDFLECWQSFLHDDFQKR
FT                   SNIIPAKGTKRKSKRTKAVKKEPGEPPKKKTTTTKKQSTLPVPVKKETSSEFPSFFTES
FT                   KSPTVEEKTKAVASKFDDSDDDEILGLINSRSKSSSKPMTKSSSRPITNSTPEPSTKSR
FT                   SRSPKSSKSSGLRDEIDDLAIENNIQYAQPPTGKRKKKSAVSYKLVSSDDEVEEISDEE
FT                   ESDDEYEED"
FT   gene            complement(<158432..>158665)
FT                   /locus_tag="DEHA2E01760g"
FT                   /old_locus_tag="DEHA0E02365g"
FT                   /old_locus_tag="DEHA-IPF5639"
FT                   /old_locus_tag="DEHA-CDS7898.1"
FT   CDS_pept        complement(158432..158665)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01760g"
FT                   /old_locus_tag="DEHA0E02365g"
FT                   /old_locus_tag="DEHA-IPF5639"
FT                   /old_locus_tag="DEHA-CDS7898.1"
FT                   /product="DEHA2E01760p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87618"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW3"
FT                   /protein_id="CAG87618.2"
FT                   /translation="MSMINIFDAGEPSLGFTNSTCWGQFDVLACLFFVTPFWLRMSCMV
FT                   AGSGMCLSYGLGDLFCNFQVRMNFFMLFCKNL"
FT   gene            <159137..>159829
FT                   /locus_tag="DEHA2E01782g"
FT                   /old_locus_tag="DEHA0E02387g"
FT                   /old_locus_tag="DEHA-IPF5638"
FT                   /old_locus_tag="DEHA-CDS5031.1"
FT   CDS_pept        159137..159829
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01782g"
FT                   /old_locus_tag="DEHA0E02387g"
FT                   /old_locus_tag="DEHA-IPF5638"
FT                   /old_locus_tag="DEHA-CDS5031.1"
FT                   /product="DEHA2E01782p"
FT                   /note="some similarities with uniprot|P11746 Saccharomyces
FT                   cerevisiae YMR043W MCM1 Transcription factor involved in
FT                   cell-type-specific transcription and pheromone response"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW2"
FT                   /protein_id="CAG87619.1"
FT                   /translation="MIYFEANVTTTIPNPSYSMNSNNKYPKSNSIAGLPTNSHSGMDYP
FT                   QPEYTQNQIQQQHQALPHQQLPHQQSHQHLPHQQSNQHSHQQPHQQYRQQGEYNSKFTP
FT                   QDIQVLKQLLITGEKHKWKQITKEINYQAASRKNMVSDQGGFGCSSDDSSTSNSYGGGT
FT                   SPGKLKNVSPTFVIKQYQALLGLPNNSMYFGLAGSSLPYVAGSNGWDDIPNVSGMYGSI
FT                   SDTQNDVE"
FT   gene            complement(<159879..>160286)
FT                   /locus_tag="DEHA2E01804g"
FT                   /old_locus_tag="DEHA0E02409g"
FT                   /old_locus_tag="DEHA-IPF5635"
FT                   /old_locus_tag="DEHA-CDS6390.1"
FT   CDS_pept        complement(159879..160286)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01804g"
FT                   /old_locus_tag="DEHA0E02409g"
FT                   /old_locus_tag="DEHA-IPF5635"
FT                   /old_locus_tag="DEHA-CDS6390.1"
FT                   /product="DEHA2E01804p"
FT                   /note="weakly similar to uniprot|Q6CRW7 Kluyveromyces
FT                   lactis KLLA0D05841g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87620"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW1"
FT                   /protein_id="CAG87620.1"
FT                   /translation="MDAYKFPRVSIEFCAACKWHNRAVWYLQEVMQTFSDPEKNFIPEV
FT                   ALQPVYNNPGLFQVVVIKDANSQPEIIYKRKFKKQGLAQEESYYFDGFPDSKLLKGLLR
FT                   DKLFPQEQLGHIDKYKDVLNDGSCRECKVQE"
FT   gene            complement(<160597..>162507)
FT                   /locus_tag="DEHA2E01826g"
FT                   /old_locus_tag="DEHA0E02431g"
FT                   /old_locus_tag="DEHA-IPF5634"
FT                   /old_locus_tag="DEHA-CDS1889.1"
FT   CDS_pept        complement(160597..162507)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01826g"
FT                   /old_locus_tag="DEHA0E02431g"
FT                   /old_locus_tag="DEHA-IPF5634"
FT                   /old_locus_tag="DEHA-CDS1889.1"
FT                   /product="DEHA2E01826p"
FT                   /note="some similarities with uniprot|P43574 Saccharomyces
FT                   cerevisiae YFL021W GAT1 Transcriptional activator of genes
FT                   involved in nitrogen catabolite repression member of the
FT                   GATA family of DNA binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87621"
FT                   /db_xref="GOA:Q6BQW0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQW0"
FT                   /protein_id="CAG87621.2"
FT                   /translation="MNIDANISQSYNRARHNQGRNRSLTSKFHFNLNDDSTNKRKSENP
FT                   PEKGVTENLWKMYSKARESLPYKERMENLTWRMMYVNNQQDYRKVKEHKSEPDSSFSSS
FT                   EVTSSSVSPDFDEFDYKSHIQKMAQDNTSNSTINSSHNNNSNSTKKRPAEFSPLITSSK
FT                   PYSNLSASLAAVKKQPLESQFESDGAFSFQLDQMAFEGPALNFSESFHSDSQSQTPILG
FT                   GDSRSHTPSLASQGSLIMQMENANNNNNHMSSSFDSHHSSSFPLQTIGPSTILNGFSNG
FT                   HLERQNSSMVSLNEHFRSQSNTPFTNQLNNQNTVNFENTGQNPPYPLVHSNSFITQESP
FT                   GLNSLPKSISQTGQSISTTFDSYDYSTSATSTSYFDSFNKNSFPLNSNSFNQNKRVNTE
FT                   DTFSSSLPTFLHETFPNEPKNSAKKGKMIKSKKKQTRIVSPDFNGPLSRKEDKGPISCT
FT                   NCNTTATPLWRRDPKGKPLCNACGLFLKLHGVVRPLSLKTDVIKKRQRGSNTSSKKSVS
FT                   GPTDGDGDDLDPTPIRKTTPVDVDVSPNDEAVTPNSKTSPVKKPKPTRKKEKIKKEKTF
FT                   KESSVDPNDNFDVDANLDPINELDYNMDYLNHSPNFSIPNFQSHVKTEGEKSDWDWLGM
FT                   A"
FT   gene            complement(<163002..>163154)
FT                   /locus_tag="DEHA2E01848g"
FT                   /old_locus_tag="DEHA0E02453g"
FT                   /old_locus_tag="DEHA-IPF12691"
FT   CDS_pept        complement(163002..163154)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01848g"
FT                   /old_locus_tag="DEHA0E02453g"
FT                   /old_locus_tag="DEHA-IPF12691"
FT                   /product="DEHA2E01848p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87622"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV9"
FT                   /protein_id="CAG87622.1"
FT                   /translation="MFNFRLCPNIALSPANLPDINLIVMPSPHIMTLTGGIDVDYNRMG
FT                   LILFF"
FT   gene            <163195..>164115
FT                   /locus_tag="DEHA2E01870g"
FT                   /old_locus_tag="DEHA0E02475g"
FT                   /old_locus_tag="DEHA-IPF5632"
FT                   /old_locus_tag="DEHA-CDS4166.1"
FT   CDS_pept        163195..164115
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01870g"
FT                   /old_locus_tag="DEHA0E02475g"
FT                   /old_locus_tag="DEHA-IPF5632"
FT                   /old_locus_tag="DEHA-CDS4166.1"
FT                   /product="DEHA2E01870p"
FT                   /note="similar to uniprot|Q04740 Saccharomyces cerevisiae
FT                   YMR234W RNH1 Ribonuclease H1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87623"
FT                   /db_xref="GOA:Q6BQV8"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017067"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV8"
FT                   /protein_id="CAG87623.2"
FT                   /translation="MPYYAVAKGIKPGIYTSWNVCKQNVSGYKGAVFKKFVSVKQAQQF
FT                   IESNSSSTQSSQTSGSQYGPKPSNLSNVAKTVQSSSTRSAIQNAKLEYHKSVPSLKVTL
FT                   GAEFHSRTGKFTSSSNRLETPDIKIQSIYVDGASRGNGKIRMPISGYGVFYSASDKRNG
FT                   AISLNQIDDVHVNKPTNQRAELFAIKHALIDIANEIVECNDKVTTKYEIYSDSQYAQSC
FT                   ITKWCDDWMKNNWKTSQGKPVSNKDIISSVIPILNYINQYYNKHHFGDLQFFHVRGHKG
FT                   DYGNEMADRLANIGADDMEKEINAE"
FT   gene            <164271..>166313
FT                   /locus_tag="DEHA2E01892g"
FT                   /old_locus_tag="DEHA0E02497g"
FT                   /old_locus_tag="DEHA-IPF5631"
FT                   /old_locus_tag="DEHA-CDS1220.1"
FT   CDS_pept        164271..166313
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01892g"
FT                   /old_locus_tag="DEHA0E02497g"
FT                   /old_locus_tag="DEHA-IPF5631"
FT                   /old_locus_tag="DEHA-CDS1220.1"
FT                   /product="DEHA2E01892p"
FT                   /note="weakly similar to uniprot|Q07845 Saccharomyces
FT                   cerevisiae YLL035W GRC3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87624"
FT                   /db_xref="GOA:Q6BQV7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQV7"
FT                   /protein_id="CAG87624.2"
FT                   /translation="MSAYAALQKMSGASSILYGINGESDNDESGTIGYLRNSSDEEVEA
FT                   EEAEVPTTSTMAPTPNIIRTPSIVPKINSFICESNFIPNDDNFIVFHDHIIIGLKANEY
FT                   ILINGQSKMTIQRGAILINTGHYMFAHPNNCIPIIASQSQSLPIISSTQVVDRSGIKDS
FT                   KTDENMHLFSSNYKSIIKLENLYTGLEKIGTYHPPFKRLFYSHAVIEDEDLTEYERLFK
FT                   TYSFEIILRDRGCIGISIEKLWLNQIQLLISDIHEDLIPKTIMIIGNKNSGKSTLSKTL
FT                   LNSLILANQNTVSYLDLDPGQSEFSMPYCLSLTNHSKPIIGMNVPKVSGDEDSVSHYYG
FT                   FTTPQSQPSQYVSIIKALFREYDQVYRPRGHHLIINTPGWIKGYGKELLNELTAFINPN
FT                   QLILLSNNTDNDNMDNSDNLSGLTFQNSRCFQGIYQTSKYSPFQLRMYNKLSYFHQVDT
FT                   LKFDFNSHILLRSPLKLSYETVNSSKDFKGINMVSVLNYDTGLNFELNDLLSMIDTSIM
FT                   GLYLIDHEYYSSLKASLKKSEDCDYLPQYLNSTDYVNLINYSSSNNIFMGLCMVHSINT
FT                   KDEFFNIYLPGHNQHRLTEMITKRDYKMLLVKGDGDIPSPDLLMFDMLLKQQEDLKRLN
FT                   KKRKKNPNVDDKDVLKIPYVTFENKNKIGGIWKTRRNVMRRSHQR"
FT   gene            <166473..>167972
FT                   /locus_tag="DEHA2E01914g"
FT                   /old_locus_tag="DEHA0E02519g"
FT                   /old_locus_tag="DEHA-IPF5630"
FT                   /old_locus_tag="DEHA-CDS2343.1"
FT   CDS_pept        166473..167972
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01914g"
FT                   /old_locus_tag="DEHA0E02519g"
FT                   /old_locus_tag="DEHA-IPF5630"
FT                   /old_locus_tag="DEHA-CDS2343.1"
FT                   /product="DEHA2E01914p"
FT                   /note="weakly similar to uniprot|P43555 Saccharomyces
FT                   cerevisiae YFL048C EMP47 Integral membrane component of
FT                   endoplasmic reticulum-derived COPII-coated vesicles which
FT                   function in ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87625"
FT                   /db_xref="GOA:Q6BQV6"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR016710"
FT                   /db_xref="InterPro:IPR035661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV6"
FT                   /protein_id="CAG87625.2"
FT                   /translation="MIGKSILILFIWLSSIFGVSFAIIPNVGNIDESNSNDQHDEPGHL
FT                   SLPNLLQANSINDLDLTWDVLSNIKLDTGRLVIDKSNGAVWSKAHLANTGDEWTIEMVF
FT                   RSSGTAKNDLAFGDTNGLALWLIDSSNSLPINDRNVDNFGGPSQFDGFQFLINTNEKRG
FT                   LKIFNNDGTKTLKNTIEQSIGDCTFNYLDSSVPFTVRVSYSKSRKWFKVQIDNNLCFKT
FT                   DKIILPDDLNDFMFGITGNISPSSQEVYEILKLNVWSHLTNDAIDDHALMSDGNLKIEY
FT                   KTVTADDPKDTYIPPSRIRESLMERNRKHKEEILRQQRVTHQQGKEDNKIDLLLNDISF
FT                   KLENLELRLSSMDSSVSGDTSYDTKVLGAQLKDITTIQTQQQEALSNLQQSYDQFKTTL
FT                   VHQYTELLQSVSKLNEKVIGEVREHQYSTEELGKKVDLLMSNHKEVAYQYQNGNNEFRN
FT                   NEADLLPSIIRWVLIPVVVGIILLTIVVYRLRHDIKHSKLL"
FT   gene            complement(<168084..>170840)
FT                   /locus_tag="DEHA2E01936g"
FT                   /old_locus_tag="IPF_5629"
FT   CDS_pept        complement(168084..170840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01936g"
FT                   /old_locus_tag="IPF_5629"
FT                   /product="DEHA2E01936p"
FT                   /note="weakly similar to uniprot|P43556 Saccharomyces
FT                   cerevisiae YFL047W RGD2 GTPase-activating protein (RhoGAP)
FT                   for Cdc42p and Rho5p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65740"
FT                   /db_xref="GOA:B5RTS8"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS8"
FT                   /protein_id="CAR65740.1"
FT                   /translation="MSFSDSFWTQDYHSGFRILFDQLHEGVNENDDFIQLFTKRMESEI
FT                   IYGTQLESIEKSSKSNSKRQNNDDYVSSIKNAYQKINENFNKQAGYHLQIGSNIQLLVL
FT                   DPFSKWCKEHKQRVEYSETVLFDKYKAFKSSKTNLEKLQKRYFNRCRMLEEFKSHYTED
FT                   EINEELKDIEFAENVEATEENDEDDGTVYVLGGTKYDNKSVKALLTSILKNIELASHKV
FT                   PILGTYNNVSSGSAITQWLLDNMNELNRNIAKAEIFGQDLVNSGFIRLIGSMSSGKNFI
FT                   NSSQFFYQWKPIVFEITKISELESVISETDSALSRTSSSAAKGSQFADYFEDMKQAMGV
FT                   TSIDYKDKSQLSKLVVNVNSLDDQYYKSTVNLDKIRCELEEIIMDHLTFMQKCELDRLK
FT                   AIKKVTFDFIASFANKVNTMKQICDELLVVEETIHPMNDLKFLIENYATGKFKPQVVLY
FT                   DNYYNSNIKQTFGVDLTVKSRLDRKVVPLIIQCILSHLDKVYPDLVNDQERINLWTMPI
FT                   HLTQVHQLRFQLNDTNDTSKINEILSGTHPMILTNVLKLYFMELPDSVIPHDYYDLIKS
FT                   LYQNYPVSNDDSTVNESRINGLQNLLVDLPKCSLATLDAILTHLSRLIHIIGSKDEELS
FT                   KTLQLKLSKEFANLILRPKLDLLSFDGSNNSSTYINDKHQYTFMNDLFEYKDTIFKELR
FT                   RRNSSRSNNPTRESSTKTTRSASSSGDNIKSRLESKLQKAVHNSKKQNATSDASSKSSL
FT                   SKDDNIAAKSDAVASSMYSNERPAPPSTPPPSTPKKSAPASLKRSTSPNKKKLNTYLKD
FT                   SNGDNSSSNASKNIVSSKATKKDIIVDKDYNNSSDGSRSGSYTDLTQPKFVQGLERKTS
FT                   VKDMASKYDSTTPPPELPEKDNDRRKRQGKNGKDDRDNKEEGVIVVD"
FT   gene            <171355..>172491
FT                   /locus_tag="DEHA2E01958g"
FT                   /old_locus_tag="DEHA0E02585g"
FT                   /old_locus_tag="DEHA-IPF5626"
FT                   /old_locus_tag="DEHA-CDS3601.1"
FT   CDS_pept        171355..172491
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01958g"
FT                   /old_locus_tag="DEHA0E02585g"
FT                   /old_locus_tag="DEHA-IPF5626"
FT                   /old_locus_tag="DEHA-CDS3601.1"
FT                   /product="DEHA2E01958p"
FT                   /note="weakly similar to Candida albicans CA4702 IPF4213"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87628"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV3"
FT                   /protein_id="CAG87628.2"
FT                   /translation="MEYISSIKTFFIYKREGYNREMSYSKEMGKPPQTPPRKGSSIEEY
FT                   DTEFRGVNSQQEFVNALSTPVTESRKSIKILKTSSETINNTDQEDEGSMEIPMTPDFTP
FT                   QKRKRNRKYSKGSISKSIHATPRSTRPTEAVSPSSPGTGGSKTNRYSSTKRIRPISLGL
FT                   QLSLAQEESSSEETGTETNYGSQPIPHTEHIRIEEQMATPKGKIIDESLVNAWHGKSLN
FT                   NDFSSDDELSDYENMMLKNDILENNGNRIAKTNRQQIHNPFGSAPFNLNTKTNIHTSPA
FT                   VDYSTHAEYYNNKTGERIIRELTEDEKRIKPKKLNFRSTPGDNDQIINEARQSSIDDSG
FT                   NQEKSVGDKFLLNNLNRFMVDSKPKSSLGFEIFKDDGN"
FT   gene            complement(<172537..>174677)
FT                   /locus_tag="DEHA2E01980g"
FT                   /old_locus_tag="DEHA0E02629g"
FT                   /old_locus_tag="DEHA-IPF5624"
FT                   /old_locus_tag="DEHA-CDS7362.1"
FT   CDS_pept        complement(join(172537..174342,174414..174677))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E01980g"
FT                   /old_locus_tag="DEHA0E02629g"
FT                   /old_locus_tag="DEHA-IPF5624"
FT                   /old_locus_tag="DEHA-CDS7362.1"
FT                   /product="DEHA2E01980p"
FT                   /note="similar to Candida albicans CA5094 IPF1387"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87630"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV1"
FT                   /protein_id="CAG87630.2"
FT                   /translation="MLTITYGSRPNRRGVVLSFFLKRKQYPTRRGVSPVSIIAPNDFLG
FT                   TWSLLGSGLTVGKGGTRNVNHEKQPNGRPAERYISRRPSWLYANRSTTMVSIQEPVDVI
FT                   YVTSNVEVPTGTFKRVKVAICSPTGDDCTASLNSFKVPVFLLNETYRVLVKDVAKIWNY
FT                   PSSYQLIKHLVKGTGTNKGEFLYTTDCTINEWLLEKSLIDESELKYKLFYIDAQFLYSV
FT                   VSNKEVLVGDDISVDDDEDNIGVNRRVVGSGDDKITISQVFPQYGLVDFSSQLNHSSFN
FT                   TLTNLTKFNYYMSTPVYQKFLGNSKLFVNERELICREYDYSLIEVLEHERTNENQVKEK
FT                   RRKGKPIGRSKKHNTNVDPNTIDLTESIIPGQGYIQEFNVNHFCKVPNYFVTTNTPNAG
FT                   LSASILKDMKKPIGSSSGSSLLFGDNVKLAKNVQQLVFTNESDNYNHAKYYYTKSYRGP
FT                   GSGNYKDAALISKMNKIPMASNSKSIKTPHKVTKDISKLNNKRYNANVKGLMHDRFNKP
FT                   LVESILNKQREDIDDCVNLEMLHNNLQFNLLLNTYREMADETWTNYYKFKLVDFEQLSV
FT                   DKKQKVEEKAKQESLEPQAQVPGAEFKPPMQNFTLADKFVHPSAHKEILSNLPVELRDE
FT                   DSNNNDSRSIKNPLYYTATYPDVNNPELLNKVEVVKLPNANAIGWDNMRKYKRD"
FT   gene            <175035..>175580
FT                   /locus_tag="DEHA2E02002g"
FT                   /old_locus_tag="DEHA0E02651g"
FT                   /old_locus_tag="DEHA-IPF5623"
FT                   /old_locus_tag="DEHA-CDS5589.1"
FT   CDS_pept        175035..175580
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02002g"
FT                   /old_locus_tag="DEHA0E02651g"
FT                   /old_locus_tag="DEHA-IPF5623"
FT                   /old_locus_tag="DEHA-CDS5589.1"
FT                   /product="DEHA2E02002p"
FT                   /note="highly similar to uniprot|P19146 Saccharomyces
FT                   cerevisiae YDL137W ARF2 ADP-ribosylation factor GTPase of
FT                   the Ras superfamily involved in regulation of coated
FT                   formation vesicles in intracellular trafficking within the
FT                   Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87631"
FT                   /db_xref="GOA:Q6BQV0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQV0"
FT                   /protein_id="CAG87631.1"
FT                   /translation="MGLSFSKLFSGLFGRKEMRILMVGLDAAGKTTILYKLKLGEIVTT
FT                   IPTIGFNVETVDYKNISFTVWDVGGQDKIRPLWRYYFQNTQGIIFVVDSNDRDRIAEAR
FT                   EELQQMLNEDELRDALLLVLANKQDLPNAMNAAEITEKLGLHSIRQRPWYIQATCATSG
FT                   DGLYEGLEWLSTNLKNSA"
FT   gene            <176499..>177329
FT                   /locus_tag="DEHA2E02024g"
FT                   /old_locus_tag="IPF_5621"
FT   CDS_pept        176499..177329
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02024g"
FT                   /old_locus_tag="IPF_5621"
FT                   /product="DEHA2E02024p"
FT                   /note="similar to uniprot|Q05871 Saccharomyces cerevisiae
FT                   YLR284C ECI1 Peroxisomal delta3 delta2-enoyl-CoA isomerase
FT                   hexameric protein that converts 3-hexenoyl-CoA to
FT                   trans-2-hexenoyl-CoA essential for the beta-oxidation of
FT                   unsaturated fatty acids oleate-induced"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87632"
FT                   /db_xref="GOA:Q6BQU9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU9"
FT                   /protein_id="CAG87632.1"
FT                   /translation="MSEGEDILYEVREKVTIITFNIPKKLNALNGDQYLLLAKLVERAD
FT                   REEDTVMTLIQSTGRYFSAGANIADKGLSNVDPEHLFSHEYWLDKFVARNVYLTDLFHN
FT                   HTKILAAAVNGPVIGLSAAMLALCDLVYVMDETKFFLLAPFSNLGLVAEGAASATLFLR
FT                   LGWSKSAEALLLARPIPGTELNKLGFINKNYGDVKFDSVEQFNKRVHDDLVSQFQGLYE
FT                   PSIFANKQLLKANRDQLINSANSREVIKGFNRWVKGVPQERFMKLYQKDIQHKM"
FT   gene            <177502..>179967
FT                   /locus_tag="DEHA2E02046g"
FT                   /old_locus_tag="DEHA0E02695g"
FT                   /old_locus_tag="DEHA-IPF5620"
FT                   /old_locus_tag="DEHA-CDS0777.1"
FT   CDS_pept        177502..179967
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02046g"
FT                   /old_locus_tag="DEHA0E02695g"
FT                   /old_locus_tag="DEHA-IPF5620"
FT                   /old_locus_tag="DEHA-CDS0777.1"
FT                   /product="DEHA2E02046p"
FT                   /note="weakly similar to uniprot|P38742 Saccharomyces
FT                   cerevisiae YHL023C RMD11 Protein required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87633"
FT                   /db_xref="GOA:Q6BQU8"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQU8"
FT                   /protein_id="CAG87633.2"
FT                   /translation="MSLNLPNPSILGILLVVSTHSGPQLVFQYPPDLSNDSKKSSNLKR
FT                   TNKTSTLQRKDSDSDELDIDDDDYIADNENDEEFVNADNDEEKEWDSRKMNYYLGTKSD
FT                   LLSFLDEQEKFRQTSQERNKIYGHKQSDSHIDPDEIKSLHRNSKSGSSDKQIESPKLEA
FT                   SNSNNLKKTISSISDSQKSSTSKASTSGIPPVSPITSSTILGFEADYLCEMLCPPKQMC
FT                   NSRFEIMIDDLVFLGLPIHSYDNGSWKSKHSHRPKSGKSSKGRSKNAADNASIDEGIDY
FT                   ETTSKSQSKNSMSMFHLVFIMNPPIIECNYRIDEMFHYVISRLSLVLRYEQSKHEYVWN
FT                   QIRMIYNLKEEFRNQATMANLTKYLTDKSSLCKLISECFTQISRSNIANLSINNKLRSF
FT                   QIPIKTEFHSLPDSTVPYLPGSHLSSTVNMLANTGLISVGETIRYDVNNLNSGGLDDFD
FT                   DIDDNKSDSNADDIIYYALLLLDDPETIIRDIKAQQQSTLANFIRMIKPTESLLKLANK
FT                   LKQQASDNGFSLDAGQIKSFAFHLIYWRRARVILPISTRSVYIVSPMAPITLKFHHDIF
FT                   IFKKTFPALPSLPHFLKLLSNSSKPRQLATVIPSKDHRDAYLNALSWLIRYGYVTQLHT
FT                   FIWLKISRKIKMKVEEDLENEGANNKRKKPSATADPNISNKLNAGTDNTSKTESNPEDI
FT                   QRKMSQLRMINRNNNGNPTSYEQEIDNIEKKLLSPSIGLNLVLEDEGDTIIIDPGRASS
FT                   LERRWINKVISEECNLSPELTVKFYELLKYMNGKNSLELLLLKENVSRQELRTLLFAIE
FT                   DHIISVRHW"
FT   gene            complement(<180059..>187360)
FT                   /locus_tag="DEHA2E02068g"
FT                   /old_locus_tag="DEHA0E02717g"
FT                   /old_locus_tag="DEHA-IPF5618"
FT                   /old_locus_tag="DEHA-CDS0014.1"
FT   CDS_pept        complement(180059..187360)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02068g"
FT                   /old_locus_tag="DEHA0E02717g"
FT                   /old_locus_tag="DEHA-IPF5618"
FT                   /old_locus_tag="DEHA-CDS0014.1"
FT                   /product="DEHA2E02068p"
FT                   /note="similar to uniprot|P33334 Saccharomyces cerevisiae
FT                   YHR165C PRP8 Component of the U4/U6-U5 snRNP complex
FT                   involved in the second catalytic step of splicing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87634"
FT                   /db_xref="GOA:Q6BQU7"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU7"
FT                   /protein_id="CAG87634.2"
FT                   /translation="MGPKVPPPPPPPGGQDKHPNNINYNKPKNNVNRKTSHNPPPPPPP
FT                   GMNNSKVRPPPPPPNPATSDSRIRRQPPPPPPPGIASGKGSMRSSSAIVTKDELQARKK
FT                   RWLQIQKNRYSATGKTNNKKSGGLVHATKVDMPPEHLRKIMFDHGDLSSKTFASDKRSH
FT                   LGSLKYVPHAILKLLENMPQPWEQTKDVKVLYHITGAITFVNEIPRVIEPVYTAQWATA
FT                   WLMMRREKRDRKHFKRMRFPPFDDEEPPLDWMENIEDVEPLDGIQLELDGMKDRAVIDW
FT                   FYDEKPLIDDLKVVNGESYKTWNLDLQTMANLYKLSTPLLPDVTDPNYYYLFDKASFFT
FT                   SKSLNIALPGGPKFEPLYKDKINNPEIEDFTEFNSIDRVIFRIPIKTEYKVAFPFLYNS
FT                   FAKSIYVGWYHEPLNCFIKNSMEDTDLPAFHFDPVLNPITPHKSKQNRKNTKKEDVGLD
FT                   MPVGFKPFMSDNQDGCIPLDPEGTSSAIQLWWAPYPYNRRSGKMVRAEDVALVKPWYKQ
FT                   HSPTEYPVKVRVSYQKLLKRYILNELHNPQGNKTGSKMSNQRKIKLLKSLKATKYFQQT
FT                   TIDWVEAGLQVCRQGFNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGNAF
FT                   HLIREILRVVKILVDSQVQFRLGNVDAFQLADGIYYILNHLGQLTGIYRYKYKVMHQIR
FT                   ACKDLKHVVYSRFNSIIGKGPGCGFWQPAWRVWLFFMRGIIPLLERWLGNLLARQFEGR
FT                   RSNDVAKTITKQRVDSYYDLELRAQVMHDILDMIPEGLKQNKSRTVLQHLSEAWRCWKA
FT                   NIPWKVPGLPEPIEKIIIRYIKAKADGWVSVAHYNRDRIRRGATVEKTVAKKNLGRLTR
FT                   LWIKNEQERQTNFAKDGPYISPDNAITTFQTMVHWLESRKFSPIPFPPISYKHDTKLLV
FT                   LALENLKESYNSNARMNSAQREELALIEQAYDNPHECLARIKKFLLTQRVFKEVGLEMM
FT                   DYYSHLVPTYAIDPLEKITDAYLDQYLWYEADKRKLFPNWIKPSDDEIPPLLTYKWCQG
FT                   INNLENVWETSNGECNVMLETSLSKMAEKIDFTLLNRLLRLIVDPNIADYITSKNNVSL
FT                   TYKDMNHVNQYGLIRGLQFSSFIYQYYGLVIDLLILGLDRASELAGSPQLPNGFLQFKD
FT                   VETETSSPIRLYSRYIDKIHIFFRFDNEDANNLIQEYLSENPDPNFENVVGYNNRRCWP
FT                   RDSRMRLMRHDVNLGRAVFWEIAGRIPRSLTTIEWEDTFASVYSRENPNLLFSMCGFEV
FT                   RILPKCRLREESSSQEGVWDLIDQESKERTAKAFLQVSQDEVDKFNNRIRQILMSSGST
FT                   TFTKVAAKWNTALIALFAYFREAVVSTETLLDILVKCETKIQNRVKMGLNSKMPSRFPP
FT                   AVFYTPKELGGLGMLSASHILIPASDLKWSKQTDTGITHFRAGMNHQEEKMIPTIFRYI
FT                   TTWENEFLDSQRVWAEYTIKRQEAIEQNRRLTFEDMENNWNRGLPRISTLFQKDRHTLA
FT                   YDKGHRIRRIFKQFSLPRFNPFSWTSNHHDGKLWNLNAYRTDVIQALGGIETILEHTLF
FT                   QGTGFDSWEGLFWEKASGFEDSLKFKKLTNAQRSGLSQIPNRRFTLWWSPTINRANVYV
FT                   GFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVQDVCQVLDKELEVLQIDS
FT                   VEKQAIHPRKSYKMNSSCADVVLTSTYKWNVSRPSLLHDSNDSMDAATANKYWIDVQLR
FT                   YGDYDSHDISRYTRAKFLDYTTDSSSAYPSPTGAMIGIDLAYNMYDVYGNWFSGFKPLM
FT                   QNAMKEIMKSNPALYVLRERIRKGLQLYQAQPQEAFLNSNNYAELFNNDTQLFIDDTNV
FT                   YRVTVHKTFEGNLTTKPINGSVFMLNPKTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEE
FT                   VAALVRSLPREEQPKQLIVTRKGMLDPLEVHMLDFPNISIRPSELHLPFASAMKIDKLA
FT                   DIVLKASEPQMVLFNLYDDWLKSISAYTAFSRIILLLRALGISQERTNLILRPDASITT
FT                   QEHHIWPSFTDEQWIDVETQLRDLILNDFAKKHDINIQSLTQSEIRDLILGQDIKAPSS
FT                   KRQEIADVEGDNKLGQDETNTDNQLTALKSKTQNVHGEEIVTVTTTNYEQSSFASKNEW
FT                   RNRAIASNNLHLRAKNIYVSSDDFIDDDSFTYIMPKNLLKKFIQISDLRTQVGAFIYGS
FT                   SPSDNPQIKEIKVIALVPQLANTHSVQFPSKLPQQEGPLEGLELLGWIHTQSQDTNLLS
FT                   PIDMTTQAKLKNDNNSLWNDKAVTLTVSFTPGSVSLAAYTLSEEGYDWASTNKDLISQV
FT                   PQGYSTSFSQKGSLLLSDRIVGLFMVPDDDIWNYSFIGPTWDPNGLYDLKVDIPLPFYH
FT                   ELHRPIHFSSFNEIEGNELEANQENAFA"
FT   gene            <187641..>190061
FT                   /locus_tag="DEHA2E02090g"
FT                   /old_locus_tag="IPF_5615"
FT   CDS_pept        187641..190061
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02090g"
FT                   /old_locus_tag="IPF_5615"
FT                   /product="DEHA2E02090p"
FT                   /note="weakly similar to uniprot|P54074 Saccharomyces
FT                   cerevisiae YMR119W ASI1 Putative integral membrane E3
FT                   ubiquitin ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65741"
FT                   /db_xref="GOA:B5RTS9"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTS9"
FT                   /protein_id="CAR65741.1"
FT                   /translation="MSNNTVLKNATSASGGSNGDQDDEWFLAKFIIAFIDAIWEQSETS
FT                   SQNRISWDRFGGITTYCCSIYGVSCLVMALILNRTLVMASTNSSRNQQSAISRQRGILN
FT                   TPKSAELLKNMSMVSFKLFAVGLLLYNCYHLLVALNLYYHTSVTSDASIPWFHVLVPDT
FT                   IFEYSPDVFNSNRYMATPKDQVNIGPTTDMYWPIFLGFCFSSFIETFVSVVQGKQPYTE
FT                   SGITIFEHSLAFQEVSSTGFFGSSRLYKRPTEQVLIACIFSTLNHLNIHIGGLLNNNRY
FT                   RLIPSSIIGLAFLTYFVSCFTNGNIWKFPTIIIMSFVPQVLIMSIIFVSVFIFSMAVLA
FT                   KGFQLQDLNYASFLLYENNESDSEFRTRNLNINLHDDFYTALLNLGMLAITSAGKSSYI
FT                   TELSLVTVDEDTWIERSIWQKLKYQAKSVASLQAKLNTNNVTDYLKENKISGYGNMIMT
FT                   PSKRLISGERTDLFNDDTSDLKNSKSISVLRKRILFLKEIVSDLIQLLYGLIIDSFLLY
FT                   FIPKKFSHYVLRRQNRENTNIDETDEEFERRKRKTPAFLRPYIKRNAKSLTKVHFDQKE
FT                   VIQSQSVDLNDYSEEQLAQNYISLLLEKELSEIDDSEDYYQTNHYESDLEEESDIESID
FT                   ISSSTTVSGNRVIDDVSHTLIDELLSPEEFQNLFSSANVDILQRHLNHDSQTSGILTRS
FT                   KFNSLTSGIAIQESTLSSQDEISKLLELILNKRKSQLEDLSSDNSNRHTDDYDLNSKLD
FT                   CVICQTNVREIITWPCKCFAICESCRLSLISKGIEGCVCCRRDVEGVSKVFIP"
FT   gene            <190315..>191418
FT                   /locus_tag="DEHA2E02112g"
FT                   /old_locus_tag="DEHA0E02761g"
FT                   /old_locus_tag="DEHA-IPF5613"
FT                   /old_locus_tag="DEHA-CDS3500.1"
FT   CDS_pept        190315..191418
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02112g"
FT                   /old_locus_tag="DEHA0E02761g"
FT                   /old_locus_tag="DEHA-IPF5613"
FT                   /old_locus_tag="DEHA-CDS3500.1"
FT                   /product="DEHA2E02112p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87636"
FT                   /db_xref="GOA:Q6BQU5"
FT                   /db_xref="InterPro:IPR003656"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU5"
FT                   /protein_id="CAG87636.2"
FT                   /translation="MSLQPNIDHATITSRLHSQHQNANTISHLSQETPLPFKKYTKKRS
FT                   WVWDWFEQDPDNKYRAVCLYCHQEIFRLDGDRGSPKKLITHVNSKHGINKDNFAGEELF
FT                   KIRLEKLKTYVNTFGPLVTNRGDAIVYGIMNSGIQAMTTVPTISSSVSGPSAASASPPR
FT                   HNSYPSDSIGMIVGETRPQLPVITKPTNQDIQPQTLSKPPLAEATNIPRSEPKEPPMDI
FT                   NVIDPSLSSSFHERQIDSNFNNLSHKSKKQEELEKYNNLITNHNRQVEEYNKAAVIAND
FT                   RNMHPCESLSNDSESRQTHENYMFKSQRLFMPLGTGRETKEGNRCKYALEEFIMKNSEC
FT                   FNNLLFIESDSFKQFVNALRDHPNDSI"
FT   gene            <192286..>194031
FT                   /locus_tag="DEHA2E02134g"
FT                   /old_locus_tag="DEHA0E02783g"
FT                   /old_locus_tag="DEHA-IPF5612"
FT                   /old_locus_tag="DEHA-CDS1739.1"
FT   CDS_pept        192286..194031
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02134g"
FT                   /old_locus_tag="DEHA0E02783g"
FT                   /old_locus_tag="DEHA-IPF5612"
FT                   /old_locus_tag="DEHA-CDS1739.1"
FT                   /product="DEHA2E02134p"
FT                   /note="similar to uniprot|P25045 Saccharomyces cerevisiae
FT                   YMR296C LCB1 Component of serine palmitoyltransferase
FT                   responsible along with Lcb2p for the first committed step
FT                   in sphingolipid synthesis which is the condensation of
FT                   serine with palmitoyl-CoA to form 3-ketosphinganine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87637"
FT                   /db_xref="GOA:Q6BQU4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU4"
FT                   /protein_id="CAG87637.2"
FT                   /translation="MPSAETIVTTTTIKTATAITTLAPSLEGLTAALSHNFVHYLNYLD
FT                   RLPGGQIILRYIKSSYKNDPVRSLFELALFIFAVHYFLSSKKKENKSDLTVFSEKEIDA
FT                   LCKDWEPEPLVEDLTPLEKWELKCIPEIKGHNGSHVQLLNEPGSHLGKVVNLASYDFLN
FT                   LNESDNIKAAAKGCISGAGVGACGPPNFYGTQDVHVRLEEDLSEYLGTEQAILYGQDFV
FT                   TAGSVIPAYLKRGDLCIVDSGVNLAIQKALIVSRCDLEWYDHNDMDHLEQILKEIKPVI
FT                   EKQKPIRRRFVVTESLFATTGDLALLPRIVELKNKYKYRLFLDESLSIGVLGATGKGLV
FT                   EHYNIPRSEISITIGSMALSFASSGGFCVGVTPMIQHQRISSNAYVFSAALPPYSAKVT
FT                   SEAIKEISSNLDSTGKSKLMSALHEKIQYVYQELEKQIPSSFFTVTSAPFSPIIHLSLS
FT                   SEYRKKLNLPPFYGNTDLLLTGKQSKRLNEFNHKLNTESFILQKIIDQCLTKAGVLLTR
FT                   SKHILEHENLPVPSPHLLFMVNTGVSIEEFNRAIYALKLAMGEVCSKIRNENDLLVLEN
FT                   EIINY"
FT   gene            complement(<194168..>195946)
FT                   /locus_tag="DEHA2E02156g"
FT                   /old_locus_tag="DEHA0E02805g"
FT                   /old_locus_tag="DEHA-IPF5611"
FT                   /old_locus_tag="DEHA-CDS1674.1"
FT   CDS_pept        complement(194168..195946)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02156g"
FT                   /old_locus_tag="DEHA0E02805g"
FT                   /old_locus_tag="DEHA-IPF5611"
FT                   /old_locus_tag="DEHA-CDS1674.1"
FT                   /product="DEHA2E02156p"
FT                   /note="similar to uniprot|P16522 Saccharomyces cerevisiae
FT                   YHR166C CDC23 Subunit of the anaphase-promoting
FT                   complex/cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87638"
FT                   /db_xref="GOA:Q6BQU3"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU3"
FT                   /protein_id="CAG87638.2"
FT                   /translation="MQTVKAEHIDKLRIKLFQSCQILTNLNLFQAAKWCAEALNGLSQT
FT                   DQNESVPYEYPIIEQDPEDKMDQEKFMLAKAYFNCKEFDRASYVLKDCKSGSALFFRLY
FT                   CILISVDKKATEETDGSINLGSLFLSGNGNHEPSDNEFNNAASRGKDELVGSLNIKLSK
FT                   IIQESENYHSKPENKPNAFLYYLNGIVYNKKKKYAMAQHNFFQSLRLFPYNWSCWQELI
FT                   STLNTFDEAIAFINKLKSAKSSLTNNIMFHFFEVVILQEFYQQSASLKANLDNLINTFP
FT                   KFNFLKVQQFLIAYHGLDYFQAESIFDQILIEDPLRLDDLDTYSNMLYVMEKRSKLSFL
FT                   AQFASSVDKFRPETCCIIANYHSMKCEHEKAIMYYKRALTLNKNCLSAWTLMGHEFVEL
FT                   KNSHAAIESYRRAVDTNPKDFRAWYGLGQAYEVLDMHLYALYYYQKATSLQPLDKRMWQ
FT                   AIGNCYEKIEKYDEAIKSFEKALKIDNYSKGGLDNVEEVINYEPHICFRLATISQKLGR
FT                   SKDTYKYMKLCFDQEYEWGVSDETSKARLWLARSALENHRFEEAYELAKDLNHSNAHDV
FT                   EEARSIARESRNRMSK"
FT   gene            <196085..>197173
FT                   /locus_tag="DEHA2E02178g"
FT                   /old_locus_tag="DEHA0E02827g"
FT                   /old_locus_tag="DEHA-IPF5610"
FT                   /old_locus_tag="DEHA-CDS3557.1"
FT   CDS_pept        196085..197173
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02178g"
FT                   /old_locus_tag="DEHA0E02827g"
FT                   /old_locus_tag="DEHA-IPF5610"
FT                   /old_locus_tag="DEHA-CDS3557.1"
FT                   /product="DEHA2E02178p"
FT                   /note="similar to CA5103|IPF1367 Candida albicans IPF1367"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87639"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU2"
FT                   /protein_id="CAG87639.2"
FT                   /translation="MMTTEDQTEIEQLQLSLSQTIETFQSANKLLELNKELLSNDQSST
FT                   EKSNDIKRLQREFLLDSFRVNRFHKGYKEWENKSKDIFIENEIKGYNNKLGQMSRLNFE
FT                   TEKLDKEYEGLRDTVKLPTCQLSIQTVKLYNGGSLLQYIEKNAEGEYPLTVDISELFSL
FT                   DSNSSLPPPDFNVFNRLLNIEYKLRIQRKVKYEILLSVKQQLTAKNKKWSSRDSELNYF
FT                   MTRKLVDIMNEVEKVRKSEYEDLKDYDYYNNEEEEEEMREQEFEDDESVDEAQDENVED
FT                   DDDSDNENDNSQTDNADDVAGGDDESEVVENQTEIQEEHPSNGEASVDAENDITTENTP
FT                   DLGEQTPTVDPEDNDDVMNIDS"
FT   gene            complement(<197327..>197731)
FT                   /locus_tag="DEHA2E02200g"
FT                   /old_locus_tag="IPF_5607"
FT   CDS_pept        complement(197327..197731)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02200g"
FT                   /old_locus_tag="IPF_5607"
FT                   /product="DEHA2E02200p"
FT                   /note="similar to uniprot|P53311 Saccharomyces cerevisiae
FT                   YGR243W FMP43"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87640"
FT                   /db_xref="GOA:Q6BQU1"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQU1"
FT                   /protein_id="CAG87640.1"
FT                   /translation="MASSAQHASKFTRYLHSETGPKTVHFWAPVLKWCLVIAGFNDLQR
FT                   PIEKVSGTQQVALFATGAIWTRWAGFVIQPRNMLLASVNFFLGGVAGYQIYRLADYRVN
FT                   EGDSPAQVFKYIVSGSSETVEPATNTEPTK"
FT   gene            complement(<197887..>198807)
FT                   /locus_tag="DEHA2E02222g"
FT                   /old_locus_tag="IPF_5606"
FT   CDS_pept        complement(197887..198807)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02222g"
FT                   /old_locus_tag="IPF_5606"
FT                   /product="DEHA2E02222p"
FT                   /note="weakly similar to uniprot|P33296 Saccharomyces
FT                   cerevisiae YER100W UBC6 Ubiquitin-conjugating enzyme
FT                   involved in ER-associated protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65742"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT0"
FT                   /protein_id="CAR65742.1"
FT                   /translation="MINTNYNDDVMSPNPIHNTDSLNITPDRKTILILTKEYHDLLLEP
FT                   IEGVTVHPDEANICIWYFLIHGPINTPYYKGLYIGVIIFPPNFPYSPPEIQVISPNGKF
FT                   KPRRSICLTLSSFHEECWNASWTFEKIIVALVSFMVSDELTSGCYKNEIITEFDKLVIA
FT                   KDSKNWLYYNCSIFKKMFQNEYQLMHKIYSSNLPHHSKIFLIDILLNEPLQVSTNVFNV
FT                   NKRLEDYIENYLQIELVVSDYTQAKRNEILQKFFKLSTTREEIRQLELFHSEYYQLDGL
FT                   SHSDNFLSDDGDEEEPEFYSTEDEG"
FT   gene            complement(<199011..>203594)
FT                   /locus_tag="DEHA2E02244g"
FT                   /old_locus_tag="IPF_5605"
FT   CDS_pept        complement(199011..203594)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02244g"
FT                   /old_locus_tag="IPF_5605"
FT                   /product="DEHA2E02244p"
FT                   /note="similar to uniprot|P14772 Saccharomyces cerevisiae
FT                   YLL015W BPT1 ABC type transmembrane transporter of MRP/CFTR
FT                   family found in vacuolar membrane involved in the transport
FT                   of unconjugated bilirubin and in heavy metal detoxification
FT                   via glutathione conjugates along with Ycf1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65743"
FT                   /db_xref="GOA:B5RTT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT1"
FT                   /protein_id="CAR65743.1"
FT                   /translation="MARMMDMNGTQTRLECGPSAIFHPLVPTKENAFNPCFISWAYTYL
FT                   AIIFAVVCGIDLIRAVRLPKHGSYIPKSTGIHHWVRCNAVLLQGVLYLVLLQFTNIHYR
FT                   YADTKILAMLTTMVTIGGVVLPLHMVETSRVAIPHASLLAFWPLLTILQTMLLYQEVYT
FT                   GWPVFTDDSSPMVAVLMLVNSLSVIVMEACRTYWKPTHELIFFHRKNETHELELPHLYE
FT                   KVTFSWMNDIIMNAYENQTITEVDLPNSPTKLSSAAATARLSKYWKAQNSSLVLSLVKA
FT                   FGPIALVAFVYESSDRVLNFVQPQLLRLLIQFFNEKTEDPDQPLMKGILISISMFMVTI
FT                   LQTTLYNQYLIKILSVGLGCRSSLTSLIYQKGLRLSMESKLKSSTGDIVNLMTVDINRI
FT                   QDVSQNLSTLILAPMELVLCVISLWSLLGKSTLSGVFTMLLLIPLNTIIVKYIRSMNKT
FT                   QMKLKDNRSRIINEILSSIKSIKLYAWEVPMLSKLFHSRNDKELKNLKKIRLVSQCANL
FT                   IWNIIPFLVSFATFATFAIGQSKPLTSDLVFPALALLNLLSSPLLALPMVINSIVEASV
FT                   AIERIKAFLLSSELDEDLVINLPRRNHLGEETVRIEKASFLWEKPNEPKDDNSVSNLKY
FT                   ALKDIDFTAKKGELSCIVGKVGSGKTSFLSALLGQLDAIDSTDVTKSPLIGLSGTVAYC
FT                   SQSPWIMNASVKENITFGCRYDEDFYQKAIEACQLLPDLEILPDGDETQVGEKGISLSG
FT                   GQKARLALARAVYARADIYLFDDILSAVDSHVGKKIINEVLAKPSGLLATKTIILSTNS
FT                   IPVLHYSNYIHLLENGKMIEHGTFDKAQNKDKNPKLFELIKEFGNVNETESNSESSSQF
FT                   DSDKVGESKDSSTIVNDIESDKGTDDSILDLQRTISHESISAASIATFYWNPLSKILPN
FT                   IRTAQINEVSAKGKVKWDVYFKYAKSCSFVGVICWMFLLVSASIASTSANYWLKYWAEQ
FT                   NSRSGRNANAWQFIGIYAIFGLSASLLTFIRGAVIWTYLAISSSKFIHDSMAKRVLKAP
FT                   MSFFERTPIGRIMNRFTNDINKVDDTLPRVFNAFFSSSVRTIFTLGIVSYAMPLFSIII
FT                   VLLILIYGYYQRFYVAISRELKRLVSVSRSPIYAHLQESLNGVDTIRAYKQIDRFKFIN
FT                   NANIDFNLKSLYMLRSINRWLSTRLQFIGSIVIISASLLAIYSLTTSKPLSAGMAGFVM
FT                   SYALQVTDSLNWVVRMSAEVESNIVSVERCLEYCELSIEENEERLFIKPPAKWPVDGSV
FT                   SFKDYSTRYRDNLDLILKDINLDIKPNEKIGIVGRTGAGKSSLALAIFRIIEPTSGFIS
FT                   IDGKNTSDLALYDLRSNLSIIPQDSQAFEGTIRQNLDPLKKHNDKELWEALELAHLNKH
FT                   VLQLDGNEGDKLSCKVSEGGSNFSSGQRQLMCLARALLNTSKVLILDEATAAVDVQTDK
FT                   IIQETIRKYFKDKTIITIAHRLDTVMDSDKILALDQGRVKEFDSPSNLLQNPDSVFYSL
FT                   CKQSGSI"
FT   gene            <204325..>206661
FT                   /locus_tag="DEHA2E02266g"
FT                   /old_locus_tag="DEHA0E02948g"
FT                   /old_locus_tag="DEHA-IPF5598"
FT                   /old_locus_tag="DEHA-CDS0899.1"
FT   CDS_pept        204325..206661
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02266g"
FT                   /old_locus_tag="DEHA0E02948g"
FT                   /old_locus_tag="DEHA-IPF5598"
FT                   /old_locus_tag="DEHA-CDS0899.1"
FT                   /product="DEHA2E02266p"
FT                   /note="highly similar to uniprot|P19414 Saccharomyces
FT                   cerevisiae YLR304C ACO1 Mitochondrial aconitase required
FT                   for the tricarboxylic acid (TCA) cycle"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87645"
FT                   /db_xref="GOA:Q6BQT9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT9"
FT                   /protein_id="CAG87645.1"
FT                   /translation="MLAASRTAARAPRSIRGLATAGLTRDSQVNQNLLETHSFINYKKN
FT                   LENVQIVKDRLNRPLTYAEKLLYGHLDDPHGQDIERGVSYLKLRPDRVACQDATAQMAI
FT                   LQFMSAGMPQVATPSTVHCDHLIQAQIGGEKDLARAIDLNKEVFDFLSTACAKYDLGFW
FT                   KPGSGIIHQIILENYAFPGALLIGTDSHTPNAGGLGQLAIGVGGADAVDVMANLAWELK
FT                   APKIIGVKLTGKMSGWTSPKDIILKLAGITTVKGGTGAIVEYFGSGVETFSCTGMGTIC
FT                   NMGAEIGATTSVFPYNKSMVDYLNATKRSQIAEFANLYKEDFLAADEGCEYDQVIEIDL
FT                   NTLEPHVNGPFTPDLATPISKMKETAEANGWPLEVKVGLIGSCTNSSYEDMTRAASIIK
FT                   DAGAHGLKAKSIYTVSPGSEQVRATIARDGQLKTFEDFGGVVMANACGPCIGQWDRQDI
FT                   KKGDKNTIVSSFNRNFTSRNDGNPATHAFVASPEITTAFAISGHLGFNPLTDSLKDSEG
FT                   NEFKLKEPVGVGLPPNGYDAGVNTYQGPPKDRSSVEVVINPSSDRLQKLTPFKAWDGKD
FT                   AERLPILIKALGKTTTDHISMAGPWLKYRGHLENISNNYMIGATNCENGEVNNVKNHYT
FT                   GEYKGVPETAADYRDAGKRWVVIGDENFGEGSSREHAALEPRFLGGFAIITKSFARIHE
FT                   TNLKKQGLLPLNFVNVADYDKINPDDEVDLLGLTTLSPGKHLTLRVHPKDGEAWDAELS
FT                   HTYNSEQIEWFKCGSALNKMATNAK"
FT   gene            complement(<207056..>210130)
FT                   /locus_tag="DEHA2E02288g"
FT                   /old_locus_tag="DEHA0E02970g"
FT                   /old_locus_tag="DEHA-IPF5597"
FT                   /old_locus_tag="DEHA-CDS0416.1"
FT   CDS_pept        complement(207056..210130)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02288g"
FT                   /old_locus_tag="DEHA0E02970g"
FT                   /old_locus_tag="DEHA-IPF5597"
FT                   /old_locus_tag="DEHA-CDS0416.1"
FT                   /product="DEHA2E02288p"
FT                   /note="weakly similar to CA3454|IPF10533.exon1 Candida
FT                   albicans IPF10533.exon1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87646"
FT                   /db_xref="GOA:Q6BQT8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT8"
FT                   /protein_id="CAG87646.2"
FT                   /translation="MSENTKEMKTQDMKILEGGKVMKVQKTRQRKILSCIYCHSKKIKC
FT                   SRVQPVCNNCDKLGLECKYFINERVSRGGKKSSRSVEPQTAIKVESTVITDIAGEGLDG
FT                   AIKMESDARTDSSSSYSDHNISPMSPKSNENSNESVTTNDDIVLCKEDSQFADLYFGLN
FT                   MQAHSPMNQLNQPLNGMGMPRNPNGSPMNLNNTLLQTPVMNSGSNNITNNFFNTNYMSN
FT                   PPDESYQFNLSSFPFNHENIVNRSGMTPPLSNINTRVHSSTNSHSNSQTNLSGLLAKSN
FT                   QQNRSNFIDNQNNNSFLPNSSNNNKSAASQLSIEISNSLNPYSSNPATTVNFLYGTNTY
FT                   YDNENLLDDLLKHLPSSRERSFELINRYVNSVHILLPLMVNLQDFIEEHTKFWDEHDRM
FT                   KENSSSDLVKADTSSSGNNPDIFQFYTLYYPILYASTVSEFEEYDNLLLNQDIDNYLKG
FT                   FNKICQYYNYPHGLRTIPLLLGNVIIQSTSPNPSSMEMSQIIRYAKFLQFHKDPILTLR
FT                   INDWEVIKFRRLLWWVIFGLDALTSHNHCLPPICKYDDFNVVMPDEEEPVFNENGSIKE
FT                   KKLNVAMLSMNVKFQYDRILSELVYQLHNGLSNNITGDEINEIKLMIMNLFYHIHESIK
FT                   KMTDFYKMNPPQTVSEMNLINFITNHSWSFVDRALMLLHKKILLRDRSKDPKHDFDESQ
FT                   GNEAIKYEDKYEINRSKNRGGILSLSQYEDTFGQIQESNIINNFDNSTISQLKFSQHEN
FT                   FSYENLGNNLIPSILHNLNDFLKYNDFIKFGKFNWYVKRTIPLDSIILMLIIITVKFKY
FT                   EFMTSNELVIYVKLINKALFILNRKWFKNEKYKRMLSLTNSVWRFILEKYNIINLITQH
FT                   NLGNENIKSEIEFCDSQVAGYMNMNELFNVMDVPQPIPPQSSPTFTPVSNLRTGMKFHG
FT                   EHLSRSSFSNQENATFQQNSLITKDQYQYTSNDTLKRKENDSSNSQCDKNELRQLSDKI
FT                   YYSLRNNFVDINDYCSFYISLENILHELMDYIQKA"
FT   gene            complement(<210722..>210793)
FT                   /locus_tag="DEHA2E02310r"
FT                   /old_locus_tag="Deha0E.47"
FT   tRNA            complement(210722..210793)
FT                   /locus_tag="DEHA2E02310r"
FT                   /old_locus_tag="Deha0E.47"
FT                   /note="tRNA Asp (GTC) cove score=60.37"
FT   gene            <211459..>213699
FT                   /locus_tag="DEHA2E02332g"
FT                   /old_locus_tag="DEHA0E03025g"
FT                   /old_locus_tag="DEHA-IPF5592"
FT                   /old_locus_tag="DEHA-CDS0986.1"
FT   CDS_pept        211459..213699
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02332g"
FT                   /old_locus_tag="DEHA0E03025g"
FT                   /old_locus_tag="DEHA-IPF5592"
FT                   /old_locus_tag="DEHA-CDS0986.1"
FT                   /product="DEHA2E02332p"
FT                   /note="similar to uniprot|P15303 Saccharomyces cerevisiae
FT                   YPR181C SEC23 cytoplasmic GTPase-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87648"
FT                   /db_xref="GOA:Q6BQT6"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="InterPro:IPR037550"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQT6"
FT                   /protein_id="CAG87648.1"
FT                   /translation="MNFEEAEDINGVRFAWNTFPCTKADANKLVVPTGALYTPLKFRED
FT                   LPIAEYDPHCCLNTHCRSILNPYCQIDPTGSWICPICGNRNPLPSHYQGISNENLPLEL
FT                   NPNSSTIEYITARPVANPPIFFFVIDLCQDEDNLKALKETLVVSLSLLPPNALIGLITY
FT                   GTMVQVHDLGSESINKSYIFRGDKEYTDKQINDMLKKPVVVPAQNFANSLTRFFLPLEE
FT                   VEFQLTSILENLTKDPWAVANGDRPLRSTGSALNVATNLLHSTFQGYGARIMLFSAGPD
FT                   TLNPGLIVGPKLKEPIRSHSDIDKDNAKHYKKAIKFYDALAAKLVKNSHTVDIFAGCYD
FT                   QIGMSEMKNLCNKTGGTLLLSDAFTTSIFKQSFLRLFNKDSEGYLLMSFNGTFDIKTSK
FT                   ELKVSGLIGNASSLAAKTNNVSENEIGIGGTSQYRLCSASPQHTYAVFFDIANTQSLPP
FT                   NSQSYIQFITHYQHSSGTYRVRVTTISNILTSEDAILTQSFDQEAAAVLMARVTLFKSE
FT                   QDDGADVLRWIDRMLIKLCQKFADYRKDFDESFRLSPQFSFYPQFIYYLRRSQFLQVFN
FT                   NSPDETAFYRHVLLTEDINNSLIMIQPTLTSFALDSEPEPVLLDSVSIKDDRILLLDTF
FT                   FHILIFHGKTIAEWRKAGYQNNPDYANFKQLLDEPKQEAAELLVDRYPLPRFIDTEEGG
FT                   SQARFLYSKLNPSTTYNNQTFTGSNGAVVLTDDVSLQVFMSHLQKLVVSGSN"
FT   gene            <213847..>214960
FT                   /locus_tag="DEHA2E02354g"
FT   CDS_pept        join(213847..213883,213933..214960)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02354g"
FT                   /product="DEHA2E02354p"
FT                   /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
FT                   YPR180W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65744"
FT                   /db_xref="GOA:B5RTT2"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT2"
FT                   /protein_id="CAR65744.1"
FT                   /translation="MSIELDDKQLTADEIALYDRQIRLWGMATQLRLRSAKILVINLGA
FT                   VGGEVVKNLVLGGINTLEILDSSKVKEEDFSAQFFLPNNDDIVGQLKLPVVIEQIKDLN
FT                   NRVNLSANTSSLSSIFSDSQETNNYLAKFDLIIGTELAKSEMLTLNEYTRNLNIPLYVC
FT                   GLHGMFGYIMSDLIHHTATSEKDAGNQPREPNTKINRCKTITNVDYNKEENKEIVTIVD
FT                   EFIPILEIFKSKELPKQLNRRQMKRLSAAFPLIFALFDIPRLENPEDTIDIEELRNKSK
FT                   EVCAQFEIPETVINDEYLRLFSNQAYTEFSPVSAILGGCLAQDVIQFLSKKESPLNNCL
FT                   ILDAVKSEMPIYLL"
FT   gene            complement(<214995..>216932)
FT                   /locus_tag="DEHA2E02376g"
FT                   /old_locus_tag="DEHA0E03069g"
FT                   /old_locus_tag="DEHA-IPF5590"
FT                   /old_locus_tag="DEHA-CDS1378.1"
FT   CDS_pept        complement(214995..216932)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02376g"
FT                   /old_locus_tag="DEHA0E03069g"
FT                   /old_locus_tag="DEHA-IPF5590"
FT                   /old_locus_tag="DEHA-CDS1378.1"
FT                   /product="DEHA2E02376p"
FT                   /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
FT                   YPR179C HDA3 Subunit of a possibly tetrameric trichostatin
FT                   A-sensitive class II histone deacetylase complex that
FT                   contains an Hda1p homodimer and an Hda2p-Hda3p heterodimer"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87650"
FT                   /db_xref="GOA:Q6BQT4"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="InterPro:IPR026216"
FT                   /db_xref="InterPro:IPR038609"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT4"
FT                   /protein_id="CAG87650.2"
FT                   /translation="MNLLKILDGTPEPPIIDLRLENVNRSGDYHLPTPMYEFQKELTDQ
FT                   IVSLHYPDILKYCETNDKNDLIIKSLEICINNCMLVSTHPYLLINHYMPKNLASKDMSS
FT                   KLADTSGKFSVLRDLMNVIISNTTRNTKTIGVVLNNNAKFFDLVEALLLGCSGNKTIKR
FT                   YIGNYVEKESSKTNKSGDSNKPVTNIHLLPFDGKVTRDEEQFAQTKFDALIVFDSYVDT
FT                   NHEFFQKLRTQNRRKEAIVIRLVPVRTVEHCQLYYSDMTTQNDYLYKIISSIVCLREHI
FT                   GILPPDVFPIFNQHLKYLSHTFFDYAFKGSRSNSFPEWPLPELSKIPKFSATDIERSLL
FT                   TEVHYHYTPYDSSEGNSQKPQKKKPSYYEAKRLESDYVTNSLRNDFNTLIGIFGNESNM
FT                   TVNSDINRNILTHKLITQLKTAYLNWNIADEEHNTYIDYNRPDIQARVGRREDETKHAL
FT                   SKIINDIDHTESRILFAEKKTLRNIQELESTKEEMKDFESKLISFIADNSITNEKLKKF
FT                   YDQQVKIWELQAKIKENLAKINSKHEEKNYMANECANAANSIIESKNQVQMAQELNNQL
FT                   KRRIAISIDSGFEERTKFKKQKTELMEEIEAEKVINKTYQAKLGKSLKFLKETSHLKKR
FT                   KSRGITPNGK"
FT   gene            complement(<217077..>218564)
FT                   /locus_tag="DEHA2E02398g"
FT                   /old_locus_tag="DEHA0E03091g"
FT                   /old_locus_tag="DEHA-IPF5589"
FT                   /old_locus_tag="DEHA-CDS2373.1"
FT   CDS_pept        complement(217077..218564)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02398g"
FT                   /old_locus_tag="DEHA0E03091g"
FT                   /old_locus_tag="DEHA-IPF5589"
FT                   /old_locus_tag="DEHA-CDS2373.1"
FT                   /product="DEHA2E02398p"
FT                   /note="similar to uniprot|P20053 Saccharomyces cerevisiae
FT                   YPR178W PRP4 Splicing factor component of the U4/U6-U5
FT                   snRNP complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87651"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT3"
FT                   /protein_id="CAG87651.2"
FT                   /translation="MEIDEIPIVNDPYINKGTHLSDPKDVPTIDEEVRMELRRLGEPIT
FT                   YFGEGKAERRERLIKLVSELPNTNFKFAYVEENNKEEEGSDEDIEEDEDEDFYTPGSEA
FT                   LLESRKRFLQYSLQKSSKRNELQKNLSKEQDFIKTLKHRRTINSNLSKFTLYGTQLISG
FT                   NTRTLSAVRFSSDNSLIACGSWDGAVYVLNRDDLKTKHYSGPGHHAEKVSALDWDLYNN
FT                   NRFMVTGGNEGNINFWTISDSDDTEPQKMTPSLSIKDAHQHRISKTLFHPTGKYVVSTS
FT                   FDQTWKLWDIEKPQDALVQQEGHSKEVFCGSFHPDGGLLSTGGLDAIGRIWDLRCGRSI
FT                   ATLQGHIKGIYSMDWSQNGYHLATASGDCAVKIWDIRKFDNSNSNGELFSIPSHTKLVS
FT                   DVKFFHRRDDTKPSGQLSTTVTDEFEKNPEQLDTNGTFLASASYDGMVNIWSADNWVKV
FT                   KSLKGHSDKVMSCDISGDGCFIVSSGWDRSVKLWSVL"
FT   gene            complement(<218710..>219726)
FT                   /locus_tag="DEHA2E02420g"
FT                   /old_locus_tag="DEHA0E03113g"
FT                   /old_locus_tag="DEHA-IPF5588"
FT                   /old_locus_tag="DEHA-CDS3818.1"
FT   CDS_pept        complement(218710..219726)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02420g"
FT                   /old_locus_tag="DEHA0E03113g"
FT                   /old_locus_tag="DEHA-IPF5588"
FT                   /old_locus_tag="DEHA-CDS3818.1"
FT                   /product="DEHA2E02420p"
FT                   /note="similar to CA3846|IPF7943 Candida albicans IPF7943"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87652"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT2"
FT                   /protein_id="CAG87652.1"
FT                   /translation="MDQSGPVTVTLDDLSKGIDFNTLEKAFGLDSLGIIVVKDLPEKFL
FT                   ELRLRVLKSASILASLPKEELSTLESEESMWLSGWSCGKETLGSNGTPDYNKGSFYMNC
FT                   AFHKDPELEGPIKSICDEFKDFKTYTTWNIWPSNELEGLSTFERDCKELCNLIIDVAQT
FT                   VASNCDKYIAKTQPNYEEHFLERIVKNSTSTKARLLHYYPSNGNSTSDDDWCGEHLDHS
FT                   CITGLTSALFLDESKGLTHGLNRSPDPEAGLYIRNRRNDVVKVNIPSDCLAFQSGSALQ
FT                   EVSKGSLKAVPHYVKGSQQKSVARNTLAVFCQPDLNEKVNSNENFAQYAERIVLSNH"
FT   gene            <220403..>220503
FT                   /locus_tag="DEHA2E02442r"
FT                   /old_locus_tag="Deha0E.1"
FT   tRNA            join(220403..220440,220467..220503)
FT                   /locus_tag="DEHA2E02442r"
FT                   /old_locus_tag="Deha0E.1"
FT                   /note="tRNA Lys (TTT) cove"
FT   gene            complement(<220532..>224110)
FT                   /locus_tag="DEHA2E02464g"
FT                   /old_locus_tag="DEHA0E03179g"
FT                   /old_locus_tag="DEHA-IPF5587"
FT                   /old_locus_tag="DEHA-CDS0240.1"
FT   CDS_pept        complement(220532..224110)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02464g"
FT                   /old_locus_tag="DEHA0E03179g"
FT                   /old_locus_tag="DEHA-IPF5587"
FT                   /old_locus_tag="DEHA-CDS0240.1"
FT                   /product="DEHA2E02464p"
FT                   /note="weakly similar to uniprot|P40851 Saccharomyces
FT                   cerevisiae YPR122W AXL1 Haploid specific endoprotease that
FT                   performs one of two N-terminal cleavages during maturation
FT                   of a-factor mating pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87653"
FT                   /db_xref="GOA:Q6BQT1"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT1"
FT                   /protein_id="CAG87653.2"
FT                   /translation="MKDYYRSIKTYPTDFKVPLSDSNRGHRIFQLANGILTLVISDPSN
FT                   EIGSASICVATGSHNDPDYIPGLAHLCEHALFMGTKEFPKPNLYHETVQAYGGLTNAFT
FT                   TGEQTCFQFEVPVINGNIGNLNPKTNMEEDGDESIFDHVLRNFASFFKSPLFRENEIRN
FT                   EISSVNEENICNLSSPEKIFFHALKSLSNKGHPFSRFATGNVQTLENVPKSLKLNLYSE
FT                   LFKFYQSYYLPEKMTLVISGPQSLNHLQRLALMNFSSIGKKSIKIKKSCETDSLKHHLS
FT                   EFSILSESWRMVYREPLFKQCNISKCLFVKSDTHSRLRIIFPMKPTKSQKEYKLYQHAW
FT                   MNILGDESIGSLCAYLIELEDLAFSVNSFRQSLTFQDDVLILDITLTSKGQNNISKILM
FT                   SIFQYINQIILNCSYSTMGHYLSDMATIETLNFIHRESNNSPMKEAAALAEILQKDISV
FT                   INPLNILKGYNDWMDEDLDYSGDYKVDPGWWRLMAAKFIAATMKTLNSANCNILILDSN
FT                   PLIVNTIRCYSANSIVLNTKDHYNDFEYTVCDIDNLFINKKSLEYCSYFSFPEPNIYLA
FT                   YNQKDLNSIVENISLKASNISWGFSAYRISETEPKLIDSSQFHEIWHKFDESTSKVTAS
FT                   CRVQSLCLDPSPSVTIGIEILVELIGNKLRHELFPGELVGYSWGLFPGLNCSPSITLTT
FT                   TGLTDKFSMFLFFIIEKIQEITSNFKTLPYRQFTRAQASVRKRYEDFSKSGGVDKAMAG
FT                   SIFLLEEGIWSLKQRLDALDEMNMSLLEVISLELFCELQHLNIFIQGDIKIHEAFKISR
FT                   ILQSLGRYEKKTNINNFQETNLSSYLLKQGKSYIYEDNDTNNGATNTILYYIQIGSRDN
FT                   VFNRSISKFVAHILSIFAATELRTKRKLGYLVYSGSKLFRTTTGIYITISSGSHSPHYL
FT                   NSQIEDFLYELELKLFEYSEEKFESFKTTFVESYLKHNTQKDELFQNNELYGVNPVKSS
FT                   SVFPKGKMYYMHRNYFDKIVNKTYTFGGMNGEYEIDLSIIDELTKDKFFEFFKSRISIK
FT                   SRKKSSLSLLLFSQEKVKSKSLKTQILEFLTEEGIPVSNNNLEDMIDEYNNNDPNFSKS
FT                   GPNMNPKVKNERTKLIMYTLKKIYRSKIERFTSSNHNKYRKMKRNDIVKNLGENYISNE
FT                   PYLVPTILTDWKQLHDESTLKKNICN"
FT   gene            complement(<224423..>224494)
FT                   /locus_tag="DEHA2E02486r"
FT                   /old_locus_tag="Deha0E.46"
FT   tRNA            complement(224423..224494)
FT                   /locus_tag="DEHA2E02486r"
FT                   /old_locus_tag="Deha0E.46"
FT                   /note="tRNA Glu (TTC) cove score=60.44"
FT   gene            <224663..>226042
FT                   /locus_tag="DEHA2E02508g"
FT                   /old_locus_tag="DEHA0E03223g"
FT                   /old_locus_tag="DEHA-IPF5585"
FT                   /old_locus_tag="DEHA-CDS2652.1"
FT   CDS_pept        224663..226042
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02508g"
FT                   /old_locus_tag="DEHA0E03223g"
FT                   /old_locus_tag="DEHA-IPF5585"
FT                   /old_locus_tag="DEHA-CDS2652.1"
FT                   /product="DEHA2E02508p"
FT                   /note="some similarities with CA1368|IPF15969 Candida
FT                   albicans IPF15969"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87654"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQT0"
FT                   /protein_id="CAG87654.2"
FT                   /translation="MAIMEIPGYYYDEIKKKYFKITNGGVSSQYHNNIIQAKKRRIEHD
FT                   IETKTINSDIKSTKNTRTIKEIQKWRHYASPYNLQKLRLGFCKLDKSTYDFEMMRGWHY
FT                   LKTLKYEDNKIWGKFKDKYFISTDGCVMNISAVDGLGTFSTCARCDELKITNYHQQLTN
FT                   EGFMIFEPTIEVLVTNGKFVFKYITFSACDTDMFMGFFKFERYDPKTRKQDLSLNLIQY
FT                   VKTINDRRIKGELMSILGIGLMKIDSDDFHYANVEFKNNCRITSALIQDNQLILGTNRG
FT                   DGYLFDFTNSGKFYKCKRFTVRKGLYSIKKIVKNDRNTFISGSTSKLFVLDSNMHISMV
FT                   ITHDDGVKDFHVRANSDIIIVGLKSIKVYNYNDPQSQPVAIKYFNDNITHQISLFEENY
FT                   FMVNQSHNEILVVHYSDYNTFSLTLVNRGRYLVNFINLSSGIYILHWDCDGKSIYEMYK
FT                   I"
FT   gene            <226878..>228953
FT                   /locus_tag="DEHA2E02530g"
FT                   /old_locus_tag="DEHA0E03245g"
FT                   /old_locus_tag="DEHA-IPF5584"
FT                   /old_locus_tag="DEHA-CDS1179.1"
FT   CDS_pept        226878..228953
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02530g"
FT                   /old_locus_tag="DEHA0E03245g"
FT                   /old_locus_tag="DEHA-IPF5584"
FT                   /old_locus_tag="DEHA-CDS1179.1"
FT                   /product="DEHA2E02530p"
FT                   /note="weakly similar to uniprot|Q6CRU7 Kluyveromyces
FT                   lactis KLLA0D06281g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87655"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS6"
FT                   /protein_id="CAG87655.1"
FT                   /translation="MDIFEKIAFTKLNSVVSIDVVEKEPVLNIPVITFAHEMSNLGFSI
FT                   TKQVYNYLCNLKNPNEKCAKILEIAKESVGAHVKMKAFYPDFPLQVMNMVEADLYFLAA
FT                   MHYWSCGYWKLSFIESSRPELKEVTHQTTISLISIKHVKAYFYKILSSKQGVPEALLTF
FT                   VDAAINEGWTCGFSGEIPFKENLCRVATYLVKKGESINNVISTSTDILRVMASLSESDI
FT                   ELKKKIRFKSLSRKYRRIIILALEEVINISDIKAYESLWKIAFHSLHVGEFGGKTADIA
FT                   SRFRNENNVKTSETIIAEAIKDGNTKLAMVKLIHKPSVFARSLDKLLRDSNKETAEFII
FT                   KQFASIINKIDAKILLQLFGHFKGRKINESSSRVVFTAGSQGRAIMVPKLTEMDNDIVR
FT                   GIINIITIELEKQFYNKGHLKNRKVYIGIEAKGVLLPSQLASISDNKRTISRGSRVPID
FT                   IIPLDIEKNILRMFIHWIGDDIDLSALFLSEDLNTQSHIAFTNLKDDFAWHSGDIVNAP
FT                   GPDGASEFIDIDLKKAQEFGKRYVCMDVRVFCGPSFLEHEQCFAGFMLRKEPQSGEIFE
FT                   PLTVRCKFDITSKGRSADICLFDMKTREMIWIDTMINHGQTANSLANNTASSVYIIRAF
FT                   LKMEQSKVNINELVSMHARAVDANIVSQRDEADFTVGLGEGDLDVYNFTSINADWI"
FT   gene            <228993..>229112
FT                   /locus_tag="DEHA2E02552g"
FT                   /old_locus_tag="DEHA0E03267g"
FT                   /old_locus_tag="DEHA-IPF5581"
FT                   /old_locus_tag="DEHA-CDS8814.1"
FT   CDS_pept        228993..229112
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02552g"
FT                   /old_locus_tag="DEHA0E03267g"
FT                   /old_locus_tag="DEHA-IPF5581"
FT                   /old_locus_tag="DEHA-CDS8814.1"
FT                   /product="DEHA2E02552p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87656"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS2"
FT                   /protein_id="CAG87656.4"
FT                   /translation="MLEIILCKIQISSDYFLTFEAKTSLHSPECFVRDEFILV"
FT   gene            <229554..>230834
FT                   /locus_tag="DEHA2E02574g"
FT                   /old_locus_tag="IPF_5580"
FT   CDS_pept        229554..230834
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02574g"
FT                   /old_locus_tag="IPF_5580"
FT                   /product="DEHA2E02574p"
FT                   /note="similar to CA3328|IPF10564 Candida albicans
FT                   IPF10564"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87657"
FT                   /db_xref="GOA:Q6BQS9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS9"
FT                   /protein_id="CAG87657.1"
FT                   /translation="MLQMVGKISAVKSHFTNILIIGGSYGGITSVKIIRDLLKTRQTED
FT                   KLKRGDEKFKITMIEPKEGFLNLIAIPRTLVDMDFARTQYFKYTDIGGLGIHKVIDANG
FT                   NIKATNNEEDKNDLFEITCIQGKVLNVGEKEANFTINGDESRNIKFDYVILASGRDRNY
FT                   PVTPAGRTKKEFLNEMKEFYDRITDEKIKTISIIGAGAVGIELSGEIKHYFPNKHVNLI
FT                   HPHDSFPPEPLSGELKQRVKESLERANIDIHYDTRIQKELENGDLLTTTGSVIISDLNY
FT                   WSTSKYNNIKIVDKYLRSDFLLPDSTLKVNDMLQLSNGEKTIPNFFCIGDIASLPIIKT
FT                   AGWALFMASIVGKNIISNLFEEDMKEKLPPAEKMPRGILLVGGNGDVISSNNGIVELNN
FT                   PEYVEAYKDYRFSSSFKYLELDLPTEN"
FT   gene            complement(<231504..>233441)
FT                   /locus_tag="DEHA2E02596g"
FT                   /old_locus_tag="IPF_5577"
FT   CDS_pept        complement(231504..233441)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02596g"
FT                   /old_locus_tag="IPF_5577"
FT                   /product="DEHA2E02596p"
FT                   /note="weakly similar to uniprot|P39980 Saccharomyces
FT                   cerevisiae YEL065W SIT1 Ferrioxamine B transporter member
FT                   of the ARN family of transporters that specifically
FT                   recognize siderophore-iron chelates"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65745"
FT                   /db_xref="GOA:B5RTT3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT3"
FT                   /protein_id="CAR65745.1"
FT                   /translation="MILEKLFKVVQKMSGENYDISSINSAKSFNKSTSNQYDKEAIIDQ
FT                   TYAKTQLDENRIDAEAKVIKDRGVYRVEASKELMDNSKNGKLMKAVLGISIVMCAWAVD
FT                   LDSSVTYSLAPWATSHYQKHSEGLGALTTANGIIAAISKPVYAQICNTLSRPTTYVISV
FT                   VLYTVGYIIVAASNTFSAYIVGSALGAAGTSGIRFINSLIAADLTVLKWRSLATAILSA
FT                   PYIINTWYAGYIVQDLGTSNWRWGYGMFTIIMPVVVCPATYILIFSQQKAHKLIPEDDR
FT                   ALYEQSFSFRKNWKTFIWRLIIEADVLGLLLLGFGFALLLLPFSLQSGAKGGWNNPSMI
FT                   AMMVIGGVLVIVFFLWEILLAPFPITPRRVLNRTVICCIVIDFFYQFAGMLPLQYLSSY
FT                   VWIVQNWSNRDWTYYNNTLTVALCVFGLVAGVLYRVTHRYKVFQIFGVLLETVSQGFMI
FT                   NGTEARTDTLSLVWHSICSGAAGGFNVVASATALSAAVPHRDLAVAMSILSLWSLIGQS
FT                   IGGAVSTAIWGSKMESEFRKYLPSSVSDEQVTGYFHSITAIREDFDWGSDERDGAIKAY
FT                   KVICYYFFAIAAALQVIRFVAVMLQTNYYLGDTQNAVEFSDETQISNEVERKNVEKSNQ
FT                   KWYVAIYDIW"
FT   gene            <235538..>236038
FT                   /locus_tag="DEHA2E02618g"
FT                   /old_locus_tag="DEHA0E03333g"
FT                   /old_locus_tag="DEHA-IPF5576"
FT                   /old_locus_tag="DEHA-CDS6445.1"
FT   CDS_pept        235538..236038
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02618g"
FT                   /old_locus_tag="DEHA0E03333g"
FT                   /old_locus_tag="DEHA-IPF5576"
FT                   /old_locus_tag="DEHA-CDS6445.1"
FT                   /product="DEHA2E02618p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87659"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS7"
FT                   /protein_id="CAG87659.2"
FT                   /translation="MPNQYVYNSYQQSYSPSIPNGSLNVVGTSPTFTNMNYNVPNSAES
FT                   SASSTTSSMGSSVTSNSSNYSFHTPRLRYYLSKSFDIEDDMEFCPDIPEIAGNSPPAKR
FT                   FNPYTASVFSPVIQPESNHEPMSPMNSGAQSPRVHTPRIKKPLEIVNPQTKMRVSSPAI
FT                   HNK"
FT   gene            <236619..>238607
FT                   /locus_tag="DEHA2E02640g"
FT                   /old_locus_tag="DEHA0E03355g"
FT                   /old_locus_tag="DEHA-IPF5575"
FT                   /old_locus_tag="DEHA-CDS1300.1"
FT   CDS_pept        236619..238607
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02640g"
FT                   /old_locus_tag="DEHA0E03355g"
FT                   /old_locus_tag="DEHA-IPF5575"
FT                   /old_locus_tag="DEHA-CDS1300.1"
FT                   /product="DEHA2E02640p"
FT                   /note="similar to uniprot|Q6MYD7 Aspergillus fumigatus ao-1
FT                   Copper amine oxidase 1 putative"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87660"
FT                   /db_xref="GOA:Q6BQS6"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS6"
FT                   /protein_id="CAG87660.1"
FT                   /translation="MTSIHPFDSVKDFEIRLASKLVKDAYPASANVHFVQIDRVDPPKK
FT                   DMIKYLDAEKLGETPQAIPRVLYTYYYTNTLTFNKALVNVTAGHIITKTQLPHGTVGPY
FT                   LPDDMMEWEKLCTNHPLVKAEIEKLKLPPGYTVRNDPWIYATDDPNERRPLVQFFMYVL
FT                   AGNGHTESNHYSLPLKFSPVFEAFTNKFIRIDYLPGGFDETITPTMPWKEVPCVEYHPD
FT                   LNNEVNMRDVKPLLISQPEGPSFSVNGSKVKWQGWEFRVATSAREGFAIYDASFKGRQA
FT                   FYRISLSEMTVPYGDPRAPYHRKQAFDLGDCGFGVNGNHLSLGCDCLGVIKYMDGVGIH
FT                   ANGEPFVVPNTVCMHEQDNGLLYKHVNYRTNNAVVARRREFIVQTIATVANYEYIINVK
FT                   FITDGSINIETRATGILSTMPIDENVKVPWGTIVGHNVMAAYHQHILSFRIDPSIDGHK
FT                   NSVVYDDVVKLPKDKLNPYGVGFITERKFVDRSGHIDQSPFTNRSYKIINENKINPISK
FT                   TPVGYKVVMPARQMILADDDSFNVKRAKFATEQVWVTKYRDHELFAAGEFTNQSQRDEG
FT                   LGTWANGVDPVRNEDLVVWATVGFTHIPRVEDFPVMPVEIHNIELVPFNFYDKNPALDI
FT                   PQANNTFNKSVLSDSNTAEKACCKTKI"
FT   gene            <238996..>239469
FT                   /locus_tag="DEHA2E02662g"
FT                   /old_locus_tag="DEHA0E03377g"
FT                   /old_locus_tag="DEHA-IPF5573"
FT                   /old_locus_tag="DEHA-CDS5933.1"
FT   CDS_pept        238996..239469
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02662g"
FT                   /old_locus_tag="DEHA0E03377g"
FT                   /old_locus_tag="DEHA-IPF5573"
FT                   /old_locus_tag="DEHA-CDS5933.1"
FT                   /product="DEHA2E02662p"
FT                   /note="weakly similar to uniprot|P10863 Saccharomyces
FT                   cerevisiae YER011W TIR1 Cell wall mannoprotein of the
FT                   Srp1p/Tip1p family of serine-alanine-rich proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87661"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS5"
FT                   /protein_id="CAG87661.1"
FT                   /translation="MQYTTLFGALLLAASSQAALDSSQLEFLTRFVNDARSHTKEYLSY
FT                   VQTADANIPKDFESLAKQIYATTGDGYTSEFDSAKVKTLESFATGMPWYDSRIAGSGSG
FT                   SDSSESGSGSSGSSSSSSSSSSTESSSASATGGAVGLMVPAGAGIAALAIALL"
FT   gene            <240017..>240088
FT                   /locus_tag="DEHA2E02684r"
FT                   /old_locus_tag="Deha0E.2"
FT   tRNA            240017..240088
FT                   /locus_tag="DEHA2E02684r"
FT                   /old_locus_tag="Deha0E.2"
FT                   /note="tRNA Asp (GTC) cove score=60.37"
FT   gene            <240097..>240167
FT                   /locus_tag="DEHA2E02706r"
FT                   /old_locus_tag="Deha0E.3"
FT   tRNA            240097..240167
FT                   /locus_tag="DEHA2E02706r"
FT                   /old_locus_tag="Deha0E.3"
FT                   /note="tRNA Gly (GCC) cove score=62.33"
FT   gene            <240600..>241472
FT                   /locus_tag="DEHA2E02728g"
FT                   /old_locus_tag="DEHA0E03443g"
FT                   /old_locus_tag="DEHA-IPF5571"
FT                   /old_locus_tag="DEHA-CDS4437.1"
FT   CDS_pept        240600..241472
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02728g"
FT                   /old_locus_tag="DEHA0E03443g"
FT                   /old_locus_tag="DEHA-IPF5571"
FT                   /old_locus_tag="DEHA-CDS4437.1"
FT                   /product="DEHA2E02728p"
FT                   /note="weakly similar to uniprot|P32323 Saccharomyces
FT                   cerevisiae YNR044W AGA1 Anchorage subunit of a-agglutinin
FT                   of a-cells highly O-glycosylated protein with N-terminal
FT                   secretion signal and C-terminal signal for addition of GPI
FT                   anchor to cell wall linked to adhesion subunit Aga2p via
FT                   two disulfide bonds"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87663"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS3"
FT                   /protein_id="CAG87663.2"
FT                   /translation="MSRIQESGMFSGRKGGGSWYEDYTNNKDNLNGHDRRQTKGRFGWV
FT                   KRLMQGQNRNQNGTLVSTSNMTENNGYANSRVRESRGTGSSQRSQSFSGGESYEYNTDN
FT                   DVNGMDQSEEIDSSNDNHEARSTTNSDQLTTQSENDNISTIPLKSMTSASTKSPSVLST
FT                   NQDNNSYVASTAETSLAPSIHANSVTQTLNPNSQLQSQTYDRDSESIVTLASSSRRTRR
FT                   RSLETNSSTAGIPPASIMERLAIHPNAASSTYTASIHNANDRTSIYNGNMGVSQSSVTD
FT                   SNDQANSVN"
FT   gene            <241943..>243988
FT                   /locus_tag="DEHA2E02750g"
FT                   /old_locus_tag="DEHA0E03465g"
FT                   /old_locus_tag="DEHA-IPF5569"
FT                   /old_locus_tag="DEHA-CDS1214.1"
FT   CDS_pept        241943..243988
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02750g"
FT                   /old_locus_tag="DEHA0E03465g"
FT                   /old_locus_tag="DEHA-IPF5569"
FT                   /old_locus_tag="DEHA-CDS1214.1"
FT                   /product="DEHA2E02750p"
FT                   /note="weakly similar to uniprot|P36047 Saccharomyces
FT                   cerevisiae YKL193C SDS22 Regulatory subunit of Glc7p type1
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87664"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS2"
FT                   /protein_id="CAG87664.2"
FT                   /translation="MGAFNYNDNSIEGDVYIQRLSTYVRRNEEALANGLMCFSKNRTNP
FT                   NIKPLRLSFTIHHLYYITERIESSPLGVDVGPLNIKLDNPNHVPTFISFMANNARSSRH
FT                   FDSDAKSITSINSMRSIVSSASVYWRSFAFSKDPKVINKDLRYLYSSFTKVPCLILTPK
FT                   TKINSITSYEEYPCDTSVPVKMFKNLQVLELVDYEPNEIFGWNILSEQLRVLIIKDSKI
FT                   SDIGEILFNLVIDDESGRSSFNFHKPSRKQTQDADTSYMDNDHPPFNHNSRHNVKRERD
FT                   KTTGAGSAPKDLLYSDTNLSRFGQDNTTESPTKDYYSLTDGKWSVLKQLTISETSITSI
FT                   RPYVFKPLGNLVKLNLSNNLLESLPEGLDQLHNIKYLNFADNYITDLKALPKNLKYLST
FT                   MNFNNNKLESLEGLENLCSLEKIDFRRNELKEIKSLKPIILQFIKNPEKFDNVYLANNA
FT                   LPKNYRIELFNLFNGVKYKNSMKIDDSRPGYFESALLLDAESAFKSLEKLFGYINDTNK
FT                   STKEQSLPPISTKVFAEFEKDKGRDTEIQTLLDPLATMNLISENDDNMKPRKVDISHIM
FT                   NMSTMSPILSSDSTSIVSASSKLPTPNSPLYNNQNLTNKQHTPDTTYTAKPTISTQTVS
FT                   VSSTPPVPTSLKRSTTLNQLDIESPSSNNAAPGIITNVQVTARMST"
FT   gene            <244602..>247046
FT                   /locus_tag="DEHA2E02772g"
FT   CDS_pept        244602..247046
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02772g"
FT                   /product="DEHA2E02772p"
FT                   /note="similar to uniprot|P22507 Saccharomycopsis
FT                   fibuligera BGL2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87665"
FT                   /db_xref="GOA:Q6BQS1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQS1"
FT                   /protein_id="CAG87665.1"
FT                   /translation="MTIVEKVNLTTGTGWGSGPCIGNTGSVPRLGIPNLCLQDGPNGVR
FT                   FTDFVTHFPSGLAAGSTFNRGLMYLRGKALGREHKKKGVHIMLGPTIGPIGLKAAGGRN
FT                   WEGFGADPYLQGIGGAATVEGIQEEGVIATVRHLIGNEQEHFRQVGEWNVSDWFLLEKS
FT                   ISSNIGDKEMHEVYLWPFADIVRSGAGSVMCSYNQVNNTYACENSYLLNYLLKEELGFQ
FT                   GFIMSDWGSQHTGVYSALAGLDMSMPGTIFNDWLGGKSYWGPHLTNAVYNQTIPQERLD
FT                   DMVIRILAPFFFCNAKGLPTEKDVPNFSSWTYNSYGQQYPLQHYGPTIQQNWHKEARSM
FT                   FSDQVALNIAREAIVLLKNEDFNLPINKTNGIRKIFISGVAAGTDPKGFNCKDQQCVNG
FT                   VLTTGWGSATVNNPYVVTPYEAISQKAKSQGMLVEFSTDAWKFDNVDELATNADMSIVV
FT                   VNSNAGEGYIQVDDNYGDRKNFSLWHNGDELIARVAQKCHKTVVVVNSVGPVNMEKWIE
FT                   NENIVAVIYAAPLGQFVGQAIADVLFGDVNPSGKLPFTIAKDDQHYVPLVDTLNGSRSP
FT                   QDTFERGIYLDYRFFEKHQIEPRFEFGYGLSYTNFQVSDLKIIEIKTPLKSLEQPNKYL
FT                   PAKIANENNILDPKAALFPNGIIEFVPGFVYPYLHYGNSTLLNNNREFDYPLGYKPDPV
FT                   RTPPVAGGGAGGNPALWNILYEISAYVTNAGRYRGGYATQMYIEFPNNPSPQSTKVLRG
FT                   FDKVFLDPGEETEVKFNVLQRDLSIWDVKQQEWIIQNGTYKVYISTTSKKTELYGIIQI
FT                   CC"
FT   gene            <247909..>249615
FT                   /locus_tag="DEHA2E02794g"
FT   CDS_pept        247909..249615
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02794g"
FT                   /product="DEHA2E02794p"
FT                   /note="similar to uniprot|P38358 Saccharomyces cerevisiae
FT                   YBR293w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65746"
FT                   /db_xref="GOA:B5RTT4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT4"
FT                   /protein_id="CAR65746.1"
FT                   /translation="MSQQNKIHSLEKDSDINVMQKSINSDLSEKLGDSHMNILPTKKIV
FT                   ICLSVLAMASMISFIDQTGVTVATSVIGKDLDSETTINWAGTASLLANCICQVLFGRLS
FT                   DIFGRKNVLMSGLLILAIADIGCGVSQTGVQFYVCRALAGIGNGCSSSLPQIILSDIVT
FT                   LRDRGRYQGILGMSIGLGNSIGPFLMAGFIHGATWRCFYYMLCPLNLLVIVVIYVFIKN
FT                   PVKKSEIILTRKEKFMKIDYIGIFFATACLTLLLIPISGGGSTYPWNSPIIIAMFIVGG
FT                   GLFFVFLLVEWKFAKLPMIPLRIFKLPMVSLIFLSTFFFGMAYFSFLYYQPYYFEIVKD
FT                   KDIVHTSLFVLPLVLCQAVMSAVSGQIITYTGHYIYVIITGYALWLLGNCLLLLWNENV
FT                   NDGVNVVSLLIIGCGVGFTFQPSMVAVQAQAKKADRAVVISTRNVIRSFGGAVGIAVGS
FT                   TTVSNSFLNNIKQLEKDNTTKIPSSYLRYLETNIYSRFDTSSLTTKQTSAVRLMYVNAL
FT                   KNYFYLLIPFIAICLITSFFIKDRGLQCIDEIEPPTRKNSDTESSVSRNRA"
FT   gene            <249951..>251819
FT                   /locus_tag="DEHA2E02816g"
FT                   /old_locus_tag="DEHA0E03531g"
FT                   /old_locus_tag="DEHA-IPF5562"
FT                   /old_locus_tag="DEHA-CDS1513.1"
FT   CDS_pept        249951..251819
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02816g"
FT                   /old_locus_tag="DEHA0E03531g"
FT                   /old_locus_tag="DEHA-IPF5562"
FT                   /old_locus_tag="DEHA-CDS1513.1"
FT                   /product="DEHA2E02816p"
FT                   /note="weakly similar to uniprot|P25386 Saccharomyces
FT                   cerevisiae YDL058W USO1 involved intracellular protein
FT                   transport coiled-coil protein necessary for protein
FT                   transport from ER to Golgi integrin analogue gene"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87667"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR9"
FT                   /protein_id="CAG87667.2"
FT                   /translation="MNNKSTLDRKYQRSRELGYIPRRTIHRSPLKFETIPRNRSTFTPK
FT                   HKLAKYTSDDARYDSARYTDNKNTDSPIRSISSLPYTPSKLQPTKLYKLFNDSTPVNKG
FT                   ILITNRNRRYDGKNRKVAALEDSGGIFSRLRSFLVKFSLSSHEDDQTDLNLLRKSAKNV
FT                   LNVDESPENKGNKRVWFEKDDHKEIKRRDISFEEPRDLVDEATIQKRKHYESEQTRNRF
FT                   EELRDIIIREKDNNERLRSKYDDRIKSLKIEFDKCTKELNQQILVLQNRARLHVDELEK
FT                   TKLEQLERELFKEHEKFLVKQKEQEQELSKERRRLQTLGYELNSKRNKLENDLATLEKD
FT                   REAILQQKLEISLKCKNLDELNERNMQLTNNRKTNNFGPNDVVVTRLGLNQERYKQERK
FT                   LLNEEKRIIKSDLDANENDYVQFFEKLIDISQSILKEGDTHKEYILNDFETLLESLNTK
FT                   DMPKNSLIKFESIKGKFSEYSKAFHRFQSAYARSKAQDIGEEYNIDNLIDIRSLFTRLT
FT                   ESFSKSIYKKRKGLFQMNQEISAFQINLMSSSTSSQRCRDIANAYDKRSKILNEMKVLN
FT                   ELLISLSVLSKQLEEIIIIIGHSPNIPSNGLLLDTDSIEDHYSSEI"
FT   gene            <251946..>253955
FT                   /locus_tag="DEHA2E02838g"
FT                   /old_locus_tag="DEHA0E03553g"
FT                   /old_locus_tag="DEHA-IPF5557"
FT                   /old_locus_tag="DEHA-CDS1270.1"
FT   CDS_pept        251946..253955
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02838g"
FT                   /old_locus_tag="DEHA0E03553g"
FT                   /old_locus_tag="DEHA-IPF5557"
FT                   /old_locus_tag="DEHA-CDS1270.1"
FT                   /product="DEHA2E02838p"
FT                   /note="similar to uniprot|P24482 Saccharomyces cerevisiae
FT                   YPR175W DPB2 Second largest subunit of DNA polymerase II
FT                   (DNA polymerase epsilon)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87668"
FT                   /db_xref="GOA:Q6BQR8"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR016266"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQR8"
FT                   /protein_id="CAG87668.1"
FT                   /translation="MENPSALPIKLQPSNLRPIAYRILSKKHGLNIQTDALKLLTDAVS
FT                   YKFGFDWKSTQSQQFLEEIAKIWKKQDRGIFIDGPGLKQVIKELSDRNTNQISTRNGSA
FT                   DNLAKKAERSDTLVDNDAENEPVNNAENTLNWQDYFKVINPDEQPNYKYDKHRKQLSFI
FT                   PSTNAKRLANNLNSNVDYFNNRYHLISDRLSRNENFQKPSFSSISSISKSLSHNNKTNE
FT                   ITLIKNVLGRDGSKFILFGLLSKNANDDFILEDSTDHIELNLTQAYKTEGSFYCPGMFV
FT                   IVEGIYSASGGSMSNANVIGGCFHVSNIGHPPAERRELSMENYGNLDFMGINRDNDTNN
FT                   NDNHILRVNKSLKKKLVSLEKTLVNHKLIILGSDCFLDDLKILDGIKKLFGKIESSLID
FT                   DETNQPLVIVLIGSFTSNPLTPTNSSVANVSNTENYKSNFDNLSNILSNFPNIVQKVKI
FT                   ALIPGINDPWQSSHSLGGSNLNAFPQRSIPKIFTNRLERLLPKGNLIAGWNPLRINYLS
FT                   QEIVLMKDDIINKFKRNDIIFSNDLELEQLKLQKDKNDDGLIHATDINTKEPHISPKIK
FT                   QARKLVKTILDQGNLQPFLKDIRIINTNFDYSLRIEPLPTILILNDATFPTFEVTYNGC
FT                   KVINTGKLVGNNRKLSFVEYFPSGKKFEFKEVYF"
FT   gene            <254094..>255098
FT                   /locus_tag="DEHA2E02860g"
FT                   /old_locus_tag="DEHA0E03575g"
FT                   /old_locus_tag="DEHA-IPF5556"
FT                   /old_locus_tag="DEHA-CDS3867.1"
FT   CDS_pept        254094..255098
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02860g"
FT                   /old_locus_tag="DEHA0E03575g"
FT                   /old_locus_tag="DEHA-IPF5556"
FT                   /old_locus_tag="DEHA-CDS3867.1"
FT                   /product="DEHA2E02860p"
FT                   /note="similar to uniprot|P20133 Saccharomyces cerevisiae
FT                   YPR176C BET2 Beta subunit of Type II
FT                   geranylgeranyltransferase required for vesicular transport
FT                   between the endoplasmic reticulum and the Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87669"
FT                   /db_xref="GOA:Q6BQR7"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR7"
FT                   /protein_id="CAG87669.2"
FT                   /translation="MTSVETKELKFVKEKHVKYIQDLDSESTKQTFEYWLSEHLRMNGL
FT                   YWGVTALGIMNSLDALSRDGVVQFVLSCWDAKQGGFGAYPKHDAHILSTLSAIQILAVY
FT                   DSLEILNEQKRGQLIEFIRGLQLDNGCFQGDSFGETDTRFVYTAIQALAILGELTQEVI
FT                   DPAVNFIMKCENFDGAFGMLPGAESHAAQVFTCLGTLAITNSLHLVNDVKLGNWLSERQ
FT                   VLPSGGFNGRPEKLPDVCYSWWVLSSLSILGKKHWIDADKLEHYILACQDLEKGGISDR
FT                   EDNQTDVFHTCFGITGLSLIESKTFPFSKIDPIYCLPTTVSEKLKKWPADYQT"
FT   gene            complement(<255441..>256205)
FT                   /locus_tag="DEHA2E02882g"
FT                   /old_locus_tag="DEHA0E03597g"
FT                   /old_locus_tag="DEHA-IPF5555"
FT                   /old_locus_tag="DEHA-CDS4800.1"
FT   CDS_pept        complement(255441..256205)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02882g"
FT                   /old_locus_tag="DEHA0E03597g"
FT                   /old_locus_tag="DEHA-IPF5555"
FT                   /old_locus_tag="DEHA-CDS4800.1"
FT                   /product="DEHA2E02882p"
FT                   /note="weakly similar to uniprot|P40059 Saccharomyces
FT                   cerevisiae YER088C DOT6"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87670"
FT                   /db_xref="GOA:Q6BQR6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR6"
FT                   /protein_id="CAG87670.2"
FT                   /translation="MSVTMSYNNHQNQKYHPYSFRPDQNRHGYYCINQVPISHSQPPTT
FT                   QTTIPPLQIPGIRSTLQTTIPQAQVQAQPHLSAPIPQPQVYYQPYPPQQYYTYVQPQGE
FT                   SSLPSNKPRKTKHFSTWTPAEDKLLRELKEEQKMGWKQISTYLNDRTPNACQFRWRRVV
FT                   GSINVSNTSVATLLPSSPEALSSRSHSLTHIDTPSSPMTSPNQPNPSIAEPAESESREH
FT                   MQIAGTTPDTRNSSHITERRKSSHHSINFLLN"
FT   gene            complement(<256839..>259220)
FT                   /locus_tag="DEHA2E02904g"
FT                   /old_locus_tag="DEHA0E03619g"
FT                   /old_locus_tag="DEHA-IPF5550"
FT                   /old_locus_tag="DEHA-CDS0858.1"
FT   CDS_pept        complement(256839..259220)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02904g"
FT                   /old_locus_tag="DEHA0E03619g"
FT                   /old_locus_tag="DEHA-IPF5550"
FT                   /old_locus_tag="DEHA-CDS0858.1"
FT                   /product="DEHA2E02904p"
FT                   /note="similar to uniprot|P39955 Saccharomyces cerevisiae
FT                   YER047C SAP1 Putative ATPase of the AAA family interacts
FT                   with the Sin1p transcriptional repressor in the two-hybrid
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87671"
FT                   /db_xref="GOA:Q6BQR5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR5"
FT                   /protein_id="CAG87671.2"
FT                   /translation="MFSRRKPPQLPLVEELQQTYNDCCNLTIRNLTLEEQNKVEDALKG
FT                   WKSLHTSLLFKIEAFDKQVIKTDSEEGTLLEELKRIRDENVKHLIRSQLRMDEITRKQN
FT                   TSSSNKPAIKVTSGHQGSSMTVPSLRGNGGSSSRSLTNTNATNQRRMLKSLRPGIPQHK
FT                   SLNTKGAAQASKAATVSWRKPSNSKVPTIKPAKDDMFEDFDQDSFEFFDSNWEKVDSPP
FT                   NLIDLDIPINGDNNETGNYLGQGLSNNGTKTNGLHDVSSSMENLTINNDFPKPRINKPS
FT                   VGQNLKLQPKLSDYASKSTSDIGVSSNDGENKGVYMYNKPKPLNINRLMKGQQQKPPAS
FT                   RSPVRQSPAPKAKPQPKSQPVYKAKPVMKPPQASTQPPKKPNISYNYIPGSQSANKPRQ
FT                   NPKKTTATTAASSTAQAKPRTAAPKNIGKDDDIPMSPTMDDILGGYDDNKPLDEEMEKA
FT                   LKDSLDETDDPNRPLDDDEQATLIASIRGIDPLAATQILNDIVVHGDEVYWDDIVGLES
FT                   AKNSLKEAVVYPFLRPDLFKGLREPTRGMLLFGPPGTGKTMLARAVATESKSTFFSISS
FT                   SSLTSKYLGESEKLVKALFLIARKLAPSIVFVDEIDSLLSSRSDGDAESSRRIKNEFLI
FT                   QWSELSSAAAGRDKDDGDDVSRVLILGATNLPWSIDEAARRRFVRRQYIPLPEDETRKS
FT                   QIIKLLAHQKNTLSKDDYNELIALTKGFSGSDITALAKDSAMGPLRSLGDKLLDTPTEN
FT                   IRPINLDDFRASLNYIRPSVSSEGLVEYENWAVKFGSSGV"
FT   gene            <260025..>260663
FT                   /locus_tag="DEHA2E02926g"
FT                   /old_locus_tag="DEHA0E03641g"
FT                   /old_locus_tag="DEHA-IPF5545"
FT                   /old_locus_tag="DEHA-CDS5234.1"
FT   CDS_pept        260025..260663
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02926g"
FT                   /old_locus_tag="DEHA0E03641g"
FT                   /old_locus_tag="DEHA-IPF5545"
FT                   /old_locus_tag="DEHA-CDS5234.1"
FT                   /product="DEHA2E02926p"
FT                   /note="similar to CA5966|IPF959 Candida albicans IPF959"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87672"
FT                   /db_xref="GOA:Q6BQR4"
FT                   /db_xref="InterPro:IPR024316"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR4"
FT                   /protein_id="CAG87672.2"
FT                   /translation="MSELKDYIAQIASIAMTVLVMVFQNCIILFNYSYRTYPQFTLMVM
FT                   GIVGAYMVYRLVLRMIRMWIGFLMGIIKALLMLVFICVCGAVYFRGWRFFTQDVHFIKQ
FT                   AIIDLYHNHDGSRKHYTKGFNVMNGFFGMFNGGDAQKGKFGSSNVLEDYGIEIDKSYFD
FT                   YVEDHFHTGGDFDFDKIGQFVSDNLGDLLEGVDMQEMSNNILGSFMNRN"
FT   gene            complement(<260775..>262562)
FT                   /locus_tag="DEHA2E02948g"
FT                   /old_locus_tag="DEHA0E03663g"
FT                   /old_locus_tag="DEHA-IPF5544"
FT                   /old_locus_tag="DEHA-CDS1653.1"
FT   CDS_pept        complement(260775..262562)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02948g"
FT                   /old_locus_tag="DEHA0E03663g"
FT                   /old_locus_tag="DEHA-IPF5544"
FT                   /old_locus_tag="DEHA-CDS1653.1"
FT                   /product="DEHA2E02948p"
FT                   /note="weakly similar to uniprot|P36172 Saccharomyces
FT                   cerevisiae YKR105C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87673"
FT                   /db_xref="GOA:Q6BQR3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR3"
FT                   /protein_id="CAG87673.2"
FT                   /translation="MQEHVNFDGANKNLENLENQSSASLNTANISQVEGNTKSRVVRET
FT                   DVQNNIGDDESDLAERLGDAHLNILPTKKMIVCLATMSLGLFISFVDQTGITIALPHIA
FT                   KDLNAETTINWAGTSSLLANCVCQVLVGRFADIFGRKTVLLYSFFLLAVADLACGLAKT
FT                   GVQFFIFRACCGIANGGIQSLTNIIISDIVVLKKRAKYYGILSSSIGLANCTGPLILAG
FT                   FIKGSSWRTFYYIMPAICFLVAVIIYFVVNKNRKDKQEVLSRREKFKKIDYLGFIFSSA
FT                   GLILLLIPISGGGSTYKWNSGLIIAMFIVGGLCLVGFLLIEWKIPRLPMIPLGLFKSGS
FT                   LSLVLSTNFLYGMTYYSFTYYIPYYFQIVRGYDSIMASVLLIPLVLMQAINSIISGQII
FT                   SYTGHYKHVILFGYGSWVLSCGLLLLWSETINIGVVIVVLLIMGIGLGFTFQPCMVAAQ
FT                   AQARKSERAVVIGARNVIRSFGGAIGIAMGSLIVSNTLLKEINQALVHKEKYANIPTDY
FT                   LNYLKSHIYTRIEVTGLNEKQVKVIKSMYMKSLMNYFYLGIPLIGICFISSFFLKDRGV
FT                   QCIDEQPEPKDKEKDITSK"
FT   gene            <263460..>264815
FT                   /locus_tag="DEHA2E02970g"
FT                   /old_locus_tag="DEHA0E03685g"
FT                   /old_locus_tag="DEHA-IPF5543"
FT                   /old_locus_tag="DEHA-CDS2720.1"
FT   CDS_pept        263460..264815
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02970g"
FT                   /old_locus_tag="DEHA0E03685g"
FT                   /old_locus_tag="DEHA-IPF5543"
FT                   /old_locus_tag="DEHA-CDS2720.1"
FT                   /product="DEHA2E02970p"
FT                   /note="similar to uniprot|P39101 Saccharomyces cerevisiae
FT                   YER048C CAJ1 Nuclear type II J heat shock protein of the E.
FT                   coli dnaJ family contains a leucine zipper-like motif binds
FT                   to non-native substrates for presentation to Ssa3p may
FT                   function during protein translocation assembly and
FT                   disassembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87674"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR2"
FT                   /protein_id="CAG87674.2"
FT                   /translation="MIKDTKYYDILGVEPTATDVELKKAYRKQAIKCHPDKNGNDPDAA
FT                   AKFQELGEAYGILQDKEKRALYDEMGVEGMQSNNVAGEADIDPAEFFSMIFGGEVFKDW
FT                   IGELSMLNEVSKTADILGDEEGTESESQTADSTTATSEVATQSESASDVTKTNEEKDDI
FT                   LSTEAINKKKKQKMTQHQREEILKLHEETKKAQEERVRVLSENLLSRIEQYTSASTNQD
FT                   SLDRFKTKLNEELEDLKIESFGIELLHLIGKIYTNQAHATINSCKTFGVSKIFSSVKSK
FT                   TNSFKNGFSILKTALDAQASVEAMVREQEDIQEAIEKGEELSDSQKHRQVEMERLITGK
FT                   VLAAAWASTKFEVTGILNKVCTRVLNDKSLGKKVRISRSQAVLYIGETMLKVQRSPEEA
FT                   EDARIFEEMMADATAKKSTKRNKKSKVSDRDIEEFMTNVNEVHEVNEPEDIK"
FT   gene            <264984..>265250
FT                   /locus_tag="DEHA2E02992g"
FT                   /old_locus_tag="DEHA0E03707g"
FT                   /old_locus_tag="DEHA-IPF5541"
FT                   /old_locus_tag="DEHA-CDS7614.1"
FT   CDS_pept        264984..265250
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E02992g"
FT                   /old_locus_tag="DEHA0E03707g"
FT                   /old_locus_tag="DEHA-IPF5541"
FT                   /old_locus_tag="DEHA-CDS7614.1"
FT                   /product="DEHA2E02992p"
FT                   /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
FT                   YER048W-A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87675"
FT                   /db_xref="GOA:Q6BQR1"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR1"
FT                   /protein_id="CAG87675.1"
FT                   /translation="MPNSKQILGLYKQLLEKAYKFDNYNFREFAKRKVVDSFKANKSLK
FT                   NDEAIKSFYNEGINQLAMLQRQTTISQMFTFDKVVVEPLKKHH"
FT   gene            complement(<266030..>266103)
FT                   /locus_tag="DEHA2E03014r"
FT                   /old_locus_tag="Deha0E.45"
FT   tRNA            complement(266030..266103)
FT                   /locus_tag="DEHA2E03014r"
FT                   /old_locus_tag="Deha0E.45"
FT                   /note="tRNA Asn (GTT) cove score=74.40"
FT   gene            <266296..>266526
FT                   /locus_tag="DEHA2E03036g"
FT                   /old_locus_tag="DEHA0E03751g"
FT                   /old_locus_tag="DEHA-IPF5540"
FT                   /old_locus_tag="DEHA-CDS7932.1"
FT   CDS_pept        266296..266526
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03036g"
FT                   /old_locus_tag="DEHA0E03751g"
FT                   /old_locus_tag="DEHA-IPF5540"
FT                   /old_locus_tag="DEHA-CDS7932.1"
FT                   /product="DEHA2E03036p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87676"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQR0"
FT                   /protein_id="CAG87676.1"
FT                   /translation="MDHDKTKEKALNHFQSVLGDKYKEYEFFFADDNGLLLINPVERRE
FT                   IDELGQDRLLEMAIDTLPHRCMVCMEHNVFT"
FT   gene            complement(<266722..>270369)
FT                   /locus_tag="DEHA2E03058g"
FT                   /old_locus_tag="DEHA0E03773g"
FT                   /old_locus_tag="DEHA-IPF5539"
FT                   /old_locus_tag="DEHA-CDS0223.1"
FT   CDS_pept        complement(266722..270369)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03058g"
FT                   /old_locus_tag="DEHA0E03773g"
FT                   /old_locus_tag="DEHA-IPF5539"
FT                   /old_locus_tag="DEHA-CDS0223.1"
FT                   /product="DEHA2E03058p"
FT                   /note="weakly similar to uniprot|Q03660 Saccharomyces
FT                   cerevisiae YMR218C TRS130 Component of the targeting
FT                   complex (TRAPP) involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87677"
FT                   /db_xref="InterPro:IPR022233"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ9"
FT                   /protein_id="CAG87677.2"
FT                   /translation="MEIDDLNLRNPVQVGYYDPFNVYPLIKDELQSKLPLTNLHWKYNI
FT                   SKPLKSIPLLPVTFVEEVPKHTSVKENDKMYSRIMFIKYENLDTYRAQVRPLIKEWLKQ
FT                   LVSDSEVEWAIILLMGSSSKDKSSTIIKTSIFDKLKIDFGIDGKELQTLPVDSGVKERC
FT                   FKLREVYEDDMTKLESYNELINHMKDFLVSSFNNKYVSFNQMIYNHQATDFKAFILKLK
FT                   LADLLNDMRLLNDSLSIYNELSNDLNKLYYANPSKFETEITHIPSDLNGYQFEQSFSSI
FT                   SIKNSLNKEKINLFELKSLIFVNQSSLLQLLANYANSISLSSISISSIYQKLLYFLNDL
FT                   SNIFGDKLNEWIFVVIDNYLKLPICNKIMNDNMKSSDGEQYYQLSEILEFKGELKLAQR
FT                   SKLAKVANSHGYAINGINEILEEISLNDDTSSKNTSELSYKPLLEILSNENTYYKHFEK
FT                   LTELIIHDFVNSGRTKTIDILSIDLALLNYQIGNYQESLNILQDSYEFFINNSWNFMGG
FT                   ILLEIYLNCTEKLDQSDYSLISLTCLRLFSNLVNPKNGKYGINNYKLIKPKVKIARLFE
FT                   KIEEFSGKLNESIEFPLEKIFKVDIKPFIQSDESTYADKYFIQINLTNYYGIEFSFKEI
FT                   KLMLENSEGVTSFNIENVMISNNVDNTLKLYSNNFKFGSFNPSNITVKINNNLCFTKRY
FT                   SSENGTENDDTIIQYNNETILKDSFLNDSESRDIVVAHNKWTSDMFFYQSLSKFSCEFC
FT                   TPIDIDLESTEIILRIKNGHNNVEDVKIDIISNTNGLKINKELLKDRLKIMTLSSKESI
FT                   DIKIPYSYYRDNKIISLKANISYSSNGENFSHFIIDQVDTTLTISVSVQDIFKSQYIFS
FT                   KFQVGTSNPKLPIRILSNDLTTKNENYSIISPKHSPRPITFGDQPASYFYKIIPKSDYS
FT                   IKSLDSLDLRVEYSDLKNECYDIIQSFLLHRLQDLQLRKYWFLIKSLLFKDISFDLNNY
FT                   AVNSEVRIINNREIELLIEKALLKHIEETEDKKKLIELFKHVLFDNEFKFEVMPNFENK
FT                   QLIISVPIPVLNILQIIEFEFERKPQYLVGEPILMNLKIESITKWSNNKVKAGSEDEIE
FT                   ILAESSPSKPEKPSVQKENFQLSIQTDDNWLISGFRKESFQIDYVANENKSNFEVVLIP
FT                   LTVGRLLLPKINVRTLDNLENDFSMDINFKNGLETLLVVPDVNSITFSF"
FT   gene            complement(<270505..>270575)
FT                   /locus_tag="DEHA2E03080r"
FT                   /old_locus_tag="Deha0E.44"
FT   tRNA            complement(270505..270575)
FT                   /locus_tag="DEHA2E03080r"
FT                   /old_locus_tag="Deha0E.44"
FT                   /note="tRNA Gly (GCC) cove score=62.33"
FT   gene            complement(<270584..>270655)
FT                   /locus_tag="DEHA2E03102r"
FT                   /old_locus_tag="Deha0E.43"
FT   tRNA            complement(270584..270655)
FT                   /locus_tag="DEHA2E03102r"
FT                   /old_locus_tag="Deha0E.43"
FT                   /note="tRNA Asp (GTC) cove score=60.37"
FT   gene            <271208..>272296
FT                   /locus_tag="DEHA2E03124g"
FT                   /old_locus_tag="DEHA0E03839g"
FT                   /old_locus_tag="DEHA-IPF5538"
FT                   /old_locus_tag="DEHA-CDS3550.1"
FT   CDS_pept        271208..272296
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03124g"
FT                   /old_locus_tag="DEHA0E03839g"
FT                   /old_locus_tag="DEHA-IPF5538"
FT                   /old_locus_tag="DEHA-CDS3550.1"
FT                   /product="DEHA2E03124p"
FT                   /note="similar to CA2161|IPF11876 Candida albicans
FT                   IPF11876"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87678"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ8"
FT                   /protein_id="CAG87678.2"
FT                   /translation="MAENQETTPLLNEGTSTGTSTKPASKKTRIILGIFAIIGILAITG
FT                   WTVYRITEKTPLVNEPLKIRLYTHNIRFDNHHTDVNEEKWSKRRQLVTSSIDFNTDSGS
FT                   ANVVCLQEVLHNQLEDILYNLNEGNTTDDWTYFGVGRTDGKTEGEYAPILFKRAEWNVV
FT                   DNSTSWLSESPEVPSRGWDAALERIVSMVTLESKANPFVRLNFFNTHFDHKGKKARRES
FT                   ARLIVDRMENYNGYPSFLCGDFNTKPEDEPYQILKSHGFKDSRTLIDQLHSYGHKATFT
FT                   GFDNLHEDTAIIDYVWGPYFAKNGNQSPSILESEDINYYDLDLHEEYKVMIKQYAVLHS
FT                   RFHGFYMSDHRPVSADYYIYKD"
FT   gene            complement(<272539..>274302)
FT                   /locus_tag="DEHA2E03146g"
FT                   /old_locus_tag="DEHA0E03861g"
FT                   /old_locus_tag="DEHA-IPF5535"
FT                   /old_locus_tag="DEHA-CDS1707.1"
FT   CDS_pept        complement(272539..274302)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03146g"
FT                   /old_locus_tag="DEHA0E03861g"
FT                   /old_locus_tag="DEHA-IPF5535"
FT                   /old_locus_tag="DEHA-CDS1707.1"
FT                   /product="DEHA2E03146p"
FT                   /note="weakly similar to uniprot|P27825 Saccharomyces
FT                   cerevisiae YAL058W CNE1 Functions in endoplasmic reticulum
FT                   protein quality control"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87679"
FT                   /db_xref="GOA:Q6BQQ7"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ7"
FT                   /protein_id="CAG87679.2"
FT                   /translation="MKLNCFSIGASVLLATNLVSGVNVNHPSFTPFDKSKLDKSSFFEQ
FT                   FDYITLLNSDWKISHAQKDDKVAYVGKWNIEEPTVYPGFENDKGLVLKTPAAHHAISYK
FT                   LEQPFDNTDNDLVLQYEIKLQDGLECGGTYIKLLDYDFDKDDEFNNDTPYQVMFGPDKC
FT                   GSENKIHFILRRFNPISKEHEEKHLVNTPMSRTGKLSTLYTLILKKNQDFEIRINGEVA
FT                   KAGNLIQKPKLMKPPLNPPKEIVDKDDFKPIDWDDRKFIPDPEQAEKPDDYDIKHGLSL
FT                   IPDPNAVKPADWNDDEPEFVEDPSAHKPEEWDDDEDGVWLAPEIPNPKCSSGCGTWEAP
FT                   LIINPTYVGPWIQPVIPNPNYNGEWKPRSKSNPNYFEDLKPSNLELIGGLGFELWSMDG
FT                   DILFDNIYLGHSIKEAELIGNKTYSPKYDIEEYDLEHNKPPVKNEPIAPPPTFEDFVNN
FT                   DQSTFSRIREIFSMLYANQYSDISSFYYKFMSNPVETIIQEPVVFFIYCCAFVSVFTFA
FT                   FGIFGALVFMVTGASQVTQYEQQPETIPKINEPDSDGNEDKHKIEDIIDDDEVKVSSIK
FT                   TSVTSASKRRA"
FT   gene            complement(<274544..>275160)
FT                   /locus_tag="DEHA2E03168g"
FT                   /old_locus_tag="DEHA-IPF5534"
FT                   /old_locus_tag="DEHA-CDS5573.1"
FT   CDS_pept        complement(join(274544..275082,275148..275160))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03168g"
FT                   /old_locus_tag="DEHA-IPF5534"
FT                   /old_locus_tag="DEHA-CDS5573.1"
FT                   /product="DEHA2E03168p"
FT                   /note="similar to uniprot|P39715 Saccharomyces cerevisiae
FT                   YAL059W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87680"
FT                   /db_xref="InterPro:IPR022784"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ6"
FT                   /protein_id="CAG87680.3"
FT                   /translation="MAKKISKHSRAARRGLVEDLGEAKDLASLPKPESDDVRKSIIRTT
FT                   IKNEDLLNKKMENQRIKKMNRKKTSSLKHRLERSNKVDGVLSTKIEQSIARAKYVQNSR
FT                   KSAWDQINKGISTTNDLVDNNEPLEKSEEQAEKEEEDAYVKQFFEDDSGKQNDDTSNST
FT                   SGKPDNKNMNRFALLEESEA"
FT   gene            complement(<275322..>277250)
FT                   /locus_tag="DEHA2E03190g"
FT                   /old_locus_tag="DEHA0E03905g"
FT                   /old_locus_tag="DEHA-IPF5533"
FT                   /old_locus_tag="DEHA-CDS1393.1"
FT   CDS_pept        complement(275322..277250)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03190g"
FT                   /old_locus_tag="DEHA0E03905g"
FT                   /old_locus_tag="DEHA-IPF5533"
FT                   /old_locus_tag="DEHA-CDS1393.1"
FT                   /product="DEHA2E03190p"
FT                   /note="similar to uniprot|P32776 Saccharomyces cerevisiae
FT                   YDR311W TFB1 Subunit of TFIIH and nucleotide excision
FT                   repair factor 3 complexes required for nucleotide excision
FT                   repair target for transcriptional activators"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87681"
FT                   /db_xref="GOA:Q6BQQ5"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="InterPro:IPR027079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ5"
FT                   /protein_id="CAG87681.2"
FT                   /translation="MSSISGACMVSKISGMIHIREDTTPSVLEWNAIDQSKTVAIPLNS
FT                   LTNLRASKETAPKMMLLVLYKLNNDQDEKELRLTFTNRPTMNNIKDSLQTIVARQKTVI
FT                   KDSPTPMPSSSAPSTPVPSSSANSAGSTSTSNMLSFTDPQSLSDSSLLKNHQLQQKLLL
FT                   EDKNLRNTFTQSVINFKLSPNVFWSTRLNQLRTYALTISQQKGPYNVLSTIKPVASSDN
FT                   QVNVNVTRDTINEIFGTYPIIRKAFDDLVPSKFPEGEFWSRFFNSKLFRRLRGDKINTS
FT                   NERGDFVLDKYLYIDSDFVEKEDADESNKQTKLPDKSEVQVNKFLDLLGNEEDNSQKLG
FT                   NMPDITMRYSDDVNKQNALLNPTVRGKTPQKGQENEMIILMKNMNKLSSKMVHMSAESE
FT                   SHKTQDDDLSAAEVNEYEQELNLHDLNEIEDLKYVELNINTKSHIMFADSQEDSTQNVS
FT                   PDELSAFLSGNTFQPQLNGINLTETYSSKKDEINKSANDITTLIKQNFRTFKLINQSSK
FT                   ESSENVIVPDSMIQEIVTYNITIMEFLSQFWKLFLNGTNPNQLKKIFASLKNCKNALNQ
FT                   LSEKITTTINNSSLVQDKPKLKEKLCKDLATCISPLQNGLDKACTDYIKAVRMSTETNE
FT                   NGKRPLE"
FT   gene            <277424..>277990
FT                   /locus_tag="DEHA2E03212g"
FT                   /old_locus_tag="DEHA0E03927g"
FT                   /old_locus_tag="DEHA-IPF5531"
FT                   /old_locus_tag="DEHA-CDS5491.1"
FT   CDS_pept        277424..277990
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03212g"
FT                   /old_locus_tag="DEHA0E03927g"
FT                   /old_locus_tag="DEHA-IPF5531"
FT                   /old_locus_tag="DEHA-CDS5491.1"
FT                   /product="DEHA2E03212p"
FT                   /note="weakly similar to uniprot|P40452 Saccharomyces
FT                   cerevisiae YIL157C FMP35 The authentic non-tagged protein
FT                   was localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87682"
FT                   /db_xref="GOA:Q6BQQ4"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="InterPro:IPR042432"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ4"
FT                   /protein_id="CAG87682.1"
FT                   /translation="MLSRNIGISTLTKRINVTRGIGGLRVYARLNSSTSSQVPPQRPPV
FT                   TVDREFPDPFKAKKQNRRYFLAYGLGVTLACAVIFNYEKTTSPIINSVMYFLRRSQNAK
FT                   QLLGEDIGFKNSWPWIWGTLNTVRGDIDIEFAVQGSQNTGKLKLKATRESKLHPFDIHH
FT                   WILQINDAQKTQINLLEDASVEFGL"
FT   gene            <278277..>279236
FT                   /locus_tag="DEHA2E03234g"
FT                   /old_locus_tag="DEHA0E03949g"
FT                   /old_locus_tag="DEHA-IPF5530"
FT                   /old_locus_tag="DEHA-CDS4029.1"
FT   CDS_pept        278277..279236
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03234g"
FT                   /old_locus_tag="DEHA0E03949g"
FT                   /old_locus_tag="DEHA-IPF5530"
FT                   /old_locus_tag="DEHA-CDS4029.1"
FT                   /product="DEHA2E03234p"
FT                   /note="some similarities with uniprot|P18494 Saccharomyces
FT                   cerevisiae YER040W GLN3 Transcriptional activator of genes
FT                   regulated by nitrogen catabolite repression (NCR)
FT                   localization and activity regulated by quality of nitrogen
FT                   source"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87683"
FT                   /db_xref="GOA:Q6BQQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ3"
FT                   /protein_id="CAG87683.2"
FT                   /translation="MAYDNGLAVGLGVGIPSAVIVLFCLIMWYRNERKQSREDRMENEI
FT                   DLGLRDDQSFNQFEEELHKKRGERNKSSLTQEEAGAEAHAEKTYQTSLSNGSSSTTNFL
FT                   DRKVIATHQKTPSSYDFYESVIPILPPNAYYNTSTQSPASSNNNVPTTDKVANGSTISP
FT                   PRIPNDNFASSNESIVASPTIASNGPDKSLDTLAKQLTGPSYFEKLPSRAATVSLKQRN
FT                   QIISNNSSSDILTNSFPSTKNSQAQESASEIQSGFYSKVPKSSTHSNLADIANGNQMDS
FT                   ADEIAEPFEDTNEHSGISPFSIRKNDSQDTYKPDVVIE"
FT   gene            <279518..>280564
FT                   /locus_tag="DEHA2E03256g"
FT                   /old_locus_tag="DEHA0E03971g"
FT                   /old_locus_tag="DEHA-IPF5529"
FT                   /old_locus_tag="DEHA-CDS3691.1"
FT   CDS_pept        279518..280564
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03256g"
FT                   /old_locus_tag="DEHA0E03971g"
FT                   /old_locus_tag="DEHA-IPF5529"
FT                   /old_locus_tag="DEHA-CDS3691.1"
FT                   /product="DEHA2E03256p"
FT                   /note="similar to uniprot|P36163 Saccharomyces cerevisiae
FT                   YKR087C OMA1 Metalloendopeptidase of the mitochondrial
FT                   inner membrane involved in turnover of membrane-embedded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87684"
FT                   /db_xref="GOA:Q6BQQ2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ2"
FT                   /protein_id="CAG87684.2"
FT                   /translation="MFRQFGRQWLHTKRPIRPHISITNSIRFTKNYATYKRFGNSGSHS
FT                   NFDFKKFLYNKNTIYVGISLGAFYVYNLHEAPFTGRLRFIWLPYWLETKIGDYSYKQIL
FT                   GEYQNQILPSSDPLYGKVTKIMNSLLTAAISNFPDQQQVEHLKSLDWAIHVIQVDPNKI
FT                   PPNAFILPNGKIFIFSSILPICHNDDGLATVLSHELSHQLAHHSSEQLSKQPFYILLSA
FT                   ILYSITGTSSFNSLMIEGLLKMPASRDMESEADHIGCELMARSCFNVNEAVQFWLRMND
FT                   WESKLKQKYNTSGLSFQEFFSTHPNTNKRIHDIQSWLPDLEKIKENSQCYEYQFNLFNE
FT                   THRNFFKR"
FT   gene            complement(<280589..>281557)
FT                   /locus_tag="DEHA2E03278g"
FT                   /old_locus_tag="DEHA0E03993g"
FT                   /old_locus_tag="DEHA-IPF5528"
FT                   /old_locus_tag="DEHA-CDS3997.1"
FT   CDS_pept        complement(280589..281557)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03278g"
FT                   /old_locus_tag="DEHA0E03993g"
FT                   /old_locus_tag="DEHA-IPF5528"
FT                   /old_locus_tag="DEHA-CDS3997.1"
FT                   /product="DEHA2E03278p"
FT                   /note="weakly similar to CA4849|IPF6954 Candida albicans
FT                   IPF6954"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ1"
FT                   /protein_id="CAG87685.2"
FT                   /translation="MLITHQQIPLRRWILNKSVGLSSVFARNYSSLPPRKSYHANLSPI
FT                   SLLWNTKVSPTFKYCSLIAILSISMSHIHPNIIVTVGPPVLLGSWYLYSKWMKLQYATE
FT                   TEKLIPKSKKEFNSKDNDIIIKKYNEAEISNVVNGIDNEFDNFKRQVVDIIERRIIDYI
FT                   ISNEDQRNDMFSLFIDENKQVSIKLSENDIETFILSSASVPDFDSIEDNEASLSQSERK
FT                   FQDFIKLSLPFFSSKDTSNRKRLGTIECYLLEMSNTQETDHIKYKILIEISPYKWFVTS
FT                   KEKLSIKYIEGEGVYNSKMFNEAKKSKESEDQDDEEITVNI"
FT   gene            <281684..>282499
FT                   /locus_tag="DEHA2E03300g"
FT                   /old_locus_tag="DEHA0E04015g"
FT                   /old_locus_tag="DEHA-IPF5526"
FT                   /old_locus_tag="DEHA-CDS4560.1"
FT   CDS_pept        281684..282499
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03300g"
FT                   /old_locus_tag="DEHA0E04015g"
FT                   /old_locus_tag="DEHA-IPF5526"
FT                   /old_locus_tag="DEHA-CDS4560.1"
FT                   /product="DEHA2E03300p"
FT                   /note="weakly similar to uniprot|P40962 Saccharomyces
FT                   cerevisiae YOR077W RTS2 Basic zinc-finger protein similar
FT                   to human and mouse Kin17 proteins which are
FT                   chromatin-associated proteins involved in UV response and
FT                   DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87686"
FT                   /db_xref="GOA:Q6BQQ0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR037321"
FT                   /db_xref="InterPro:IPR038254"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQQ0"
FT                   /protein_id="CAG87686.2"
FT                   /translation="MGKADIGTAKYQSKQLKASGLQRLRFYCQICEKQCRDANGFKNHI
FT                   NSLSHQKKITSLKDGGSSIIEEYSSQFLNDFIKLLKINHGTKKINANKFYQEYILNDRD
FT                   HVHMNSTKWSSLTQFVKFLGTKGYVKVEQPEADTDTEFNLVIRLIDTEYYQKQQELLQN
FT                   QKNLKTEEQMSMKLINDQIKKSQEYMNRHKQEFKEESKPDNINTNQPIKVSLKSSISKR
FT                   PKVRSAFGNDSESEGEEEGEEEERGSQLKRKNNTKIGEITNRLGVKSKR"
FT   gene            complement(<282534..>285347)
FT                   /locus_tag="DEHA2E03322g"
FT                   /old_locus_tag="IPF_5525"
FT   CDS_pept        complement(282534..285347)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03322g"
FT                   /old_locus_tag="IPF_5525"
FT                   /product="DEHA2E03322p"
FT                   /note="weakly similar to uniprot|P40453 Saccharomyces
FT                   cerevisiae YIL156W UBP7 Ubiquitin-specific protease that
FT                   cleaves ubiquitin-protein fusions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65747"
FT                   /db_xref="GOA:B5RTT5"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT5"
FT                   /protein_id="CAR65747.1"
FT                   /translation="MSTINHSNINGSSDHHNLNHRVQGQGKESNSPGKEDEIKKYYIRL
FT                   INEEFRNLQLDPDLQSKSLFDLIDYCELLYEDSTRVISTEKGLKTFIKGYLIFNYFINS
FT                   LIMMHFDGFDEFIKSNERDFIIYLHLFTFYNTDDYIKTDTRSIPLGILRKWILGYLIAN
FT                   KLLNFDVHVLYDWLYEYIDYLKEKDEFESQEQLVQPNQISKSQRMNNINANITEINSSQ
FT                   DSLHHSSDSLLDLQNKSDDNESLNHFKNRYPAFTLNEINDSSESLVFQPINDSTNDIPS
FT                   GTDFSYKTSIPPQFPSNPPPIPSIPPPIPSITPPIPSIPPPIPSIPPPISSMPPPIPFT
FT                   APPELPRQSSSDHYSSPSHSPPKTSQETPYPVDKVTDITTAPYPVSNNVSSNSLYYSNP
FT                   SFESYDRDIRTDNFTKTPSQGIKKAHSNYNRPSPGISRQPQAYNNDMLKFNPNGQTISY
FT                   NNQNYPNQHAYANPSFSNQYISQPAPHIILPNHALHQQNHQVGQKINYMMAYSICGLKN
FT                   FGSSCYINSTIQLLFGLFQFKAIFANSNYVRYIKDPKFLKIMKHHGNSKASQLLSEAIS
FT                   GLLKSFQAHGGAAIAPTKFLRISSSIKPDFNIPNEQQDAQEFLLFVLERLHDELSYKVL
FT                   DEREMEPETLERYIQKWNININIKDKEYYLNWYKSLVKSEGNSPINDLFQGHLQNKLIC
FT                   NKCGYESTNYSPFTILSLPIPDYNVRINLSDCLRYYTQDEILSGDNAWNCPKCSKNKDG
FT                   DHLSPPNTLDNHPVFTSKRSGIFKLGRRSKSPSRDKAKANAAAKDSKKDSVSVKTLNFI
FT                   KLPQILFIHLSRFSMTSMTDKVNKVIKYPLELKFNNYSNNINHEITYKLVGLINHYGNL
FT                   KSGHYTSLVNKAIPSSNNDDINHPCWCYFDDDAVRINLRHGDINKPNIDFNELNSRDVY
FT                   VLCYERR"
FT   gene            complement(<285587..>287821)
FT                   /locus_tag="DEHA2E03344g"
FT                   /old_locus_tag="IPF_5523"
FT   CDS_pept        complement(285587..287821)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03344g"
FT                   /old_locus_tag="IPF_5523"
FT                   /product="DEHA2E03344p"
FT                   /note="weakly similar to uniprot|P22035 Saccharomyces
FT                   cerevisiae YKR099W BAS1 Myb-related transcription factor
FT                   involved in regulating basal and induced expression of
FT                   genes of the purine and histidine biosynthesis pathways"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65748"
FT                   /db_xref="GOA:B5RTT6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT6"
FT                   /protein_id="CAR65748.1"
FT                   /translation="MESSNTKRLAQIDPLTITESLGFQTFRRESRKPWSKYEDSELIRA
FT                   INELHPSQINNLDADVVKWDVVAQRMYPNGERKPKDCRKRWCNSLDPNLKKGKWTKDED
FT                   EKLIKAYEKHGASWQRVSNEISGRTDDQCAKRYIEVLDPDTKDRLKPWEHHEDLQLIRQ
FT                   VKNHGTKWRTIALEIKGRPSLTCRNRWRKIVTDVVRGKADPIIKKEVDTIANGNINVLE
FT                   NIGKGNTSKPTSSHESLMNSKPTSQASTPYPLSVSSQPTSVEQRDIYLAQRSYPNQTGQ
FT                   VPQQYQQRISRPPAQSAITMPVNSEVEWKYTLEREDGKPDNPNLPHAALFNDENNGQIK
FT                   NQELVQQLISYAKTYGLNITVHQHIHHHYSQPGNRHSQKQRQAPDIQNYPYQSVQSPFS
FT                   ILGSSSTGNNNELVNEPGFNDSIPPNEMNKNYQSPYYLEPETQLTRYQHFNYLPPLTEV
FT                   PKLNSSSSPPSTTKDANNPTHHHHHHHHHHHHDNENENEKQDRKDPSNSKESDLIKLLN
FT                   RYNNETTPELQERNKRAMVSTESTPPGSNSLTPLTQAVEMAAAAEAGGKIPSNSRKRSN
FT                   TNAYQNKSKSQRNEKELEDGIDFWDNMKNLTDLPNQQSQQIAQPHQLTQTQQLAQSQQE
FT                   NQSSSQKPVSQHQSSNMFSNNTSDQALAKPSSVIDSNPNINKTTNNDINDPPYEEEEAV
FT                   GEEDYGLFYNVFNKEGSSTTQTNNDTENQNNGSVYDNLISIFGMIPFNPS"
FT   gene            complement(<288173..>289141)
FT                   /locus_tag="DEHA2E03366g"
FT                   /old_locus_tag="DEHA0E04081g"
FT                   /old_locus_tag="DEHA-IPF5521"
FT                   /old_locus_tag="DEHA-CDS3996.1"
FT   CDS_pept        complement(288173..289141)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03366g"
FT                   /old_locus_tag="DEHA0E04081g"
FT                   /old_locus_tag="DEHA-IPF5521"
FT                   /old_locus_tag="DEHA-CDS3996.1"
FT                   /product="DEHA2E03366p"
FT                   /note="similar to uniprot|Q02046 Saccharomyces cerevisiae
FT                   YKR080W MTD1 NAD-dependent 5 10-methylenetetrahydrafolate
FT                   dehydrogenase plays a catalytic role in oxidation of
FT                   cytoplasmic one-carbon units"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87689"
FT                   /db_xref="GOA:Q6BQP7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR035812"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP7"
FT                   /protein_id="CAG87689.2"
FT                   /translation="MSTETKPAGRTILASTIAKEFVDEITGQLKELEFKPKLVGFLAND
FT                   DPAAQMYANWTGKTCEGLGFNYELIQVDKNDLESSLMKANKDDNVNGIMVYFPVFGDKQ
FT                   DQYLQQLISTEKDVEGLNFMYYHNLYHNVRFLDAPYNEQKCILPCTPLAMVKILEYLGV
FT                   YNKILHYGNRLYGKKIMIVNRSEIVGRPLAALLANDGATVYSVDINNIQQYSRGDDLSE
FT                   KRHKALQLDSTHTIETLAPTCDVIITGVPSDSYKFPIEYITNGTVVINFSSSKNFPDEV
FT                   KQKAGLYVPSIGKVTIAMLLRNLLRLIKNKNHRIVKGEQQP"
FT   gene            complement(<289573..>291483)
FT                   /locus_tag="DEHA2E03388g"
FT                   /old_locus_tag="DEHA0E04103g"
FT                   /old_locus_tag="DEHA-IPF5519"
FT                   /old_locus_tag="DEHA-CDS1436.1"
FT   CDS_pept        complement(289573..291483)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03388g"
FT                   /old_locus_tag="DEHA0E04103g"
FT                   /old_locus_tag="DEHA-IPF5519"
FT                   /old_locus_tag="DEHA-CDS1436.1"
FT                   /product="DEHA2E03388p"
FT                   /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
FT                   YOR070C GYP1 Cis-golgi GTPase-activating protein (GAP) for
FT                   the Rab family members Ypt1p (in vivo) and for Ypt1p Sec4p
FT                   Ypt7p and Ypt51p (in vitro)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87690"
FT                   /db_xref="GOA:Q6BQP6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP6"
FT                   /protein_id="CAG87690.2"
FT                   /translation="MSQVYSNSNNEFIFGENGGKGKHLSSFLKNLSLTGSSNSTSNPSP
FT                   KGNDHYNDINSNIYGSLSYGSSSPNEKNVDNSGSIKTPNFKRSPYQRSVSGPVGASFSH
FT                   LASTPGDKKGSSNSNTKHGSSTPYKNLGSHPSAGLKSGHRTFSGRQRYTDLDDDWDADL
FT                   EEVSVPSQNRGSLENKNLSRVNTDNASANSSMNSLTLQPSPMLDSLHPDLTIPINTHSN
FT                   KDTSNKESLDYDDLQTKLEINKLNQLNVKYSKFHKMITDDTNIAIQDLRRLSWNGIPPE
FT                   LRAITWQILLGYLPTNKSRQSSTLKRKREEYLDGLSVVSSQIKFSDDSPSNSSSTSIAS
FT                   VSNSNSNRDKQLYHQIKIDVKRTNPTIKLYAYPETQQSLRKILFLWAVRHPASGYVQGI
FT                   NDLCTPFYQIFLSNYIWQLQKVAAYRQNPSEDCDMQLFIPGLLDDSDDNEQKLLNDPNL
FT                   MNYNIGNFNPAKLSSRIMSIIEADTYWCLSRVLENITDNYIHEQPGIIRQVNDLRNLIS
FT                   KIDLELLQHFDNEGVEFIQFAFRWMNCLLMRELSIPLIIRMWDTYLSESPLGFNNFHIY
FT                   VCAAFLIKFSGELKHKDFQEILLFLQNPPTNCWTEKDIELMLSEAFIWQSLYKNASAHL
FT                   R"
FT   gene            complement(<291711..>293339)
FT                   /locus_tag="DEHA2E03410g"
FT                   /old_locus_tag="IPF_5517"
FT   CDS_pept        complement(291711..293339)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03410g"
FT                   /old_locus_tag="IPF_5517"
FT                   /product="DEHA2E03410p"
FT                   /note="similar to uniprot|P38788 Saccharomyces cerevisiae
FT                   YHR064C SSZ1 DnaK homolog interacts with Zuo1p (DnaJ
FT                   homolog) to form a ribosome-associated complex (RAC) that
FT                   is bound to the ribosome via the Zuo1p subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65749"
FT                   /db_xref="GOA:B5RTT7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT7"
FT                   /protein_id="CAR65749.1"
FT                   /translation="MSAVIGITFGNTSSSIAVATQDGKVDVIANPDGDRSIPSVLSYVG
FT                   SDEYHGAQAQAQLVRNPKNTIVNFRDFIGKSLDEVDVSVTDIGAPAIKTSDNKIGFEIT
FT                   RENGKVETVSVNEATKRHFQQMKVAAEDYIGKSIEGVVLTVPTDFNEHQRNELAKITTD
FT                   AGLKVLQLINEPSSALLAHLSSEGEDLLKDKIYVVADFGGIRSDAAVIAVRGGVLTILA
FT                   TAHQHGLGGSNLDDVLAEYFAKEFEKKYKANPRTTARSLAKLNSESITVKKTLSNVQTS
FT                   TCSIESLADGLDFHTTINRLRYELTARQAISEMTGFVEKVVSKAGLENLDIDEVLLVGG
FT                   TANTPKLASNIAFIFPESTTVIAPSLDSKAVNPSELVCRGAALQASLIESFDEEEIKES
FT                   LQPVVVNTQHLSKAIGIKDAEGNFQPILVAETAYPIKKSIEVTNGSSDSVLVALYEGKK
FT                   TIKETVIEPEQNDESDDDYSDDEPEVRREAVYECGDLLAELSLKDLKPNSKLEVIVNIT
FT                   QNGTLHVSGRELKPGSVVVKGEITA"
FT   gene            complement(<293661..>293732)
FT                   /locus_tag="DEHA2E03432r"
FT                   /old_locus_tag="Deha0E.42"
FT   tRNA            complement(293661..293732)
FT                   /locus_tag="DEHA2E03432r"
FT                   /old_locus_tag="Deha0E.42"
FT                   /note="tRNA Gln (TTG) cove score=66.25"
FT   gene            <294406..>296262
FT                   /locus_tag="DEHA2E03454g"
FT                   /old_locus_tag="DEHA0E04180g"
FT                   /old_locus_tag="DEHA-IPF5515"
FT                   /old_locus_tag="DEHA-CDS3353.1"
FT   CDS_pept        294406..296262
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03454g"
FT                   /old_locus_tag="DEHA0E04180g"
FT                   /old_locus_tag="DEHA-IPF5515"
FT                   /old_locus_tag="DEHA-CDS3353.1"
FT                   /product="DEHA2E03454p"
FT                   /note="weakly similar to CA4846|IPF6945.3f Candida albicans
FT                   IPF6945.3f 3-prime end"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87693"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP5"
FT                   /protein_id="CAG87693.2"
FT                   /translation="MSRISRRKNIRFLIWSLVLLSLLAFIVTSYDVYDGVIKFSNEPLK
FT                   ETQQLGNRKKRPSGKEEKANEEANEEDNDKQQAAKNNQKNSGKKGSESKNDGGDNGKQT
FT                   AQKGKANDKDNAKKKPQKSQNAAKPETPKKPQKPGKTKEEEQVDKAGKAEKPTGKNTEN
FT                   QKASGSDDEAKKPEAKPSKYKTTPKPKLPPKPKEKEEESAQDQKGSKLKSSPKDAVNDY
FT                   VNEKYGDHSNDPKNPNMFLGDTYKGPSDDGSIYDENEDENDNDDVDNDAPHIHESEQEG
FT                   TLGSGPVPNSALKPVTIKEKQFAEVPEKFDEIQPLNFRVYSHNVKNGGHDILVSGERTW
FT                   AERVNNIATSIAFNARHDTIVALQEVYKFQLDNILSELNRYSPPNKPEWAAYGAGRIDG
FT                   RNIGEFVPILYKTSEWELVFSDTMWLNDKDPRVSLEGWDAKYLRICSYVTLKHKRTENY
FT                   FNVFNTHFDHVGELSRIGSASMIVQKMNEINKWPSIFCGDLNAEPKERTYQLITEDYKD
FT                   VSKLTTAFNRYGHTKSSVTGFEGEVLLQGGQNIDYIFAPGYTTKVSQEDDCDKQSTPED
FT                   SPDANLSLKLQAFAMLHSKFNGAYMSDHRPLVADFTLENKCK"
FT   gene            complement(<296455..>297804)
FT                   /locus_tag="DEHA2E03476g"
FT                   /old_locus_tag="DEHA0E04202g"
FT                   /old_locus_tag="DEHA-IPF5512"
FT                   /old_locus_tag="DEHA-CDS2580.1"
FT   CDS_pept        complement(296455..297804)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03476g"
FT                   /old_locus_tag="DEHA0E04202g"
FT                   /old_locus_tag="DEHA-IPF5512"
FT                   /old_locus_tag="DEHA-CDS2580.1"
FT                   /product="DEHA2E03476p"
FT                   /note="weakly similar to uniprot|P53063 Saccharomyces
FT                   cerevisiae YGL246C RAI1 Nuclear protein that binds to and
FT                   stabilizes the exoribonuclease Rat1p required for pre-rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87694"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="InterPro:IPR039039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP4"
FT                   /protein_id="CAG87694.2"
FT                   /translation="MDYVKSPEFIGLLEESNVTKEPCYEKLCYCRNKELQIALDRSEAR
FT                   YFDVSSGLFMADSLESPRINAKINVDLSSGYRKFRVLSRTSSTLDNIRGTKYVAMEEFE
FT                   RNENKKLDENIVTSRHTLLDLLHLPFQKSAIIQNIVAFNGQVFMEAEQRPQRRADASSM
FT                   TGYNFEEVMTCAENEIHNSKPFEFIPAVNNAIKYNSMINHTFPETGLSVLVSCEIDSIK
FT                   RRSEELAALYDKIEFKYKILENNIEMKSRKIGSRNNLIKAILQCYLAGTNDLVVGYRDD
FT                   NFNLKYVEKLNVSELLETSNNPLLNRAFLDKWFWFIAQFISKAVKMPRGLALRHHQLIF
FT                   NKNDNVISIESFRLSPYRLEKTILSRFVKWRRYLATMQKHQLSVEANVGIINYPNKKGK
FT                   RRSKKKDKKSEDTNFSTKITDHSNSISKFEDNEQNETNHITKVLEHVSLS"
FT   gene            <298154..>298430
FT                   /locus_tag="DEHA2E03498g"
FT   CDS_pept        join(298154..298213,298272..298430)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03498g"
FT                   /product="DEHA2E03498p"
FT                   /note="similar to uniprot|P69851 Saccharomyces cerevisiae
FT                   YDR320ca"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65750"
FT                   /db_xref="GOA:B5RTT8"
FT                   /db_xref="InterPro:IPR013959"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT8"
FT                   /protein_id="CAR65750.1"
FT                   /translation="MENPHEQVQNALLSRIISNMENLNESIVTMNKSLQDINRGNMDTE
FT                   MVAQMWENYSKNSEFNLEATGQKKDPI"
FT   gene            complement(<298816..>298992)
FT                   /locus_tag="DEHA2E03520g"
FT                   /old_locus_tag="DEHA0E04224g"
FT                   /old_locus_tag="DEHA-IPF5510"
FT                   /old_locus_tag="DEHA-CDS8549.1"
FT   CDS_pept        complement(298816..298992)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03520g"
FT                   /old_locus_tag="DEHA0E04224g"
FT                   /old_locus_tag="DEHA-IPF5510"
FT                   /old_locus_tag="DEHA-CDS8549.1"
FT                   /product="DEHA2E03520p"
FT                   /note="highly similar to uniprot|Q6Q547 Saccharomyces
FT                   cerevisiae YHR072W-A NOP10 Constituent of small nucleolar
FT                   ribonucleoprotein particles containing H/ACA-type snoRNAs
FT                   which are required for pseudouridylation and processing of
FT                   pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87695"
FT                   /db_xref="GOA:Q6BQP3"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQP3"
FT                   /protein_id="CAG87695.1"
FT                   /translation="MHLMYTLGPDGKRVYTLNKTTSDGEITKSAHPARFSPDDKYSRQR
FT                   VTLKKRFGLLPTQ"
FT   gene            <299233..>301599
FT                   /locus_tag="DEHA2E03542g"
FT                   /old_locus_tag="IPF_5509"
FT   CDS_pept        299233..301599
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03542g"
FT                   /old_locus_tag="IPF_5509"
FT                   /product="DEHA2E03542p"
FT                   /note="weakly similar to uniprot|Q06677 Saccharomyces
FT                   cerevisiae YDR320C SWA2 auxilin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65751"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTT9"
FT                   /protein_id="CAR65751.1"
FT                   /translation="MAPPPKKDAFADLFQSANSGSNGSLNDKNLSLLERQRKQQSPAVN
FT                   KSNYSQNSFSNLDIFGGSPASNSSVGSVNQSRSSTPNQSNDPFSIFEKPQATEPIRAGR
FT                   PSAPVPETTNSISNTVIGGKNKHEVSLLDDEFTDAFTPEPETAEQLTDTKRGSKSETGT
FT                   RPSVNNGAKSTEQVSGSRMQDRPSSRTSSRTSARSTESEYRQSKPKSSTDARDTTLAEL
FT                   VDIGFSIEQSNEAIDEVGLDLQTCVNFIMGGGKKKTKKKEATNRPIHDDRDLSNDLGAK
FT                   INDFSSDFFNKASLFINNSRNTVMKNIEQFQHHSKSDQNDGESSLPAWMKSQHMYKEDA
FT                   AERKANGGVSENYGSDEENIDHEAINEFITSQKLKDKEKQRARYEHLKGLAKNQISGSS
FT                   NTSNSQSGRSSPIKHPDLPQRPSSQPQSGPPRNEQKRQTTSIQPKAKQPSQPVVNEVDL
FT                   LGMNHKSSHIKSQGKSSGGRIEHTFVSTPLNQFHASDYETSKDKATESFRVGDYDTAHV
FT                   AYTKCLESLPEKHELRLVINSNLALTLIKTGNYKQAKTCCDEALQLVTEDDLQDYAYLI
FT                   NEKTIKSWYIKLLSRKAESLEMLESFPEALESYMELISKYGVTDKKIMDGRRRVNHIVN
FT                   PPKPKPRTASPEKAPSKAKTTTQTESTDNLRRIQKQHEDTKKQEEMKFNLHDDIQARIF
FT                   SWSNGKEDNIRTLLMSLDDIIPSKLGLPFATTKKLTINDLMLPKKVKINYMKVISSIHP
FT                   DKLINLELEDKMVCEAVFITLNKAWDIFKEQNGMN"
FT   gene            <302743..>303318
FT                   /locus_tag="DEHA2E03564g"
FT                   /old_locus_tag="DEHA0E04268g"
FT                   /old_locus_tag="DEHA-IPF5506"
FT                   /old_locus_tag="DEHA-CDS5452.1"
FT   CDS_pept        302743..303318
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03564g"
FT                   /old_locus_tag="DEHA0E04268g"
FT                   /old_locus_tag="DEHA-IPF5506"
FT                   /old_locus_tag="DEHA-CDS5452.1"
FT                   /product="DEHA2E03564p"
FT                   /note="similar to uniprot|Q03559 Saccharomyces cerevisiae
FT                   YMR295C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87697"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP1"
FT                   /protein_id="CAG87697.1"
FT                   /translation="MAIFRSKSSKKDDSHEGEVRFSKQDFDSYKMTTNNMHDPILSAVN
FT                   EAQPFEQAAQHDAQRRPSYLSQESAELKDIFGNNIRQADISNPTRSRNERPLDTIRTFE
FT                   YAITGDPTYKDQMETQRLGWGFHEDFSYHNMGARDANATGTGEFERPVINFGASDDQGV
FT                   YQAPNYSATSLQPEAKKKKKGLFGRKKK"
FT   gene            <304049..>305131
FT                   /locus_tag="DEHA2E03586g"
FT                   /old_locus_tag="DEHA0E04290g"
FT                   /old_locus_tag="DEHA-IPF5502"
FT                   /old_locus_tag="DEHA-CDS3571.1"
FT   CDS_pept        304049..305131
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03586g"
FT                   /old_locus_tag="DEHA0E04290g"
FT                   /old_locus_tag="DEHA-IPF5502"
FT                   /old_locus_tag="DEHA-CDS3571.1"
FT                   /product="DEHA2E03586p"
FT                   /note="similar to uniprot|P16892 Saccharomyces cerevisiae
FT                   YBL016W FUS3 Mitogen-activated protein kinase involved in
FT                   mating pheromone response"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87698"
FT                   /db_xref="GOA:Q6BQP0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQP0"
FT                   /protein_id="CAG87698.2"
FT                   /translation="MNNEQPPPQQAHTRQISFNVSDHYQILEVVGEGAYGIVCSAIHKP
FT                   TNQKVAIKKIEPFERSMLCLRTLRELKLLKHFNHENIISILAIQRPINFNLFNEIYLIQ
FT                   ELMETDLHRVIKTQKLSDDHIQYFIYQTLRALKTMHSANVLHRDLKPSNLLLNSNCDLK
FT                   ICDFGLARSIASSEDNFGFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLV
FT                   GRPLFPGRDYHNQLWLIIEVLGTPNMEDYYNIKSKRAREYIRSLPFVKKVPFANLFNSE
FT                   AINPLAIDLLENLLVFNPAKRITVDNALNHPYLNIYHDPNDEPISEKIPEDFFDFDKRK
FT                   DELSIEDLKKLLYDEIMKPL"
FT   gene            <305538..>306201
FT                   /locus_tag="DEHA2E03608g"
FT                   /old_locus_tag="DEHA0E04312g"
FT                   /old_locus_tag="DEHA-IPF5501"
FT                   /old_locus_tag="DEHA-CDS7897.1"
FT   CDS_pept        join(305538..305669,305788..306201)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03608g"
FT                   /old_locus_tag="DEHA0E04312g"
FT                   /old_locus_tag="DEHA-IPF5501"
FT                   /old_locus_tag="DEHA-CDS7897.1"
FT                   /product="DEHA2E03608p"
FT                   /note="similar to uniprot|P32803 Saccharomyces cerevisiae
FT                   YGL200C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87699"
FT                   /db_xref="GOA:Q6BQN9"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN9"
FT                   /protein_id="CAG87699.1"
FT                   /translation="MKLSVVALTLMSLFLTMIEAHNVLLPPYGKHCFFENLKKNDELAI
FT                   TTPNGQVVLKRTDLDHGDEQVKAQTSGKYQYCFSNEKTSRVDLDVSFNIHGVVYVDVND
FT                   PKADSLDYAIQRMSQLTNDVKAEQTYLVIRERTHRNTAESTNSRVKWWSVFQVLVVAAN
FT                   SVFQIYYLKRFFEVKSVV"
FT   gene            <306507..>307769
FT                   /locus_tag="DEHA2E03630g"
FT                   /old_locus_tag="DEHA0E04356g"
FT                   /old_locus_tag="DEHA-IPF5498"
FT                   /old_locus_tag="DEHA-CDS2989.1"
FT   CDS_pept        306507..307769
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03630g"
FT                   /old_locus_tag="DEHA0E04356g"
FT                   /old_locus_tag="DEHA-IPF5498"
FT                   /old_locus_tag="DEHA-CDS2989.1"
FT                   /product="DEHA2E03630p"
FT                   /note="similar to uniprot|P23542 Saccharomyces cerevisiae
FT                   YLR027C AAT2 Cytosolic aspartate aminotransferase involved
FT                   in nitrogen metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87700"
FT                   /db_xref="GOA:Q6BQN8"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN8"
FT                   /protein_id="CAG87700.1"
FT                   /translation="MSKYFSSIKELPPDPLFGLKARYTADDRSDKVDLGIGAYRDNNGK
FT                   PWILPAVRKAEVKLVNSEEYNHEYLSISGYQPFLTESAKVILGNNSAAIKESRVTSQQS
FT                   LSGTGALHLAGAFLKEFFTTESKKAPTVYLSNPTWANHNQIFTSLGLQVEKYPYWDNDT
FT                   KSLNLKGFLSTIQEAPKNSIFVLHACAHNPTGLDATKEQWEEILEALAKNEHLALYDSA
FT                   YQGFASGNLDNDGFAVRLAVDSKKLKTPIVICQSFAKNCGMYGERVGAIHVIPAENDKS
FT                   LNNAIKSQLNKLTRSEISNPPAYGAKVVATILTDSELRQQWEDDLVTMSSRINKMRTRL
FT                   RDLLTNQYSTPGNWDHIVSQSGMFSFTGLTPDMVSRLEKNHGIYLVSSGRASVAGLNDG
FT                   NVEQVAKAIDEVVRFYSKSKL"
FT   gene            complement(<308058..>308655)
FT                   /locus_tag="DEHA2E03652g"
FT                   /old_locus_tag="DEHA0E04378g"
FT   CDS_pept        complement(join(308058..308303,308653..308655))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03652g"
FT                   /old_locus_tag="DEHA0E04378g"
FT                   /product="DEHA2E03652p"
FT                   /note="highly similar to uniprot|P38711 Saccharomyces
FT                   cerevisiae YHR021C RPS27B Protein component of the small
FT                   (40S) ribosomal subunit or uniprot|P35997 Saccharomyces
FT                   cerevisiae YKL156W RPS27A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87701"
FT                   /db_xref="GOA:Q6BQN7"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN7"
FT                   /protein_id="CAG87701.1"
FT                   /translation="MVLVQDLLNPSPASEAQKHKLKTLVQQPRSFFMDVKCQGCLNITT
FT                   VFSHAQTAVTCDSCSTVLCTPSGGKAKLTEGCSFRRK"
FT   gene            complement(<309730..>310716)
FT                   /locus_tag="DEHA2E03674g"
FT                   /old_locus_tag="DEHA0E04400g"
FT                   /old_locus_tag="DEHA-IPF5495"
FT                   /old_locus_tag="DEHA-CDS3930.1"
FT   CDS_pept        complement(309730..310716)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03674g"
FT                   /old_locus_tag="DEHA0E04400g"
FT                   /old_locus_tag="DEHA-IPF5495"
FT                   /old_locus_tag="DEHA-CDS3930.1"
FT                   /product="DEHA2E03674p"
FT                   /note="highly similar to uniprot|P32598 Saccharomyces
FT                   cerevisiae YER133W GLC7 Catalytic subunit of type 1
FT                   serine/threonine protein phosphatase involved in many
FT                   processes including glycogen metabolism sporulation and
FT                   mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87702"
FT                   /db_xref="GOA:Q6BQN6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN6"
FT                   /protein_id="CAG87702.1"
FT                   /translation="MADHQEADIDSIVDRLLEVRGSRPGKQVTLLEHEIRYLCTKAREI
FT                   FIQQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETI
FT                   CLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAA
FT                   IIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRG
FT                   VSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGA
FT                   MMSVDESLLCSFQILKPADKKPRYPQSNNISNNRPVTPPRKPRRGSK"
FT   gene            <311451..>312053
FT                   /locus_tag="DEHA2E03696g"
FT                   /old_locus_tag="DEHA0E04422g"
FT                   /old_locus_tag="DEHA-IPF5494"
FT                   /old_locus_tag="DEHA-CDS5355.1"
FT   CDS_pept        311451..312053
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03696g"
FT                   /old_locus_tag="DEHA0E04422g"
FT                   /old_locus_tag="DEHA-IPF5494"
FT                   /old_locus_tag="DEHA-CDS5355.1"
FT                   /product="DEHA2E03696p"
FT                   /note="weakly similar to uniprot|P40080 Saccharomyces
FT                   cerevisiae YER128W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87703"
FT                   /db_xref="InterPro:IPR013640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN5"
FT                   /protein_id="CAG87703.2"
FT                   /translation="MSAFPNHYHARLVAEKDSKACTLCFKPTTTVLISQNKVDFFYVCP
FT                   SHLKDEHFSTAIRPDEYKGLETKREELDKKIEDSRKRVERLRPYAWNFLSSMSGSKKGE
FT                   GTEVDKDKGTEKDKDKEKETYETAKQDLRRLEGELNEINSGISNYKFKDYTLNKDIYRM
FT                   RTQNYAQSKIRAKKQQEMHKPGFFPSAPQHGVDKVDK"
FT   gene            complement(<312067..>312879)
FT                   /locus_tag="DEHA2E03718g"
FT                   /old_locus_tag="DEHA0E04444g"
FT                   /old_locus_tag="DEHA-IPF5491"
FT                   /old_locus_tag="DEHA-CDS4574.1"
FT   CDS_pept        complement(312067..312879)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03718g"
FT                   /old_locus_tag="DEHA0E04444g"
FT                   /old_locus_tag="DEHA-IPF5491"
FT                   /old_locus_tag="DEHA-CDS4574.1"
FT                   /product="DEHA2E03718p"
FT                   /note="weakly similar to uniprot|P36057 Saccharomyces
FT                   cerevisiae YKL154W SRP102 Signal recognition particle (SRP)
FT                   receptor beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87704"
FT                   /db_xref="GOA:Q6BQN4"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN4"
FT                   /protein_id="CAG87704.2"
FT                   /translation="MDYIQVSLITLLLGLVVTLLIFCIQNLETKKGGRSQYSKPTFLII
FT                   GPNNSGKTALFFKFISNPDDKYEFTPTVSSIEPNVKDKILPFSNPKLGSKYQIIDYPGH
FT                   IKYSKLLTKLMNEDITLKNIRGIIYVIDSSSNAINGEAVKLISKQLFTLLSSTEKLPTG
FT                   IDFLFAVNKQDLFDSKPIHKVKEILELEMTKLIKNELSTKKFQENNENELESEENDNAI
FT                   REFWSSTMGLQQSFKFELLEGSMDFVGGSVLKNKSDGWENWIDEKVVN"
FT   gene            complement(<313576..>314436)
FT                   /locus_tag="DEHA2E03740g"
FT                   /old_locus_tag="DEHA0E04466g"
FT                   /old_locus_tag="DEHA-IPF5490"
FT                   /old_locus_tag="DEHA-CDS4393.1"
FT   CDS_pept        complement(313576..314436)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03740g"
FT                   /old_locus_tag="DEHA0E04466g"
FT                   /old_locus_tag="DEHA-IPF5490"
FT                   /old_locus_tag="DEHA-CDS4393.1"
FT                   /product="DEHA2E03740p"
FT                   /note="similar to uniprot|P87221 Candida sp CIP1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87705"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN3"
FT                   /protein_id="CAG87705.1"
FT                   /translation="MSSVAIFGVNSSVFPSIFEAITSSTFKSNFKFPLRGITRSKDGKT
FT                   DTSELEYYEANDEESLKQALEGFDIIISLAGPSADFDVLAKAVISAKPKLYIPSQFGMD
FT                   LDIVPFDVLGFKTKHSRYVRAGGIKVVDICTSHFLQKGAWNDVPSQALSLNFEGDKAII
FT                   RGDPDVKWAFTAYENVGQTIVSVISKDPSTLPDKVRVWSDKITQEQLLNRMMGEDYPRK
FT                   YVTYEDSLKESNETIKRVGIRAEDFLLYTQTVSASGLLDFDWDSKELVNPGETLFKWIR
FT                   FEPTK"
FT   gene            <314816..>315535
FT                   /locus_tag="DEHA2E03762g"
FT                   /old_locus_tag="DEHA0E04488g"
FT                   /old_locus_tag="DEHA-IPF5488"
FT                   /old_locus_tag="DEHA-CDS4934.1"
FT   CDS_pept        314816..315535
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03762g"
FT                   /old_locus_tag="DEHA0E04488g"
FT                   /old_locus_tag="DEHA-IPF5488"
FT                   /old_locus_tag="DEHA-CDS4934.1"
FT                   /product="DEHA2E03762p"
FT                   /note="similar to uniprot|Q04432 Saccharomyces cerevisiae
FT                   YDR533C HSP31 Possible chaperone and cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87706"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN2"
FT                   /protein_id="CAG87706.1"
FT                   /translation="MSSQKKVLVAVTSYNKIFYKDGKKTGLFLVEALHPFNVFKENGYD
FT                   VDFVSETGTYGFDDHSLGPDFLNGKDLEVFNDAKSDFNVHLKNIKKASEVNADDYGIFF
FT                   ASAGHGTLFDYPQAKVLQSLGENIWSNGGVLAAVCHGGAIFDGMVDKANGKPLLQGKSI
FT                   TGFTDIGEAILGVDGIMKENELQSIEEMTKKYGGKYLAPIGPWDDYSVSDGKLITGVNP
FT                   ASAISTAKRSLIAFEAI"
FT   gene            complement(<316416..>317549)
FT                   /locus_tag="DEHA2E03784g"
FT                   /old_locus_tag="DEHA0E04510g"
FT                   /old_locus_tag="DEHA-IPF5487"
FT                   /old_locus_tag="DEHA-CDS3383.1"
FT   CDS_pept        complement(316416..317549)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03784g"
FT                   /old_locus_tag="DEHA0E04510g"
FT                   /old_locus_tag="DEHA-IPF5487"
FT                   /old_locus_tag="DEHA-CDS3383.1"
FT                   /product="DEHA2E03784p"
FT                   /note="highly similar to uniprot|P28777 Saccharomyces
FT                   cerevisiae YGL148W ARO2 Bifunctional chorismate synthase
FT                   and flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87707"
FT                   /db_xref="GOA:Q6BQN1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN1"
FT                   /protein_id="CAG87707.1"
FT                   /translation="MSTFGNIFRVTTYGESHCKSVGCIVDGCPPGLALTEDDIQPQLSR
FT                   RRPGQSKLSTPRNEKDQVHIQSGTENGLTLGSPIGMLVQNEDHRPHDYSETDLYPRPSH
FT                   ADWTYIQKYGVKSTSGGGRSSARETVGRVAAGAIAEKILTKANNVEIVAFVSSIGEIEM
FT                   NRSPQDATFQNILNTITREEVDEVGPIRCPDASVRDEMVKVIEKYRDNKDSIGGVVTCV
FT                   VRNCPIGLGEPCFDKLEAQLAHAMLSLPATKGFEFGSGFLGTKIPGSVHNDPFISDGTS
FT                   NKLRTVTNNSGGIQGGISNGENIYFSVAFKSAATISQEQYTSTYDGEKGVLAARGRHDP
FT                   SVTPRAVPIVEAMTALVLVDQLLTQKAREYGRNIVSN"
FT   gene            <317877..>319934
FT                   /locus_tag="DEHA2E03806g"
FT                   /old_locus_tag="DEHA0E04532g"
FT                   /old_locus_tag="DEHA-IPF5485"
FT                   /old_locus_tag="DEHA-CDS1255.1"
FT   CDS_pept        317877..319934
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03806g"
FT                   /old_locus_tag="DEHA0E04532g"
FT                   /old_locus_tag="DEHA-IPF5485"
FT                   /old_locus_tag="DEHA-CDS1255.1"
FT                   /product="DEHA2E03806p"
FT                   /note="similar to Candida albicans IPF9116"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87708"
FT                   /db_xref="GOA:Q6BQN0"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQN0"
FT                   /protein_id="CAG87708.2"
FT                   /translation="MMLREASISLLLYFMALISVVNCALNNDWNTLYSFSDGKVYLHLK
FT                   NNDLVSLNFSVSGFNDMEDSKYTEKQLNLQNGQQVEKLATPPVNTSLVLVQEELYGFNA
FT                   VSEEGGSVDGCGNGVLNLIRYDRDSDKWETVSGLGYDDIADASFYQHSTYLSAPNDDII
FT                   YIYGGVCESSEKVSNRMISFDINKAKFSNITTSTKPQAFYGATNLLAPNPQTQLVIGGQ
FT                   SNNGWLNMYQLATWDFSSGWSFKQVSDAEKSTEVNSRRFPLALPIFDPLTNNSNEAFTN
FT                   FYNVKEVLLIGGELLDTDSSPVFAKLSTSTNSWTWDSADNSGLGYDEILGGVTIFDTLV
FT                   IINSTRSVNKRDTSDQYTINLYDVHSFEAIENIKDNTESKDSGNDSSDVTKKAVLGTVL
FT                   PVFAIAMAITTAFFIKRKRKQNANDDNNDMDYQFGTYYDQESALNQRARRKSNPFDNDT
FT                   SSTLDAASIDSWVKKRQQFDEKRTKTIRNSYLASNETLSSNSSHLTKSTDDDHEKLENK
FT                   IITKPEPSPLQTNLVNRSVSKLKKSFSMSSTPTTPVLSHEYGSIKKKKSTSTLNHKPVS
FT                   TSPLSDDEADVVKAANITDLDTSRENINDEDSESDASVDDKMDVQVLVSSKRRSVLRIV
FT                   NPDLETINDENEENEYLENDFEDNTASINDREDTSIRQRVPSGDRTLEDD"
FT   gene            <320183..>322681
FT                   /locus_tag="DEHA2E03828g"
FT                   /old_locus_tag="IPF_5483"
FT   CDS_pept        320183..322681
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03828g"
FT                   /old_locus_tag="IPF_5483"
FT                   /product="DEHA2E03828p"
FT                   /note="weakly similar to uniprot|P33748 Saccharomyces
FT                   cerevisiae YMR037C MSN2 Transcriptional activator related
FT                   to Msn4p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65752"
FT                   /db_xref="GOA:B5RTU0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU0"
FT                   /protein_id="CAR65752.1"
FT                   /translation="MDDYANYNKEPYQMNTNMYQMNNGVVPNSPRDDYDQQRIDTDEPL
FT                   YENLFSVENGDKEFDNFKANITERTGVKEEGGTMNFNMLEGFRSYDNMDLDESPPFNVN
FT                   FDAYYDPLMDQQAITNDSNVLFNSDNIQDNGNLQNGIGVLPPKDEFVNTASAPRVPSQQ
FT                   SFMPHTNSFVSMNNFRNNVPVDGFSEGSVDMKDYNSHKNLNLNNHASNMSGKNSISNAS
FT                   LSINNTNSYYNELSPLTTTTSLTPSVSSVHSTQPSFFSAHQYLTRNSLDHPPSQQNRPS
FT                   IDFYSKARTSFDSQQSSINQRQRTQVGGRYTSFTNSISNYIPFMGDRNQRTSNNSTPSE
FT                   SLSPPRPSAFINVPPQQAQQPRHLIRSIFKSSAVPSNANNNSNEDNIENSNGQDILNGE
FT                   LNNQNTPSINNNGNSKNMDNIDDDSEFLDMDHSQQEPEDDIIESNIATKKARRSKRSLF
FT                   TRFKTPVKMEPIEGSTDLFKTEEAISNNKNNLNKELDNENMESDMVGSASLHGLSINGT
FT                   PSLDSTNVINGAALDPSTSNNSNNNNLNAAPGNSMLEPDYGALFEKVGKRKNIVNPATY
FT                   IRNKPRYKNEQSEVNSLNGSNNTSNSNTEKSSISNYNSGGSYPENIDPRNLNSINSNDS
FT                   SINNRNIQVEGGDSDSDLSTSLGSSSNTPSSLATASKRILGSKLMSKRKNSQTNMNTAP
FT                   PPPPPTTTTIISKGVEVEVDLQSLDLPPTTQIFPTNIINSKNRTRGRKENKEADLVDST
FT                   KIYLCNYCSRRFKRQEHLKRHFRSLHTFEKPYDCSICHKKFSRSDNLNQHLKIHKQEEE
FT                   LAQQGLNTSDNIKTETHDSL"
FT   gene            complement(<322960..>324918)
FT                   /locus_tag="DEHA2E03850g"
FT                   /old_locus_tag="IPF_5480"
FT   CDS_pept        complement(322960..324918)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03850g"
FT                   /old_locus_tag="IPF_5480"
FT                   /product="DEHA2E03850p"
FT                   /note="some similarities with uniprot|P21192 Saccharomyces
FT                   cerevisiae YLR131C ACE2 Transcription factor that activates
FT                   expression of early G1-specific genes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65753"
FT                   /db_xref="GOA:B5RTU1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU1"
FT                   /protein_id="CAR65753.1"
FT                   /translation="MEPFSNWEEVATSNPSNRVPLPHEDFDQYFTGYAEVDNMFNETLT
FT                   CLQDLDVPSGFVNQDLKQQQDLQNGSGHQVKHSRGMSGTAIFGFAEHNRELSISGLTGD
FT                   LYKAAKPSMDMGKSISPGQLVNSLNGQTEQVGLPSVALDFNFHGEIQKPLHFAEEEEYE
FT                   YEHAKTNKKDSKQDYIVTNKNPKSYKFPPSPNSPPSKEPEPAVDPKQFKSVNQYSVKYL
FT                   QELNKFNDRSSPKPKQVTYADDIGPLLEKGAESVPIVYSNPPTGEYTNLPASQQSTPFN
FT                   NHTVYKYIPIPTQNPTLFPNSTQDQRKLDQKEFPLNIKNNLNAYLPPPSTPGLTNGSPD
FT                   WNSSPEPQSPSPSRAVLNSYQNNSRFSSPIRPQMRNGRNDFYTPQFFSDDNGNLTNNNT
FT                   LKNNVPSEQSSSPVFHQTLNSSPIKFYTSPLRNAPPNEDDTMDANATITQLTPLKSQTP
FT                   MTPSKNRVTLEWSPIISPNAKSSKDVKKALKESSPKRRVKKTSLLPPGELDQYWDGPDE
FT                   HKVFTCTYKNCGKKFTRRYNVRSHIQTHLSDRPFACSYCPKKFVRQHDLNRHVKGHLEA
FT                   RYCKCSCGKEFTRLDALRKHRARNICVGGLASHENHCVTKPPRKDKVEILDGMTSERLS
FT                   EDIQAILPTTESSSSPD"
FT   gene            <324926..>325060
FT                   /locus_tag="DEHA2E03872g"
FT                   /old_locus_tag="IPF_43306"
FT   CDS_pept        324926..325060
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03872g"
FT                   /old_locus_tag="IPF_43306"
FT                   /product="DEHA2E03872p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65754"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU2"
FT                   /protein_id="CAR65754.1"
FT                   /translation="MNQMLDYFKFGQANVLTNLFSFEGYLRSKLTTQSQEEEKGNKRI"
FT   gene            complement(<325423..>326751)
FT                   /locus_tag="DEHA2E03894g"
FT                   /old_locus_tag="IPF_5478"
FT   CDS_pept        complement(325423..326751)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03894g"
FT                   /old_locus_tag="IPF_5478"
FT                   /product="DEHA2E03894p"
FT                   /note="similar to uniprot|P19262 Saccharomyces cerevisiae
FT                   YDR148C KGD2 Dihydrolipoyl transsuccinylase a component of
FT                   the mitochondrial alpha-ketoglutarate dehydrogenase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87711"
FT                   /db_xref="GOA:Q6BQM7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM7"
FT                   /protein_id="CAG87711.1"
FT                   /translation="MLSRSIKTTTRRLPSVCKKPVLQTGAKIGNVMMTRSIQTESYKSV
FT                   RDMNKMSNNMLNFKRFASQTVKVPEMAESITEGTLSEYLKEVGDFVNQDETIATIETDK
FT                   IDVEVNAPVSGTITERLVEVEENVTVGQDLVKIEEGEAPAGGAKEESKEESKEEPKKEE
FT                   SAAPKKEEAPKPKKEEAPKPKKEEPKKEAKKETSKSGEEATFTNFSRNEERVKMNRMRL
FT                   RIAERLKESQNTNASLTTFNEVDMTNLMEMRKLYKDEFLDKTGIKLGFMGAFAKASTLA
FT                   MKEIPSVGASIENNDTLVFRDYADISVAVATPKGLVTPIVRNAESLSILGIEKSISDLG
FT                   RKARDGKLTLEDMTGGNFTISNGGIFGSLYGTPIINLPQTSVLGLHGVKQRPVTVNGQI
FT                   ESRPMMYLALTYDHRVLDGREAVIFLRTIKELIEDPRKMLLLQ"
FT   gene            <327566..>328858
FT                   /locus_tag="DEHA2E03916g"
FT                   /old_locus_tag="IPF_5474"
FT   CDS_pept        327566..328858
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03916g"
FT                   /old_locus_tag="IPF_5474"
FT                   /product="DEHA2E03916p"
FT                   /note="weakly similar to CA0100|IPF11569 Candida albicans
FT                   IPF11569"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65755"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU3"
FT                   /protein_id="CAR65755.1"
FT                   /translation="MTRRSLKQESNGYYGDKRVISDLSRFEYSTGGPRNRSRNTTPTSI
FT                   DTESILNSKDDNIRPDPQYPADTANPRYLNDIYKHYMKPSFSSISDVDNSFVPYPTSLS
FT                   DKDGKILLPYNNKAALDLPSLPSFHTIHIGQSNDTLCSSSSTLPSKMSKELPPIMATEE
FT                   YVKQNQMDSESVYNPQADLQSLSSRRKDLEHDLLKKVMNRPVASFPVKTITGSQKYDDT
FT                   HITITANFILYVFEIIIAIIVVTLCSVLAQKDSKLPNSIYRYLIADGVVSLIVSLLFIT
FT                   TIINFEKRNGSFYCLVAAIMTFVSFVIAIAVLIPSSNCANESICTMRKAAAGFIIVSFC
FT                   LWLSNIVMLLTTYYISNLNLLQDINFDYSNQGLDSTYNDTIQNKPVPYIEPTSPGSNQP
FT                   LKEYLINENGEMYEIHNPVQVRGRNKIIVYL"
FT   gene            <328985..>330640
FT                   /locus_tag="DEHA2E03938g"
FT                   /old_locus_tag="IPF_5473"
FT   CDS_pept        328985..330640
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03938g"
FT                   /old_locus_tag="IPF_5473"
FT                   /product="DEHA2E03938p"
FT                   /note="weakly similar to CA0099|IPF11570 Candida albicans
FT                   IPF11570"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65756"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU4"
FT                   /protein_id="CAR65756.1"
FT                   /translation="MVKLNDLVIFLCFINLGCSIALDYRKLGIDFPSRINLRSLRRMKK
FT                   NSEIELKSLMSPFINEEQLDKDDTDDTDVDITDQLLLVPRNLLKSGILTKLGLEYLNRD
FT                   SHLFNLTHKYQNIVIPKDSKNLFIFNTTDNLSIPKRAQNKFVELIQRSAPFNLPQYMKL
FT                   VNFYAVIPKAYMTSHFNSSRNGLESVFSNGILEVPASKLPIFRKCISENKPLMVFLFNS
FT                   GKRDDFKASSGTIMNIKNYITRNKQKASVSTFFDSFAYNWIDKINYASLIQSVFCTTNN
FT                   KNMDESYCLKVQDKQTIHLFPAFYDIAKLSRTRHHLADLHSRQENQDLSEHLDANQAIK
FT                   EAGDILYSAAQLINGTVYKFAGERFSNSERFNIDAKSKIHKLQDKLGEIPEILGDIKDT
FT                   LEDPEQSPIINNFDGLKKIFKPNDEEGEETVNGNSFPSPRLRKIGLTGYSEQLKNRNLR
FT                   KPDGGFSFPASLIKFADSMNTTPRKKWYSQVIYSPFKIDDNAADKSHNYIEDVDNTSLL
FT                   KRSSIFSNDENCDKITWYNIFHYSIFGKPHFCLD"
FT   gene            complement(<330770..>333079)
FT                   /locus_tag="DEHA2E03960g"
FT                   /old_locus_tag="DEHA0E04664g"
FT                   /old_locus_tag="DEHA-IPF5470"
FT                   /old_locus_tag="DEHA-CDS0920.1"
FT   CDS_pept        complement(330770..333079)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03960g"
FT                   /old_locus_tag="DEHA0E04664g"
FT                   /old_locus_tag="DEHA-IPF5470"
FT                   /old_locus_tag="DEHA-CDS0920.1"
FT                   /product="DEHA2E03960p"
FT                   /note="similar to uniprot|P39719 Saccharomyces cerevisiae
FT                   YAL053W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87714"
FT                   /db_xref="GOA:Q6BQM4"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM4"
FT                   /protein_id="CAG87714.2"
FT                   /translation="MKWNIIWVLVMMMVGVTMGASDDKGKKGNYIKSTSLLTCMENSLF
FT                   TASHFDVVFYPDSGKVFFDITAISNIDGKIAAQIDVIAYGLNVLTRNISFCDLNFETIC
FT                   PLTSGHMELDSHYDLSKSITKEIPGVAYTIPDLDARVRVVVYDAEDNTKQYACVEAVLS
FT                   NGKTVQTKYAAWPIAAISGLGVITSGVVSIIGHSNTAAHIASNSMSLFVYFQSLAITSM
FT                   MAVAMVPPIAAAWAQNFQWSLGIIKVGFVQNIANWYMQATGGTPTDILASSYLSISVQK
FT                   NKFKRSAEYLLNTLIDKQRANDHLTLFKRASISLDSDDFGYGDSLDSSLYSVNEKDDDL
FT                   SSKILVLRGIQRISYLAGIEITSLFMTSIMFLLFVAFVLVVCISAFKAIMEICIRAKFI
FT                   NEGKFNEYRQQWRYIIKGSLYRLLLIAFPQLSVMCIWEFTTHDSGGTVVVAVFLLAVVL
FT                   ILLVQAAIRVYLLGRRSVRQFKNAAYLLYGDGKFLNKFGFVYVHFRADCYYFVMINLIY
FT                   IFLKSLFVAVLQKQGKAQSVIVFAIELIYCILLCWVRPFMDKRTNAFNITISVINAINA
FT                   LFFMFFSYIFKQPHIVASVMAIVYFILNAVFALFLLLFTIVTCVLALVYKNPDTRYQPM
FT                   KDDRVSFLPRFDRKNKGDKDMNKSQQDGDDLELMALGATAMRGHENGGKPAIYDEDESV
FT                   YDEDAFSEQNIKHQNTFNSNSYSDSGGNRDSYYLESIEPTQPTSTIVGNPNGAMGKYNT
FT                   AYGNTDNANGNRVNFI"
FT   gene            complement(<334148..>339859)
FT                   /locus_tag="DEHA2E03982g"
FT                   /old_locus_tag="IPF_5464"
FT   CDS_pept        complement(334148..339859)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E03982g"
FT                   /old_locus_tag="IPF_5464"
FT                   /product="DEHA2E03982p"
FT                   /note="similar to uniprot|P37297 Saccharomyces cerevisiae
FT                   YLR305C STT4 phosphatidylinositol-4-kinase that functions
FT                   in the Pkc1p protein kinase pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65757"
FT                   /db_xref="GOA:B5RTU5"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU5"
FT                   /protein_id="CAR65757.1"
FT                   /translation="MDYSGIPRGSIRGDALKKLAKLSVENSPTCLQEASGETTDDFFNL
FT                   LSHTTRNEKTQLSDVAISPKEFEVLIALCESTASDMKFPKQAKILIDKIRLYLLELPNQ
FT                   KFSNSVFDLTHKSSPWNFLGEKLTTAAINLGRKFNSLFLDKVLDLLAEFNEKLFHNKTF
FT                   ELSSYLTLLGFIEGLVGNAWIFHHSEKSFNTFITLDTCIDNFEFLNEAEIYSNVLYSQP
FT                   NEYSSLIDRDVVCDFSPILYIERLSKLQCSIIDSILGNTQTSLLEYLLTKASRQYEDND
FT                   SNCDSNSSAGLMDVSEFHMNIIDKLSYMAVQKMEFLDRGETYIVYSSFNRLKTGYLAKS
FT                   INLHIIGCGTFTDNVDILIAKKFLKNCLSIYDVMLDINLGLSVIQLGSLLVFKDEQVGP
FT                   PITRAFTSLVANPKFDTTYCSISSKSVGLASKCFSQDAVVTTIYALTNLLFIGDDGVQA
FT                   RNSVKRNTALGRPPDKFAPRDLNISRSVSRFTSMNSLVNEKADPIVHDKASVGDYEESD
FT                   YMRVCENAIIAIVDITQACNDETISTLAVTILSQKTAKLNSRIGDILLKGLVSCAPFLP
FT                   NREFIILSKLLNKLSLDALEGGNSRLLNSLIKARISLSHKLEPDNPLFKIYLHEILQAI
FT                   ISKGDVRVLEHHRPHTEISEISDQIGIYLQPLAELLPDVHRGKSPLIINDTSTINLFRN
FT                   IWFNMVVHGYSINSKNVKKYRVELERIAYNSPPLASELSWDRTETSLELNTVLRRGSSN
FT                   HNVKDHRHIMGDIFEVNRTMSYPKLMFVSATVFVESLRVKSGDCSTILQCYSDPSIKTS
FT                   SIDKYIGNISNKIVEDFVSLVNNGGNAQFTSENIAEQLTCMLALCCHRIEDLQDAALQS
FT                   CDTLINKIPSSLCHHKSLFALFDLLTLLFESIVDADENQYEPKTSFRADRTGIQLLLPD
FT                   SYKWRNETFKRFHDKAKSWLKLILVKCNVDVKALIQSYISGLETFQSDDKVQYGVSFAL
FT                   EMAGSVLANDRELSNVSKFVPQNFNTLPVFVSQLSWRSNLVTKLMDKVPLHSQDDTENA
FT                   FNTMRQKVVEIKRKISDNQYNISNDETIDLLSELAGLALVSYNNSAEIIRYLVEIPFAI
FT                   FESSIMKTATGIWFAVMKERPNLSVILLSEIAKKWESSIKMKQGLYSTNHDICNPEFAK
FT                   MEYSPSDRKVVNRLGNATSKSFDPHMQIIKLFASNFEATLYQSDHLLKVFTRFVDFGLR
FT                   ELAIASLHPYARVVRFELIRFAFHVLNYHIKLGSRSVFSLTEAIFDATLSWFRQRASYP
FT                   FGSNLLKTKADYSLLQETARLVSHTSAMKNNELESKKALIMFFLDDEISKISVWLNPIN
FT                   ARDLKGKFTSSHISGIDISNAYKLDPILAVNLALRYKLKDLDQILQHLITENPLPAISY
FT                   PDAVQYFIGINSRTNMPSHHLLFWEPLSPIDAITLFLPPFGSNPYILQYTMRSLEHHDT
FT                   NLTFFYVPQIVQSLRFDAKGYVERFILETAKVSQLFAHQIIWNMLANSYKDEDSTEPDS
FT                   LKPVLDRIQDSMLKSLSKEDFTFYEKEFGFFNEVTSISGKLKPYIKKSKAEKKVKIDEE
FT                   MAIIEVKPGVYLPSNPDGVVVDINRKSGKPLQSHAKAPFMATFKIKKDVDDVDESGEQV
FT                   KTQIEKWQSAIFKVGDDCRQDVLALQLISVFRTIWSNAGLDLFVYPYRVTATAPGCGVI
FT                   DVLPNSVSRDMLGREAVNGLYEYFTTKFGPENSIEFQKARNNLIKSLAAYSIISYILQF
FT                   KDRHNGNIMYDDQGHVLHIDFGFCFDIVPGGVKFEVAPFKLTHEMVMVLGGRSDTQAFQ
FT                   WFEELCVKGFLACRPYMETIVRTVNPMLESGLPCFKPHTIKKLRSRFAPRKSEKEASLY
FT                   MRGLIKKSMESYYTKGYDEFQRITNGIPY"
FT   gene            complement(<340323..>341060)
FT                   /locus_tag="DEHA2E04004g"
FT                   /old_locus_tag="DEHA0E04752g"
FT                   /old_locus_tag="DEHA-IPF5460"
FT                   /old_locus_tag="DEHA-CDS4862.1"
FT   CDS_pept        complement(340323..341060)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04004g"
FT                   /old_locus_tag="DEHA0E04752g"
FT                   /old_locus_tag="DEHA-IPF5460"
FT                   /old_locus_tag="DEHA-CDS4862.1"
FT                   /product="DEHA2E04004p"
FT                   /note="highly similar to uniprot|Q12522 Saccharomyces
FT                   cerevisiae YPR016C TIF6 Eukaryotic translation initiation
FT                   factor 6"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87720"
FT                   /db_xref="GOA:Q6BQM3"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM3"
FT                   /protein_id="CAG87720.1"
FT                   /translation="MASRTQFENSNEVGVFSKLTNSYCLVAVGGSENFYSAFEAELGDV
FT                   IPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELMHLRNSLPDTVKIQRVEERLSAL
FT                   GNVICCNDYVALVHPDIERETEELIADVLGVEVFRQTIAGNVLVGSYCSLSNQGGLVHP
FT                   QTSIQDQEELSSLLQVPLVAGTVNRGSAVVGAGMVVNDWLAVTGLDTTAPELSVVESIF
FT                   RLQDAQPDSISGNLRDTLIETYS"
FT   gene            complement(<341419..>344121)
FT                   /locus_tag="DEHA2E04026g"
FT                   /old_locus_tag="DEHA0E04774g"
FT                   /old_locus_tag="DEHA-IPF5459"
FT                   /old_locus_tag="DEHA-CDS0607.1"
FT   CDS_pept        complement(341419..344121)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04026g"
FT                   /old_locus_tag="DEHA0E04774g"
FT                   /old_locus_tag="DEHA-IPF5459"
FT                   /old_locus_tag="DEHA-CDS0607.1"
FT                   /product="DEHA2E04026p"
FT                   /note="similar to uniprot|P31539 Saccharomyces cerevisiae
FT                   YLL026W HSP104 Heat shock protein that cooperates with
FT                   Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and reactivate
FT                   previously denatured aggregated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87721"
FT                   /db_xref="GOA:Q6BQM2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM2"
FT                   /protein_id="CAG87721.2"
FT                   /translation="MDNSEFTDNALRIITNATQLAKDNAHTQLAPLHFLAAMVPTDDEN
FT                   STQYLKTLIQKARYEWPTFERNVNKHLVRLPSQTPAPDDIRPSYATGQVLANATKIKSQ
FT                   QKDDFVAQDHLLLALLDDSSIKAIFKESGINVDSIKTQAIELRGSQRIDSRQADSSSSY
FT                   EFLNKYCEDFTEKAREGKIDPVIGREEEIRRVIRVLARRTKSNSVLIGEPGVGKTSIVE
FT                   GVAQRIIDGDVPNILANSRLFALDLGALTAGAKYKGEFEERIKGVLNDIEKSNEMIILF
FT                   IDEIHMLMGDGKSDAANLLKPMLARGSLHCIGATTFTEYRKFIAKDGAFERRFQKIDVP
FT                   ASTVPETVAILRGLQPRYEIHHGVRILDSALVTAAQLASRYLTYRSLPDSAVDLIDETA
FT                   ATVAVARDSKPEELDTLERQLHLIEVEINALERDVEADADSKDRLEVAKRKKAELEEQL
FT                   GPLRERFNQERAGHEELIAAKRKLDELEIKASDAERRHDTATAADLRYFAIPDVAKQIE
FT                   ELEVKVAEEEQSLGSESMLKNAVSSEQVAETAARLTGIPVTKLSQAENTKLINMERELS
FT                   SEVVGQSKAVKAVSNAIRLNRSGLANPNQPASFLFLGLSGSGKTELAKKVAGFLFADER
FT                   AMIRIDCSELGDKWSASKLLGAAPGYVGYEEGGILTEALLRRPYSVILFDEVEKAAPEV
FT                   LTILLQILDDGRVTSSQGKLVNCSNSIIIMTSNIGAEYINASKGPTIDDTTKGLVMDAV
FT                   RANFRPEFLNRISSTVIFNRLSKKAISKIVKIRLKEIQERFAANGKALALEVDDAALEY
FT                   LCNKGYSPDLGARPLNRLIQSEILNRLAVLLLKGQIKDKEVARVTLGPKGLEVLPNHEA
FT                   EDEDMADVQVDDWKDSEDEDDYLDSTPLD"
FT   gene            complement(<344641..>344790)
FT                   /locus_tag="DEHA2E04048g"
FT                   /old_locus_tag="DEHA0E04796g"
FT                   /old_locus_tag="DEHA-IPF5456"
FT                   /old_locus_tag="DEHA-CDS8871.1"
FT   CDS_pept        complement(344641..344790)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04048g"
FT                   /old_locus_tag="DEHA0E04796g"
FT                   /old_locus_tag="DEHA-IPF5456"
FT                   /old_locus_tag="DEHA-CDS8871.1"
FT                   /product="DEHA2E04048p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87722"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM1"
FT                   /protein_id="CAG87722.1"
FT                   /translation="MTDLRPNNREGSLDEMPITPVISGSSSKGHILRLLYYHTTNGYSV
FT                   TEAS"
FT   gene            complement(<345054..>345575)
FT                   /locus_tag="DEHA2E04070g"
FT                   /old_locus_tag="IPF_5455"
FT   CDS_pept        complement(345054..345575)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04070g"
FT                   /old_locus_tag="IPF_5455"
FT                   /product="DEHA2E04070p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65758"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU6"
FT                   /protein_id="CAR65758.1"
FT                   /translation="MWFSLYFLPLILLISTSQKSLVLSCSGDVLPYDKLDVDDWIISST
FT                   YIEKRYPYFTFSCNSTMCSIREMDYLFHDIAYTFRVKDIVKSLMFMYGSDYIQLVEYDE
FT                   TGLEDSSYSDGDDDDDGESKKSSLPSDNGSDGNDDDDTKSSANKSQSNSLSSQIYVTLL
FT                   LCLLTIFNYS"
FT   gene            complement(<345827..>346192)
FT                   /locus_tag="DEHA2E04092g"
FT                   /old_locus_tag="DEHA0E04818g"
FT                   /old_locus_tag="DEHA-IPF5454"
FT                   /old_locus_tag="DEHA-CDS6554.1"
FT   CDS_pept        complement(345827..346192)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04092g"
FT                   /old_locus_tag="DEHA0E04818g"
FT                   /old_locus_tag="DEHA-IPF5454"
FT                   /old_locus_tag="DEHA-CDS6554.1"
FT                   /product="DEHA2E04092p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87723"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQM0"
FT                   /protein_id="CAG87723.2"
FT                   /translation="MLAVMYIFSSIIIATAIMRSLVSGSMALNGTSEYILQFDKAWEES
FT                   NKNWDDYIQFKTFSCNKTDCCIMGANCSNFTKDFTFPIEDALIVLVSCFGPPYYSYIED
FT                   KIAGSYGPAGSIEQIGY"
FT   gene            <347944..>348016
FT                   /locus_tag="DEHA2E04114r"
FT                   /old_locus_tag="Deha0E.4"
FT   tRNA            347944..348016
FT                   /locus_tag="DEHA2E04114r"
FT                   /old_locus_tag="Deha0E.4"
FT                   /note="tRNA Thr (AGT) cove score=74.95"
FT   gene            complement(<348097..>349488)
FT                   /locus_tag="DEHA2E04136g"
FT                   /old_locus_tag="IPF_5450"
FT   CDS_pept        complement(348097..349488)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04136g"
FT                   /old_locus_tag="IPF_5450"
FT                   /product="DEHA2E04136p"
FT                   /note="weakly similar to uniprot|P40956 Saccharomyces
FT                   cerevisiae YGL181W GTS1 Contains a zinc-finger in the
FT                   N-terminus and a long Gln-rich region in the C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65759"
FT                   /db_xref="GOA:B5RTU7"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU7"
FT                   /protein_id="CAR65759.1"
FT                   /translation="MSKRFQKNIEKQLIDIVNSRGNENKCGECGSAYPTWASWNLGVLL
FT                   CGRCASLHRKVLPKDVSKVKSLTLDQWTSEQVDCLKRIGNKKAKKKWNPKRFPFPHDDD
FT                   DDGPIEEFLKDKYIMGRFRDDNFAAVEYDDKNSRYSGDGVSTPVSGNRSRSRSNSMRPK
FT                   ASDPIPPLSHRKLTTFESTQYSKQENTILRYGYSNRDSILEALLLSNGSIEFALDILDN
FT                   DAKVNPAQEELPPALPTRPARSTSLSENNPMNSVLGQQQSQTQPSNDWWSNSNASSNTN
FT                   TGATMPSVPTSATGASVTQAQIYQYTDPVTGQISYIDSNGQQYLDPTNQQHQQMLYQQQ
FT                   NPQLVAQQTNKQAILSLYSQPNQNNSNSAVPNSQQPQQTGFGSQQQPQQQTGFGFQQQP
FT                   QQPQQTGFGFQQQPQQTGFSGFQPQQTGFAQQPTGFSNFAPQQQQQQPHQQQQYQQQYQ
FT                   QGYWN"
FT   gene            complement(<349659..>350564)
FT                   /locus_tag="DEHA2E04158g"
FT                   /old_locus_tag="IPF_5449"
FT   CDS_pept        complement(349659..350564)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04158g"
FT                   /old_locus_tag="IPF_5449"
FT                   /product="DEHA2E04158p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65760"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU8"
FT                   /protein_id="CAR65760.1"
FT                   /translation="MENIYDYSSSEDSDTDELPPVPELNIYSQNYSNQFDMSSIFVYIP
FT                   WNPSLSVLNHLKSICNRTIKHVHTRNPGVGKKYNWNIVGAPSKGLDGRFSVTNNQLLRS
FT                   HHITLFPNVRGESYKMKQYIENVSGSLSNMPIPASLVQEDSKEAERISNLNRILFQATS
FT                   TKEGLQNKEKKYVSLNFEPKLSFYTSSTTNSIFIAGKVRLTPDSTIFFKNINQIIVDNI
FT                   KLLDVTSEQSPIEQDYHISLILGELKGFETNRAEVGKLIRLMKELDFTNELENINISIN
FT                   SLRINEISSSRNSYEVPLNI"
FT   gene            <351285..>353039
FT                   /locus_tag="DEHA2E04180g"
FT                   /old_locus_tag="DEHA0E04928g"
FT                   /old_locus_tag="DEHA-IPF5448"
FT                   /old_locus_tag="DEHA-CDS1853.1"
FT   CDS_pept        351285..353039
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04180g"
FT                   /old_locus_tag="DEHA0E04928g"
FT                   /old_locus_tag="DEHA-IPF5448"
FT                   /old_locus_tag="DEHA-CDS1853.1"
FT                   /product="DEHA2E04180p"
FT                   /note="weakly similar to uniprot|P32467 Saccharomyces
FT                   cerevisiae YHR092C HXT4 High-affinity glucose transporter
FT                   of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87728"
FT                   /db_xref="GOA:Q6BQL8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL8"
FT                   /protein_id="CAG87728.2"
FT                   /translation="MGKNVLNKLKRRLSNAGDSMSIKSAKENETHIPIPNEIYNWKIVL
FT                   VALVSASAAIIIGYDSGFIGGTVSLVSFQQEFGLDKMSPDQSTLITANVVSVFHAGAFW
FT                   GSLIMYPIGEVLGRKAGLIISGFLLTFGAAITLIANQDRGLGAIYAGRIITGIGIGGCS
FT                   GLAPIYISEISPSSIRGKLVGCWELSWQIGGIVGYWINYGVLEHIPNSTKQWIIPFAIQ
FT                   LIPSGIFFGCLFLIPESPRYLISRGKMAKAKKNLAFLRGLPEDHEYSLHEIDIFTTDIE
FT                   ERIAKIGNGFFAPIVEIFTNKKLIYRLFLSTALFPMQNGSGINAINYYSPTVFKSLGVS
FT                   GPNAGLLSTGIFGILKGFASVIWIFFVVEIMGRRTALIWFSIPCSLCMWYIGAYIKISD
FT                   PAARLASGNTKMDAGGKAAQALLYIWTIFYGASWNGTPWVINSEIFSQEVRTFTQAVNS
FT                   SSNWFWAFIMGRFTGRAFEATSYGLYFLFGACMIVFPIIIFFFYPETKGVPLEAIDHLF
FT                   EVPAWRAREYALDKFEREYENGELIQEHAHEVNAHGSVTSDDEKVGGVQINVTNGSSFA
FT                   SNSINDRT"
FT   gene            <353722..>355407
FT                   /locus_tag="DEHA2E04202g"
FT                   /old_locus_tag="DEHA0E04950g"
FT                   /old_locus_tag="DEHA-IPF5447"
FT                   /old_locus_tag="DEHA-CDS2023.1"
FT   CDS_pept        353722..355407
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04202g"
FT                   /old_locus_tag="DEHA0E04950g"
FT                   /old_locus_tag="DEHA-IPF5447"
FT                   /old_locus_tag="DEHA-CDS2023.1"
FT                   /product="DEHA2E04202p"
FT                   /note="weakly similar to uniprot|P39003 Saccharomyces
FT                   cerevisiae YDR343C HXT6 High-affinity glucose transporter
FT                   of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87729"
FT                   /db_xref="GOA:Q6BQL7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL7"
FT                   /protein_id="CAG87729.2"
FT                   /translation="MKHKIFSRLKRSVSNAGDSMSVKSIKDDDGHIPIPREIYNWKIVL
FT                   VAITAASAAIIIGYDTGFIGGTVELESFQKEFGMDKMSSDERSLVSANVVSIFHAGAFW
FT                   GALSMYPIGELFGRKVGLIVSGFILTLGCAIAMISNNERGLGAVYAGRVLSGFGIGGCS
FT                   GLAPIYISEISPASIRGKLVGCFELSWQVGGIVGYWINFGVQENQPISTKQWLIPFAIQ
FT                   LVPAGMFWILTFVIPESPRFLVSKGKIEKARKNLAFLRDLPEEHEYSLHEMDLFIADSE
FT                   KKSKIGTGFFAPIKEVFTSKKLLYRLLLSTSLFPMQNGTGINAITYYSPTVFKSLGMDG
FT                   SSAGLLSTGIFGIIKGVSALFWMFFIVDNLGRRFALIVMSVPLSLCMWYIGAYVYVADP
FT                   ASRLASGNTEMDAGGKTAQGLLYIWSVAYAMSWNGTPWIINSEIFSQEVRTFTSAINAS
FT                   SNWFWSFIMSRFTGKAFEATSYGLYFLFASCMVLFPCVVYMLYPETKEVPLEAIDYLFE
FT                   VPAWRARDYAMSKFEIEYEGQYTADPSSSEQSFHEAHFPDKGNS"
FT   gene            <356437..>358200
FT                   /locus_tag="DEHA2E04224g"
FT                   /old_locus_tag="DEHA0E04972g"
FT                   /old_locus_tag="DEHA-IPF5443"
FT                   /old_locus_tag="DEHA-CDS1706.1"
FT   CDS_pept        356437..358200
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04224g"
FT                   /old_locus_tag="DEHA0E04972g"
FT                   /old_locus_tag="DEHA-IPF5443"
FT                   /old_locus_tag="DEHA-CDS1706.1"
FT                   /product="DEHA2E04224p"
FT                   /note="weakly similar to uniprot|P32465 Saccharomyces
FT                   cerevisiae YHR094C HXT1 Low-affinity glucose transporter of
FT                   the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87730"
FT                   /db_xref="GOA:Q6BQL6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL6"
FT                   /protein_id="CAG87730.1"
FT                   /translation="MNDINLESCTQKPNMNHKLINKLKRRVSSAGDSMSIKSAREQADH
FT                   VPIPDAIYNYKLVIVAVTAAAAAVIIGYDAGFIGGTVSLESFKQEFGMDKMSSDQATLI
FT                   EANVVSVFQAGAFWGALMMYPVGEIFGRKVGLIISGFLLTFGAAISLISNKDTGLGAIY
FT                   AGRVLTGVGIGGCSGLAPIYVSEISPAAVRGKLVGCWELSWQIGGIIGYWINYGVLQNI
FT                   PTSKKQWLIPFAIQLIPSGLFWIGACIIPESPRFLVSKGKMEKARKNLAYLRNIPEDHE
FT                   YSHHEIDVFTKDIQERRAKIGDGFFAPILAIVKSKKLLIRLLMSTSLFPMQNGSGINAI
FT                   TYYSPTVFKSLGVSGSDAGLLSTGIFGIIKAFASVVWIFFIVDLMGRRSSLIWFSVPCS
FT                   LCMWYIGAYVYVADPAARLATGDTQMDAGGKAAQGLLYIWTFFYGASWNGTPWVINSEI
FT                   FSQDVRTFTQAINAASNWFWAFIMGRFTGQAFEATSYGLYFVFAACMIVFPLFIFFFYP
FT                   ETKGVPLEAIDHLFEVPAWRAREYAMEKYDAEFEGGEFQEDDFASYPSSHEEKVGAATN
FT                   VTVNTDPSDNR"
FT   gene            <359010..>359695
FT                   /locus_tag="DEHA2E04246g"
FT                   /old_locus_tag="DEHA0E04994g"
FT                   /old_locus_tag="DEHA-IPF5442"
FT                   /old_locus_tag="DEHA-CDS5214.1"
FT   CDS_pept        join(359010..359012,359060..359695)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04246g"
FT                   /old_locus_tag="DEHA0E04994g"
FT                   /old_locus_tag="DEHA-IPF5442"
FT                   /old_locus_tag="DEHA-CDS5214.1"
FT                   /product="DEHA2E04246p"
FT                   /note="similar to uniprot|P53102 Saccharomyces cerevisiae
FT                   YGL183C MND1 Protein required for recombination and meiotic
FT                   nuclear division"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87731"
FT                   /db_xref="GOA:Q6BQL5"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="InterPro:IPR040453"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL5"
FT                   /protein_id="CAG87731.2"
FT                   /translation="MAPKKGLSAEDKKEKLYEFFNQSHTFYTLKEIEKEGSKYAKISSM
FT                   LIKDIVQQLIDDNLINCEKCGTTNLYWCFKFDKIKTLQTQYNNYQNKLKEKQLERDQLI
FT                   EKIQSGKLQRLVKSDFGNRHKLIDQFTCLSKRKLHLEEELLKYGDNDPQLIQTLDEKNV
FT                   HLISAIETFTDDIESMIYYFTKVSSATIEESDLRSELGIPSEFAELPKM"
FT   gene            <359957..>362056
FT                   /locus_tag="DEHA2E04268g"
FT                   /old_locus_tag="DEHA0E05016g"
FT                   /old_locus_tag="DEHA-IPF5441"
FT                   /old_locus_tag="DEHA-CDS1151.1"
FT   CDS_pept        359957..362056
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04268g"
FT                   /old_locus_tag="DEHA0E05016g"
FT                   /old_locus_tag="DEHA-IPF5441"
FT                   /old_locus_tag="DEHA-CDS1151.1"
FT                   /product="DEHA2E04268p"
FT                   /note="similar to Q6QIR4_CANTR (Q6QIR4) Fatty alcohol
FT                   oxidase,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87732"
FT                   /db_xref="GOA:Q6BQL4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012400"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL4"
FT                   /protein_id="CAG87732.2"
FT                   /translation="MISYVVEDKHVEVFMFLADAIVHETTPENIEPFLDENFDKSKLEE
FT                   YCQSFTKPSEVPGFRDCVKECVNCTPVSSSRTFVLLMNVLDSRVLAPILTGSITLIRDM
FT                   GYKEREELLRSWQNSNLESFRRLFKLLYSLSITTFIKLCPDLHNQVIGYPGKEMRDEIY
FT                   ENIEIDPFRYSMLEHPTGDELYAPNIDVLIIGSGSGAGVVAHTLSNDGHKCLVLEKGKY
FT                   FHPTELVFDEKDGNKNLYESRGVLTTVNQQTMILAGSTFGGGSTVNWSACLKTPFKVRK
FT                   EWYDDYGVDWAANELYDKCADYVWNKMGATLDSVKHSFSNQVILNGAEKLGYTAKPVEQ
FT                   NNGNHPNHSCGFCHLGCKFNVKQGSSACWFRDASEKGCQFMDQVKVVKVLHSGGKAVGA
FT                   LCQDTQTGHEFTIKGPKKFVVCGGSLNTPVVLQNSGFKNKNIGANLKLHPVTVIFGDFG
FT                   KDNNTKPFNESILTTVCTEVDDLDGKAHGAKIETVLHTPLLESVFMPWQSSDKARQDLL
FT                   RYNHLAAMLIITRDKSSGTIRADATKPDSLIIDYSINKYDRNALLQAILVSADMLYVEG
FT                   AKEIIHPQRWVPNFQSNKPKEERSVKDRDYVQWRESVSKTKLDTFGCPYGSAHQMSSCR
FT                   ISGKGPKYGACDNKGRLYECKNVYVADASAMPTASGANPMISTMSIARLIALGISKDLQ
FT                   PQARL"
FT   gene            complement(<362113..>362553)
FT                   /locus_tag="DEHA2E04290g"
FT                   /old_locus_tag="DEHA0E05038g"
FT                   /old_locus_tag="DEHA-IPF5439"
FT                   /old_locus_tag="DEHA-CDS6163.1"
FT   CDS_pept        complement(362113..362553)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04290g"
FT                   /old_locus_tag="DEHA0E05038g"
FT                   /old_locus_tag="DEHA-IPF5439"
FT                   /old_locus_tag="DEHA-CDS6163.1"
FT                   /product="DEHA2E04290p"
FT                   /note="weakly similar to uniprot|P32601 Saccharomyces
FT                   cerevisiae YPR017C DSS4 Nucleotide release factor
FT                   functioning in the post-Golgi secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87733"
FT                   /db_xref="GOA:Q6BQL3"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL3"
FT                   /protein_id="CAG87733.1"
FT                   /translation="MTLQHFKDLDTAKSTDSSIIIRCPFGSCNTRIIMLSEKLLSNELI
FT                   IQNSPGMVQISDNTDSNPNSFFKLDDVWDFDNIGVSRPSSDIKQPIIEENNKVLNIKIE
FT                   RLLICSECDKGPIGFAGLEGEDTDVKNLKYFLSCSSVLYDIK"
FT   gene            complement(<362681..>363892)
FT                   /locus_tag="DEHA2E04312g"
FT                   /old_locus_tag="DEHA0E05060g"
FT                   /old_locus_tag="DEHA-IPF5438"
FT                   /old_locus_tag="DEHA-CDS3149.1"
FT   CDS_pept        complement(362681..363892)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04312g"
FT                   /old_locus_tag="DEHA0E05060g"
FT                   /old_locus_tag="DEHA-IPF5438"
FT                   /old_locus_tag="DEHA-CDS3149.1"
FT                   /product="DEHA2E04312p"
FT                   /note="weakly similar to uniprot|Q7SE60 Neurospora crassa
FT                   NCU00513"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87734"
FT                   /db_xref="GOA:Q6BQL2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL2"
FT                   /protein_id="CAG87734.2"
FT                   /translation="MSQPDVTEVRNSFDTQGLERYLSNLSNAHHTTFGLNKPNFKLPLT
FT                   IKQFKFGQSNPTYFITDANGFEFVLRRKPVANDKLVSKSAHAIEREFFMLRGIQVCNKP
FT                   RTKKVPVPDLYLLCEDESVIGFVFYLMEYVNGRQIKNPSMQGMSESDAKLHWDSIMETI
FT                   SSVHSLDPDTLIKELPANHFPQFQPEKMAKSSGSYFQRQIRTLSSVANLQSKVVDPIPH
FT                   FDQICKWLLEKAPNDPSKKSLIHGDFKIDNVLFDVNEPKIVAVLDWELCTFGHPLFDLA
FT                   NFLQPFQLPNQLNLLLYKPDKTDMGIEKPGSLDSIYDKLAIYQSKLGYNWNDNDPSNNA
FT                   SDNWNVGFVFGLLRLCVISQGIAMRVAKGSASSGDAAGYAKLYLHLPDLALNTINDKVQ
FT                   DSKL"
FT   gene            complement(<364234..>366015)
FT                   /locus_tag="DEHA2E04334g"
FT                   /old_locus_tag="IPF_5437"
FT   CDS_pept        complement(364234..366015)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04334g"
FT                   /old_locus_tag="IPF_5437"
FT                   /product="DEHA2E04334p"
FT                   /note="weakly similar to uniprot|Q06479 Saccharomyces
FT                   cerevisiae YLR352W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65761"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTU9"
FT                   /protein_id="CAR65761.1"
FT                   /translation="MGYPGIQGLYSNSRAHPFVSLSPVSSYESGGQAPGTEEEAKDDIG
FT                   GNSTDYGNFSPLLSLPLEILYQIIEIVYYDDNTTSINSNLENFSKTIPLLSKAINTISL
FT                   RFLYKYANFNRPHSFDKFLQNLVKYPTLGKFVEFMDFQIFTSIGLGRTGRMNQEIQMVT
FT                   SKTILQALELTPNLIEFLASENIQDDLDEHVLNYLFNNSPKLQALDFCGASSESFVSAF
FT                   QKLIINDPVNELDDDEVVVKSSLENLFKISFHDCSNLTPDVFIKILPHLSNLRRLDLTH
FT                   TSVTSTILNTYLPHSIELTHISLAKCSKLTTKDLINFLTNHPSVCNNSLTWLNLQIDSN
FT                   MVSPLNEVYLYYTLKHLKAENLRYLNLGGLPLNEKILRLIKVNFPRLESLSVSHSSIEL
FT                   NDVSEYLNENKNIRYLDITGCKKITRWNLTHILKANYDSPLTAIEFDYKLLFELTTGEF
FT                   MKILPLQSSNMNLLSYETKEPEIWKFYDNEGRRSWIYKIVPSDPDYNSILNNNNKALTN
FT                   ANLTFYDLETGEKIVQRVKKPEFLKYASRKINCSVGYFNLNMVKKKNYIQNILKENIWP
FT                   VEFSQRGIYNYYSLNIK"
FT   gene            complement(<366537..>366782)
FT                   /locus_tag="DEHA2E04356g"
FT                   /old_locus_tag="IPF_43284"
FT   CDS_pept        complement(366537..366782)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04356g"
FT                   /old_locus_tag="IPF_43284"
FT                   /product="DEHA2E04356p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65762"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV0"
FT                   /protein_id="CAR65762.1"
FT                   /translation="MSSPCRTPLTIGHRDSFVFPVLSGRSILHPFSPSALRHFCSSRPS
FT                   PIPVRYKPLHRSCNYIVQIPQYRPTISVFIYYQPTN"
FT   gene            <366869..>368455
FT                   /locus_tag="DEHA2E04378g"
FT                   /old_locus_tag="DEHA0E05104g"
FT                   /old_locus_tag="DEHA-IPF5434"
FT                   /old_locus_tag="DEHA-CDS2124.1"
FT   CDS_pept        366869..368455
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04378g"
FT                   /old_locus_tag="DEHA0E05104g"
FT                   /old_locus_tag="DEHA-IPF5434"
FT                   /old_locus_tag="DEHA-CDS2124.1"
FT                   /product="DEHA2E04378p"
FT                   /note="weakly similar to uniprot|P47039 Saccharomyces
FT                   cerevisiae YJL060W BNA3 Arylformamidase involved in
FT                   biosynthesis of nicotinic acid from tryptophan via
FT                   kynurenine pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87736"
FT                   /db_xref="GOA:Q6BQL0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQL0"
FT                   /protein_id="CAG87736.2"
FT                   /translation="MSNFNFNESDDESLSEFERLESTLPEPLKRSASSLLLTLNNTQTS
FT                   NMPSLTGNYGGASSYMNEGHPSARAPPVPISHKNHLINKLSRSEGRESSPVPIPRPKFN
FT                   EEINKPAMNTSQSSTGVLWVTERAGEYGFNNQDSWANLGQGAPEHGDTIPGSFKRPTSV
FT                   PISEHSKEYAPTAGIKELRHAVANLYNETYRKNKHSKYTYKNVCIVPGGRAGLTRIASI
FT                   ISDCYLSFFLPDYTAYAEMLSLFKNFSPIPVPLKESDNYEFHLEMIKNELMRGVSALLT
FT                   SNPRNPTGKCMSREQLASLHKLCEEKCLLIMDEFYSHYYYDDNCSGSSISSAEFVEDVN
FT                   RDPVLILNGLTKAFRLPGWRICWILGPEEYINSLSSAGSFLDGGSNAPLQFAAIDFLEP
FT                   TLVRNEMRALQVHFKMKRDYIIERLSKMGFEFNDKNTPNSTFYLWLNLSHLPGKLSNCL
FT                   GFFHECLHEKVIIVPGFFFLINPQNLSKLEDVIWYNYVRISYGPEYNQLVKGMDGIERI
FT                   LKRFNCLPCDV"
FT   gene            <368691..>373325
FT                   /locus_tag="DEHA2E04400g"
FT                   /old_locus_tag="DEHA0E05126g"
FT                   /old_locus_tag="DEHA-IPF5433"
FT                   /old_locus_tag="DEHA-CDS0098.1"
FT   CDS_pept        368691..373325
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04400g"
FT                   /old_locus_tag="DEHA0E05126g"
FT                   /old_locus_tag="DEHA-IPF5433"
FT                   /old_locus_tag="DEHA-CDS0098.1"
FT                   /product="DEHA2E04400p"
FT                   /note="similar to uniprot|Q04958 Saccharomyces cerevisiae
FT                   YML059C NTE1 Serine esterase that deacylates exogenous
FT                   lysophospholipids"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87737"
FT                   /db_xref="GOA:Q6BQK9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQK9"
FT                   /protein_id="CAG87737.2"
FT                   /translation="MSTIEIVSTVAEYTEIHSPVSSKFLLPSARDSSSSISLFSAIFWF
FT                   WSWLFFKIMNIFLYYIPNIIVNLFSVNFQITLSLSSIVITLTGIISFCFLIVRYKYLTR
FT                   YSKTTKSTDKPKSSNKNIDLVGSIKKNKRGDSKSTSNYLDEFLSAIKVFGYLERPVFHE
FT                   LTRNMTTQKLSSEEILYLDEKLGFSIVVEGTIQVYTKVNSVNSSTTSNSDDNELNFEKD
FT                   DLLTIGDQCYQLLNEVKSGSPLSSLMSTLDLFKPVDPDTMSNRLFSPFELDSNPASNPL
FT                   SPDNTGSKSFDPLSSGNFNDTSLSSSDRNYPNIVARPKPIEDSNNLNTATIAIIPYSAF
FT                   QKVQSKYPKATSHIVTMVITRLYKITMNTIHSYLGLTREIIRSEIQLNESEGAKDSLPS
FT                   YLYDGVIEKFYGDKNNETLLNKTAESPSVSINKTSSSSSSLPKKSTTSLRPLNRNQSSR
FT                   YVVLDSRSKSTHPGDLLSSVPLSRRSDYYQTHTTIQPDPEEVRSQSRTKMTSPVLPKRQ
FT                   ISSNGGPTLKGHSSSTTKFENIRDRTFSDEREETEETSLRIAIIENIFKILGINEVSNM
FT                   IGSMSDLNSRSSSVNSSVVGLPSLMNNGNESKYPNGIFDFNTGKVRYDSISSFPTSLNK
FT                   GANNNLKFYDTVNQSQLKDMDHENDKSSQVDINNLMFKRKSIPIQSFESNFYDVKNEFS
FT                   KHLNIKYFGPNTTLVEQESFNSGLYYVIDGTLDVFYKPASKESENLTPMNKKKLYTVKS
FT                   GGLAGYLSSIIGVRSLVSISTPGDKGVIVAHIPKNEFSKLLDKFYFLQLPVASKLKSLL
FT                   SSQILTIDYALEWCHIPAGDVLCSQGDLANGFHIVLSGRFRVVRYNNNKSSEVNPDDNT
FT                   DIHDYNNNLIDESLSYKSRKKKDDITILGEYGHGETIGEVEVLTASRRTNSLIAVRDSE
FT                   TARIPRTLFEMLSLRNPSIMVKVSRIVANKMAKKDNIGIPSTISSNVPLIVTNTDSHIS
FT                   NDYKTITILPTVSGLPVRDFADKLVSALKNIGRNVIALDQASTLTHLGRHAFDERLAQL
FT                   KLSGYFAYLEEEYQTIVYVCDTPLKSNWTSTCISQGDCILLLADADDDDVATNIGEYER
FT                   LLMKLKTTARTDLCLIHADKYVEPGSTSVWLKNRIWVQGHHHIQMEIARDNSVQQGQKT
FT                   SIIKNIAAKISSRTNTNIKSRLENVKTKAILSLNKFNNRLSRRTHSYKTVQAHKNDFLR
FT                   LARILSNESVGLVLGGGGSRGISHVGVVMALEKHGIPIDLIGGTSIGSFVGGLYAKDYN
FT                   IVSIYGRAKRFAKRVSSWWRMVLDLTYPVTSYITGYEFNRGIWKIFGSSEIEDFWIRYF
FT                   CNSTNITNSTMDIHESGFSWRFIRASMSLAGLLPPITYGGSMLLDGGYLDNLPVMEMKK
FT                   KGAKYIIAVDVGSVDDRTPMNYGDTLSGFWVLFNRWNPFSRHPNVPNMMDIQLRLAYVA
FT                   SVNALELAKKTPGVIYLRPPIDDYATLDFAKFDEIYHVGMAYADNLLTRWEQTGKIPPI
FT                   AGMIDRSRIRNGEERKSLYRRSSI"
FT   gene            <373470..>376031
FT                   /locus_tag="DEHA2E04422g"
FT                   /old_locus_tag="DEHA0E05148g"
FT                   /old_locus_tag="DEHA-IPF5431"
FT                   /old_locus_tag="DEHA-CDS0697.1"
FT   CDS_pept        373470..376031
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04422g"
FT                   /old_locus_tag="DEHA0E05148g"
FT                   /old_locus_tag="DEHA-IPF5431"
FT                   /old_locus_tag="DEHA-CDS0697.1"
FT                   /product="DEHA2E04422p"
FT                   /note="some similarities with CA3418|IPF12777 Candida
FT                   albicans IPF12777"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87738"
FT                   /db_xref="GOA:Q6BQK8"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQK8"
FT                   /protein_id="CAG87738.2"
FT                   /translation="MYIPTARKRLLRNGVLGRVACLRNPWIFHRRNIQIVHNNASVQAE
FT                   QVQKKRLNLDSVASLKYDPSDDLTDFTSFGILPFFQEKLNRLLRPDDRSITSAPDYNVP
FT                   PTHDQRTLLSVLNSEHSLIHRGSSQTGKSLALLTYALNHTLSKVPNFGSLKNSRSYQSV
FT                   DSIILAPTDLLIGKYEYYAKELTKDIPEMCCPDQLLVDGSDNDYSVMRKPLSVKFLYSD
FT                   GTTKSLCTSNNSEYSSNIPQILITTPSKLYEIMNDEKSVDNITKGNLNEVRFFAIDEMD
FT                   FLLNTTNISTTSNTNLVNSGKKSKYLNKIEKIIRELQTSQIKYYTSHLIRRLKYVETTH
FT                   RNANKEAFDNNKFDHATFVLEDNTLSTSNVSTNLELLLSHNSTNSRPDESLLKKLIKVK
FT                   RKVLYKPIQYCFIFHPKHSYQQILLQLSNKKYKKAFDETIMKELQKIHNVSRNDDRLQN
FT                   EYSKYLLEKVTRNDQKQEDSQVSFIEKLVRFDDSKRFYRKQERKIVSVGSFNLDNKIID
FT                   TSKEASENETSSSISKIQTHFVEARNIKKNSNRVLLRDINITKNMPDKVKTISVLENDI
FT                   ENSGYNIKNLLKSFLKSRMLSTSSLLKKDKGFINNQMIVTEITRATISKFKMEYPLNTD
FT                   PILIVMPPAINVESLSDELSMDKSSPDKFTCLNTEEFRTKTECASPNFDYLALSNFFLK
FT                   QSPKEYDIRTNLIVHPDQLIGQNISGLTNLIVIGMESMLPQLAFSSKDSTVDEIAGIDD
FT                   PVSDLSSFYLSKLSSSSNSNVKNLLFVLDAFNKNDSKILKSRISSDFQRLSQIILYNDL
FT                   QERINLSKLCEEHPAMTELAYGIDKSFYQRVRNDINKHVYK"
FT   gene            complement(<376141..>378639)
FT                   /locus_tag="DEHA2E04444g"
FT                   /old_locus_tag="DEHA0E05170g"
FT                   /old_locus_tag="DEHA-IPF5430"
FT                   /old_locus_tag="DEHA-CDS0749.1"
FT   CDS_pept        complement(376141..378639)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04444g"
FT                   /old_locus_tag="DEHA0E05170g"
FT                   /old_locus_tag="DEHA-IPF5430"
FT                   /old_locus_tag="DEHA-CDS0749.1"
FT                   /product="DEHA2E04444p"
FT                   /note="weakly similar to uniprot|P07271 Saccharomyces
FT                   cerevisiae YML061C PIF1 DNA helicase involved in telomere
FT                   formation and elongation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87739"
FT                   /db_xref="GOA:Q6BQK7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQK7"
FT                   /protein_id="CAG87739.2"
FT                   /translation="MSRRIFVLQASYSNNWLIRGYSTYKQSKSIISNNNIPNMSANCAG
FT                   YSNRNQSDNIIHNGNRNVHSVQIPIDKNKHEMQDAVAGIDFSSSFSDDTSMKELEDEDL
FT                   EDDDMESSVAFSDDEALLQMLDSRTLHAPQLKKYNNDDNADVVCNNYNIERTILSPENS
FT                   RINIMDCSSPKHKRVKPEPVITVPVEHPIKHSISPKRSTSEITEPFSNTPNQLRSFSTS
FT                   SIRSKKLENIYPTIQLATQKAFNIEDDSEIKKSNTRKSTDIIKSVKPIVLSGEQEYVLQ
FT                   LATGGQSLFYTGSAGTGKSVLLRSIIKSLKQKHEKGHVAVTASTGLAACNIGGITLHSF
FT                   AGVGLGDGTISALMKKIRRNKKAYIRWCSVKVLIIDEISMIDGVFLNKLDSISKTLRKN
FT                   NKPFGGIQLIVCGDFYQLPPVNKVKPTNQMSLNGQNIVEESIFAFESQAWKDTIKCTII
FT                   LKEVFRQKGDQRFIDMLNDMRNGKVNNETIAEFKRLSRKLDNPDGIEPAELFSTRYEVE
FT                   NANNTRLNLLKGESQIFKAIDSGSLPTDQRQTVLNNFLAPQKLFLKKNAQVMCIKNFDE
FT                   SLVNGSLGQVVNFMDRDTYMHYNLMKENPEATISEIEREFKKNKEKKKILDELESEHKP
FT                   LSLNDSIFDFLEDIEIMEGSHDVELDVHELAFRTNKERKVDFIKALHQNSSKSKYPLVR
FT                   FLLPDGYNTREVLVEPEQWTIEDENENVLARRVQLPLILAWSLSIHKSQGQTLPKVKVD
FT                   LKRVFEKGQAYVALSRAVSRNGLQVLNFNKDKIMAHPKVNKFYESLSSTEELALTTNDF
FT                   ARPHLLQPKEGRHKERIMIS"
FT   gene            <378850..>381417
FT                   /locus_tag="DEHA2E04466g"
FT                   /old_locus_tag="IPF_5429"
FT   CDS_pept        378850..381417
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04466g"
FT                   /old_locus_tag="IPF_5429"
FT                   /product="DEHA2E04466p"
FT                   /note="some similarities with uniprot|Q12745 Saccharomyces
FT                   cerevisiae YLR440C SEC39"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65763"
FT                   /db_xref="GOA:B5RTV1"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV1"
FT                   /protein_id="CAR65763.1"
FT                   /translation="MNDDNNVLIADAKIYISIVYLLSSTTNVDVDDLSNVFNSLGSDMD
FT                   VGKPHTYTNLHNILGLLLIYPTRSYISIENIARFAQGVVNYANSPEDRSLNASEGLYED
FT                   LEEFANWISSRFKIDDSAILSLDDGLLVQAAYDLALDNRLQCEQYGYTLTTNQSNNELL
FT                   FQFVQAKALFLSKYCTEIGVLNPLFEILEGYAPFDKWYRGIIVPFMYYWDNYGSLNSNS
FT                   LLDLFQFLKSESFNEMLHILIEPLNSPAYSEKLSVSNWVSKVIMPLVVYQGYDFKPLLE
FT                   WLYFRGDWNVQEPSKKYKIWNNAIRSIISFKDYNNDVLEISNYENILRFFLGSCYYYAI
FT                   FYETVEKVSSIEMLKLYDSIKDSLDVIKKRVGSPHSGKTDYAIDKLDFDSLDNSSDLDA
FT                   FMNDPSNPFAQLFNPSPSSISFLHEAIITCERLYPTNKFTILEFLKLKYSTASDFSYGE
FT                   REVAKIMTNLNTNNWTMILSSARLFTDSFIANDEANNESINKLIIDRFLFNNLFDVVGD
FT                   FYEKGELSISVDALFSIISKKFWESFNKASNFNNKIGRLHEASQSIELYDKISTDEQLS
FT                   AINKEEIIRIKHLFKAVSNIKNFKIVIQKGSPFVPSDLISQFSSVSSMGALDLDEQKRS
FT                   PMALISTILEQNPKSYLAFEKLYKILNDLLIFFNDNRSEPTFYFNKLKSICIESALVDN
FT                   NFQFAYRQSNELLDHYSVDSNKNLNDFWLTFYQVGKFISPEWFNESRSPQNDKIDILIK
FT                   QREILSKTLKYSKPSDTSIDNSRLILKQWESINSQIEDWYINSQQGYYTKGLSSTTDAV
FT                   PERMATLASDIMNDASNTTTQASDKLSNLFVSGLGWALGANPQ"
FT   gene            <381525..>382481
FT                   /locus_tag="DEHA2E04488g"
FT                   /old_locus_tag="IPF_5427"
FT   CDS_pept        381525..382481
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04488g"
FT                   /old_locus_tag="IPF_5427"
FT                   /product="DEHA2E04488p"
FT                   /note="similar to CA3421|IPF19782 Candida albicans
FT                   IPF19782"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65764"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV2"
FT                   /protein_id="CAR65764.1"
FT                   /translation="MVLITNKQQDLIDEVISNYLKNYDKIAQQYLKIRQDIYELTTSIS
FT                   QEITESKEGLVSDSNKFKIKQLSYDFDKVCEIYKTHLQILNSNLDIKQNIPPPYIEELN
FT                   LQYDALLARKTDLKSEIDTLKNVQKPLLDKMRLLLKSFENGLNSRTAKRMNRIVSDGIN
FT                   EPDENSKDIDVQSLIFHSADMETLFSDVDTKLNQLKNIGNDDDPDNIIDSNQPKNITRY
FT                   IDEHLRNGRTFHLLEEDKYIYDVSKSATVDTATSLTSVDEYDRMIENLIINIKDVIEHG
FT                   AESKERWSNNARKLDLIKETLNKFEDSVDISDEEMES"
FT   gene            complement(<382653..>382919)
FT                   /locus_tag="DEHA2E04510g"
FT                   /old_locus_tag="DEHA0E05236g"
FT                   /old_locus_tag="DEHA-IPF5426"
FT                   /old_locus_tag="DEHA-CDS7613.1"
FT   CDS_pept        complement(382653..382919)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04510g"
FT                   /old_locus_tag="DEHA0E05236g"
FT                   /old_locus_tag="DEHA-IPF5426"
FT                   /old_locus_tag="DEHA-CDS7613.1"
FT                   /product="DEHA2E04510p"
FT                   /note="similar to uniprot|P57743 Saccharomyces cerevisiae
FT                   YLR438C-A LSM3 Component of small nuclear ribonucleoprotein
FT                   complexes involved in RNA processing splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87742"
FT                   /db_xref="GOA:Q6BQK4"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034105"
FT                   /db_xref="InterPro:IPR040002"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQK4"
FT                   /protein_id="CAG87742.1"
FT                   /translation="MSTVRTEQQQQEPLDLVRYQLDELVLVKLRGAREMKGKLQGYDSH
FT                   CNMILSDAVEYIYDVPEGQEPVTKNTDMVFVRGDSVILISPVN"
FT   gene            <383145..>384053
FT                   /locus_tag="DEHA2E04532g"
FT                   /old_locus_tag="DEHA0E05258g"
FT                   /old_locus_tag="DEHA-IPF5425"
FT                   /old_locus_tag="DEHA-CDS4221.1"
FT   CDS_pept        383145..384053
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04532g"
FT                   /old_locus_tag="DEHA0E05258g"
FT                   /old_locus_tag="DEHA-IPF5425"
FT                   /old_locus_tag="DEHA-CDS4221.1"
FT                   /product="DEHA2E04532p"
FT                   /note="weakly similar to uniprot|P36517 Saccharomyces
FT                   cerevisiae YLR439W MRPL4 Mitochondrial ribosomal protein of
FT                   the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87743"
FT                   /db_xref="GOA:Q6BQK3"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="InterPro:IPR038340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQK3"
FT                   /protein_id="CAG87743.2"
FT                   /translation="MASHLSIRSLSGSSRYLARNKALKFTDLKSIKLREPIVPTHKNFD
FT                   VSPDHPLWAFFPDGNKSETCFRETVDLDIQSRPWGLPELRRKSFEDLHKLWYLILKERN
FT                   ILAREVRLADSFNERSTHAHNDLDDKLTLTQKRIKQALIERQVAYERVQTFTDNQKEYL
FT                   SDFEESYINADSSEIVSFNEKLVRLQYAFFGIQPQLEDYNLEEDINVKFVEGLSYVANL
FT                   KLKRYLSQNPQSTEEFQTPLNGVVEELPFLLRDTEEAIEEVQELRNSGANVVLHKIEVF
FT                   PFLRNALGKTIQEAYASDEQL"
FT   gene            <384297..>384668
FT                   /locus_tag="DEHA2E04554g"
FT                   /old_locus_tag="DEHA0E05280g"
FT                   /old_locus_tag="DEHA-IPF5424"
FT                   /old_locus_tag="DEHA-CDS6655.1"
FT   CDS_pept        384297..384668
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04554g"
FT                   /old_locus_tag="DEHA0E05280g"
FT                   /old_locus_tag="DEHA-IPF5424"
FT                   /old_locus_tag="DEHA-CDS6655.1"
FT                   /product="DEHA2E04554p"
FT                   /note="similar to CA3001|IPF8841 Candida albicans IPF8841"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87744"
FT                   /db_xref="GOA:Q6BQK2"
FT                   /db_xref="InterPro:IPR031463"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQK2"
FT                   /protein_id="CAG87744.2"
FT                   /translation="MGGRIHGFLGGVLLTSALTYYTGEYFRKNSKFVSTHLKASDNIIN
FT                   NRILTDRDITREVIPISNQHNSITRSNTVETCKDIWNDEIIQMVNWIYGINWYQWGIEA
FT                   DKTFNELTDKVAASVVEKK"
FT   gene            complement(<384747..>385733)
FT                   /locus_tag="DEHA2E04576g"
FT                   /old_locus_tag="DEHA0E05302g"
FT                   /old_locus_tag="DEHA-IPF5422"
FT                   /old_locus_tag="DEHA-CDS3928.1"
FT   CDS_pept        complement(384747..385733)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04576g"
FT                   /old_locus_tag="DEHA0E05302g"
FT                   /old_locus_tag="DEHA-IPF5422"
FT                   /old_locus_tag="DEHA-CDS3928.1"
FT                   /product="DEHA2E04576p"
FT                   /note="similar to uniprot|P38342 Saccharomyces cerevisiae
FT                   YBR265W TSC10 catalyzes the second step in the synthesis of
FT                   phytosphingosine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87745"
FT                   /db_xref="GOA:Q6BQK1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQK1"
FT                   /protein_id="CAG87745.2"
FT                   /translation="MLFSNNKIHAEGKLALIVGASQGLGADLALKLYQQNCSVILVART
FT                   ETKLVAQIERIQSSSPENNATLSYKCCDASNYEDCVKLWNDLIVDQKQDPDFIFCCAGS
FT                   SIPKLFSDLTAKDFAIGINTNYTTSLNITHTGFKQVLGQFSDLSCDQYKKRHVIFVSSV
FT                   VSFYPFIGYSQYAPLKSAIQSLSIILRQEMGPFNYRVSCVFPGNFQSEGYEEEQKTKPS
FT                   ITKSIEGSSKPISGEDCADIILNQLNRGYDTVTTDFIGWLLGCSVLGVLPRSWGFFQVI
FT                   VSFIFSIIAPIANYVVYRDVLKFFKTRSTREVEEYEIVSTDDNKKTL"
FT   gene            complement(<385955..>386707)
FT                   /locus_tag="DEHA2E04598g"
FT                   /old_locus_tag="DEHA0E05324g"
FT                   /old_locus_tag="DEHA-IPF5421"
FT                   /old_locus_tag="DEHA-CDS4799.1"
FT   CDS_pept        complement(385955..386707)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04598g"
FT                   /old_locus_tag="DEHA0E05324g"
FT                   /old_locus_tag="DEHA-IPF5421"
FT                   /old_locus_tag="DEHA-CDS4799.1"
FT                   /product="DEHA2E04598p"
FT                   /note="weakly similar to uniprot|P22353 Saccharomyces
FT                   cerevisiae YJL063C MRPL8 Mitochondrial ribosomal protein of
FT                   the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87746"
FT                   /db_xref="GOA:Q6BQK0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQK0"
FT                   /protein_id="CAG87746.2"
FT                   /translation="MPSLQKFHANVARHVKSMDKNLCANLIRHEYIVTGRTKAKRSQRK
FT                   IERFLSRAVSENKQMSEKDEEFKLKNNKAFAFLQPPDKQEVGSKVINDLVNRYPKRTHG
FT                   FTRIIKLEPRLGEDKAPMSVLELVDSEYEIKFWFTAKIVARLELQGLELDDLTKHTVTK
FT                   LTQFRVNGEDKFREAVETAKVEFFKYDPESGEVTDADMKENLKNLPRNLEYNGGSMSGK
FT                   LLMSKKFKTIPRPEAKKVELPKSPFLSS"
FT   gene            <387194..>387267
FT                   /locus_tag="DEHA2E04620r"
FT                   /old_locus_tag="Deha0E.5"
FT   tRNA            387194..387267
FT                   /locus_tag="DEHA2E04620r"
FT                   /old_locus_tag="Deha0E.5"
FT                   /note="tRNA Asn (GTT) cove score=74.40"
FT   gene            complement(<387511..>387705)
FT                   /locus_tag="DEHA2E04642g"
FT                   /old_locus_tag="DEHA0E05368g"
FT                   /old_locus_tag="DEHA-IPF5419"
FT                   /old_locus_tag="DEHA-CDS8325.1"
FT   CDS_pept        complement(387511..387705)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04642g"
FT                   /old_locus_tag="DEHA0E05368g"
FT                   /old_locus_tag="DEHA-IPF5419"
FT                   /old_locus_tag="DEHA-CDS8325.1"
FT                   /product="DEHA2E04642p"
FT                   /note="similar to uniprot|Q3E764 Saccharomyces cerevisiae
FT                   YLR262C-A RBF7"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87747"
FT                   /db_xref="InterPro:IPR015157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ9"
FT                   /protein_id="CAG87747.2"
FT                   /translation="MSGRQGGKQKPLKNPKKKQSDEDEEDVAYKAKLKADAQAKKDMAN
FT                   KAKKGGPLVGGGIKKSGKK"
FT   gene            <387936..>389864
FT                   /locus_tag="DEHA2E04664g"
FT                   /old_locus_tag="DEHA0E05390g"
FT                   /old_locus_tag="DEHA-IPF5418"
FT                   /old_locus_tag="DEHA-CDS1392.1"
FT   CDS_pept        387936..389864
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04664g"
FT                   /old_locus_tag="DEHA0E05390g"
FT                   /old_locus_tag="DEHA-IPF5418"
FT                   /old_locus_tag="DEHA-CDS1392.1"
FT                   /product="DEHA2E04664p"
FT                   /note="similar to uniprot|Q12446 Saccharomyces cerevisiae
FT                   YOR181W LAS17 Actin assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87748"
FT                   /db_xref="GOA:Q6BQJ8"
FT                   /db_xref="InterPro:IPR000697"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ8"
FT                   /protein_id="CAG87748.2"
FT                   /translation="MGILTKADKEKIKRVIPKANNKIIDATVARLYIAYPDPTEWKYTE
FT                   LLGAIVLVDDLVGHTFFLKLVDILGHRGVLWDQELYIDFEYYQDRKFFHTFEIEDCLVG
FT                   LLFEDTNDASHFYKRVTGRQKHGSKQTVNNKNAIALKESNPASSGHNMPGPRGEYMDVN
FT                   TAQRSRRAKGVLYYDDVPPPEWRSLYSELEAAGITEDMIADNRDFIKSYIAQQGGPLVG
FT                   LEPPIPRKLHKKHEFVPEPSTRISSSSSLKNKKAPPPPPPPAKSPGPSANSSTDNFNFQ
FT                   TAGESSAPPVSDYASATDASHSPSPSPSPAEEVESKPKFRLPPATAVAPPVPGYSMSQP
FT                   NQSNQGPGMQPQQQFTQPPPQQSHNAPPALPQGARPVPPPPPSRSNQTSTAGIPPPPPR
FT                   AGTAPVAPQRTGAPPPPPPPRAARANAPPAPPPRAARTNVTGPQGQQPGAFSPQTATNP
FT                   PPLPPTHNQAPPSRQTSTYNQRPQQPIPPASTGASHPPPPPRFPQSTGSAPPPPPLPPT
FT                   ATGGAPPPPPLPPTATGGAPPPPPLPPSNMGETAPLPSVDPSRDALLASIRGSGLGSLK
FT                   KTDKSQLEKPSVLLSEAKGESPSIPSSAAPPGTGQPASLADALASALNKRKDKVAGSDD
FT                   DDDDDDW"
FT   gene            <390008..>391084
FT                   /locus_tag="DEHA2E04686g"
FT                   /old_locus_tag="DEHA0E05412g"
FT                   /old_locus_tag="DEHA-IPF5415"
FT                   /old_locus_tag="DEHA-CDS3593.1"
FT   CDS_pept        390008..391084
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04686g"
FT                   /old_locus_tag="DEHA0E05412g"
FT                   /old_locus_tag="DEHA-IPF5415"
FT                   /old_locus_tag="DEHA-CDS3593.1"
FT                   /product="DEHA2E04686p"
FT                   /note="weakly similar to uniprot|Q05881 Saccharomyces
FT                   cerevisiae YLR287C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87749"
FT                   /db_xref="GOA:Q6BQJ7"
FT                   /db_xref="InterPro:IPR026907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ7"
FT                   /protein_id="CAG87749.2"
FT                   /translation="MAKDRLDLKNLIQSFKEALQYWSVCLESSNTSLSEIKAAEVTNPL
FT                   EELDKLAKLIRAHTTKVGIVFKPETLIKSTDAAFNTLQKLSESLVLIISLVSQLKSKII
FT                   SDMFYKEILNSVRLLIESNSQFADELTTMELDTSEGSETQAPASHSENGIDGRLVSVGK
FT                   IWSNCDALSKLVKDGELGVLSKKIKQSIILIEDGLDEFEEWAENPDDFDMDDDPFGFSD
FT                   DESEEEDAPPTNEIPEKENGNKEGKENLIEFSQLWLSKIKLIKLLLTSVTRSLPSVTSG
FT                   DIINNINDVQRSLVNKIDTLIVDLMMSKEVDEESVSNSQDITKICYKLIKIVKDVNKSN
FT                   DNKIKWCVAWDSKFKEGL"
FT   gene            complement(<391155..>392036)
FT                   /locus_tag="DEHA2E04708g"
FT                   /old_locus_tag="DEHA0E05434g"
FT                   /old_locus_tag="DEHA-IPF5413"
FT                   /old_locus_tag="DEHA-CDS4314.1"
FT   CDS_pept        complement(391155..392036)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04708g"
FT                   /old_locus_tag="DEHA0E05434g"
FT                   /old_locus_tag="DEHA-IPF5413"
FT                   /old_locus_tag="DEHA-CDS4314.1"
FT                   /product="DEHA2E04708p"
FT                   /note="similar to uniprot|P40363 Saccharomyces cerevisiae
FT                   YJL068C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87750"
FT                   /db_xref="GOA:Q6BQJ6"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ6"
FT                   /protein_id="CAG87750.2"
FT                   /translation="MTFNTEQEIFQFQGRLLKLSHSSSTTNTKMDVNVFLPPQALETSS
FT                   SKTPVLVYLSGLTCTPNNASEKSFLQYFGTKYGFAVVFPDTSPRGAGIAGEDESYDFGT
FT                   GAGFYLDATEEPWSKNYNMYSYVHKELLTELAKQFSQLDFENKISILGHSMGGYGALTG
FT                   FFKNPGKYRSVSAFAPISNPSNCPWGEKAFGNYLGKNKQAWYEYDPTHLIKNYSNGNQP
FT                   DILIHQGSKDGFYHKDHQLQPENFVKAAKEAGYKGNIDLRIVDGYDHSYFFISSFVEDH
FT                   AKHHAKFLGLLD"
FT   gene            complement(<392221..>393813)
FT                   /locus_tag="DEHA2E04730g"
FT                   /old_locus_tag="DEHA0E05478g"
FT                   /old_locus_tag="DEHA-IPF5410"
FT                   /old_locus_tag="DEHA-CDS2111.1"
FT   CDS_pept        complement(392221..393813)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04730g"
FT                   /old_locus_tag="DEHA0E05478g"
FT                   /old_locus_tag="DEHA-IPF5410"
FT                   /old_locus_tag="DEHA-CDS2111.1"
FT                   /product="DEHA2E04730p"
FT                   /note="weakly similar to uniprot|P25297 Saccharomyces
FT                   cerevisiae YML123C PHO84 High-affinity inorganic phosphate
FT                   (Pi) transporter and low-affinity manganese transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87752"
FT                   /db_xref="GOA:Q6BQJ5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ5"
FT                   /protein_id="CAG87752.1"
FT                   /translation="MMPSSIVVNSENNEDQSSKTGKIVEEEWNVSDTALSSESTLYENS
FT                   GFSERYLEKSKLLSRAIDEIGFGKYQVGLFFVAGFGWLSDNAWPIVTSLILPRLTEVDG
FT                   VHSPAGKGPYLTLAQNLGLLAGALVWSLSSDIIGRRWAFNLTFLCTAIWATVAGSSPNF
FT                   AAIGVFSALWSFGVGGNLPVDSAIFIENLPSRQKYLLTMMSGFWALGQILANLISWGLI
FT                   GNYSCSDTDTVCHKADNKGWRYFLFTMGGITFLMFFSRFAFRVLESPMFYMARGDDEKA
FT                   IENLYKIAKINGKSVSLTLEQLEEVDKKYGDQEIVPSKHAHLSKFKLTHIRDCFSSRKL
FT                   AISTSLVIFAWGVIGLAFPLYNAFLPSYLERNGDANEPLPVHLVYRNSLIVAVIGIPGA
FT                   IVAGICVELKIGRKGTLFISLILTGVFLYCSTTATTSNANLGWNCGFSFFSNIVYGVLY
FT                   AYTPEIFPTRIRGTGVGLAASFNRVMGVFAPIIAIYADITTSAPIYVSGALFMFAGLLT
FT                   LLFPYEPRGKSSY"
FT   gene            complement(<394072..>394728)
FT                   /locus_tag="DEHA2E04752g"
FT                   /old_locus_tag="DEHA0E05500g"
FT                   /old_locus_tag="DEHA-IPF5408"
FT                   /old_locus_tag="DEHA-CDS5175.1"
FT   CDS_pept        complement(394072..394728)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04752g"
FT                   /old_locus_tag="DEHA0E05500g"
FT                   /old_locus_tag="DEHA-IPF5408"
FT                   /old_locus_tag="DEHA-CDS5175.1"
FT                   /product="DEHA2E04752p"
FT                   /note="similar to uniprot|Q9HDU7 Schizosaccharomyces pombe
FT                   SPBPB2B2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87753"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ4"
FT                   /protein_id="CAG87753.2"
FT                   /translation="MTVSSTALIEDDFDLLVPIHHPSQPLDVRHLIQTKASPYSEPDHL
FT                   LDLTRLSDEYRILALALQSFHPIDNYTYAYSTYSEAFNLEIIIDLVRKYSLQLNFTFPP
FT                   TTVYIIVFRSALYEDVRNSSEKRQFLANIDKASHAEANESGGLLKYWFGIPDDTSGRNL
FT                   ATCWWRNRGDAKLGGGGKAHRKGMNEVKSWFKHWQVEEYTLQIFEQASGFSFDRI"
FT   gene            complement(<395065..>396960)
FT                   /locus_tag="DEHA2E04774g"
FT                   /old_locus_tag="DEHA0E05522g"
FT                   /old_locus_tag="DEHA-IPF5407"
FT                   /old_locus_tag="DEHA-CDS1457.1"
FT   CDS_pept        complement(395065..396960)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04774g"
FT                   /old_locus_tag="DEHA0E05522g"
FT                   /old_locus_tag="DEHA-IPF5407"
FT                   /old_locus_tag="DEHA-CDS1457.1"
FT                   /product="DEHA2E04774p"
FT                   /note="similar to uniprot|Q08108 Saccharomyces cerevisiae
FT                   YOL011W PLB3 Phospholipase B (lysophospholipase) involved
FT                   in phospholipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87754"
FT                   /db_xref="GOA:Q6BQJ3"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ3"
FT                   /protein_id="CAG87754.1"
FT                   /translation="MKYLLLLAFLSVISIACSWSPTGGYAPGQVDCPDKSLVRAASDIS
FT                   DEEKEWIEGRNKITNENLIKFLENCDMKDFDAEKFVKNTSKPITIGLSFSGGGYRAMLN
FT                   GAGQLSALDNRTDGASDAALGGLLQASTYLTGLSGGSWLVGTIALNNFTSVQKILKDGD
FT                   IWDLEHSIVNYGGWNVLSTYNYYKSISDDLNAKEDAGFEVSLTDTWARALSHQFFAELD
FT                   DFGASLTWSGIRDMDPFKKYEMPFPIVVADGRTPGTQIISSNSSVFEFNAFEMGSWDPS
FT                   LYQFSDVKYIGTDVDDGESTNGTCIGGFDNAGYVLGTSSSLFNQFVLQINTTSLSETVQ
FT                   NIISHFLDKVSDAEDDVAIYKPNPFYKTDEAAVKSIVKNDTLYLVDGGEDLQNVPLHPL
FT                   IQPQRNVDVIFAYDNSADTNESWPNGASLVATYERQFLEQGNGTIFPHVPDVNTFLNLN
FT                   LTARPTFFGCDAKNLTSLLSDTSDKDSVFDSPLVVYTANRPFSYWSNTSTYKLDYEDNE
FT                   KKGIIQNGYEAASRLNRTLDDEWAACVGCAIIRREQERNGIEQSDQCKSCFNKYCWNGD
FT                   LDSTDQPGVNFTTTGLTDGENRISSGVSLIFGNSHQIMMSIGYALLASVVFSIAV"
FT   gene            <397188..>397355
FT                   /locus_tag="DEHA2E04796g"
FT                   /old_locus_tag="DEHA0E05544g"
FT                   /old_locus_tag="DEHA-IPF12687"
FT   CDS_pept        397188..397355
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04796g"
FT                   /old_locus_tag="DEHA0E05544g"
FT                   /old_locus_tag="DEHA-IPF12687"
FT                   /product="DEHA2E04796p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQJ2"
FT                   /protein_id="CAG87755.2"
FT                   /translation="MPPHCLRRIRPSDHILSNELQGSRSCHNFSGNNVEEYSLVCKKTK
FT                   IRSNSIVHII"
FT   gene            <398574..>398645
FT                   /locus_tag="DEHA2E04818r"
FT                   /old_locus_tag="Deha0E.6"
FT   tRNA            398574..398645
FT                   /locus_tag="DEHA2E04818r"
FT                   /old_locus_tag="Deha0E.6"
FT                   /note="tRNA Glu (TTC) cove score=57.78"
FT   gene            <398987..>400138
FT                   /locus_tag="DEHA2E04840g"
FT                   /old_locus_tag="DEHA0E05588g"
FT                   /old_locus_tag="DEHA-IPF5404"
FT                   /old_locus_tag="DEHA-CDS3328.1"
FT   CDS_pept        398987..400138
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04840g"
FT                   /old_locus_tag="DEHA0E05588g"
FT                   /old_locus_tag="DEHA-IPF5404"
FT                   /old_locus_tag="DEHA-CDS3328.1"
FT                   /product="DEHA2E04840p"
FT                   /note="weakly similar to uniprot|P36164 Saccharomyces
FT                   cerevisiae YKR088C TVP38 Integral membrane protein
FT                   localized to vesicles along with the v-SNARE Tlg2p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87756"
FT                   /db_xref="GOA:Q6BQJ1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQJ1"
FT                   /protein_id="CAG87756.1"
FT                   /translation="MPRLPSSSDPFQGHNELPQSNNFMSRTNSIIQDKLFLVRNVGQQT
FT                   LDWYQSQPLWKRTLLQVLFVFNAIVVVLIMIFHKSIIQAIVVISDKWHGLKFGQGLLFT
FT                   LVFMVGFPPLLGFSALSMLAGMVYGFVHGWILLACASISGSFCSFLVFRYLLHSRAERL
FT                   MNSNKKFRAFSEILREDSSLFILVLLRLCPLPYSLSNGALAAIPELPATTYFLASLITS
FT                   PKLMIHIFVGHKLKELGDDTKGKSTHLIDILSIIITGAAASLTTYIIYNKMQRKLEFYH
FT                   QRGIIPRDDAIIFGNFEDIESANNVELNSADYDEDNFIIEDEDDENATDPDYVASKKNI
FT                   QVHAEDQNKNGEFEIDENDGVDDLGLGEISKNSKQNTNGYRDY"
FT   gene            complement(<400300..>402663)
FT                   /locus_tag="DEHA2E04862g"
FT                   /old_locus_tag="IPF_5403"
FT   CDS_pept        complement(400300..402663)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04862g"
FT                   /old_locus_tag="IPF_5403"
FT                   /product="DEHA2E04862p"
FT                   /note="weakly similar to uniprot|P36166 Saccharomyces
FT                   cerevisiae YKR090W PXL1 LIM domain-containing protein that
FT                   localizes to sites of polarized growth required for
FT                   selection and/or maintenance of polarized growth sites may
FT                   modulate signaling by the GTPases Cdc42p and Rho1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65765"
FT                   /db_xref="GOA:B5RTV3"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR034962"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV3"
FT                   /protein_id="CAR65765.1"
FT                   /translation="MEPKLQTLPQYYKRETSPMIQHSAFPPFKIEHRYRGVYERAGFDV
FT                   NLKGDSPTSDVRSTRSPTMQRFQHSSNGMNSPNSSANSIGGSMKIDSAMPSSAKTSKSF
FT                   GELQKNTPYPVYENRAHSESQPNTSQLPAISSAPSNLSYDQSQSANSVKPELPVVQIQQ
FT                   CGTPDNTELPPPSNSGFTFIPSTTQNKNLKNLSLNLNEPQSNASDNSEMSENDDDSIPN
FT                   ESYDTSSETSVNNPYIQKNDTGSKRSSQSSIRTAELSSSQIQPVHGLPSPPPTSRSCEL
FT                   QPDNSLIKKQRLSSALNEFRKDIEDHKNYVPKTPSVPNTPTFDEAPQLPTSFPPNVRVN
FT                   QTDSYQNPDTRFSYNQNYVNSANGDSSNKNAFVDQSVDPSNQFQNFRDQQLASVTQLND
FT                   EYQNFLQSGDKSQPRASQVSMVSSILSRDSEDDAADEAMERQLHALKMGENNNGNSVNE
FT                   TGSTAHINGENLQDIDSNANIDNDSSSWGSSIPKSTPNVIPAPIPSIKIQNIDDDDSPI
FT                   SANHSFDNQDSQDRANATWESIKPLSVNNSERQPLSDTSNDRAIERQINVDESSEGIEV
FT                   KPLSPKNHLVEEELRNMNFPVQQVQGSVAGNKEEISDDFFKYPSGKGPCRACKKEISPY
FT                   SRGSERAVFSKTGELSGQWHRSCFTCAYSGCTVQFSKSIQCYVYDDNAFCHNHYHELND
FT                   TLCQRCLKGIEGECVENELHQKWHLHCLTCHQCKCQINKDYYLINGASYCEEDAVKIIK
FT                   EGGSYEDMSGNVKTGGLTTSDKVEKRRTRIMYVE"
FT   gene            <403074..>404129
FT                   /locus_tag="DEHA2E04884g"
FT                   /old_locus_tag="DEHA0E05654g"
FT                   /old_locus_tag="DEHA-IPF5401"
FT                   /old_locus_tag="DEHA-CDS3662.1"
FT   CDS_pept        403074..404129
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04884g"
FT                   /old_locus_tag="DEHA0E05654g"
FT                   /old_locus_tag="DEHA-IPF5401"
FT                   /old_locus_tag="DEHA-CDS3662.1"
FT                   /product="DEHA2E04884p"
FT                   /note="similar to Candida albicans CA0802 IPF14060"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87759"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQI8"
FT                   /protein_id="CAG87759.2"
FT                   /translation="MNNVYSALSLALIGEKRFVLTTNDYENTVFLFRTLLQESCQFNSD
FT                   DICEVDVKHELDNNSVDSLIRQMIYWEENTSEYGFKNVIIWRNMEKLSHEQQKVGLFPL
FT                   LNQIDEYDTTVARSNPQSRVQVGSFVIRKPKMFIIVPLIESEHAHPQVYQYVKEKFWFA
FT                   QNFHYKDASDEKEEIDYCDDYSGLILEIRNVTRPQVYASPEIQRYIYSLVVHARNHRLC
FT                   SLAPIQSRLSTRTIDAMQQLSECMVAWKKHGSDRLFVTPDYCKIAMRKIGYWLIDWEHD
FT                   SIFNTSSDCDVDADLDYRRQLEISMLTGDWYGSDWKYVKKYLETYKTDTNAANYINKIV
FT                   EDVLQSVRPPI"
FT   gene            <404523..>409532
FT                   /locus_tag="DEHA2E04906g"
FT                   /old_locus_tag="IPF_5398"
FT   CDS_pept        404523..409532
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04906g"
FT                   /old_locus_tag="IPF_5398"
FT                   /product="DEHA2E04906p"
FT                   /note="similar to uniprot|P22137 Saccharomyces cerevisiae
FT                   YGL206C CHC1 vesicle coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65766"
FT                   /db_xref="GOA:B5RTV4"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV4"
FT                   /protein_id="CAR65766.1"
FT                   /translation="MSNDIPIDFTELASLTELGIQQSSLDFRSTTLESDHYVCVREQGS
FT                   SGNTVAIIDLKNNNAVTRKNMSADSAILHPGQLVISLRANGTTLQIFNLGTKQRLKSFT
FT                   MDQAVVYWKWLDNENLGLVTANSIYTWSIFDGSNDGPVKLTDRHHTLNNCQIINFVAEP
FT                   QLNWFAVTGIAQEEGRIAGHIQLFSKSRNVSQAIEGHVCKFGQVKLNGALHPTKVFCVG
FT                   NKNAQGQGNLHIIEIDHVEGNPDFSKKSVDIFFPPDAANDFPISLQASDKYGIVYILTK
FT                   YGFIHLYDMETGSNLFVNRITADPVFTAAPYNDGTGIITINKSGQVLSVEISQSKIIPY
FT                   VLEKLSNVPLALALSSRGGFPGAENLFSQQFQNYLNQGDYTNAAKVAASSEQLRTQDTI
FT                   NKLKHITPQPGQISPILQYFSTLLDRGTLNKYESIELAKPVLQQDRKPLFEKWLKEDKL
FT                   TSSEELGDIVKSYNDAGLALAVYIRANVNIKVVSCLAELGQFDKIMPYCEKVGYKPDYT
FT                   NLIQNLVRVNPDKASEFATSLLASSDTDLKIENIADLFFSQNYIQQGTAFLLDALKNDS
FT                   PAEGHLQTKVLEINLLHAPQVADAILGNNMFSHYDKPTIGKLCEKSGLFQRALEHYDDL
FT                   KDIKRVVVHTNVLPNDWLVAYFGQLNVQQSVACLKELLSNNIQQNLQIVIQVATKYSDL
FT                   IGPLTLIKIFEDYKCNEGAYYYLSSIVNLTQDPDVVFKYIQCAAKMNQTKEIERVVRDN
FT                   NVYNGEKVKNFLKEFKLEDQLPLIIVCDRFNFVHDLILYLYKNKYFKFIEVYVQQVNPS
FT                   NTPQVIAGLLDVDCDENIIKGLLISVLGRIPIKELVSEVEKRNRLKILLPFLEKTLEGG
FT                   STDQEVFNTLAKIYIDSNNNPEKFLQDNTNYDTLAVGKYCEKRDPYLAYICYSKGSNND
FT                   ELINITNENKMYKYQARYLLAKSDFDLWNKVLTEENTHRRQLVDQVIATGIPELDDPEP
FT                   ISITVKAFMENDLPHELIELLEKIILETSPFNDNTSLQGLLILTAIKADNSRVMGYIEK
FT                   LDKFDPEEIAPLCIDNQLYEEAFEVYDKFELRSDAMKVLVDDIMSLDRGEQYAEKYDVS
FT                   ELWYQLGTAQLNGLRIPEAIDSYVKSKNPGNFEQVIEISEHAGKEEELIPFLDMARETL
FT                   RESSIDGALINCYANAGKLNEIEKFVSGPNVADMESIGDKLFEAKNYKAAKILYSNVSK
FT                   YSKLATTLVYLKDYQGAVDCARKASNTSVWKQVNYACIENKEFRLAQICGLNLIIDAEE
FT                   LPELVKLYEKNGYFNELFALFESGLGLERAHMGMFTELAILYTKYSPEKVMEHLKLFWS
FT                   RINIPKVLTACEEAHLYPELIFLYCHYEEWDNAALTMIDKSEVAFDHSSFKEIVVKASN
FT                   LEIYYKAINFYINENPSLLVDLLSVLTPKLDLPRVVRMFVKSDNLPLIKPFLISVLDKN
FT                   NSVVNGAYHDLLIEEEDYKSLRSTIENESNNRFNSLDLAERLENHDLIFFRQISATLYT
FT                   KNKKFIKSISILKNDKLWADLIKTAAVSKSTKIAHELLDYFVETGNRECFVALLYTCYD
FT                   TIEYDYVLELSWLHELGNFIKPYEISVTYENQKKLDEVYNDLQKRREAEKQDEENPGMG
FT                   QPLMITSGPAMNQSITGLGYQPTGAGFGNAF"
FT   gene            complement(<409759..>410823)
FT                   /locus_tag="DEHA2E04928g"
FT                   /old_locus_tag="DEHA0E05698g"
FT                   /old_locus_tag="DEHA-IPF5397"
FT                   /old_locus_tag="DEHA-CDS3626.1"
FT   CDS_pept        complement(409759..410823)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04928g"
FT                   /old_locus_tag="DEHA0E05698g"
FT                   /old_locus_tag="DEHA-IPF5397"
FT                   /old_locus_tag="DEHA-CDS3626.1"
FT                   /product="DEHA2E04928p"
FT                   /note="weakly similar to uniprot|Q06675 Saccharomyces
FT                   cerevisiae YDR318W MCM21 Protein involved in minichromosome
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87761"
FT                   /db_xref="GOA:Q6BQI6"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQI6"
FT                   /protein_id="CAG87761.2"
FT                   /translation="MSADSLQIEIQEVKGDIQSLHSEIGLLDKEYSALLAQAKDLEESL
FT                   RQGDEPYNLQEIHGHSKANYDIDGPPVIKNSCFDESIRKYFTNVLDDVEEEESTEVVTK
FT                   RQKLDIIASDFKAKSETILEMKQNILYENIFRFGGVTSFPLNPFLFDENDEIMGLRFDV
FT                   FSHYKRKFITPHYVILRKMKNTEKGLETTMKWEVYRHTLPVYLPLSEYSECLHEDEEVA
FT                   FSKFTQQIREHLIQIQYKHDKFDFLRNIKYDHISKNRSSQGRVVIEKVEKDLQCQRINI
FT                   TLSNRVSNSKRASEINLVCTNDEIKEVSCIISGVDSDDKIIIQCESLLKNCDLKDLIKT
FT                   FKNVIGHLIKSDKL"
FT   gene            <410868..>413867
FT                   /locus_tag="DEHA2E04950g"
FT                   /old_locus_tag="IPF_5396"
FT   CDS_pept        410868..413867
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04950g"
FT                   /old_locus_tag="IPF_5396"
FT                   /product="DEHA2E04950p"
FT                   /note="similar to Candida albicans CA0717 IPF9785"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65767"
FT                   /db_xref="GOA:B5RTV5"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV5"
FT                   /protein_id="CAR65767.1"
FT                   /translation="MLKSRWIHASRILLKIIYLKYSVIIKSFKLIPRRSLVAIIMSNKF
FT                   SNLYWSADYKSGIDKLTQQSLRSIKQLHELRKLIFNYMQYFHSNSEYLNKLGIETFSFE
FT                   SGFRPIVPKESIEFPSKNRAVRKVSGSFQRRTVSQAERHLDSVKALDHKELHDTEETES
FT                   DKKKPHLTSMSDAFELCVKNISDESHSLINLASVIDREILEGITDFIKEHEPRVKETLK
FT                   EFSELLSDYDTTFKEIEAIEVEYDEYLRLKEFSRIDPQNGKDNEIHEDISASSDNSIPN
FT                   SASENIDKSFSDSTPHASLQDSGFEFPLPIGSTKVKKQSDLTSLLQKMIASISTIRRKI
FT                   PLPGYKNEIFSSDHLCDWLSKQRPCGLNPSRSNMEKFGQALLDLKLIVGTGIWSKKFKS
FT                   EGMWFEWSDLAVQIANYDLSDTEKYEHVSTKIPKLTIDDTTSNFMNDMAQNTSKRFNGL
FT                   FNTVKSSILKNNYSEHLNNLEAKYNESYLELQDLKHLIDLEVTNKSTALERFEKMKIEL
FT                   VFKSLTKLHEILYNISLTTTTRLHKLASEYIVNINSATNYTHEFDKLLEEFNTGIYFPS
FT                   TISPNILGNPQFGAIQSNKNFQNLKYQFNLYKDIPLQPQLTQSEENSNRLLSISSLPIF
FT                   LYQIINLIEEQENNEEVKQCWVSPIDHQCNWTIKESIINRVNVYVPESELDVSKELEIH
FT                   KDMSERVVSYLRTLPSSSLISFFKNWLLEISDSLIPCMVFDSLLNNYKNDISESDKQAI
FT                   DKRRNETAKLISTIPRSNLSSLIYIIEHICEVFSLGQIPGFGYADEISEELKEPSNESK
FT                   LNEIATELNSMEAIGSVPFIHLILRPSPVKHSSGFKPPLKAYNSILVDLLDIDVRSKLF
FT                   NSLIAHEKNYIFKKENEKKALNIQVKKIAQHPKSESSANKNIVSTLPKTPNPLNGGDSF
FT                   SLRPFRTRPTPNPSPSNSPRHTPHNSLEAGGGELKVNKLREKSIADDTNRTRSSSASFL
FT                   APNIDIEFEE"
FT   gene            complement(<413946..>415220)
FT                   /locus_tag="DEHA2E04972g"
FT                   /old_locus_tag="IPF_5393"
FT   CDS_pept        complement(413946..415220)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04972g"
FT                   /old_locus_tag="IPF_5393"
FT                   /product="DEHA2E04972p"
FT                   /note="similar to uniprot|Q02783 Saccharomyces cerevisiae
FT                   YPL060W LPE10 Mitochondrial inner membrane magnesium
FT                   transporter involved in maintenance of magnesium
FT                   concentrations inside mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65768"
FT                   /db_xref="GOA:B5RTV6"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV6"
FT                   /protein_id="CAR65768.1"
FT                   /translation="MYSISKICLGGVRQSYLRTGSLISSKFRDIYNIRLFSNTRRCQDA
FT                   NSEAFNDVLLMKALSTNKQHSENAYIRCTIFDSKGDIVVHGKDIRRSQFMKTHNLVPRD
FT                   FRKITRHYHGSNMSSMNNINVDIVPSIVTRGNSILLNLSNIKALIKSDTVVIFDSLSKN
FT                   SGSGMNKSHSHGSFLKDMNEKLKTKNEQDDLPYEFRALECILIHVMLNLTTEMNVHKTV
FT                   LQNILSRLEESIERVKLRYLLIQSKKIAQFHQKTKLIRDLLDNILEQNDELNALYLTEI
FT                   SKGKPRLQANHAEAEMLLESYYKTIDEIVQTVENLRSQIKTSEEIINIVLDSNRNELML
FT                   LGLKFSTGLLSMGCALYIAALYGMNLENFIEETDGGFELVVGGGSILLLILLMFSVKQL
FT                   KKVQRITMTGMGRENSRISINDNKR"
FT   gene            <415383..>417026
FT                   /locus_tag="DEHA2E04994g"
FT                   /old_locus_tag="IPF_5392"
FT   CDS_pept        415383..417026
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E04994g"
FT                   /old_locus_tag="IPF_5392"
FT                   /product="DEHA2E04994p"
FT                   /note="weakly similar to uniprot|P08458 Saccharomyces
FT                   cerevisiae YDR523C SPS1 dispensable for mitosis involved in
FT                   middle/late stage of meiosis required for spore wall
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65769"
FT                   /db_xref="GOA:B5RTV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV7"
FT                   /protein_id="CAR65769.1"
FT                   /translation="MGIRIQSADELQVCEEVGRGGFGVVYRGVIKATNEEVAIKQIDLE
FT                   NEQTDLFEVNKEIMIISECRLSQITQYYGCFVNHYKLWVIMEYVNGGSLFELLKPGAVT
FT                   DENVISIIAKEILIALEYLHDQGKIHRDLKSQNILLNQTGEVKLTDFGVSTQLSSNFSR
FT                   RNTTVGTPYWMAPEVILNNNGGHSYKADLWSLGCCVYELFTGKPPLQNHFSPMKALRQI
FT                   SRCHYENNFAELIGLDDLEISGSFKDFLCSCFIIEPKERFSATKLLKHKFITNVSLSDN
FT                   DKKKIVKKLITNKRRWDQENHVIQKQNYYVPTEIRNNQKKWNENELDEQKTIHFDFSSI
FT                   QESASENPIIQYPPSPTASQKSSRESSLSPTSDSKETNQDPPLPKLNYQSLSKINTKQE
FT                   NLKKTIEPELRKILNKVFHKLDSKNSLTTQQYDLLVTFNDNMLNLMSFIQYSEPNNAPY
FT                   NKLLICQYMKYFLKELLKLPAERQMENNPRFMLQKLIIPSNLNVKLNTLRTISDTTTMT
FT                   TLNNKSFTQFDEIEFSLFETWIDKMNEKIS"
FT   gene            <417365..>418504
FT                   /locus_tag="DEHA2E05016g"
FT                   /old_locus_tag="DEHA0E05775g"
FT                   /old_locus_tag="DEHA-IPF5390"
FT                   /old_locus_tag="DEHA-CDS3361.1"
FT   CDS_pept        417365..418504
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05016g"
FT                   /old_locus_tag="DEHA0E05775g"
FT                   /old_locus_tag="DEHA-IPF5390"
FT                   /old_locus_tag="DEHA-CDS3361.1"
FT                   /product="DEHA2E05016p"
FT                   /note="weakly similar to uniprot|P38123 Saccharomyces
FT                   cerevisiae YBR175W SWD3 Subunit of the COMPASS complex
FT                   which methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87765"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQI2"
FT                   /protein_id="CAG87765.2"
FT                   /translation="MYSRREKDNDMAESSLKRQKLSIQNDEEGITISMDDLYKEKYSIN
FT                   KGSLSINTIKISPNGTKFAIGSSDTKVKIFNLSNGELLTELIGHTKGISDLEFSPINSD
FT                   IIASCSDDLTIRLWSIKKAQCLKVLKKHTYHVTAVKFSSKGNILISGSADETITIWDIV
FT                   SGITLKTLAAHSDPVSSLALTPDSTMIASASYDGLMRLFDLETGQCLKTLTYNSSSHGT
FT                   ATASTTDVVNLPISNVTFSPNGKYILSSSLDGVLRLWDYMNNKVIKTYLGIGGGEVPIS
FT                   EVYNCSAKFITKTKDPLIISGSDKSGLLIWDVQSKKIVYQFKSSDEPVFDIDIYDEGRI
FT                   IASCSKDGTINIMEMNPKYFKPTEVHPETNSLPESPESS"
FT   gene            <418682..>419215
FT                   /locus_tag="DEHA2E05038g"
FT                   /old_locus_tag="DEHA0E05797g"
FT                   /old_locus_tag="DEHA-IPF5389"
FT                   /old_locus_tag="DEHA-CDS5640.1"
FT   CDS_pept        418682..419215
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05038g"
FT                   /old_locus_tag="DEHA0E05797g"
FT                   /old_locus_tag="DEHA-IPF5389"
FT                   /old_locus_tag="DEHA-CDS5640.1"
FT                   /product="DEHA2E05038p"
FT                   /note="similar to uniprot|Q12016 Saccharomyces cerevisiae
FT                   YOL129W VPS68"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87766"
FT                   /db_xref="GOA:Q6BQI1"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQI1"
FT                   /protein_id="CAG87766.2"
FT                   /translation="MEQQTNLFRFNAASLRLPKSAKLKSFGVYIAGALYAIGFWSMIDA
FT                   AIYSKTVNASIVHITFVDWIPFICSTLGMLIVNSIEKANLFNDSNNSFLSSNGNNTAWV
FT                   ARVILFCGFSLLAGGLAGSFMVFILKFLLKHYGFPTLGMGVSNIICNGCIMLSCISLWL
FT                   SQNIEDEYSYSLAL"
FT   gene            complement(<419486..>420619)
FT                   /locus_tag="DEHA2E05060g"
FT                   /old_locus_tag="DEHA0E05819g"
FT                   /old_locus_tag="DEHA-IPF5388"
FT                   /old_locus_tag="DEHA-CDS3382.1"
FT   CDS_pept        complement(419486..420619)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05060g"
FT                   /old_locus_tag="DEHA0E05819g"
FT                   /old_locus_tag="DEHA-IPF5388"
FT                   /old_locus_tag="DEHA-CDS3382.1"
FT                   /product="DEHA2E05060p"
FT                   /note="similar to uniprot|P21965 Saccharomyces cerevisiae
FT                   YNL307C MCK1 Protein serine/threonine/tyrosine
FT                   (dual-specificity) kinase involved in control of chromosome
FT                   segregation and in regulating entry into meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87767"
FT                   /db_xref="GOA:Q6BQI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQI0"
FT                   /protein_id="CAG87767.2"
FT                   /translation="MNQVGSTNNTFNEYVLDQVVENITLHSDRMVVREYKKIGEGAFGT
FT                   VVEAVLRKDYKTDSEQDREEPWLGPFAIKRVPAQTEYKSRELEILRVVNHPNIVSLRFF
FT                   FDKKSSSDGKIYQNLVMECLPSNLQSEIKYYRHSKYTIPYPHMKTYTFQLARAMLYLHG
FT                   FGISHRDIKPSNILVDPATVTLKICDFGSAKKLEPDQPSVSYICSRYYRAPELIIGCSI
FT                   YTTKIDIWGLGCVIAEMFLGKPIFQGESPQSQLKEISKLLGPPSKTFFFNNNPKYRGNM
FT                   YTNKLFSCTVEERFKQIFSNSPPDAIDLLMKILVYEPEKRASPRRVLCHPFFHELKKDD
FT                   FQVYPRGSSEPIRLNLFNFSNYELELLGPLKDELLSS"
FT   gene            <421589..>422245
FT                   /locus_tag="DEHA2E05082g"
FT                   /old_locus_tag="DEHA0E05841g"
FT                   /old_locus_tag="DEHA-IPF5386"
FT                   /old_locus_tag="DEHA-CDS5174.1"
FT   CDS_pept        421589..422245
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05082g"
FT                   /old_locus_tag="DEHA0E05841g"
FT                   /old_locus_tag="DEHA-IPF5386"
FT                   /old_locus_tag="DEHA-CDS5174.1"
FT                   /product="DEHA2E05082p"
FT                   /note="weakly similar to uniprot|P42847 Saccharomyces
FT                   cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein
FT                   of the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87768"
FT                   /db_xref="GOA:Q6BQH9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH9"
FT                   /protein_id="CAG87768.1"
FT                   /translation="MISRSTKLAGRIPAAKIFAPAATFRSLSTTNTLRSEPISMSSNKH
FT                   EEHQITNIIDPNMKQQLFKGRKNEKIVLWKLYGSFHRHNTLLSLVAVVEDQDFMEKNDH
FT                   LTYNDKVLYYLQLPHHTKVHVSAGQLGFRKAQRSEYEAGYQVSSRMFKLIEERNLLGPN
FT                   DKIELILKDFGKGREAFLAALQGKEGSKVKPNIIRISDNTKLQFGGSRPKKLRRL"
FT   gene            <422788..>423573
FT                   /locus_tag="DEHA2E05104g"
FT   CDS_pept        join(422788..422800,423152..423573)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05104g"
FT                   /product="DEHA2E05104p"
FT                   /note="highly similar to uniprot|P04456 Saccharomyces
FT                   cerevisiae YOL127W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87769"
FT                   /db_xref="GOA:Q6BQH8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH8"
FT                   /protein_id="CAG87769.1"
FT                   /translation="MSPISQSKPSAAKKAALKGTNAKKSLKVRTDTSFHRPKTLKLSRS
FT                   PKYSRKSVPHYNRLDAYKIIVSPIASETAMKKVEDGNILVFQVDLKSNKNQIKSAVKEL
FT                   YDVDVEYVNTLVRPNGTKKAYIRLTADHDALDIANRIGYI"
FT   gene            <424911..>426590
FT                   /locus_tag="DEHA2E05126g"
FT                   /old_locus_tag="DEHA0E05885g"
FT                   /old_locus_tag="DEHA-IPF5384"
FT                   /old_locus_tag="DEHA-CDS1888.1"
FT   CDS_pept        424911..426590
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05126g"
FT                   /old_locus_tag="DEHA0E05885g"
FT                   /old_locus_tag="DEHA-IPF5384"
FT                   /old_locus_tag="DEHA-CDS1888.1"
FT                   /product="DEHA2E05126p"
FT                   /note="weakly similar to uniprot|P22580 Saccharomyces
FT                   cerevisiae YDR242W AMD2 Putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87770"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH7"
FT                   /protein_id="CAG87770.2"
FT                   /translation="MLTTDWKTLALQAKSIFNDSQSRTLELFPFESDADLETFNELPCA
FT                   IGKSVTDFGNPAKFPVEKYYQALPKKDAQITEADPVVLIQDIKNGKYTCVEVLTSYLHA
FT                   ALIASKLTNCVYEFLPDEALKKARYLDENKGKLVNHSPMFGLPISLKEMIPLTGHSVTH
FT                   GSLCYLDRVVDYNADIVNILIKNGAVPFVRSTNPQSLMMLECESFTHGRTVNPFNSDLT
FT                   CGGSSGGEGAINGIHASPIGLGSDIGGSIRCPSAFNGIYGMKTTLGRIPSSDFFSCQMG
FT                   SESIISVTGPLTRSLDTLELLMKTVVQEKPWTIDPSLTSIEWKSDVRKKPYRIGILRTD
FT                   GVVTPHPPVTRALDMMCEKLKCMDNLEVFEFEPLNHSKAWEIISTLYFEDGGEDTRKTL
FT                   KNTGEPMCPQTEWILGKDSVKRLAAEDIWKWNLEKQKYRKDYLKHWLSFNNPDGNTPMD
FT                   ALIAPVFPGPAAKHRSTKYWGYTAQWNLLDYPVLVFPVTKVDLKKDIPVEDYKPKNQMD
FT                   EFVYKQYDSPESFENAPVNLGLVGLRYSEEQLIDIMKLINLQ"
FT   gene            <428214..>428975
FT                   /locus_tag="DEHA2E05148g"
FT                   /old_locus_tag="DEHA0E05907g"
FT                   /old_locus_tag="DEHA-IPF5382"
FT                   /old_locus_tag="DEHA-CDS4768.1"
FT   CDS_pept        428214..428975
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05148g"
FT                   /old_locus_tag="DEHA0E05907g"
FT                   /old_locus_tag="DEHA-IPF5382"
FT                   /old_locus_tag="DEHA-CDS4768.1"
FT                   /product="DEHA2E05148p"
FT                   /note="similar to uniprot|P41277 Saccharomyces cerevisiae
FT                   YIL053W RHR2 Constitutively expressed isoform of
FT                   DL-glycerol-3-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87771"
FT                   /db_xref="GOA:Q6BQH6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH6"
FT                   /protein_id="CAG87771.1"
FT                   /translation="MTIQKQPAVFYVNAALFDCDGTLVNSTGAISEFWRDFGKTRPHVN
FT                   PDEIISTSHGCRTFDVIAKWSPEDAIEEQVTEWEGSIPDSFGQFAKPIPGAVELVKSFD
FT                   KFSKSETENGKQRWAIVTSGTLPLATKWLKLLTIEKPDCFITAEKVTKGKPHPQGYQSA
FT                   RETLGYKGAHNKVVVFEDAPAGITAGKGAGAFIVGICSTYDPEKVRKAGADIVVDDLTS
FT                   FRIDSYNKETDEFKVIVDDYHYANDEFLQSV"
FT   gene            complement(<429276..>429842)
FT                   /locus_tag="DEHA2E05170g"
FT                   /old_locus_tag="IPF_5381"
FT   CDS_pept        complement(429276..429842)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05170g"
FT                   /old_locus_tag="IPF_5381"
FT                   /product="DEHA2E05170p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65770"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV8"
FT                   /protein_id="CAR65770.1"
FT                   /translation="MSYNYKNRHLRREIGRSEWHSKHCQGNFKVVLKYGEKAVSRPLIG
FT                   RAMGNGGNIISTFLTNILRNKGKIGEYIEETRNIPIGMSWQKNDATISIDTCAAKNEKC
FT                   NIEAASEQIKQAAAWMDRTIDKYPYGRFYEMNFSNNGMWTLCLKLVRNDMFDKGSETHT
FT                   PVQNLEANEAHYDGERPDISPYDKL"
FT   gene            <430332..>432449
FT                   /locus_tag="DEHA2E05192g"
FT                   /old_locus_tag="IPF_5379"
FT   CDS_pept        430332..432449
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05192g"
FT                   /old_locus_tag="IPF_5379"
FT                   /product="DEHA2E05192p"
FT                   /note="weakly similar to uniprot|P53276 Saccharomyces
FT                   cerevisiae YGR128C UTP8 Nucleolar protein required for
FT                   export of tRNAs from the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65771"
FT                   /db_xref="InterPro:IPR018843"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTV9"
FT                   /protein_id="CAR65771.1"
FT                   /translation="MAPSLSDSYSLVSLPRITDLDLSHQVVIPTISSTNTTHIDIGISK
FT                   SIISSYILKPTPKLVWSFPLSPSTIVECMDVQEVDGNGTDFIKNYVVGTTERKTNKVLL
FT                   IKRHNDSADHFEIKLDSKVKGVRFSQCGKFVYAILSNGGIKLLKINEDSFEDVSLDLKL
FT                   KSGNELVYHKFISSHEFKYNNDLLLTIESNERSLVYKLTSLNYEKSFEINQFSHFAECQ
FT                   CIFTYQSGVLYEFNIDKLEISSRSIIDFKVLKSITVNSIIDAPTKAINDYSIICPSVDR
FT                   LLLSWKSKLYLINFKFQSLLDTYTRPDKIYIKQVVDVKGSSANTSSTFAVYLHYNARKK
FT                   NTSLNIINVNTGINTLSECLGKSIVKRTNDDFKGLTNVINDSFDKESTKISKELKEIYD
FT                   ELVELKTKKNINKWESIVVPYLKNESWTSIKKALGKNTPAREFSVFEVEQDRIIDPAFI
FT                   SKVLSLIFDEQSDFIPEYTLIYLLTHPLFPYEHTKGLLTLFTQLDKPRLLRQAIITCPN
FT                   LSIEEISLQLNNDNLDIFQDVITRLISEFSVNQITHQLNDILQSKQNNLNLETILNNLI
FT                   KLNNNQSWYLIQSIIDVGGLFNWSMNTVNNLIEIIEDKLTSIMANNYNLTLTNQAILIN
FT                   EPIRKLNKNKKAGKKPTDKSNNIIESNNEIQQQQLNSILSIQNNAGRKLKDEGIEISKR
FT                   IPNYSIEKLIL"
FT   gene            <432639..>432998
FT                   /locus_tag="DEHA2E05214g"
FT                   /old_locus_tag="DEHA0E05951g"
FT                   /old_locus_tag="DEHA-IPF5378"
FT                   /old_locus_tag="DEHA-CDS6758.1"
FT   CDS_pept        432639..432998
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05214g"
FT                   /old_locus_tag="DEHA0E05951g"
FT                   /old_locus_tag="DEHA-IPF5378"
FT                   /old_locus_tag="DEHA-CDS6758.1"
FT                   /product="DEHA2E05214p"
FT                   /note="similar to uniprot|Q03429 Saccharomyces cerevisiae
FT                   YDR493W FMP36"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87773"
FT                   /db_xref="GOA:Q6BQH4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQH4"
FT                   /protein_id="CAG87773.1"
FT                   /translation="MSNIRALGAYRNALRATRVAFKTDLPVLMAARTQIKQGFVDNKDL
FT                   ADQEQQHEAIDKMNEVSQFLIKNIVQGEKQEGDKYFLNFHERTELGDNETIKQSKAEMG
FT                   SLAGARAKKYSNIKK"
FT   gene            <433475..>434116
FT                   /locus_tag="DEHA2E05236g"
FT                   /old_locus_tag="DEHA0E05973g"
FT                   /old_locus_tag="DEHA-IPF5377"
FT                   /old_locus_tag="DEHA-CDS5222.1"
FT   CDS_pept        433475..434116
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05236g"
FT                   /old_locus_tag="DEHA0E05973g"
FT                   /old_locus_tag="DEHA-IPF5377"
FT                   /old_locus_tag="DEHA-CDS5222.1"
FT                   /product="DEHA2E05236p"
FT                   /note="similar to uniprot|Q12272 Saccharomyces cerevisiae
FT                   YOL102C TPT1 tRNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87774"
FT                   /db_xref="GOA:Q6BQH3"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH3"
FT                   /protein_id="CAG87774.2"
FT                   /translation="MASLPPAKRDIAISKSLSYLLRHGAVKEKLNIDQTGYININELLN
FT                   HNRLKTNKVTLDDIRRIVGNNDKKRFSIVEKEGEIMICANQGHSIKTVNDSNLIQLSKD
FT                   TIPEEIYHGTYKNKLPAIFNSGGLSKMNRNHIHFASSISDVSGIRNSSNVLIYLNIEKC
FT                   LQSGIVFYRSSNNVILTSGDANGLIGSEFFGKVVDAKNGTPIDINQYANI"
FT   gene            <435592..>436185
FT                   /locus_tag="DEHA2E05258g"
FT                   /old_locus_tag="IPF_5375"
FT   CDS_pept        435592..436185
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05258g"
FT                   /old_locus_tag="IPF_5375"
FT                   /product="DEHA2E05258p"
FT                   /note="weakly similar to CA5784|IPF1129 Candida albicans
FT                   IPF1129"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65772"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW0"
FT                   /protein_id="CAR65772.1"
FT                   /translation="MQNCYPSNPVSSFNGNTNTGNKIDMGDSQNANKICQWYCCSCGQS
FT                   YGSIIYKDNMETEIAEEKEDDIFIKKLKYYSQILYSGGDPSYSKYEYLNGSKNLRTPEE
FT                   RVNVNYFEPVRRRSSSMTDLNENFKRLGDSEPVPHAISTIPSSCTSPSVSPVPGLFEYN
FT                   SKVAVCIPTRFNCHRCNHMMCPYCLKIRLRDLDN"
FT   gene            complement(<436395..>436468)
FT                   /locus_tag="DEHA2E05280r"
FT                   /old_locus_tag="Deha0E.41"
FT   tRNA            complement(436395..436468)
FT                   /locus_tag="DEHA2E05280r"
FT                   /old_locus_tag="Deha0E.41"
FT                   /note="tRNA Asn (GTT) cove score=74.40"
FT   gene            <436731..>436970
FT                   /locus_tag="DEHA2E05302g"
FT                   /old_locus_tag="DEHA0E06039g"
FT                   /old_locus_tag="DEHA-IPF5374"
FT                   /old_locus_tag="DEHA-CDS7830.1"
FT   CDS_pept        436731..436970
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05302g"
FT                   /old_locus_tag="DEHA0E06039g"
FT                   /old_locus_tag="DEHA-IPF5374"
FT                   /old_locus_tag="DEHA-CDS7830.1"
FT                   /product="DEHA2E05302p"
FT                   /note="similar to CA0242|IPF12047 Candida albicans
FT                   IPF12047"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87776"
FT                   /db_xref="GOA:Q6BQH1"
FT                   /db_xref="InterPro:IPR018860"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQH1"
FT                   /protein_id="CAG87776.2"
FT                   /translation="MLRRPATTIKLTPEDVLEYDDSLLDQQNSQHHFQQSHDQNHNDFI
FT                   LQEQMNTNIHNNSSNEIATKEQSKDDRIGATRNN"
FT   gene            complement(<437267..>437944)
FT                   /locus_tag="DEHA2E05324g"
FT                   /old_locus_tag="IPF_5373"
FT   CDS_pept        complement(437267..437944)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05324g"
FT                   /old_locus_tag="IPF_5373"
FT                   /product="DEHA2E05324p"
FT                   /note="weakly similar to uniprot|Q08492 Saccharomyces
FT                   cerevisiae YOR078W BUD21 Component of small ribosomal
FT                   subunit (SSU) processosome that contains U3 snoRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65773"
FT                   /db_xref="GOA:B5RTW1"
FT                   /db_xref="InterPro:IPR013268"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW1"
FT                   /protein_id="CAR65773.1"
FT                   /translation="MVVTRSRLNAKAGNGATPKKMKFSDNDADVNDIEYHTAEEDELNQ
FT                   SAGSQDSDSDSDSDSDEAPEEESTSGIRNEILAKQKEDLKSQQELKKLEKERRRQQNVY
FT                   NQQQQLLKKNKKQEDKLPEYLPEDIFESISDNETGESEPIIPSKHLKLQDFEKLDEMEI
FT                   RKKIKESKLKELKKSKKLSIKKGPVHVKVQSFNLDKKVVPKFENKVVNTRNKWLKRKSL
FT                   GKK"
FT   gene            complement(<438063..>440225)
FT                   /locus_tag="DEHA2E05346g"
FT                   /old_locus_tag="DEHA0E06083g"
FT                   /old_locus_tag="DEHA-IPF5372"
FT                   /old_locus_tag="DEHA-CDS1072.1"
FT   CDS_pept        complement(438063..440225)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05346g"
FT                   /old_locus_tag="DEHA0E06083g"
FT                   /old_locus_tag="DEHA-IPF5372"
FT                   /old_locus_tag="DEHA-CDS1072.1"
FT                   /product="DEHA2E05346p"
FT                   /note="weakly similar to uniprot|Q7LGN4 Saccharomyces
FT                   cerevisiae YOR080W DIA2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87778"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG9"
FT                   /protein_id="CAG87778.1"
FT                   /translation="MPLDQETINDKLNLAILYFKSSDYEKALNLYNQLILQCQSYTIDE
FT                   LKLIRVNIYNLNETPLVGPIVHPKLGSLLDQRAATYEKLDQLDKSLKDGEKLIRHEPIS
FT                   CKGYLRVAKVLLIIKKEVDAYKTLQRGNYIICNAIEKYNIAVPEKLFNSLKSQYKTLNR
FT                   RLKQQKEQYSNNNVINKSLDKSLEKMLALKRTKSVSSTSSKKSKKTLDPFNYLPLEIIE
FT                   LIFQAFNLKDVLRCHLVSSKWYNLLVNIPSLYTSKISFKPRITTNEFINGVKLIKKVID
FT                   KSYSKQIKMLKLRSTANNVQLFKMIELLISEKQLKLQGLDVINKYLSFEFFINKLYKTN
FT                   WNVSNLNSLQFLRLGIRSSLKCENLIFKMMTQLKSLEIIIIDNESSGASMSLIPNNSKF
FT                   HDLIRIDDKPYDTLECLSIVNHPKLMRDNNQSRVGNDTYNPYPPFILKNFPNLTSLCIV
FT                   SYDFTNRQTQFQDFLSRSTNLTSLYLENNEKISIKNFLQDLIVCDATFRLRKLTIREKS
FT                   VSGAVHLNEMNDLYIPSLHYLTYLDVYASSLSIKGLFKLLKIANFNNELHTLFIGNSNY
FT                   LYFKNDKISIHHNLKISLYDILGVVPNLRKLYLNEIELDNSSMRFFRNDLVDNIGLKNI
FT                   KLQVLDISFCKQVDGIGLMNLFSFNLKSSDDNKLFKLQELIIDGMEFNQDTLKILIKRG
FT                   YVERIRNDPLKSKWKQYGLTTLVPDL"
FT   gene            <440367..>441266
FT                   /locus_tag="DEHA2E05368g"
FT                   /old_locus_tag="DEHA0E06105g"
FT                   /old_locus_tag="DEHA-IPF5370"
FT                   /old_locus_tag="DEHA-CDS4249.1"
FT   CDS_pept        440367..441266
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05368g"
FT                   /old_locus_tag="DEHA0E06105g"
FT                   /old_locus_tag="DEHA-IPF5370"
FT                   /old_locus_tag="DEHA-CDS4249.1"
FT                   /product="DEHA2E05368p"
FT                   /note="weakly similar to uniprot|Q12067 Saccharomyces
FT                   cerevisiae YOR079C ATX2 Golgi membrane protein involved in
FT                   manganese homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87779"
FT                   /db_xref="GOA:Q6BQG8"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG8"
FT                   /protein_id="CAG87779.1"
FT                   /translation="MNDGLKRAVESVVLALIMGLTSYSVGLIPLRLPLSQKQINLTSFF
FT                   SMGIILGTALVIAIPEGIETLYQSVGDNNNELIPRYIGLGLVAGFIIMYIIDHLYVILH
FT                   SFNIELKSINEIHYSGSYRELFTSIFTSSLTLGLIFHAMIDGISLGSSFSKSHEESSIG
FT                   LILFTMIIIHKLPTCFSLSSLLMKEKMNTSVLKFHILIFASITPLSSILTFIFMSLFQL
FT                   QNDFIVGNLLVFSGGTFLYVVTHVMLEVSSTDNTIPQSSGSEDTLYYSHQSPIEGIDLL
FT                   ASLIGTGVPILISFFGEH"
FT   gene            complement(<441291..>444368)
FT                   /locus_tag="DEHA2E05390g"
FT                   /old_locus_tag="DEHA0E06127g"
FT                   /old_locus_tag="DEHA-IPF5369"
FT                   /old_locus_tag="DEHA-CDS0413.1"
FT   CDS_pept        complement(441291..444368)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05390g"
FT                   /old_locus_tag="DEHA0E06127g"
FT                   /old_locus_tag="DEHA-IPF5369"
FT                   /old_locus_tag="DEHA-CDS0413.1"
FT                   /product="DEHA2E05390p"
FT                   /note="weakly similar to uniprot|P36165 Saccharomyces
FT                   cerevisiae YKR089C STC1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87780"
FT                   /db_xref="GOA:Q6BQG7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG7"
FT                   /protein_id="CAG87780.2"
FT                   /translation="MSELMLTVAGMEVNTNVGPFDFDIIESLYNQYSHLLEDEPSSPTY
FT                   SFIPSIRSIPIINRIIPALDEKQILIKKLLSDQKSAISYKEWFEISLKLDELLNNDQWK
FT                   VNPESNLYDYELVHNNLMEMRNARISKDYKLLLYLIRTKWTRNLGNMGDINLYRHSHVG
FT                   TKTLIEDYIKECEMSLDYLINNKEVSLDDRYLLGMLIQTRKNIGRTALVLSGGSTFGIF
FT                   HIGVVITLLESSLLPRIISGSSAGSIIASIICSHSNEETVSILNDIMVRRFDIFESGDI
FT                   EKEKDGESYKKVLKNLSHLLKYGTLFDIDSLQNTMIGLVGDLTFREAYNRTGRILNITV
FT                   SPTSIHEQTRLLNYLTAPNCLIWSAVCASCSLPGVFPSTLIYEKVPNTNGVQEWNNDAS
FT                   MKFVDGSVDNDLPITRLSEMFNADHIIACQVNPHVVPILKVSISSIGGEVENEINYKFK
FT                   NFLNNCYDFMTSEIIHYLQILNEMDVYKTLSNKLITLISQHYSGDITILPDFKSKDFFK
FT                   VFKNPTPAFLLDFIIRGARASWPKVTVIYNHCGVEFALDKAISLLRGRLITTNNKLTYR
FT                   TSNSTNNNVNQNITLVNLPVMNYDDSISSPVTPEKSRINSFSHVPPNIKRHNSASSSIG
FT                   LPTNTNRTPAFKRNSISVAVPSTHKATDKLLKGRSTTSLASLSSQYSHQNSSISAETTL
FT                   INDDDRYGRFAPSNKRLEKHHSFPDNIKNPSGYSEDNESNGWKQEKDRHERQKVRKAKS
FT                   SGNFHIAGRKPDPNSQKLKYQTERIPFYKGNPYLDASSKHAHFDFVGPKECAENVLISE
FT                   TDNNMEKEKPNLPKLSNNNSLKNSYIGLNRLKDNYLSRSNNNSNYNLKDAYNSDLIKTR
FT                   LMNLHSPDLRRSFSKSYLNDNKYSQVFNTTDNEEESEELRNNELIPVKGDVKASKFKAK
FT                   DNDKDAKNKINENKAIDDRAENKEENDLECDEDNEQDNDTDSNSGNDEGNTGNSEEEGK
FT                   DEKGAKIIELLEDNCIGDKQSEGTENDENDDFYECN"
FT   gene            <444899..>447526
FT                   /locus_tag="DEHA2E05412g"
FT                   /old_locus_tag="DEHA0E06149g"
FT                   /old_locus_tag="DEHA-IPF5367"
FT                   /old_locus_tag="DEHA-CDS0649.1"
FT   CDS_pept        444899..447526
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05412g"
FT                   /old_locus_tag="DEHA0E06149g"
FT                   /old_locus_tag="DEHA-IPF5367"
FT                   /old_locus_tag="DEHA-CDS0649.1"
FT                   /product="DEHA2E05412p"
FT                   /note="similar to uniprot|P36159 Saccharomyces cerevisiae
FT                   YKR079C TRZ1 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87781"
FT                   /db_xref="GOA:Q6BQG6"
FT                   /db_xref="InterPro:IPR027794"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG6"
FT                   /protein_id="CAG87781.2"
FT                   /translation="MFTVTTISHKTSDSRHPLVMLTNREGYRYLFGKIPEGSQRILNEN
FT                   RFRLGKLKSIFLSGTISSWSEIGGLPGLFLTISDSTKKSIDIFTNSGKITSFIVATWRY
FT                   FVFRKGVELKINDSNEHDIIADSNLIVKPIKIESNKTTSINEDVSNRLHQQLKKLISLM
FT                   FPMDTTKVNDPDPTSYKSDPSETEIQTHVKLPNPFNLLPTYQQPSLNYLVRFLPIRGKF
FT                   DPIKAKSLGIKPGIDFRKLTQGHSIVNEQGETVHPHQVIEESKSFSKLLIVDIPNASYL
FT                   SNTLNCEEWFRSNENIGEEDIGIVYHFLGDDIDFNQPEYLDFIKKFPDNCKHVISHSKL
FT                   SDDTLIFKTSAINVLKLKCLQKDHFNLPYIESYNPLQSDSADSIHKLQQLQQFHIETSS
FT                   IKSDDSLISEDTWSSLYDSNILPLDIKNINKTDILESEPISLAQIPGSMKDQVQVVTLG
FT                   TGSALPSIHRNVISTLVRIPYIDNNTVKFRTIMLDGGENTLGTMMRNFGHNNKEQLIKI
FT                   FEELSLIHLSHLHADHHLGIISIINKWFEINIDSEKKLYLVIPWQYNNFMKEWYSLEEQ
FT                   IYDKIDLNRIVYLSCEDFIKDRQPQFQQVDIDEFERKYDNDEFNQVIPREKLAPKNHVL
FT                   INDLYKNLGINSIQTVRAIHCYWSYSISIDFALPSEESFKVSYSGDTRPNPKFVDIGYG
FT                   SDLLIHESSLDHELIEEAISKKHSTMIEAITVSKLMNCAKVILTHFSTRYSNKANMLIE
FT                   NNELIKLSTNLRDYLVRYGSTSNIFVPERSNKRPIKEFEDLQICFAFDMMNVRFNNLHL
FT                   QKDKYKEILEIFQTDDDLNEDLNDKREKEMKKQREKREAKRIQRLSIKNGKKKRRVSSD
FT                   EEID"
FT   gene            <447625..>448233
FT                   /locus_tag="DEHA2E05434g"
FT                   /old_locus_tag="DEHA0E06171g"
FT                   /old_locus_tag="DEHA-IPF5365"
FT                   /old_locus_tag="DEHA-CDS5331.1"
FT   CDS_pept        447625..448233
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05434g"
FT                   /old_locus_tag="DEHA0E06171g"
FT                   /old_locus_tag="DEHA-IPF5365"
FT                   /old_locus_tag="DEHA-CDS5331.1"
FT                   /product="DEHA2E05434p"
FT                   /note="similar to CA5778|IPF1119 Candida albicans IPF1119"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87782"
FT                   /db_xref="GOA:Q6BQG5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQG5"
FT                   /protein_id="CAG87782.2"
FT                   /translation="MNVNIKYPLVLHDNWLLESITGQINKNVKYTNSLIKKDFISPSSI
FT                   SKTPILRILRFLKTTKSSDLTAILSDSTHTVIAIFPFDPAIINFEIRYKHRITYHTPNS
FT                   LILIKQANLRFVNNVELTTEWGITIEDEIDVAVLEVLDLEIFQRDQIMLGVNIENNLQL
FT                   IYYDKSYLNLCGKSRQRDSLGEKEIKEVISQSYDDVVSI"
FT   gene            <448593..>449165
FT                   /locus_tag="DEHA2E05456g"
FT                   /old_locus_tag="DEHA0E06193g"
FT                   /old_locus_tag="DEHA-IPF5364"
FT                   /old_locus_tag="DEHA-CDS5783.1"
FT   CDS_pept        448593..449165
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05456g"
FT                   /old_locus_tag="DEHA0E06193g"
FT                   /old_locus_tag="DEHA-IPF5364"
FT                   /old_locus_tag="DEHA-CDS5783.1"
FT                   /product="DEHA2E05456p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87783"
FT                   /db_xref="GOA:Q6BQG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG4"
FT                   /protein_id="CAG87783.1"
FT                   /translation="MSICGCNISIYIPCLQLTTIYATMNEPTHEPNYGASQETNWNASN
FT                   DSIESDNSNESIGENDDHRSEEHFATTGYEVSSFRRVKRYAKYLLGLRKSQRQPLLPHH
FT                   SPPSSPLPPRRPINYIIFDIIWNRILSEANRELLISYKWVFFLLSILIVVAVLVITNNF
FT                   EYLKVFLKSLFCYILNCLRKGTKDCYE"
FT   gene            complement(<449216..>450301)
FT                   /locus_tag="DEHA2E05478g"
FT                   /old_locus_tag="DEHA0E06215g"
FT                   /old_locus_tag="DEHA-IPF5363"
FT                   /old_locus_tag="DEHA-CDS3556.1"
FT   CDS_pept        complement(449216..450301)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05478g"
FT                   /old_locus_tag="DEHA0E06215g"
FT                   /old_locus_tag="DEHA-IPF5363"
FT                   /old_locus_tag="DEHA-CDS3556.1"
FT                   /product="DEHA2E05478p"
FT                   /note="similar to uniprot|P32611 Saccharomyces cerevisiae
FT                   YEL050C RML2 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87784"
FT                   /db_xref="GOA:Q6BQG3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG3"
FT                   /protein_id="CAG87784.1"
FT                   /translation="MLPWTRRCLANPIRGVKTSILILSRFQSTIAEAGEANLTDLEKRD
FT                   EIYKRQRKLASAHVKLKSYANGHLQPGSTNFKKPVHDHLYKGGPVRELTVSKRKTAGRN
FT                   NTGHITIRGRGGGHKQRYRFVDSHRLDSGKQTVLRIEYDPNRSGHIALVKHDETGDLSY
FT                   ILAASGLREGDVVESFRKGLPKDFLEEMNETNNGEIDEALLNSRIMQRGNCLPLNMLPV
FT                   GSIIHNIGLHPNGRGQLVRSAGTFGRILSKHPEMNKAIVRLSSGEHRYININCHATLGT
FT                   VSNKEHQAISWGKAGRSRHRGRRPMVRGVAMNAFDHPHGGGRGKSKSNKVSQSMWGLKK
FT                   FAKTRKFKNVNKMKVKDRPRR"
FT   gene            <450553..>451170
FT                   /locus_tag="DEHA2E05500g"
FT                   /old_locus_tag="DEHA0E06237g"
FT                   /old_locus_tag="DEHA-IPF5361"
FT                   /old_locus_tag="DEHA-CDS5301.1"
FT   CDS_pept        450553..451170
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05500g"
FT                   /old_locus_tag="DEHA0E06237g"
FT                   /old_locus_tag="DEHA-IPF5361"
FT                   /old_locus_tag="DEHA-CDS5301.1"
FT                   /product="DEHA2E05500p"
FT                   /note="similar to uniprot|P09457 Saccharomyces cerevisiae
FT                   YDR298C ATP5 Subunit 5 of the stator stalk of mitochondrial
FT                   F1F0 ATP synthase which is a large evolutionarily conserved
FT                   enzyme complex required for ATP synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87785"
FT                   /db_xref="GOA:Q6BQG2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG2"
FT                   /protein_id="CAG87785.1"
FT                   /translation="MASRFFVRSMASAAKSVKPPVQLFGVDGTYANALYSASVQDSSVE
FT                   KTFQFLGTINELVENDSQVRDFLHNPALTKDDRSAVIKALSSGLKLDKTTTNFLNVLAE
FT                   YNRLSHFQNVYKEFATLNDAHQGLVEAKVTSVKPLDSKILKRLQASIGKSSFVGEGKTL
FT                   KLTNDVNPDIVGGLIVEVGDRTVDLSVSAKIAKLNNTLGEAL"
FT   gene            <451679..>453145
FT                   /locus_tag="DEHA2E05522g"
FT                   /old_locus_tag="DEHA0E06259g"
FT                   /old_locus_tag="DEHA-IPF5360"
FT                   /old_locus_tag="DEHA-CDS2426.1"
FT   CDS_pept        451679..453145
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05522g"
FT                   /old_locus_tag="DEHA0E06259g"
FT                   /old_locus_tag="DEHA-IPF5360"
FT                   /old_locus_tag="DEHA-CDS2426.1"
FT                   /product="DEHA2E05522p"
FT                   /note="similar to uniprot|P40533 Saccharomyces cerevisiae
FT                   YIL039W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87786"
FT                   /db_xref="GOA:Q6BQG1"
FT                   /db_xref="InterPro:IPR033307"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG1"
FT                   /protein_id="CAG87786.2"
FT                   /translation="MSGGGFKIFKWAVVTVAIAFNILVYFYPDILNDLQQCKWHEFSDS
FT                   GRLKSKLDFINGLDQSISDKILLNLPFLQDIKMSNTKSPYDLHNDVKDIHLLAFGDPQI
FT                   NGNWASTKYIKRLDNYGNDYYLGHIYTTMKERLSPSHVAVMGDHFSSQWIYDSEFYNRT
FT                   YRYVERIFTRPIEYKQNVLDVHERHEDYDWQKWLSEEVKLDPLVRFNSRVYNDVYDWYN
FT                   LDKKYPNFENPLFINLTGNHDIGYSGDATWQHLARFHLLFGQNNYVINYNKGTPEEWRI
FT                   IVLDSLTLEGPALQEEFLNYTWSFVNNIEKYENKDFKGSTILFTHIPFYKREGLCKDGP
FT                   EHKYYVNNTQEPYKNGKLRSQNHLSYDSTQKIMNIMFPKDSKNGIILTGHDHYGCNSWY
FT                   NLLSDTWEASESVKPTGERFAVREIVVESMMGDFDGQTGILTGHFDKFKQTWLFEFTYC
FT                   SFLVQHYWWSSKILTVVAVFLLSTGFLFKW"
FT   gene            complement(<453206..>453955)
FT                   /locus_tag="DEHA2E05544g"
FT                   /old_locus_tag="DEHA0E06281g"
FT                   /old_locus_tag="DEHA-IPF5359"
FT                   /old_locus_tag="DEHA-CDS4811.1"
FT   CDS_pept        complement(453206..453955)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05544g"
FT                   /old_locus_tag="DEHA0E06281g"
FT                   /old_locus_tag="DEHA-IPF5359"
FT                   /old_locus_tag="DEHA-CDS4811.1"
FT                   /product="DEHA2E05544p"
FT                   /note="weakly similar to uniprot|P40553 Saccharomyces
FT                   cerevisiae YIL010W DOT5 Nuclear thiol peroxidase which
FT                   functions as an alkyl-hydroperoxide reductase during
FT                   post-diauxic growth"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87787"
FT                   /db_xref="GOA:Q6BQG0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQG0"
FT                   /protein_id="CAG87787.1"
FT                   /translation="MPELRRSARVASKPTSSPTKETQIETQIEPPAKKAQTSSVKELQV
FT                   GDKIPDMKLLDEEENEIDLLKEAEANKYVIIFAYPKASTPGCTRQVCGFQKNFGFLQKS
FT                   NAKVYGLSADQPSAQKNFVTKQGLQYPLLSDPSRELIEILGAKKEPTGVKRSHWIFVDG
FT                   LLKVKKIAISPEESFDSAKTDIESFIGTSSEDQQESSDPKPEDSESKGAEPNGLESKDS
FT                   ESKDALTSNEEAQPATSKGLEDELKAD"
FT   gene            <454927..>455847
FT                   /locus_tag="DEHA2E05566g"
FT                   /old_locus_tag="DEHA0E06303g"
FT                   /old_locus_tag="DEHA-IPF5358"
FT                   /old_locus_tag="DEHA-CDS4165.1"
FT   CDS_pept        454927..455847
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05566g"
FT                   /old_locus_tag="DEHA0E06303g"
FT                   /old_locus_tag="DEHA-IPF5358"
FT                   /old_locus_tag="DEHA-CDS4165.1"
FT                   /product="DEHA2E05566p"
FT                   /note="some similarities with gnl|GLV|KLLA0B10076g
FT                   Kluyveromyces lactis KLLA0B10076g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87788"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQF9"
FT                   /protein_id="CAG87788.2"
FT                   /translation="MSCNSYLSNLNTLSQVAATIQTDMGSDNDHFEDIFAATSQDIKNP
FT                   SLLSSPISSPLEDEECFTEKNTRLINSDESLDLVNSLLCLKHRSYSYGPGLDCKNVSVP
FT                   RSLNGDKCLVKAAKLLSKTRSSKKSNPRFQIKRRQGQGRPYTNSLKARFYMHDSIEELY
FT                   CYLNNISAFTFHEPSSFKSKDYLCTRISPRSPHFKMIFFNNLPPTTNLYEKLCEAFKIA
FT                   NFKFVKINRNIEGKVVNIESVCNTDSIITAEWIKQNVCRPRYKSNMKIYLIRSNQPMKE
FT                   CIYKDKKVFELDIENVYNSVVKIIE"
FT   gene            <456056..>457648
FT                   /locus_tag="DEHA2E05588g"
FT                   /old_locus_tag="DEHA0E06325g"
FT                   /old_locus_tag="DEHA-IPF5357"
FT                   /old_locus_tag="DEHA-CDS2110.1"
FT   CDS_pept        456056..457648
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05588g"
FT                   /old_locus_tag="DEHA0E06325g"
FT                   /old_locus_tag="DEHA-IPF5357"
FT                   /old_locus_tag="DEHA-CDS2110.1"
FT                   /product="DEHA2E05588p"
FT                   /note="similar to CA0853|IPF19640 Candida albicans
FT                   IPF19640"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQF8"
FT                   /protein_id="CAG87789.2"
FT                   /translation="MKIFKRRRFTISAPDSASSLDSRGEERRFSLPYTNNEILYFPDHN
FT                   PNSITNELANQEISTQTSISESIALSESDTLLYDKKQQLELQETYNDNFTLYLPFLLRQ
FT                   LRNARDEFVDAADHDIDSDDQKTMIDENNISPCLILNKEACNFNLKRRFIIVQELLKHN
FT                   TYLFASEESFQLFKHLRSNKKKESKNSRIVYDANGSIRRLSASKGSKRGNDIHNDELVD
FT                   NRTHIIPLEYKVKGLGLPIFKINTPYLSSFRKNSPFLVFKKYREIPLKPSLQDCPSNEN
FT                   SDSSTNYEAYVFCSVYVKHFYDVRRYILNFSPVGKKPFRIIMFQHNFKPFADFNYQNTR
FT                   FRVVGTSLSCVYVTNYSPIMKLMIIDNDKPSLCDDIINKKTGFEIPSIIKHKKKHPNNN
FT                   SSDNTGNDLNDDMIFSNPYPDPTGPLLADSASFKRLTSKRAFMSRSMPPFGLFKDSMLY
FT                   GNDSINFIPKKFSDTGKIEIYQDNSNCTEDANSTLSIDLDSLVINCILLTLRESNIRNS
FT                   VKTTLPQAITFQD"
FT   gene            complement(<458027..>459404)
FT                   /locus_tag="DEHA2E05610g"
FT                   /old_locus_tag="DEHA0E06347g"
FT                   /old_locus_tag="DEHA-IPF5355"
FT                   /old_locus_tag="DEHA-CDS3755.1"
FT   CDS_pept        complement(join(458027..458921,459328..459404))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05610g"
FT                   /old_locus_tag="DEHA0E06347g"
FT                   /old_locus_tag="DEHA-IPF5355"
FT                   /old_locus_tag="DEHA-CDS3755.1"
FT                   /product="DEHA2E05610p"
FT                   /note="weakly similar to uniprot|Q01560 Saccharomyces
FT                   cerevisiae YDR432W NPL3 RNA-binding protein that carries
FT                   poly(A) mRNA from the nucleus into the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87790"
FT                   /db_xref="GOA:Q6BQF7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQF7"
FT                   /protein_id="CAG87790.2"
FT                   /translation="MPSDTLYVTGFSKESKAADLAPDFEKYGDLVRLDIPPPRTDDGEK
FT                   YAFVEYKNAEDCEKALELNGKQLPYSSKDGLVVQLARSDPYSARRGGFRGRGGYGYAPR
FT                   GGYGYAPRGGYSYAPRGGYGYTASGGYGYAPRGGYGYAPSGGYGYAPSGGYRGGRGGYN
FT                   DYGGYSSDYGYGGSYGGSYRGGYYSGSRGSYRGGRGGYYDRDNGYRNYSDSDYQNHEYS
FT                   DRDYRYSRDGQLRESTYDNRLADTDDNHAERSNDTPYEENSHPRPSSRSPVRKERSRSP
FT                   VRKERSRSPVRKERSRSPVRQEKPRSPTRQETDTQETSKSPQ"
FT   gene            <460027..>463581
FT                   /locus_tag="DEHA2E05632g"
FT                   /old_locus_tag="IPF_5349"
FT   CDS_pept        460027..463581
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05632g"
FT                   /old_locus_tag="IPF_5349"
FT                   /product="DEHA2E05632p"
FT                   /note="weakly similar to uniprot|P40578 Saccharomyces
FT                   cerevisiae YIR033W MGA2 ER membrane protein involved with
FT                   its homolog Spt23p in regulation of OLE1 transcription"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65774"
FT                   /db_xref="GOA:B5RTW2"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW2"
FT                   /protein_id="CAR65774.1"
FT                   /translation="MSSITDDQLLEHNFVNDMSNENEQDILDEFLDQRVYESINLPDSN
FT                   SIKVETDDLLNDFYNNNDSNDSNNDGSNYGGGSGNANYLLNQSQMTTPNNNDYMYLDNI
FT                   GYNATNSVYTSPPDASQMNITNKLQLSDYDIVRDELSKLKFGTANMKSCPPSVDVPDQS
FT                   YLDFSQQAMDSLPYKLTLTNLPSYSRVETQIKFKFGLSPPPPHVLLHIPQDLISKNKFC
FT                   LSNGVDTLAPTLKESLLYLDTYVLTSDYKKSCNICSRCIKREQKRASRRKSGVNGNESD
FT                   TNNDATNDNNNTRENGKSSSSSWADDKMMKKAIIFNCKEIVSFPPPNGLNNDLSKSLDL
FT                   SARIICYCRHHKESQGFKLLFVVKNHEGKVVAKQISSTIMIMDRKKTTAASKNKVNEDS
FT                   LPNSICGSSTNLQQMSGDQQQQRSPKESDNDILSNSFRQLSSNSIDESNSEAQTNTDTN
FT                   TFTEGRNLKRKKLSVDDSFNTQTNPMFNGSVNALSPLSNSDTNTSTSNMLTKPLNTQLP
FT                   SNGQPSFGLSPLSHPQLNTQQPRLPSIQRIIPAQGPIRGGIEITLLGFNFRQGLAVKFG
FT                   ANQALATHCWSETTLVTYLPPASQPGQVLVSFEDHENMMIGGPPQQQIFTYTDDTDKQL
FT                   IELALQIVGLKMNGKLEDAKNIAKRIVGTDNSSISGTNTNVTSPANQQNMNQANIEWFD
FT                   SAHKAVLQLTKSDLSTEEILINFLSLVDLPNCPIIIPNWQLCNGQGQTLLHLASLKRYS
FT                   QLIKFLITHGCKIDVKDNQGLTPLFLASMCGYRDMIQIFVACKSNWNLKLSNDKLLKDY
FT                   CDPNVLDVFNSLENQDNENDADDFSRFLSKDNKLAKSMSLDSLNSMFAMNFGCHVSKMV
FT                   MEDSVNHSSGSKFESGDRHLMREELNSRSNENENDSSEFSHEDSDLGNSELADSEFESN
FT                   DDDRFYNDDYYESESDDDFDDEDEHGDSSDHRELNIAKVGGILDDNQSLCSNSTILPPL
FT                   SNNNDDEDEDEDEDVFSSNSAGLWQKVKNVFSNDESDSQLPSYDDLFPFGPSSFHSKPK
FT                   SSVERSLNSVDDDSNGDSSKVITGTSRDDNQEDAGVSSDSSEDMVISYINHPRKNVEND
FT                   KMLLFFWFPALVCIMALFIFVYIMGYKFVFIENFKHYIRTTIGNLMVGNERIGKLFHSS
FT                   NAAGVERVLSATRKIINE"
FT   gene            <463789..>464583
FT                   /locus_tag="DEHA2E05654g"
FT                   /old_locus_tag="DEHA0E06424g"
FT                   /old_locus_tag="DEHA-IPF5348"
FT                   /old_locus_tag="DEHA-CDS4651.1"
FT   CDS_pept        463789..464583
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05654g"
FT                   /old_locus_tag="DEHA0E06424g"
FT                   /old_locus_tag="DEHA-IPF5348"
FT                   /old_locus_tag="DEHA-CDS4651.1"
FT                   /product="DEHA2E05654p"
FT                   /note="similar to uniprot|P06174 Saccharomyces cerevisiae
FT                   YOR278W HEM4 Uroporphyrinogen III synthase catalyzes the
FT                   conversion of hydroxymethylbilane to uroporphyrinogen III
FT                   the fourth step in the heme biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87794"
FT                   /db_xref="GOA:Q6BQF3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQF3"
FT                   /protein_id="CAG87794.2"
FT                   /translation="MVHVLLLKNQTIPKDPYNDKLKASGYNPVFIPLLEHNHYDRHSTV
FT                   EYLKSKEFSNIRNFIITSQRAVECFNECIQEINDENIKQSIFQKIGYTVGPATAKILSE
FT                   AGFKTVKGGNDAGNGSILSKIIIDEIAPEEEIVFFTGKIRKDIIPKNLKLANINIMERV
FT                   IYRTDLREDIGETFNKQLSLLDQTNNIEKKWIIFFSPQGTELIIEKLKQLDNLTSQFYI
FT                   GSIGPTTEDYLVSRGITPNIVSKKPEAASLFESMQNHEATYK"
FT   gene            complement(<464866..>466881)
FT                   /locus_tag="DEHA2E05676g"
FT                   /old_locus_tag="DEHA0E06446g"
FT                   /old_locus_tag="DEHA-IPF5347"
FT                   /old_locus_tag="DEHA-CDS1254.1"
FT   CDS_pept        complement(464866..466881)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05676g"
FT                   /old_locus_tag="DEHA0E06446g"
FT                   /old_locus_tag="DEHA-IPF5347"
FT                   /old_locus_tag="DEHA-CDS1254.1"
FT                   /product="DEHA2E05676p"
FT                   /note="similar to uniprot|Q01574 Saccharomyces cerevisiae
FT                   YAL054C ACS1 Acetyl-coA synthetase isoform expressed during
FT                   growth on nonfermentable carbon sources and under aerobic
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87795"
FT                   /db_xref="GOA:Q6BQF2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQF2"
FT                   /protein_id="CAG87795.1"
FT                   /translation="MTPHSTHVTLDHEGIIQPPAEFKERSKSKPNLADFETYSKMYKES
FT                   IENPSKFFGEQALEHLSWDRPFDEARYPVSSEQDFADGDIASWFVNGQLNASYNAVDRW
FT                   AIKNPNKPAIIYEADEENEGRIITYGQLLKDVCKLAQCLTKLGIRKGDSVAVYLPMIPE
FT                   ALVTLLAIVRIGAVHSVVFAGFSSSSLKDRILDASSKIVITTDESKRGGKTIETKKIVD
FT                   DALKNCPDVTNVLLFKRTGNAHIPFTEGRDLWWHEEMAKYGPYFPPVPVNSEDPLFLLY
FT                   TSGSTGKPKGIQHSTAGYLLGAAMTSKYTFDVHEDDVLFTAGDVGWITGHTYVVYGPLL
FT                   CGATTVVFEGTPAHPNYSRYWEIVDKYQVTQFYVAPTALRLLKRAGTKYIENYKLDSLR
FT                   VLGSVGEPIAAEIWHWYNDNIGRRKCHIVDTYWQTESGSHMLAPLAGITPTKPGSASLP
FT                   CFGIDAKILDPVSGKELKENDVEGVLCVKSCWPSISRGIYNDYARFIETYLKPYPNHYF
FT                   SGDGAARDVDGFYWILGRVDDVVNVSGHRLSTAEIEAALILHESVAECAVVGYADELTG
FT                   QAVAAYVSLKSNVSEDLEVIKKELILTVRKEIGPFATPKTILLVDDLPKTRSGKIMRRI
FT                   LRKVLAGEEDQLGDISTLSNPGVVAQIIDVVKATRK"
FT   gene            <467432..>467896
FT                   /locus_tag="DEHA2E05698g"
FT                   /old_locus_tag="DEHA0E06479g"
FT                   /old_locus_tag="DEHA-IPF5342"
FT                   /old_locus_tag="DEHA-CDS5997.1"
FT   CDS_pept        467432..467896
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05698g"
FT                   /old_locus_tag="DEHA0E06479g"
FT                   /old_locus_tag="DEHA-IPF5342"
FT                   /old_locus_tag="DEHA-CDS5997.1"
FT                   /product="DEHA2E05698p"
FT                   /note="similar to uniprot|Q9P7W0 Schizosaccharomyces pombe
FT                   SPBC1703 Putative OPA3-like protein C1703.11"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87797"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQF0"
FT                   /protein_id="CAG87797.1"
FT                   /translation="MSGLALKFTSLLIRTVAKPISNSIKAQAKEHENFRRKCIWFAQMM
FT                   HHTDLKMRMNLVGEKKIKIRPLNDNKAIEKGANFLSEMFVFSVAGSLILFESFRSRKKT
FT                   NLEKSNVQDDITFLQDEIVALQHELEEMKTKLVERPTNGPANKAADASAK"
FT   gene            complement(<468228..>468626)
FT                   /locus_tag="DEHA2E05720g"
FT                   /old_locus_tag="DEHA0E06501g"
FT                   /old_locus_tag="DEHA-IPF5339"
FT                   /old_locus_tag="DEHA-CDS6444.1"
FT   CDS_pept        complement(468228..468626)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05720g"
FT                   /old_locus_tag="DEHA0E06501g"
FT                   /old_locus_tag="DEHA-IPF5339"
FT                   /old_locus_tag="DEHA-CDS6444.1"
FT                   /product="DEHA2E05720p"
FT                   /note="highly similar to uniprot|Q12692 Saccharomyces
FT                   cerevisiae YOL012C HTZ1 Histone variant H2AZ exchanged for
FT                   histone H2A in nucleosomes by the SWR1 complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87798"
FT                   /db_xref="GOA:Q6BQE9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQE9"
FT                   /protein_id="CAG87798.1"
FT                   /translation="MSGKGKVHGGKGKSSETAKSTTSHSARAGLQFPVGRIKRYLKRTA
FT                   QNKIRVGSKSAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDEELDNL
FT                   IKATIAFGGVLPHINKALLLKVEKKKQK"
FT   gene            complement(<468791..>470545)
FT                   /locus_tag="DEHA2E05742g"
FT                   /old_locus_tag="DEHA0E06523g"
FT                   /old_locus_tag="DEHA-IPF5338"
FT                   /old_locus_tag="DEHA-CDS1721.1"
FT   CDS_pept        complement(468791..470545)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05742g"
FT                   /old_locus_tag="DEHA0E06523g"
FT                   /old_locus_tag="DEHA-IPF5338"
FT                   /old_locus_tag="DEHA-CDS1721.1"
FT                   /product="DEHA2E05742p"
FT                   /note="weakly similar to uniprot|P39923 Saccharomyces
FT                   cerevisiae YEL062W NPR2 Regulator of nitrogen permeases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87799"
FT                   /db_xref="GOA:Q6BQE8"
FT                   /db_xref="InterPro:IPR009348"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE8"
FT                   /protein_id="CAG87799.2"
FT                   /translation="MESDGFVPITAIFYAVFHPTEGTKVLNQVPEGSIGNSSTSDSNGI
FT                   IFNFDTIKNYIIPKPKLCNKLISIKIDRFKVLGYPVNIENEKYSRNSFNFNFCFVFPYN
FT                   SDTTPYESAIKRMGKMFQVLEEQSFILSKLDKFGSFFKNKDEYPTENSLMINEFITPGF
FT                   RRTQKVNLSSIESLIHQIYQDLNNYSECCIPLDSANSVDIKLFPILPPPVNTKAYQVPI
FT                   LTVKLSSLVDINWDPTMLKILPYIDGINSIKRISQLADADYILTKQCIQHLMHYKCINM
FT                   IDIFQFSNIYAPTNHIGNFLTLNNIAEECQAYIITNEPNLLNELPVNEDSDIQSSTFPN
FT                   SASPTSKHSSIFKASKKKFSGETTVIPSKASLFYLYRSLNQGQTVKEWYMQHRKYLNNI
FT                   DVRRFINFGVIRGILYRVHSYPILNSLTKSLENKNDNELDKIIDLFKAKTNPNVYPVNE
FT                   SLANKSLLKSIVHETNLKTSNAKSKRRVSFNYDVHKSAYQSEDADDSDNDPQSSDTDSF
FT                   NSDVSNDEDVQDNVEELGRGEEDDIIVLIKLLRGLQNYDSINTEMQKSRFEIEALLRKL
FT                   GPHNNIHS"
FT   gene            <470622..>470996
FT                   /locus_tag="DEHA2E05764g"
FT                   /old_locus_tag="DEHA0E06545g"
FT                   /old_locus_tag="DEHA-IPF5336"
FT                   /old_locus_tag="DEHA-CDS6265.1"
FT   CDS_pept        470622..470996
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05764g"
FT                   /old_locus_tag="DEHA0E06545g"
FT                   /old_locus_tag="DEHA-IPF5336"
FT                   /old_locus_tag="DEHA-CDS6265.1"
FT                   /product="DEHA2E05764p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87800"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE7"
FT                   /protein_id="CAG87800.2"
FT                   /translation="MSSYKVNMEHPYLSLSKILTPVSLIKRLLSVLAPFYLHPYVLYSA
FT                   DLTQLFGRILQQPFLFDQNFGADAHMLYARPKIGVNFADVNNSYGFTSYMLLLHSLLLR
FT                   LTIIHIHSSSDLVFTSRKST"
FT   gene            <471369..>473117
FT                   /locus_tag="DEHA2E05786g"
FT                   /old_locus_tag="DEHA0E06567g"
FT                   /old_locus_tag="DEHA-IPF5335"
FT                   /old_locus_tag="DEHA-CDS1734.1"
FT   CDS_pept        471369..473117
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05786g"
FT                   /old_locus_tag="DEHA0E06567g"
FT                   /old_locus_tag="DEHA-IPF5335"
FT                   /old_locus_tag="DEHA-CDS1734.1"
FT                   /product="DEHA2E05786p"
FT                   /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
FT                   YLL028W TPO1 Proton-motive-force-dependent multidrug
FT                   transporter of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87801"
FT                   /db_xref="GOA:Q6BQE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE6"
FT                   /protein_id="CAG87801.2"
FT                   /translation="MSVPTENINKEVSNALESSSSSFVTPVDRDGVSEGLAQEEPEPFT
FT                   GDLENGKEDCVPQGGDELSRYESSVEASRTLSQRLTGSESLMSKANETDEPMPPMGGGK
FT                   EYPPPLGSREPYMVEYNGPDDPIHPHNWPSVKKVYSCVVVGLTALSVSLGSAMFSAANP
FT                   IIMETYHVGTSVAALGVSLFVLGFAAGPVVWGPLSELYGRKVVMVPSCLGYVCFSFAVA
FT                   TAKDIQTIMICRFFAGLIGAAPLVVVPASIADMYGAAKRGQAMAIFAMVLFGGPMLAPI
FT                   FGGFIIKNPRLGWRWTSYFSGIVGVIALIGVVFFYEETHHPIILVKKAEVLRRRTGNWG
FT                   IQAPHDEVSLSVKEICENTISRPLVMLLKEPILLLITIYNAFIYGLLYLFLTAVPLIFA
FT                   GNYHFSSGVSELPYLSMLIGIVIGGFVCVFFDGRYTRIMNENNGKPVPEERLPAMMIGS
FT                   FAFAGGLFWLGWAGDYPDKVHWIVPTIGAAPIGFGLIVIFLPSINYIIECYLVLAASAL
FT                   AGNAFLRSAFAAAFPLFAKQMFVNMEIKWASTLLGCLAAVMIPVPFMFYIYGARIRHKS
FT                   KYAFVL"
FT   gene            <473437..>475155
FT                   /locus_tag="DEHA2E05808g"
FT                   /old_locus_tag="DEHA0E06589g"
FT                   /old_locus_tag="DEHA-IPF5333"
FT                   /old_locus_tag="DEHA-CDS1798.1"
FT   CDS_pept        473437..475155
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05808g"
FT                   /old_locus_tag="DEHA0E06589g"
FT                   /old_locus_tag="DEHA-IPF5333"
FT                   /old_locus_tag="DEHA-CDS1798.1"
FT                   /product="DEHA2E05808p"
FT                   /note="highly similar to uniprot|P19882 Saccharomyces
FT                   cerevisiae YLR259C HSP60 Tetradecameric mitochondrial
FT                   chaperonin required for ATP-dependent folding of precursor
FT                   polypeptides and complex assembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87802"
FT                   /db_xref="GOA:Q6BQE5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE5"
FT                   /protein_id="CAG87802.1"
FT                   /translation="MLRSVRPSLKKTTISLARNLSHKELKFGVEGRAALLKGVNTLADA
FT                   VSVTLGPKGRNVLIEQQFGSPKITKDGVTVAKSITLQDKFEDMGAKLLQEVASKTNESA
FT                   GDGTTSATVLGRSIFTESVKNVAAGCNPMDLRRGSQAAVEAVVSFLQNNKKEITTSEEI
FT                   AQVATISANGDKHIGDLLASAMEKVGKEGVITVKEGKTLEDELEVTEGMRFDRGFISPY
FT                   FITNTKSGKVEFENPLILLSEKKISSIQDILPSLELSNQQRRPLLIIAEDIDGEALAAC
FT                   ILNKLRGQVQVCAVKAPGFGDNRKNTLGDIAILSGGTVFTEELDLKPENATIDLLGSCG
FT                   SITITKEDTVVLNGEGSKENIQARCEQIRTSVDDIQTTEYEKEKLQERLAKLSGGVAVV
FT                   RVGGTSEIEVSEKKDRYDDALNATRAAVQEGILPGGGTALIKASRVLDDIKATAANFDQ
FT                   KLGVDIIKSAITKPARRIIENAGEEGAVIVGKIYDEPNFNHGYDSSKGEFTDMIAAGII
FT                   DPFKVVKNGLVDASGVASLLATTECAIVEAPEPKGSPAPPAGGMPGMGGMPGMGF"
FT   gene            <475394..>476944
FT                   /locus_tag="DEHA2E05830g"
FT                   /old_locus_tag="DEHA0E06611g"
FT                   /old_locus_tag="DEHA-IPF5331"
FT                   /old_locus_tag="DEHA-CDS2218.1"
FT   CDS_pept        475394..476944
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05830g"
FT                   /old_locus_tag="DEHA0E06611g"
FT                   /old_locus_tag="DEHA-IPF5331"
FT                   /old_locus_tag="DEHA-CDS2218.1"
FT                   /product="DEHA2E05830p"
FT                   /note="weakly similar to uniprot|Q04712 Saccharomyces
FT                   cerevisiae YML043C RRN11 rDNA transcription factor CF
FT                   component which also contains Rrn6p and Rrn7p which is
FT                   required for rDNA transcription by RNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87803"
FT                   /db_xref="GOA:Q6BQE4"
FT                   /db_xref="InterPro:IPR007224"
FT                   /db_xref="InterPro:IPR016850"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE4"
FT                   /protein_id="CAG87803.2"
FT                   /translation="MFEDFLSDPKYSNSKKKHKQLQRLLLKYIEVQKFQEIKSNEDLTL
FT                   QQRQKLNKARTKKKILKKIHEELNERIRPEETFEIWHLYKNLNLDRQKSGKKYNANGQG
FT                   NMTEKLMDDLINSNENDEVESEESDNEQSVDNQLDRFLNSFDSSSTWTKANFLIKTKGL
FT                   EVLPHDSLETDSPSMIRNGNVGLRNHHINNLKTLLHVNILRRNWGLAYKIFCLLIRLPK
FT                   VDIRSLWPLGIEILNRQREETAYDNKDIKLFKDEKFFDWLSSFFIINRHSNTFNLSNTR
FT                   KISAPIWRSGSKTHTPMYVITSLWGLMIKNKYTRLRDRLDELLLEPPYDTDGVFYFLMA
FT                   LCKLLENFKLANKFSSFGNEAPIEESENEDNDEMDDLFFTSKNDIHKKVIENQKVIERN
FT                   LEKCKEFNFEFPKSLLNNEINGIMKQINEDHNDSNSPLSSSSERDFDSENDIHIRNISS
FT                   TPLDVEPIFGDIDGKVKSRQNSIDSYENKSSFENAENNEMNNNLEENSQSMNFDFDFD"
FT   gene            complement(<477022..>478803)
FT                   /locus_tag="DEHA2E05852g"
FT                   /old_locus_tag="DEHA0E06633g"
FT                   /old_locus_tag="DEHA-IPF5328"
FT                   /old_locus_tag="DEHA-CDS1662.1"
FT   CDS_pept        complement(477022..478803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05852g"
FT                   /old_locus_tag="DEHA0E06633g"
FT                   /old_locus_tag="DEHA-IPF5328"
FT                   /old_locus_tag="DEHA-CDS1662.1"
FT                   /product="DEHA2E05852p"
FT                   /note="weakly similar to uniprot|Q08109 Saccharomyces
FT                   cerevisiae YOL013C HRD1 Ubiquitin-protein ligase required
FT                   for endoplasmic reticulum-associated degradation (ERAD) of
FT                   misfolded proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87804"
FT                   /db_xref="GOA:Q6BQE3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE3"
FT                   /protein_id="CAG87804.2"
FT                   /translation="MIIDKSHQYFIGYISVSIALISWSVYSSLEISPNAFTFLIEFTDG
FT                   YKLGILLNFLFLSFVLCGKLIQILLFGQLRIIEVEHLVEKLPIYFINLLFNLTTNDNNL
FT                   ILNCLLLGIAVSLKIFHVILIDRLDYVHMKIFNNSSNERYTTSKVLQKYSTSLYFWLIL
FT                   SFIISDFAVAKFLVYDVFQGINSVTCLLFGFQFAVQGVEALTYYSKLLLNIYELAFYRN
FT                   QQDDFDTDEENEEELDEEEEEEDNERVWDNKAFFSKSIDICSASLKAISYLGFIYLLTI
FT                   HSGLSLPISMLQGTYLSLKQTYKEISQLFAFIESSKKLDSQLPNATKDELESSDNLCII
FT                   CREDMFALDEYERAHHKKLSARRYPKKLKCGHILHMGCLKDWLERSEICPLCRRKVFQT
FT                   EENDLQEQAQPEAQPEAQPEEQPEEQPEEQPEAQPEAQPEAQPEAQPEAQPQVPLETQQ
FT                   AQPMRTNQEDTRINVDEQTQRNQNILNQLNIPAGYPETTITPPPTRTTEPSEVFQTIRL
FT                   PTTAIIPQDWTILPLHKSANDKYKIDFSTFNQGTLTIKQKPPGNELSIIEPNLSSSRHD
FT                   EIRINETRNTNYTNNAN"
FT   gene            complement(<478931..>481684)
FT                   /locus_tag="DEHA2E05874g"
FT                   /old_locus_tag="DEHA0E06655g"
FT                   /old_locus_tag="DEHA-IPF5327"
FT                   /old_locus_tag="DEHA-CDS0574.1"
FT   CDS_pept        complement(478931..481684)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05874g"
FT                   /old_locus_tag="DEHA0E06655g"
FT                   /old_locus_tag="DEHA-IPF5327"
FT                   /old_locus_tag="DEHA-CDS0574.1"
FT                   /product="DEHA2E05874p"
FT                   /note="similar to uniprot|P28742 Saccharomyces cerevisiae
FT                   YBL063W KIP1 Kinesin-related motor protein required for
FT                   mitotic spindle assembly and chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87805"
FT                   /db_xref="GOA:Q6BQE2"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE2"
FT                   /protein_id="CAG87805.2"
FT                   /translation="MSSNIQVVVRCRGRNSREVTAKSPLIVDLPNDTYSVSNPTITVNQ
FT                   DQQFSTFINSMNSKTYTVDQVYGSQADQSLLFDKVAMPLFNDFINGFNVTILAYGQTGT
FT                   GKTYTMCGNCNTEDAVGKLESYNPSLNEMAGIIPRTLNELFKSLESDSGANDYVVKCSF
FT                   IELYNEDLKDLLNDDTDRNRLRMFESKKPNSDTLIIQNLQETYINSAIDGLNILRKGLI
FT                   KRKTASTKLNDVSSRSHTIFTVNLYKKQGNEFFKVSKMNLVDLAGSENINRSGAVNQRA
FT                   KEAGLINQSLLTLGRVINSLSDRSLSASNTSHIPYRESKLTRLLQDSIGGQTKTALIAT
FT                   ISPAKINLEETVSTLEYASRAKNIQNKPQLGQDCDLMLKKILLKDMSKEITKLNKDLIA
FT                   TRNKNGIWMDENNYNTLIENNDLIKAELKESNSIINGLNMKISQLSNLKKTTELNNKNY
FT                   KSKINEYQLKIKSLENIETNNKKQISDNDTMISTLNDKLFKLNENYKSSKLQLTQLINN
FT                   SLNDSISQIENVVTDLNNSKESQNNSLNASIKSIQNNLQTCKNSLSETIASTNTELSQS
FT                   IDKIPKMMSDINSNFHDFNGIVSDNESKIKASMSDLKIANDKFSGYITEEHLDSQALNN
FT                   VINQIVSERVNEQLSSIKSNMLNKFSKLLDDTHLKHESLFKDSVNEVSSKFINLERNTL
FT                   LERQSNWFHESEKFYNSIDKDATSFKKQYHDFNDENSHKLSTTTNNISSLITNTINPNL
FT                   AKINQIIDKNNLSDDMPKLKSISDLIIKKDDRVCESLNHVNQNLNSLQYDITSNEANVI
FT                   MKSPVRSPNKSPIKHTKPSPFKQLNSPTKESSSSPSKRLPSAKSSPSKKSPLKRQSSSI
FT                   ALSVNTDLQRTKIPQLSRSNSDKENVSAAAFKRRRIIHDVNTTLNK"
FT   gene            complement(<481854..>482237)
FT                   /locus_tag="DEHA2E05896g"
FT                   /old_locus_tag="DEHA0E06677g"
FT                   /old_locus_tag="DEHA-IPF5325"
FT                   /old_locus_tag="DEHA-CDS6553.1"
FT   CDS_pept        complement(481854..482237)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05896g"
FT                   /old_locus_tag="DEHA0E06677g"
FT                   /old_locus_tag="DEHA-IPF5325"
FT                   /old_locus_tag="DEHA-CDS6553.1"
FT                   /product="DEHA2E05896p"
FT                   /note="similar to uniprot|Q04773 Saccharomyces cerevisiae
FT                   YMR074C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87806"
FT                   /db_xref="GOA:Q6BQE1"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE1"
FT                   /protein_id="CAG87806.1"
FT                   /translation="MDDAELNAIRSARLSELQKNSGQAPADQGGDKKDDMKLSMLSQIL
FT                   ETSARERLSRVRIVRPDRADAVEQYIIKLAATGNITRKLSENDIVEILDGISRDEKKQT
FT                   QSKIVFDRRTTNIDSDEDDDFFD"
FT   gene            <482431..>483130
FT                   /locus_tag="DEHA2E05918g"
FT   CDS_pept        join(482431..482488,482574..483130)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05918g"
FT                   /product="DEHA2E05918p"
FT                   /note="similar to uniprot|Q99260 Saccharomyces cerevisiae
FT                   YLR262C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87807"
FT                   /db_xref="GOA:Q6BQE0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQE0"
FT                   /protein_id="CAG87807.2"
FT                   /translation="MDKSNILRKYKIVFLGDQSVGKTSLITRFMYDTFDDQYAATIGID
FT                   FLSKTMYLEDNKTIRLQLWDTAGQERFRSLIPSYIRDSHVAVICYDITNKKSFENLNKW
FT                   IQDVKLERGDDVIIVVVGNKSDLNNKRQVTMEECEAYLKSINGKFCIETSTKANHNVKQ
FT                   LFKKIASSLPDVEKSTKDETTQPETVDINIEQPKVENNSCC"
FT   gene            complement(<483599..>485389)
FT                   /locus_tag="DEHA2E05940g"
FT                   /old_locus_tag="DEHA0E06721g"
FT                   /old_locus_tag="DEHA-IPF5322"
FT                   /old_locus_tag="DEHA-CDS1644.1"
FT   CDS_pept        complement(483599..485389)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05940g"
FT                   /old_locus_tag="DEHA0E06721g"
FT                   /old_locus_tag="DEHA-IPF5322"
FT                   /old_locus_tag="DEHA-CDS1644.1"
FT                   /product="DEHA2E05940p"
FT                   /note="weakly similar to uniprot|P32948 Candida rugosa LIP4
FT                   Lipase 4 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87808"
FT                   /db_xref="GOA:Q6BQD9"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD9"
FT                   /protein_id="CAG87808.2"
FT                   /translation="MIFTSKLFALSVLFCIGSASPVSRRDAAQSVGSVTSSTVESAPTV
FT                   DTTNGTYVGTYLECFDQDIFLGMRYAQSPLGSLRFVNPQPVNETFSEVREAKEYLPSCM
FT                   NLGDSEGGDNWGLEQSEDCLGINVIRPANTTGPLPVLIYIYGGGFYQGASSVDAYNLSY
FT                   IVQESVEMGKPMIGVSFNYRLSGFGFLGGEEVVKRGYTNVGLRDQLLAIEWVQENIDEF
FT                   GGDPNHIVLWGESAGAISISLQLGSGRLNSSHIRGAIMDSGFVAGNGIGVATSDVSTEG
FT                   YKNITAYLGCDKAEDAFACLQNYENVTELIEAFDPDFGIISDDVFGHVTIDYDYVPTVP
FT                   SEMFVNNNFTEVPIIIGANSDEGTAFVSSTVDNENIKEYLAAKYTHLSESQLDTILDLY
FT                   KDNNPEFQPPYQPPFPVSFEGYGSGFRRAASIVGDLRYIGPKRHAAKNWVSKNLTAYTY
FT                   RWNLFLNDTAEQLGATHAQELRWNFDNDQTSFSSLSPQQQNQTLVSLFNRDGLYRNHQG
FT                   EAVTMAEIISKQWISFITTLNPNNHDIYGIPHWPSYGSLYEPNKNYVYDWRSISTEVDN
FT                   FREEAINYVSTLFEDLFIAY"
FT   gene            <486014..>486136
FT                   /locus_tag="DEHA2E05962g"
FT                   /old_locus_tag="DEHA0E06743g"
FT                   /old_locus_tag="DEHA-IPF5321"
FT                   /old_locus_tag="DEHA-CDS8989.1"
FT   CDS_pept        486014..486136
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05962g"
FT                   /old_locus_tag="DEHA0E06743g"
FT                   /old_locus_tag="DEHA-IPF5321"
FT                   /old_locus_tag="DEHA-CDS8989.1"
FT                   /product="DEHA2E05962p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD8"
FT                   /protein_id="CAG87809.1"
FT                   /translation="MIKATKTKAIPIAAPPNHNVAIEAPMYLAANANCTIIKFI"
FT   gene            <487216..>488634
FT                   /locus_tag="DEHA2E05984g"
FT                   /old_locus_tag="DEHA0E06765g"
FT                   /old_locus_tag="DEHA-IPF5319"
FT                   /old_locus_tag="DEHA-CDS2544.1"
FT   CDS_pept        487216..488634
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E05984g"
FT                   /old_locus_tag="DEHA0E06765g"
FT                   /old_locus_tag="DEHA-IPF5319"
FT                   /old_locus_tag="DEHA-CDS2544.1"
FT                   /product="DEHA2E05984p"
FT                   /note="weakly similar to uniprot|Q12132 Saccharomyces
FT                   cerevisiae YPL230W Up in starvation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87810"
FT                   /db_xref="GOA:Q6BQD7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD7"
FT                   /protein_id="CAG87810.2"
FT                   /translation="MPAINNTSPVSSKEPVNGPREAEDVEQTQINKHDAQTMQQSSSSS
FT                   SSSSSLQLHEPPGESRQSEESSELRDSDPEEHPKDTQESMNSKFANEYNTNTRKKRASK
FT                   GRVFRCTGYPDCNMSFTRSEHLARHKRKHTGERPFTCPHCHKNFSRLDNLRQHKQTVHA
FT                   YENFMGNNSNNMPIPTNYNSCGTGGSMADTNKTNYMPIPNHLTMNNGANNGTPESPLTY
FT                   GFGNSPGSTAMISPPNTNSPVNYHLPYQNQPYHNNSFESSNNSVNNNFQYPESQIKTKI
FT                   NEFKPKRRPRPLSLVHSFTDNSALGDDNSLHIGQSLKSAPAMYNMNGSFTYPPKSGPLT
FT                   PNMVSPLSPLFHHTFNQTMDLPKSPHVTSNTLRLPPYNHPIHNNIIPNNPANKNITLPS
FT                   VQELPIPTQFNPIKNSKSWLKKVLNDDSSASSSSPNDTNRSSVTQEDKHVSKKPTINNL
FT                   LSPYDDDEFPNSVK"
FT   gene            <489245..>490741
FT                   /locus_tag="DEHA2E06006g"
FT                   /old_locus_tag="IPF_5318"
FT   CDS_pept        489245..490741
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06006g"
FT                   /old_locus_tag="IPF_5318"
FT                   /product="DEHA2E06006p"
FT                   /note="weakly similar to uniprot|P53283 Saccharomyces
FT                   cerevisiae YGR138C TPO2 Polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65775"
FT                   /db_xref="GOA:B5RTW3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW3"
FT                   /protein_id="CAR65775.1"
FT                   /translation="MTNNFDKENEIEKENVSFHTKSPTPYEEPWKELSDDHKQYLIDKH
FT                   GTYKLDPIPSMNDEDPLNWPTYIKAIQLGMLSFHAFSTTFMAAGLIPSFATLSEEFSTS
FT                   VSACSYFTSTQILVLGIFPLLWVPLMNKYGRLQLLVISALGSCVFNIGCIFSTNYKDLM
FT                   ICRIFGAFFVSPAIAVGGGVVSELTFSHQRGWWTGWWVVGVTLGTHVGPFLMGFVQYQT
FT                   GNTKYTFVVFAIMNILQFFGYLTMGKETVYNSKVYTRSIYSLFKIRPKTDCDLNFALML
FT                   SPFKCINQPKVVIPAIAYSVTFCYANVACGVELTSLFHEKFSFNPQQIGLQFLSLILGC
FT                   ILGEQIGGWVSDLWMKYFHFKSSEKTIEDRLWLSYPGFIIAIVGLIIYGVLLGNITDNT
FT                   WRFGPLVGLCLASFGLQIITTILVTYAIDSNPANASNIALFITVIRQVFGFVGPFYFPV
FT                   MLENPDLGIKSTYGILAALVAAFGLIPVALLHLSRFCAKN"
FT   gene            complement(<490743..>491435)
FT                   /locus_tag="DEHA2E06028g"
FT                   /old_locus_tag="DEHA0E06809g"
FT                   /old_locus_tag="DEHA-IPF5316"
FT                   /old_locus_tag="DEHA-CDS5042.1"
FT   CDS_pept        complement(490743..491435)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06028g"
FT                   /old_locus_tag="DEHA0E06809g"
FT                   /old_locus_tag="DEHA-IPF5316"
FT                   /old_locus_tag="DEHA-CDS5042.1"
FT                   /product="DEHA2E06028p"
FT                   /note="some similarities with uniprot|P32380 Saccharomyces
FT                   cerevisiae YDR356W SPC110 Inner plaque spindle pole body
FT                   (SPB) component ortholog of human kendrin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD5"
FT                   /protein_id="CAG87812.2"
FT                   /translation="MMSKYNNSFSFLLNTENIEPLLESVNKLSKIVEENAEILNRLTYT
FT                   IDNDLQFPELTIDIEDDSVTENKTDPLRQLLNQKYKLEEMSIESELIDKVENPRIKELL
FT                   LDNEKLKRLQVSKRKINTELYGIVQDYELFILNTMLPSLRKDIEIYRQEITRDVKANQI
FT                   PLKFAASEKLWSRYVTYIGYLEKLSKLCERLMQMLDDTQSNKEVLIIEQKLISINELRL
FT                   NLQNQLAR"
FT   gene            complement(<491691..>493409)
FT                   /locus_tag="DEHA2E06050g"
FT                   /old_locus_tag="DEHA0E06831g"
FT                   /old_locus_tag="DEHA-IPF5315"
FT                   /old_locus_tag="DEHA-CDS1797.1"
FT   CDS_pept        complement(491691..493409)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06050g"
FT                   /old_locus_tag="DEHA0E06831g"
FT                   /old_locus_tag="DEHA-IPF5315"
FT                   /old_locus_tag="DEHA-CDS1797.1"
FT                   /product="DEHA2E06050p"
FT                   /note="similar to uniprot|P26570 Saccharomyces cerevisiae
FT                   YML016C PPZ1 Serine/threonine protein phosphatase Z isoform
FT                   of Ppz2p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87813"
FT                   /db_xref="GOA:Q6BQD4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011159"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD4"
FT                   /protein_id="CAG87813.2"
FT                   /translation="MGNNSSKPKDLRGSPLSRTDTGNSAKSSRSIRSRISMSRDDNSTS
FT                   GSPKTGSKATSRKNSSTSLNNMNSSSHSMNIPINGNNSAHSNNNSSANLSNSFSNLSLH
FT                   KNPSNQHSNNNFNLPPSMIQVEPKEPILIRRNTGPDGEDTPLSPKNHSFNSNSPHLASS
FT                   FDNSNPSSNPSNNISRTSTNHSHHSGSINNYPLSPQPTSSSANGSTKDLQEDTSKNFDS
FT                   QSLNENRNKDVSINNLSHSSTTESNESDDSGSIDIENLIQRLLDAGYSGKKTKSVCLKN
FT                   HEIQLICAKARNILLSQPSLLELSPPVKVVGDVHGQYGDLIRIFTKCGFPPQTNYLFLG
FT                   DYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWK
FT                   LFIDTFNTLPIAAIVAGKIFCVHGGLSPVLNSMEEIRNIARPTDVPDFGLLNDLLWSDP
FT                   ADTMNEWEDNERGVSYVFSRVAINKFLQKFGFDLVCRAHMVVEDGYEFFNDRTLVTVFS
FT                   APNYCGEFDNWGAVMSVSDELLCSFELLDPLDSIALKQVMKKGKEERKNAQLQQS"
FT   gene            <494887..>496455
FT                   /locus_tag="DEHA2E06072g"
FT                   /old_locus_tag="DEHA0E06853g"
FT                   /old_locus_tag="DEHA-IPF5314"
FT                   /old_locus_tag="DEHA-CDS2198.1"
FT   CDS_pept        494887..496455
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06072g"
FT                   /old_locus_tag="DEHA0E06853g"
FT                   /old_locus_tag="DEHA-IPF5314"
FT                   /old_locus_tag="DEHA-CDS2198.1"
FT                   /product="DEHA2E06072p"
FT                   /note="similar to CA3407|IPF9406 Candida albicans IPF9406
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87814"
FT                   /db_xref="GOA:Q6BQD3"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD3"
FT                   /protein_id="CAG87814.2"
FT                   /translation="MTIMLKSINYNSLGKINLSIIRRFSKSVNIYNKSKSNNEFQQPES
FT                   DLYFGKFTKEEYDNAANHVKNQINRLEKEIKGDVNIRQNIGTMPTLPAMANSAKKIRID
FT                   DLTNLLSETIKTTGPISLSAFMRQCLTHPQFGYYTTRDPLNASSGDFITSPEISSMFGE
FT                   MIGIWLFSTWLNQNKPQKLNIIEFGPGRGTLMYDCLKSFNKFKKNLIQEENIEITMIEA
FT                   SSILRKEQWKLLCGSNEFITNSDGFNISRTQWGNRVKWVDNETDITKDENVANYIVAHE
FT                   FFDALPIKSFQKTKHGWRELVVEHTPSVDNTQLSLPEDASSKSTSENNDLLNTEFHLTL
FT                   SPKETSSSVIPDLNPRFKDLPIDSRIEICPDAELYVLKMAQLLNNEKGMGSVLIIDYGI
FT                   SEGIPDNTLRGIYKHKFVSPFINPGEVDLSVDVDFTNLKNVTEKMCKSFGPVEQGDWLH
FT                   ELGIGYRTDQLIKANDGNVNAQDKIYNAYQRLTGKDERSMGKIYKFLCLTPHESKSPVG
FT                   FGGSL"
FT   gene            complement(<496676..>497785)
FT                   /locus_tag="DEHA2E06094g"
FT                   /old_locus_tag="DEHA0E06875g"
FT                   /old_locus_tag="DEHA-IPF5313"
FT                   /old_locus_tag="DEHA-CDS3473.1"
FT   CDS_pept        complement(496676..497785)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06094g"
FT                   /old_locus_tag="DEHA0E06875g"
FT                   /old_locus_tag="DEHA-IPF5313"
FT                   /old_locus_tag="DEHA-CDS3473.1"
FT                   /product="DEHA2E06094p"
FT                   /note="weakly similar to uniprot|Q04081 Saccharomyces
FT                   cerevisiae YDR435C PPM1 Carboxyl methyl transferase
FT                   methylates the C terminus of the protein phosphatase 2A
FT                   catalytic subunit (Pph21p or Pph22p) which is important for
FT                   complex formation with regulatory subunits"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87815"
FT                   /db_xref="GOA:Q6BQD2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016651"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQD2"
FT                   /protein_id="CAG87815.2"
FT                   /translation="MISPQEKQDKVIRATDLDALSCRYSANNKSYFSKPDPFIDSLISS
FT                   YKMHLPLCTGYTNMSANRTLRSVFNEQKLPLINRGTYLRTESIDVITQEFIKEFKKCQV
FT                   ISLGGGSDTRCFRILEEHGEDVRYCEIDFHESVKIKKLAIINDKKLADIVKYDEESQSI
FT                   TSKEEFARLESNIHTENYHLIGYDLRELTGALDSGAILEYVDTSLPTLILSECVLCYLN
FT                   PKENERIIEFWKNAFASKALLALLIYEPMSLNDAFGTTMTHNLSNRGINLLTFNEYPNL
FT                   EARYKFLSEKCQSSNVKLTDMSNVGGYDSDNTTKAWINSKDLARINRLELVDEIEEIRL
FT                   LLKHYCLCYCEFSHSPSLKTINKWKWILE"
FT   gene            complement(<497908..>498681)
FT                   /locus_tag="DEHA2E06116g"
FT                   /old_locus_tag="DEHA0E06897g"
FT                   /old_locus_tag="DEHA-IPF5312"
FT                   /old_locus_tag="DEHA-CDS4720.1"
FT   CDS_pept        complement(497908..498681)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06116g"
FT                   /old_locus_tag="DEHA0E06897g"
FT                   /old_locus_tag="DEHA-IPF5312"
FT                   /old_locus_tag="DEHA-CDS4720.1"
FT                   /product="DEHA2E06116p"
FT                   /note="similar to uniprot|P49957 Saccharomyces cerevisiae
FT                   YML014W TRM9 tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87816"
FT                   /db_xref="GOA:Q6BQD1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD1"
FT                   /protein_id="CAG87816.2"
FT                   /translation="MSLPSLNNEVDPVNQENDFVHTVYNEIAPHFSQTRYKPWPIVEKF
FT                   LSNQKDYSIGLDVGCGNGKYLSVNKKLFMIGTDRSDGLISCAKDLSNNSYNVGVADGLN
FT                   LPHPNNTFDFAISIAVIHHFATAERRVLAIKHILQKMRSGGEVLIYCWALEQENSRRGY
FT                   KEGDDQDILIPWVLQNKQKKDKSKGRFKKQDQQSDQINSDIKEEDKPDVPETKYRYYHL
FT                   YRKGELVDNALAAGGCSLIDQGYEKDNWWVVIRKD"
FT   gene            <498816..>499988
FT                   /locus_tag="DEHA2E06138g"
FT                   /old_locus_tag="DEHA0E06919g"
FT                   /old_locus_tag="DEHA-IPF5311"
FT                   /old_locus_tag="DEHA-CDS3259.1"
FT   CDS_pept        498816..499988
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06138g"
FT                   /old_locus_tag="DEHA0E06919g"
FT                   /old_locus_tag="DEHA-IPF5311"
FT                   /old_locus_tag="DEHA-CDS3259.1"
FT                   /product="DEHA2E06138p"
FT                   /note="weakly similar to uniprot|Q04080 Saccharomyces
FT                   cerevisiae YDR434W GPI17 Transmembrane protein subunit of
FT                   the glycosylphosphatidylinositol transamidase complex that
FT                   adds GPIs to newly synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87817"
FT                   /db_xref="GOA:Q6BQD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQD0"
FT                   /protein_id="CAG87817.2"
FT                   /translation="MNLETNYYNSTFLYFIICLVGVLFPLVSLFKYNSSLSIEELQRMK
FT                   SFIIDDLAITIPISVRFGDKGFNFPDLVDATQVELDYELRKTVNNSWRFKLINELASNW
FT                   TSSNDGQYILELTHSDDNFVIVEPNMCKAQVHYSQGSVHANDLPFFMTQATLEHLMSAE
FT                   IELLGLLKSPEKALDIPFIDARIIIIGSKSRHYADIFEENLMPLNSFATEVSGLSNVTV
FT                   TVTALESLTEDDNILNSSSSLYYLYSDIHNEAFISNETNFPNRISYIYNDSVTSDDATY
FT                   FISKVTDDLKGSIGLPKNPTNNLAIRVHAMKRYLTLKGLIESIDHLTTATIGDNNNSSG
FT                   QIEKLVSNLNPIIDCLHKNESKHDWNNLLAWSRYFKETSSQLLQDSHLLI"
FT   gene            <500225..>500950
FT                   /locus_tag="DEHA2E06160g"
FT                   /old_locus_tag="DEHA0E06941g"
FT                   /old_locus_tag="DEHA-IPF5309"
FT                   /old_locus_tag="DEHA-CDS4917.1"
FT   CDS_pept        500225..500950
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06160g"
FT                   /old_locus_tag="DEHA0E06941g"
FT                   /old_locus_tag="DEHA-IPF5309"
FT                   /old_locus_tag="DEHA-CDS4917.1"
FT                   /product="DEHA2E06160p"
FT                   /note="weakly similar to uniprot|Q04226 Saccharomyces
FT                   cerevisiae YML015C TAF11 TFIID subunit (40 kDa) involved in
FT                   RNA polymerase II transcription initiation similar to
FT                   histone H3 with atypical histone fold motif of Spt3-like
FT                   transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87818"
FT                   /db_xref="GOA:Q6BQC9"
FT                   /db_xref="InterPro:IPR006809"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC9"
FT                   /protein_id="CAG87818.2"
FT                   /translation="MDTEYEDDDHLSDVSLDEEDEELIWRVFYSSLEEKTRDSPLIDDG
FT                   SEFSESDELDYLSDISDVDDPELVSKYKELKSQNIGNLNEEEKKRLIIANFTDDQMERF
FT                   ESYRRMTVNKPGVKKICNGVLGHSIPQNIAVVLAGLSKSFLGEIITRAFEIQERENKAQ
FT                   LILDIDNKKKQKLDILKNLENGKEVEVDDRKLQYQGDVQKPLLPEHIREAWRLYKLENS
FT                   GVFNAQWRSQGDADGKLFR"
FT   repeat_region   complement(504719..505062)
FT                   /locus_tag="DEHA2E06182t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   gene            complement(<506821..>507117)
FT                   /pseudo
FT                   /locus_tag="DEHA2E06189g"
FT                   /old_locus_tag="IPF_43237"
FT                   /note="weakly similar to uniprot|Q8TFJ9 Debaryomyces
FT                   hansenii Polyprotein of Tdh5 retrotransposon pseudogene"
FT   mobile_element  507471..509415
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06204t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            <507471..>508964
FT                   /pseudo
FT                   /locus_tag="DEHA2E06215g"
FT                   /old_locus_tag="IPF_43234"
FT                   /note="uniprot|Q8TFJ9 Debaryomyces hansenii Polyprotein of
FT                   Tdh5 retrotransposon pseudogene"
FT   repeat_region   complement(509415..509573)
FT                   /locus_tag="DEHA2E06226t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  509574..509981
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06237t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            <509574..>509981
FT                   /pseudo
FT                   /locus_tag="DEHA2E06248g"
FT                   /old_locus_tag="IPF_43230"
FT                   /note="highly similar to uniprot|Q8TFJ9 Debaryomyces
FT                   hansenii Polyprotein of Tdh5 retrotransposon pseudogene"
FT   repeat_region   510313..510769
FT                   /locus_tag="DEHA2E06270t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  complement(510770..511351)
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06292t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            <510770..>511351
FT                   /pseudo
FT                   /locus_tag="DEHA2E06301g"
FT                   /old_locus_tag="IPF_43225"
FT                   /note="uniprot|Q8TFJ9 Debaryomyces hansenii Polyprotein of
FT                   Tdh5 retrotransposon pseudogene"
FT   gap             511352..511451
FT                   /estimated_length=unknown
FT                   /note="gap of 100 nt"
FT   mobile_element  511453..513058
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06424t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   repeat_region   513191..513647
FT                   /locus_tag="DEHA2E06446t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   mobile_element  complement(513648..515764)
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06468t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            complement(<513648..>515764)
FT                   /pseudo
FT                   /locus_tag="DEHA2E06479g"
FT                   /old_locus_tag="IPF_43221"
FT                   /note="uniprot|Q8TFJ9 Debaryomyces hansenii Polyprotein of
FT                   Tdh5 retrotransposon pseudogene"
FT   mobile_element  complement(515765..519697)
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06490t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            complement(<516216..>519725)
FT                   /pseudo
FT                   /locus_tag="DEHA2E06501g"
FT                   /old_locus_tag="IPF_43216"
FT                   /note="uniprot|Q8TFJ9 Debaryomyces hansenii Polyprotein of
FT                   Tdh5 retrotransposon pseudogene"
FT   repeat_region   complement(519698..520154)
FT                   /locus_tag="DEHA2E06512t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh5
FT                   retrotransposon"
FT   gene            <520133..>522046
FT                   /pseudo
FT                   /locus_tag="DEHA2E06523g"
FT                   /old_locus_tag="IPF_12381"
FT                   /note="similar to uniprot|Q8TFJ9 Debaryomyces hansenii
FT                   Polyprotein of Tdh5 retrotransposon pseudogene"
FT   mobile_element  521639..523489
FT                   /mobile_element_type="retrotransposon:Tdh5"
FT                   /locus_tag="DEHA2E06534t"
FT                   /note="relic of Debaryomyces hansenii Tdh5 retrotransposon"
FT   gene            <522016..>523489
FT                   /pseudo
FT                   /locus_tag="DEHA2E06545g"
FT                   /old_locus_tag="DEHA0E06974g"
FT                   /old_locus_tag="DEHA-IPF12376"
FT                   /old_locus_tag="DEHA-CDS8254.1"
FT                   /old_locus_tag="DEHA0E06985g"
FT                   /old_locus_tag="DEHA-IPF12375"
FT                   /old_locus_tag="DEHA-CDS3175.1"
FT                   /note="similar to uniprot|Q8TFJ9 Debaryomyces hansenii
FT                   Polyprotein of Tdh5 retrotransposon pseudogene"
FT   gene            complement(<524381..>525802)
FT                   /locus_tag="DEHA2E06556g"
FT                   /old_locus_tag="DEHA0E07007g"
FT                   /old_locus_tag="DEHA-IPF12373"
FT                   /old_locus_tag="DEHA-CDS2528.1"
FT   CDS_pept        complement(524381..525802)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06556g"
FT                   /old_locus_tag="DEHA0E07007g"
FT                   /old_locus_tag="DEHA-IPF12373"
FT                   /old_locus_tag="DEHA-CDS2528.1"
FT                   /product="DEHA2E06556p"
FT                   /note="similar to uniprot|P17709 Saccharomyces cerevisiae
FT                   YCL040W GLK1 Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87822"
FT                   /db_xref="GOA:Q6BQC8"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC8"
FT                   /protein_id="CAG87822.1"
FT                   /translation="MLNLKLQTAVDDIVNQFTVTEEFLHDATKEFTKSMDTGLQNTASK
FT                   REYMPMIPTYVTGIPTGKEKGLFLAADLGGTNFRVCSVNLHGDHTHELKQSKYSIPLDL
FT                   MKNSTADSLFSFLAKKVETFLKDNHDDLEADEQLKLGFTFSFPINQTALNRGTLIRWTK
FT                   GFDLPDCVDKDVVELLQSNIDLLGCKVNVVALANDTVGTLLSRAYSNNPEKTNANTIVG
FT                   AIFGTGTNGAYFETLDNIPKLKSTNIPEGAKGMVINTEWGSFDNTLKILPKTKYDEIVD
FT                   SETANKGFHLFEKRISGMFMGEILRVCLIDLFQRDLIFVDLYKSRGGSLPHRLSEEWLL
FT                   SSEVLSYLQIDDSTDLKMSELILENELRLPTTKEERIVIQKLTQAIAHRAAYLSAIPVA
FT                   AILNRVKGQFSNDNRDFEFGCDGSVVEFYPGFQASILEALEIINPLEGEKKKVHLKIAK
FT                   DGSGVGAALCASTAK"
FT   gene            <526183..>526518
FT                   /locus_tag="DEHA2E06578g"
FT                   /old_locus_tag="DEHA0E07029g"
FT                   /old_locus_tag="DEHA-IPF12372"
FT                   /old_locus_tag="DEHA-CDS6991.1"
FT   CDS_pept        526183..526518
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06578g"
FT                   /old_locus_tag="DEHA0E07029g"
FT                   /old_locus_tag="DEHA-IPF12372"
FT                   /old_locus_tag="DEHA-CDS6991.1"
FT                   /product="DEHA2E06578p"
FT                   /note="weakly similar to uniprot|Q05926 Saccharomyces
FT                   cerevisiae YLR364W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87823"
FT                   /db_xref="GOA:Q6BQC7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC7"
FT                   /protein_id="CAG87823.1"
FT                   /translation="MSKEYIERAQELVNNHPYLMLSKSWCPDCHYTYEIWNQYNVKEKI
FT                   YIIELDKFEDQNEAEELEKAFTEIAGRKWVPTIFFHGKILGTEEDLKRWTKEGKLSEIF
FT                   KDSHLIN"
FT   gene            complement(<526595..>528007)
FT                   /locus_tag="DEHA2E06600g"
FT                   /old_locus_tag="DEHA0E07051g"
FT                   /old_locus_tag="DEHA-IPF12371"
FT                   /old_locus_tag="DEHA-CDS2562.1"
FT   CDS_pept        complement(526595..528007)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06600g"
FT                   /old_locus_tag="DEHA0E07051g"
FT                   /old_locus_tag="DEHA-IPF12371"
FT                   /old_locus_tag="DEHA-CDS2562.1"
FT                   /product="DEHA2E06600p"
FT                   /note="highly similar to uniprot|P37291 Saccharomyces
FT                   cerevisiae YLR058C SHM2 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87824"
FT                   /db_xref="GOA:Q6BQC6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC6"
FT                   /protein_id="CAG87824.1"
FT                   /translation="MPYALSESHKQLVEGHLKDIDPEVDQIIKDEVDRQKHSIVLIASE
FT                   NFTSTAVFDALGTPMCNKYSEGYPGARYYGGNEQIDKMEILCQERALKTFNATSDKWGV
FT                   NVQTLSGSPANLQVYQALMKPHERLMGLDLPHGGHLSHGYQTDSRKISAVSTYFETMPY
FT                   RVNLDTGLIDYDMLEKTAVLFRPKILVAGTSAYCRLIDYKKMREIADKVGAYLVVDMAH
FT                   ISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGQEILYDLEN
FT                   PINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNSKVLEEEFTKKGYTL
FT                   VSNGTDSHMVLVSLKDKQIDGARVETICEKINIALNKNSIPGDKSALVPGGVRIGAPAM
FT                   TTRGLGEEDFKKIVSYIDFAVNYAKEIQANLPKDANKLKDFKNKVLNTEDEKLQAAKKE
FT                   ISQWAGEFPLSV"
FT   gene            complement(<528471..>529070)
FT                   /locus_tag="DEHA2E06622g"
FT                   /old_locus_tag="DEHA0E07073g"
FT                   /old_locus_tag="DEHA-IPF12370"
FT                   /old_locus_tag="DEHA-CDS5366.1"
FT   CDS_pept        complement(528471..529070)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06622g"
FT                   /old_locus_tag="DEHA0E07073g"
FT                   /old_locus_tag="DEHA-IPF12370"
FT                   /old_locus_tag="DEHA-CDS5366.1"
FT                   /product="DEHA2E06622p"
FT                   /note="similar to uniprot|P53224 Saccharomyces cerevisiae
FT                   YGR038W ORM1 Evolutionarily conserved protein with
FT                   similarity to Orm2p required for resistance to agents that
FT                   induce the unfolded protein response"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87825"
FT                   /db_xref="GOA:Q6BQC5"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC5"
FT                   /protein_id="CAG87825.1"
FT                   /translation="MSQYSPKMNNNNNDDNNLLTPTQSHHSAHTVTTRKRRSSSIIQHL
FT                   EPDTLETKIDQSLNPNVNANWVHSKGAWVIHIVLILFLKIFFNFITVLNNDWKWTLTNL
FT                   TYNIGSYIMFHQVKGTPFEFNSGAYDNLTMWEQIDNGDQYTPTKKFLMLVPISLFLIST
FT                   HYSNYNLNLFILNGVSCLCVVVPKLAVSHRLRVTLY"
FT   gene            complement(<529426..>531147)
FT                   /locus_tag="DEHA2E06644g"
FT                   /old_locus_tag="DEHA0E07095g"
FT                   /old_locus_tag="DEHA-IPF12369"
FT                   /old_locus_tag="DEHA-CDS1789.1"
FT   CDS_pept        complement(529426..531147)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06644g"
FT                   /old_locus_tag="DEHA0E07095g"
FT                   /old_locus_tag="DEHA-IPF12369"
FT                   /old_locus_tag="DEHA-CDS1789.1"
FT                   /product="DEHA2E06644p"
FT                   /note="weakly similar to uniprot|P38352 Saccharomyces
FT                   cerevisiae YBR280C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87826"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC4"
FT                   /protein_id="CAG87826.2"
FT                   /translation="MTAITLNDLGEDIICSNIAIHLSPEDIFSLSLVSHSFYSYLTTND
FT                   IFHLLYLKKFGSKPTPLNLSNYNWKELFKLRSSSQAKIYTWGSSQLGRLGYLLSNAPPE
FT                   NIANSGISKNVHTPTNLTTFNGFVISDISAGGFSFQILTNEGDLYFTGADWNKGERSTS
FT                   TPGPFETFDYKSTAASIPRVESLGSRRSLNGISMPFMGRRYDRDIEAPTSTPSADRQTN
FT                   PNLRKPSDQLDLSLPDPTGSSMKHQKKVKETNFVTKLLLPDNPEFPDRYVTSISSGREH
FT                   IIAIDNYHNIISWDTGNTSNVGVHIKFEGLRYDSINKISAGWNLSACYINHIGIVVWYS
FT                   RAPVTKESSEASTMISNANYLVIPNTDNCKIDDFLSGCDFILYIKDGSLMRFNLHTSGY
FT                   ASGSVDRNLVEDPFPVLGFDNWLNNYNIDNNGKASFTKITGCYNSFSIFTNDGMVLLGN
FT                   KALSDEESEEPPIIIPQLQKNHIIHVVIGDYHYMALTDEGDLYSWGTESSRCGCLGLGA
FT                   KDEFVSQNSNNVVTDLGPGKGMVVHNPTLVKSPSPGGKWLAITASGWNSGGIYIPK"
FT   gene            complement(<532058..>532840)
FT                   /locus_tag="DEHA2E06666g"
FT                   /old_locus_tag="DEHA0E07139g"
FT                   /old_locus_tag="DEHA-IPF12367"
FT                   /old_locus_tag="DEHA-CDS4686.1"
FT   CDS_pept        complement(532058..532840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06666g"
FT                   /old_locus_tag="DEHA0E07139g"
FT                   /old_locus_tag="DEHA-IPF12367"
FT                   /old_locus_tag="DEHA-CDS4686.1"
FT                   /product="DEHA2E06666p"
FT                   /note="some similarities with uniprot|P41546 Saccharomyces
FT                   cerevisiae YFL031W HAC1 bZIP transcription factor
FT                   (ATF/CREB1 homolog) that regulates the unfolded protein
FT                   response via UPRE binding and membrane biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87828"
FT                   /db_xref="GOA:Q6BQC2"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC2"
FT                   /protein_id="CAG87828.2"
FT                   /translation="MADIVDNLESANFKSSLPPRKRAKTKEEKEQRRVERILRNRRAAH
FT                   ASREKKRKHVEYLESYVLKLEDNMSRLQSNFDGVCGQMSAKQLAKIDMQEMDDLQDLKD
FT                   KIHTNLNGSLLANEGGDDNLDEELTPPAEQPDTKRRKLSSANSCSSLTTDSTESVEQEQ
FT                   VSSDKVNQIPHIKMEPNSDSNELLSITNENVYYNYLSPISINSPINSPIDLTLKKSSEN
FT                   LPPLSLANNDGDIDSLKVYDPMGQNSEEILLPRSYDHQ"
FT   gene            complement(<533137..>533382)
FT                   /locus_tag="DEHA2E06688g"
FT                   /old_locus_tag="DEHA0E07161g"
FT                   /old_locus_tag="DEHA-IPF12365"
FT                   /old_locus_tag="DEHA-CDS7772.1"
FT   CDS_pept        complement(533137..533382)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06688g"
FT                   /old_locus_tag="DEHA0E07161g"
FT                   /old_locus_tag="DEHA-IPF12365"
FT                   /old_locus_tag="DEHA-CDS7772.1"
FT                   /product="DEHA2E06688p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87829"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC1"
FT                   /protein_id="CAG87829.2"
FT                   /translation="MFAIYSLRQLNISTPTVIPFTSPHVAQQKGSVAIDSTHYVIFSPK
FT                   DLLLKNKNATNSAMCGCCLSLLVMSHGMGSDLPHFV"
FT   gene            <534051..>535019
FT                   /locus_tag="DEHA2E06710g"
FT                   /old_locus_tag="DEHA0E07183g"
FT                   /old_locus_tag="DEHA-IPF12363"
FT                   /old_locus_tag="DEHA-CDS3990.1"
FT   CDS_pept        534051..535019
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06710g"
FT                   /old_locus_tag="DEHA0E07183g"
FT                   /old_locus_tag="DEHA-IPF12363"
FT                   /old_locus_tag="DEHA-CDS3990.1"
FT                   /product="DEHA2E06710p"
FT                   /note="similar to uniprot|P39988 Saccharomyces cerevisiae
FT                   YEL029C BUD16 Protein involved in bud-site selection"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87830"
FT                   /db_xref="GOA:Q6BQC0"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQC0"
FT                   /protein_id="CAG87830.2"
FT                   /translation="MKSVLSIQSHVSHGYVGGRAAIFPLQCQGWEVDSINTVNFSNHTG
FT                   YGSVRGSSINEADLVDIFKGLNNIQVSYDAIITGYIPNASLIAVTNENIKSLKLNNDNL
FT                   LYLLDPVMGDQGFLYVDESCVDEYKKILEDRLVDIITPNQFELELLVGFKVKNESDLNL
FT                   AINHLHSKFNIKYVVISSLTDINKSSEDLIYCAISTMGEEKIQIFSIPVINSYFTGVGD
FT                   LFSALLLDKLYNSFRCHESKSPSLSKAVSQVLTIMSKTLSLTHKLGIESYCKDKNLTNS
FT                   NGDMPVSKVNDDVMKYFELKIIQSKDFFAYDGIGEFKPEYL"
FT   gene            <535226..>536281
FT                   /locus_tag="DEHA2E06732g"
FT                   /old_locus_tag="DEHA0E07205g"
FT                   /old_locus_tag="DEHA-IPF12362"
FT                   /old_locus_tag="DEHA-CDS3656.1"
FT   CDS_pept        535226..536281
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06732g"
FT                   /old_locus_tag="DEHA0E07205g"
FT                   /old_locus_tag="DEHA-IPF12362"
FT                   /old_locus_tag="DEHA-CDS3656.1"
FT                   /product="DEHA2E06732p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87831"
FT                   /db_xref="GOA:Q6BQB9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB9"
FT                   /protein_id="CAG87831.1"
FT                   /translation="MSERKSKVLVVGSGGVGAIGALCLTLNDKADVTLVVRSDYAKVNE
FT                   SGYSIKSVTYGEHENWKPRHIAKSVADASERFGEFDFILLTTKNIPDGPITCEDIIRPA
FT                   VTPRTAIILLQNGLGIEKPMIEQFPHNVILSGVSLIGSSNINCVVSNMHKDQIYLGAWS
FT                   NPNIENHAEKEQCTINEFTRIYSNEKYNRVIIDENVQKTRWEKLVYNSVLNTTTTVVNL
FT                   DINRCQIAGANNELFRPAMREVIAIAASEGIEISPDTIERFIHLGDGLFYSPSMCVDAR
FT                   KKQLFELEVILGNPLKIAEANGVETPMLRTLYTLLTMVQFRIKEERGIIKIDENEYNKI
FT                   NSDSYPDLLKK"
FT   gene            <536702..>537754
FT                   /locus_tag="DEHA2E06754g"
FT                   /old_locus_tag="DEHA0E07227g"
FT                   /old_locus_tag="DEHA-IPF12361"
FT                   /old_locus_tag="DEHA-CDS3669.1"
FT   CDS_pept        536702..537754
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06754g"
FT                   /old_locus_tag="DEHA0E07227g"
FT                   /old_locus_tag="DEHA-IPF12361"
FT                   /old_locus_tag="DEHA-CDS3669.1"
FT                   /product="DEHA2E06754p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87832"
FT                   /db_xref="GOA:Q6BQB8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB8"
FT                   /protein_id="CAG87832.2"
FT                   /translation="MPERKPKVLVVGSGGVGAIGALCLTLNDKADVTLVVRSDYAKVNE
FT                   SGYSIKSVTYGEHENWKPRHIAKSVADASERFGEFDFILLTTKNIPDGPITCEDIIRPA
FT                   VTPRTAIILLQNGLGIEKPMIEQFPHNVILSGVTLLCSTNINCVVCNSLKDQIYLGAWS
FT                   NLNIKNHAEKEQSAINEFTRIYSNEYNKVFIDENVEKTRWEKLLYNAALNSTTTIVNLD
FT                   VSRCQIAGANNELFRPAMREIVAIAASEGVEISPETVEKFIHISDGQFYSPSMCVDARK
FT                   KQLFESEIILGNPIKIAEANGVETPVLKTLYTLLSMVQFRIKEEKGIIKIDENEYRNTN
FT                   SDSYPDILKK"
FT   gene            complement(<537810..>539825)
FT                   /locus_tag="DEHA2E06776g"
FT                   /old_locus_tag="DEHA0E07249g"
FT                   /old_locus_tag="DEHA-IPF12359"
FT                   /old_locus_tag="DEHA-CDS1252.1"
FT   CDS_pept        complement(537810..539825)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06776g"
FT                   /old_locus_tag="DEHA0E07249g"
FT                   /old_locus_tag="DEHA-IPF12359"
FT                   /old_locus_tag="DEHA-CDS1252.1"
FT                   /product="DEHA2E06776p"
FT                   /note="weakly similar to uniprot|P42951 Saccharomyces
FT                   cerevisiae YJL100W LSB6 Phosphatidylinositol 4-kinase that
FT                   binds Las17p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87833"
FT                   /db_xref="GOA:Q6BQB7"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR039756"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB7"
FT                   /protein_id="CAG87833.2"
FT                   /translation="MTKNDDNTENSKNLAENDEISGLQRLKEIQDVNTHKDQSYPPLDS
FT                   NHLQSTSSYDSSIRHYVPNLDSVVDPFSNNISKQSPHDGLKKLASASSQKKLVRSKSQP
FT                   FYSRSSETSLSQLNKFTKSYIIPAAKWAYSPISNGRSKKEDLIPLYKIEYSVFKPLKNI
FT                   RPVQNENEYNFHRQRIIDEDSPELGYPDNYLSKDDFSSLVVGITDLIELDGYKPNRISQ
FT                   GSSGSYFIYNRRVCDGTQEIYKAGIFKPKDEEPYGPLSPKWTKWLHRTFFPCFFGRSCL
FT                   IPNLGYVSEAAASILDQQLLSFIVPHTEIVYLKSSSFYYSYWDRHRAYSKLSPKIGSFQ
FT                   CFLKGYMEAQAWFHHFPIPNEITGLPDECEILVEHNENNLDSNFKWNKKTLQQFREELE
FT                   KLVILDYIMRNTDRGLDNWMIKIQWIETKRDKSYKKMTPIIKIGAIDSGLAFPWKHPDE
FT                   WRSFPFGWLFLPLSIIGHPFSMNTRNLYLPLLTSIMWWETTVKKLKDVFMQDTDFKERM
FT                   WKKQLSVLKGQAFNVVEVLKLSHAGPLELTRRETVLIRDDEMNIPVSVDSDIMINAMET
FT                   SIYDLNNKPSKITIVPKFNNLNDLEPNESSLLLPDNSSIHSTKSEPQFSMSGFEYNLNF
FT                   NGEQRNDSEEGETNTKKVVIERLEKVKNKPPVFTWC"
FT   gene            complement(<540140..>541360)
FT                   /locus_tag="DEHA2E06798g"
FT                   /old_locus_tag="DEHA0E07271g"
FT                   /old_locus_tag="DEHA-IPF12358"
FT                   /old_locus_tag="DEHA-CDS3117.1"
FT   CDS_pept        complement(540140..541360)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06798g"
FT                   /old_locus_tag="DEHA0E07271g"
FT                   /old_locus_tag="DEHA-IPF12358"
FT                   /old_locus_tag="DEHA-CDS3117.1"
FT                   /product="DEHA2E06798p"
FT                   /note="similar to CA0380|IPF14109 Candida albicans
FT                   IPF14109"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB6"
FT                   /protein_id="CAG87834.2"
FT                   /translation="MRLYTLLSLCCMFAAFVSALPYASPVEDSEFDMGLYLEDLIEENG
FT                   LQEYFDGFYQNDGIHKRDEQSIEKILLLVNKSGIIWEALDAVAGHPSRIQFLANQTAKL
FT                   LNSSGSSLDLTSGLNTTQLFNIVKASGLLTSVLDGILLDDDYRSVLTDLIERVVRPNMF
FT                   IISYLIHDVFQKSSIQKRAEYSGSFASFAENTLATVLGSKIFTNTFADIVNALNDTGVA
FT                   VYTIKRFIADESYQNMTAALVKEIYDTGAIKLSGSLNITALVSTAVSNPKTITDLIGKV
FT                   LSGDLNFGSSLGKYSGAVKKIIKDLENDGLFAELNEEVFPSSSTKASSTKAASQTKKEK
FT                   ILATSTSKTSSKKATSLYMYGNNKENSPTSSSDSGSISLQQNSNIPIVKCLIYLQTLIF
FT                   GGALLLI"
FT   gene            <542190..>543212
FT                   /locus_tag="DEHA2E06820g"
FT                   /old_locus_tag="DEHA0E07293g"
FT                   /old_locus_tag="DEHA-IPF12356"
FT                   /old_locus_tag="DEHA-CDS3786.1"
FT   CDS_pept        542190..543212
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06820g"
FT                   /old_locus_tag="DEHA0E07293g"
FT                   /old_locus_tag="DEHA-IPF12356"
FT                   /old_locus_tag="DEHA-CDS3786.1"
FT                   /product="DEHA2E06820p"
FT                   /note="similar to CA0046|IPF14850 Candida albicans
FT                   IPF14850"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87835"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB5"
FT                   /protein_id="CAG87835.2"
FT                   /translation="MRLSRIILTCIPFISGLTKAIASNSDVYQVDTKEERSLEDIYEDL
FT                   VSIVDSHVDKRSDSSRVEQLEKILLQVNESGIIMDVLNEIAGSKAQQNTLVNMTTDMIN
FT                   NGGGSFDGIQIDLNTTNILNAVKKSGIINSTLDGLLLNDENREILGDRTGHVLSKYAYV
FT                   SKILADIGNGQKPTVEYIANTVKHFKTKNPKYQYMNEGKQVVLSARDDEYSGSAQAFLN
FT                   NLINTVVSSDLVSGSAEDFLIALNRTGIAVSIAMEVVKTPKITEMGTYIIGQLYANGVF
FT                   DNLDTNKYFQDAKKKNILSDGAQTVLTDPTYSPALAKLFQQMENNGVFADIQKNLYGHT
FT                   "
FT   gene            complement(<543499..>546303)
FT                   /locus_tag="DEHA2E06842g"
FT                   /old_locus_tag="DEHA0E07315g"
FT                   /old_locus_tag="DEHA-IPF12355"
FT                   /old_locus_tag="DEHA-CDS0541.1"
FT   CDS_pept        complement(543499..546303)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06842g"
FT                   /old_locus_tag="DEHA0E07315g"
FT                   /old_locus_tag="DEHA-IPF12355"
FT                   /old_locus_tag="DEHA-CDS0541.1"
FT                   /product="DEHA2E06842p"
FT                   /note="similar to uniprot|P25360 Saccharomyces cerevisiae
FT                   YCR037C PHO87 Low-affinity inorganic phosphate (Pi)
FT                   transporter involved in activation of PHO pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87836"
FT                   /db_xref="GOA:Q6BQB4"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB4"
FT                   /protein_id="CAG87836.2"
FT                   /translation="MKFSHSLKFNAVPEWADSYINYTGLKKAIYKLQQDQLNNQPQDGS
FT                   IEINSVNPATVTDLVNESKVQAPKNKAENGSSDKKFSSRLISRFRKHGPDVDDDEKAVG
FT                   SSTVDARLGNYNGSKDEKSQSIESFTVDLDNSTIVTFDEEKTKYNDQKSSNFDPLKVFT
FT                   KQLLIELSKINEFYLSKESVVFQDYDNLVRDLESNHINIDELFKTTQAYQHEFGPIEHS
FT                   SKEPVSRVASLNYADYENHGFEKPNGGVVEVERYSDDDDDDDDDDDDDTHSQNSALLNH
FT                   TDFNVKQQKRITLKKKSISLFIALSELKSYIELNKIGFTKITKKFDKTCNYAIKIDFIE
FT                   NFLPTTTKTFTPETLKSVDHKINKIIIIYSLLSGNLSTKTTKQDLENIRVELRSHLREH
FT                   IVWERNTVWKDLLSLEKKSYNLHLDNEATRSNKMGDEGSINLMHLNWTRLNFPFGWSIF
FT                   GHTSMIVPSCLLTWQIVKLIVIITTFVVLMCVKTFNDLEQQRCLAVLVASAMLWASEAL
FT                   PLHITAMLVPLLVVTCKVLKNEDDGKPMSGPDASKYILSTMWSSVIMLLMGGFTLAAAL
FT                   SKYNIAKVISSYILAVAGTKPRNVLISIMSVSLFLSMWISNVAAPVLCYSLIQPVLRTL
FT                   PTESPFAQALVLGIALASNVAGMASPIASPQNMVAIESMNPNPGWGKWFAVALPVSIIA
FT                   MVGIWVELILTFKINTVKIMAYKPIKEKFTTKQIYISLVTIGTIILWCVLSELEGVFGE
FT                   SGIISIIPIVLFFGTGLLQKEDLNNFPWSIILLAMGGLSLGKAVSSSGLLKTIATALQH
FT                   QIKDFNVFVILIIFGILILVVATFVSHTVAALIIVPLVKEVGEKLPEPHPLILVMGTAL
FT                   IASAAMGLPTSGFPNVTAIGMTDEVGKPYITVNTFITRGVPASIIAYLCVVTIGYGIMN
FT                   ALSF"
FT   gene            <547134..>550007
FT                   /locus_tag="DEHA2E06864g"
FT                   /old_locus_tag="DEHA0E07337g"
FT                   /old_locus_tag="DEHA-IPF12352"
FT                   /old_locus_tag="DEHA-CDS0508.1"
FT   CDS_pept        547134..550007
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06864g"
FT                   /old_locus_tag="DEHA0E07337g"
FT                   /old_locus_tag="DEHA-IPF12352"
FT                   /old_locus_tag="DEHA-CDS0508.1"
FT                   /product="DEHA2E06864p"
FT                   /note="similar to uniprot|P38149 Saccharomyces cerevisiae
FT                   YBR281C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87837"
FT                   /db_xref="GOA:Q6BQB3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB3"
FT                   /protein_id="CAG87837.2"
FT                   /translation="MAFNGNIHEAEYVPIPARVRLPINSTSESSVSTPARIPTPVKSPN
FT                   LTVANLSSDNSTNVPVDRFPNLIHKWSHTHSILCVVPSPKRNLIFCGTQNSKILVFDIV
FT                   NYSLKYEIKCGNSDHSASILCLTIDESEDYLFSAGSDSLIKVWDLSMVNDNTNYPIHCT
FT                   HIIYSLVDIGDVFSICWSDALSTLFIGAQNASILWCKLYLYSSTISDSQSTIDRMPHFR
FT                   YDKFFDSKGPGGSINNLQSKHQILKSTSLETSNSVSPKLIEVNNDDIIRFAHNGYVYCM
FT                   NYFNVEDTSNDFTKNYPTQFANLLITGGGDGLVIIWGVSCTNKKVSLQKLKILKNNESV
FT                   LSMSIQDSYLYVGLSEPCINVWDLMTFQLIRSIHFSNSQQVKNNYDEVLSLGIYNDCIF
FT                   KASNLGGLIKFSLKTDPPNMVPSDHGNLNPDRSSMVVITEEDDKYNAEFNKSSVENGSV
FT                   LAVKIFTSTTGVTYLVSGGHKALCLWDITNLGSTNRHLSDANSLSSNLVDNENLLKSLK
FT                   RFISYKTISKFPALYLEDSRRCSQFLTNLLVNLGATVTKLLPVPNSNPVVYSCFSSNSP
FT                   DRPKQAKRILWYGHYDVVDATADSNSWSTDPFCLTARDGNLYARGVSDNKGPILAAIYA
FT                   VSELFHNKELSCDVVFIIEGEEECGSIGFQDVIHENKELIGDIDWIMLSNSYWLDDETP
FT                   CLNYGLRGVINASITINSDKPDRHSGVDGGVSKEPTMDLIQILGQLMNPFNNNIKIPNF
FT                   YDDVLSLTDREIEIYQKIENTASTKNIKNQDFKSLMAKWRNPSLTIHNIQVSGPNNNTV
FT                   IPQSAKASVSIRIVPNQDLEKIKKSLIKTLNDSFNKLETDNHLLINIFHEAEPWLGDPY
FT                   NLVYKILYDKIRSNWGPEVPEPLFIREGGTIPSIRFLEKCFNACAAQIPCGQASDNAHL
FT                   KDEKLRILNLFKLRDILADTLKELGSK"
FT   gene            complement(<551749..>553944)
FT                   /locus_tag="DEHA2E06886g"
FT                   /old_locus_tag="DEHA0E07381g"
FT                   /old_locus_tag="DEHA-IPF12349"
FT                   /old_locus_tag="DEHA-CDS1024.1"
FT   CDS_pept        complement(551749..553944)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06886g"
FT                   /old_locus_tag="DEHA0E07381g"
FT                   /old_locus_tag="DEHA-IPF12349"
FT                   /old_locus_tag="DEHA-CDS1024.1"
FT                   /product="DEHA2E06886p"
FT                   /note="weakly similar to CA1872|IPF6700 Candida albicans
FT                   IPF6700"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87839"
FT                   /db_xref="GOA:Q6BQB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB1"
FT                   /protein_id="CAG87839.2"
FT                   /translation="MVNVTPSSWNAPKNNNRQHKMIKEENTNLPSPSKSLQGTQIPRDS
FT                   INSSESIHSIKVEYESISDVLVENKGIARTENIKTKSGGIGSFLKPKFLKSRSSLNSSG
FT                   SNENIVRSEPNFTTKQRQSTIEDFADTSSEEQNSKQYVYDAESINSILEEYGTRNSLNL
FT                   SPTKKNDFIFKEEFNDSWESNRSILSSMNRSNSARNSGANTPVILSNAPQARRNNRTSV
FT                   IERTLGNRLSQSSSGSSSLPGAFYDCSKGSNGTNSDSSGSSKFKIYTDKQNEGQTDNRR
FT                   KVDRRNIISTSSNVDVFNRSSFSNLTTISNIDFNMTDDNKYPASKSTNANAHRQSKRQS
FT                   DNRFLFDVSNNILEAEFDENADSNISERVLQPKDRTSIFSDRFPNTSSINMDETAIKNT
FT                   TRDITRSSMSTNELLYKLETFYNTDNDNNTQESIPNSQTRSKEINKNFYDLTAGIDSKT
FT                   NLPVMLYKVQDKQYLERNNRWSIDDKLQKDIRSNRSPVSSQQNRSPNVIPKSFAGSSMS
FT                   ILEPSKSRLGQYASKASISSSGQGVSLNSDASQIYGSKKHSHNNLHEKSPPLIFNPSAS
FT                   PDTQSHGSITSLTANNYLHDTLSKNNSHEHMLNNSPTTNYNAIDSSYDDLEKNLKPILD
FT                   QVPHNTHSWPLFILIMIIGLVVPPIYILLAVGFFDNNNTSNSQYNLHSTYLVVNPNQNK
FT                   RFSKTQKLVSFFIGLLWLCIILAMIGVGLGVGLTRES"
FT   gene            complement(<554385..>555431)
FT                   /locus_tag="DEHA2E06908g"
FT                   /old_locus_tag="DEHA0E07403g"
FT                   /old_locus_tag="DEHA-IPF12346"
FT                   /old_locus_tag="DEHA-CDS3688.1"
FT   CDS_pept        complement(554385..555431)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06908g"
FT                   /old_locus_tag="DEHA0E07403g"
FT                   /old_locus_tag="DEHA-IPF12346"
FT                   /old_locus_tag="DEHA-CDS3688.1"
FT                   /product="DEHA2E06908p"
FT                   /note="similar to CA1873|IPF6696 Candida albicans IPF6696"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87840"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQB0"
FT                   /protein_id="CAG87840.1"
FT                   /translation="MKVSTTTLATVIACTTAVSAAPATYESSVQKRADIDQLAEALREL
FT                   QSFNEKRDTLSTHLEKREYEIVTKVLASLNDTGMAPKVIHYLATNEKLQPVVVKTLVAV
FT                   IKAGAMNLTGLFKALDESNLVTKVVNDLISDCQLYVSLFDVAKKIIANLEKKVESLVKE
FT                   GISKLSQRDLEVIQHQKRSSSQLQPAAEFDKRDLNDVVVNLLDSLGESGLASSVVKSIA
FT                   TDPSYLPFAIDLVKEVMASGALSVSQLISAVKGSNLVGNLLEQILTVDTFKTVATNAFA
FT                   AFFGDCPGATSVISVDGATSTSSSGSSGSDSNSGSGSGSGSSSGSTSGKGTTANPCKKK
FT                   RRRRSYNY"
FT   gene            complement(<556383..>557510)
FT                   /locus_tag="DEHA2E06930g"
FT                   /old_locus_tag="DEHA0E07425g"
FT                   /old_locus_tag="DEHA-IPF12345"
FT                   /old_locus_tag="DEHA-CDS3377.1"
FT   CDS_pept        complement(556383..557510)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06930g"
FT                   /old_locus_tag="DEHA0E07425g"
FT                   /old_locus_tag="DEHA-IPF12345"
FT                   /old_locus_tag="DEHA-CDS3377.1"
FT                   /product="DEHA2E06930p"
FT                   /note="similar to CA2892|IPF6688 Candida albicans IPF6688"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87841"
FT                   /db_xref="GOA:Q6BQA9"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="InterPro:IPR041913"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA9"
FT                   /protein_id="CAG87841.2"
FT                   /translation="MDASSEQVEYLSSILLKHNTPVTYHTLARELKIHQNNAKNVLHEF
FT                   YAANGDKISASFIITGKSESGTLIKLCKDESSLESDIKLFEDIHSIHVYSLQTKESHMG
FT                   NENIVLEELKYKVDHMNNDEYYSLGMIRGPGLVVVDAKSVPAKAPNTTVKSDAAPADST
FT                   NETSNKPPKSAGLTSGYVSRKANNDNRSSDRSKTDSITNYTSRKSEAANKPSKRSSTAP
FT                   TSGYQYKSRKLEKQQPKERVVISNEGEQDHVEEELPEKRENKKNISDLNNLFIDDFSDE
FT                   SDKEANNDEKEEPVIINENEPESKEPISKETESKTPEVTSKKTPTPTTRTEIKTEPDAV
FT                   DGDGYLTSFKSNNPVKNKHDKKKTQSSLMNFFKPK"
FT   gene            complement(<557729..>558811)
FT                   /locus_tag="DEHA2E06952g"
FT                   /old_locus_tag="DEHA0E07447g"
FT                   /old_locus_tag="DEHA-IPF12342"
FT                   /old_locus_tag="DEHA-CDS3566.1"
FT   CDS_pept        complement(557729..558811)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06952g"
FT                   /old_locus_tag="DEHA0E07447g"
FT                   /old_locus_tag="DEHA-IPF12342"
FT                   /old_locus_tag="DEHA-CDS3566.1"
FT                   /product="DEHA2E06952p"
FT                   /note="similar to uniprot|Q873I9 Neurospora crassa B9B11
FT                   Related to pirin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87842"
FT                   /db_xref="GOA:Q6BQA8"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA8"
FT                   /protein_id="CAG87842.1"
FT                   /translation="MNTNFFKWVLVLFFLSSYFTIGFQISEKQMSLRTVRTILAAFEQA
FT                   EGVGAKVRRSIGTMNMRKFNPFLMLDDFSVSAPAGFPEHPHLGQETITLILKGAVAHED
FT                   FTGSKGVLYPGDLQFMTAGKGVVHSEMPVPQPDGSPTVGMQLWVDLPESLKECKPRYRD
FT                   LKSYEIPEAVEQDGKLRIKVISGKAYGVESLKDLAYTPVQYYYYTMKPGATFKQEMPKD
FT                   FNFFLYVREGNTLVVNGDTKVEKHHNCFFNMDGDGITGENPASSTEDVEFVLVGGKTLN
FT                   QEVFQYGPFVATSEHRIQQAFSDYRSARNGFDNLRTWDSLISGGVTDDMVCGELKGSLD
FT                   DREKERLAYLHNKESKKDEL"
FT   gene            complement(<559011..>559895)
FT                   /locus_tag="DEHA2E06974g"
FT                   /old_locus_tag="DEHA0E07469g"
FT                   /old_locus_tag="DEHA-IPF12341"
FT                   /old_locus_tag="DEHA-CDS4294.1"
FT   CDS_pept        complement(559011..559895)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06974g"
FT                   /old_locus_tag="DEHA0E07469g"
FT                   /old_locus_tag="DEHA-IPF12341"
FT                   /old_locus_tag="DEHA-CDS4294.1"
FT                   /product="DEHA2E06974p"
FT                   /note="similar to uniprot|P32643 Saccharomyces cerevisiae
FT                   YER175C TMT1 Trans-aconitate methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87843"
FT                   /db_xref="GOA:Q6BQA7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA7"
FT                   /protein_id="CAG87843.2"
FT                   /translation="MSTYSESNFNTTHYNSARPSYPDEFYNTLIEYHDSTNSAHELALD
FT                   IGCGSGFVAFKLIDFFEKVIGTDISSTMVNQCRKTAKPGKNIQFLVGSAEQAPPEIQEN
FT                   SVDLITGAECCHWVDHEKFFKESFRILKPGGTLAYWFYKDPIFIGHDKANEIYTNYTYN
FT                   SSMEMNKDDTFERYMGPYYQQPGHDYLRTLMKEIEVPTKYYKNVVRHEYDPVHHGADST
FT                   KTTLYISKKITLPAFLNYVKSWSAYHTWMTEHGSKYDIAEAFVNELKEAMNWDDTFEFE
FT                   VVWATVYTFAKKK"
FT   gene            complement(<560266..>561276)
FT                   /locus_tag="DEHA2E06996g"
FT                   /old_locus_tag="IPF_12339"
FT   CDS_pept        complement(560266..561276)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E06996g"
FT                   /old_locus_tag="IPF_12339"
FT                   /product="DEHA2E06996p"
FT                   /note="similar to uniprot|P38992 Saccharomyces cerevisiae
FT                   YDR297W SUR2 Sphingosine hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87844"
FT                   /db_xref="GOA:Q6BQA6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA6"
FT                   /protein_id="CAG87844.1"
FT                   /translation="MNSIPINFMPPENFSNVMWQSYEPVVSLSLKKNLIAGIPDGVLAL
FT                   VAPIIAYWGYATVFHIIDVYELAEKYRIHPSEEEEARNKATLKDVVKDVVIQHIIQTVV
FT                   GGTFFLFDPPQTTGHEWMIMWNLRQKYVPLFVPDNVVWVGYMYGWTFLRICIAIGIIDT
FT                   WQYWLHRIMHINKTLYRKFHSRHHRLYVPYAYGALYNDPVEGFLLDTLGTGIATIVTNL
FT                   SHRESIILFTFATLKTVDDHCGYRLPFDIFQIIFPNNSLYHDIHHQTWGVKNNFSQPFF
FT                   TFWDKLNKTDYKFVNEYKSMQDHITLTKYREFLANKQRKPNKKPVNTEPEKKKDI"
FT   gene            <561880..>562537
FT                   /locus_tag="DEHA2E07018g"
FT                   /old_locus_tag="DEHA0E07513g"
FT   CDS_pept        join(561880..561939,562019..562537)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07018g"
FT                   /old_locus_tag="DEHA0E07513g"
FT                   /product="DEHA2E07018p"
FT                   /note="highly similar to uniprot|P36149 Saccharomyces
FT                   cerevisiae YKR068C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87845"
FT                   /db_xref="GOA:Q6BQA5"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR016721"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA5"
FT                   /protein_id="CAG87845.2"
FT                   /translation="MSKASRFSSDDIWKNNVEKINSELFTLTYGSVVSQLCRDYNNNYQ
FT                   EVNQQLDRMGYNIGLRLIEEFVAKTGAQRCQTFKETAEIISKVGFKIFLNIQPVVTNWS
FT                   QDGKSFSLILVDNPLAEFVELPVTNDNKINKELWYSQILCGVLRGALQMVQLDVDVWFV
FT                   KDALRGDEQTELRLKLNKILKDEVPAGED"
FT   gene            <562741..>564903
FT                   /locus_tag="DEHA2E07040g"
FT                   /old_locus_tag="DEHA0E07535g"
FT                   /old_locus_tag="DEHA-IPF12332"
FT                   /old_locus_tag="DEHA-CDS1069.1"
FT   CDS_pept        562741..564903
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07040g"
FT                   /old_locus_tag="DEHA0E07535g"
FT                   /old_locus_tag="DEHA-IPF12332"
FT                   /old_locus_tag="DEHA-CDS1069.1"
FT                   /product="DEHA2E07040p"
FT                   /note="similar to uniprot|P32784 Saccharomyces cerevisiae
FT                   YBL011W SCT1 High copy suppressor of choline-transport
FT                   mutants"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87846"
FT                   /db_xref="GOA:Q6BQA4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA4"
FT                   /protein_id="CAG87846.2"
FT                   /translation="MDTTNKDPEKKEDENGTRKTVEVENGLLTRILTIISYDLVLWFFS
FT                   AVIHTFFREVKSRGTFNIPKKGAIVFVIAPHANQFIDPIVVMSSVKQYSRRRIAFLVAA
FT                   KSYRRKFIGTGAKFTGAIPVERAQDLLRKGTGTIKLQDLEDGTIVEGEGTLFTKECMKK
FT                   GLIGLPESLGNAVIESIESDTKLTLRKTFQINVSDPKEADKRRIQRLTEGTPFKVAPHV
FT                   DNNCVFQHVFDHLNGGNVLGMFPEGGSHDRPDLLPLKPGVAIMALGAAAKSEDPDAVIN
FT                   VIPVGMNYFHPHKFRSRAVIEFGKPIKVDKKLGKKYEENPKDSVAKLIDVITLGLKEVT
FT                   VTCGDYDTLMALQAARRLYTSSNRESIPLPLVVEMNRRLVKGYQKYSNDPDVIEMKTLV
FT                   SNYNKKLMRMGLHDHQVESLTETNRIHTFVTFAARLFKVFLFLGLSMPGIFLFSPVFIV
FT                   GRRIARKKAKEALAGSVVKIKANDVLGTWKILVALVLAPSLYIFYSIIGTFLIIKSNIT
FT                   KDKVPTVIIFLVCYGWSVLTTYASLRIGEIGVDYYKSLKPLFYSLLSHHKDIIQIEDLK
FT                   RNRTLLAEKVTEFCNSYGPSMFEDFDRFYRQYNNIESSEYVNESESDIENVPVSNTVNR
FT                   PSMSLLRSASFNINNLADVPIFSIPGFSDLQSDVGDDGSKGEHESDESSSFDTSDIEAS
FT                   DVGDLQKSKLRLRNAMKSKFNAENNP"
FT   gene            <565501..>565782
FT                   /locus_tag="DEHA2E07062g"
FT                   /old_locus_tag="IPF_12329"
FT   CDS_pept        565501..565782
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07062g"
FT                   /old_locus_tag="IPF_12329"
FT                   /product="DEHA2E07062p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65776"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW4"
FT                   /protein_id="CAR65776.1"
FT                   /translation="MLLIICFFMAVVLGTPVPANLQFKATRFVPSNTFSTIVPTYTPAY
FT                   APTAEKPKDVKIMFNNQDMVDAASVESRRTYNNPSEGPSSEHNHYALL"
FT   gene            <566273..>566821
FT                   /locus_tag="DEHA2E07084g"
FT                   /old_locus_tag="DEHA0E07579g"
FT                   /old_locus_tag="DEHA-IPF12326"
FT                   /old_locus_tag="DEHA-CDS5568.1"
FT   CDS_pept        566273..566821
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07084g"
FT                   /old_locus_tag="DEHA0E07579g"
FT                   /old_locus_tag="DEHA-IPF12326"
FT                   /old_locus_tag="DEHA-CDS5568.1"
FT                   /product="DEHA2E07084p"
FT                   /note="weakly similar to uniprot|Q08422 Saccharomyces
FT                   cerevisiae YOR052C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87848"
FT                   /db_xref="GOA:Q6BQA2"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQA2"
FT                   /protein_id="CAG87848.1"
FT                   /translation="MKVTIRSSTEISYSVTIPDNSTVEDLRNSAKVACPPSGKIPEDFK
FT                   LIYNGEKLTPNYKTLEMFGIVAGAEDIVVILMSDGSDTPKSTSPIASPALQPVSPATGG
FT                   ASCAPAKKKTKKNRCSFKNCSAAPLRMVGNCSHCQGKFCAKHRLLEDHLCQGLQFCKDN
FT                   AHEKNAMKLQNEKTITSKV"
FT   gene            complement(<567133..>568464)
FT                   /locus_tag="DEHA2E07106g"
FT                   /old_locus_tag="IPF_12324"
FT   CDS_pept        complement(567133..568464)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07106g"
FT                   /old_locus_tag="IPF_12324"
FT                   /product="DEHA2E07106p"
FT                   /note="similar to uniprot|Q6Q5I2 Saccharomyces cerevisiae
FT                   YOR051C Nuclear protein that inhibits replication of Brome
FT                   mosaic virus in S. cerevisiae which is a model system for
FT                   studying replication of positive-strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65777"
FT                   /db_xref="GOA:B5RTW5"
FT                   /db_xref="InterPro:IPR024318"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RTW5"
FT                   /protein_id="CAR65777.1"
FT                   /translation="MAPKRHLGLGKAAKSKKQKKDDSSEVENPVQQSNELTVELNEEVD
FT                   ANDEVSQLRALWKTHAKSDKDNELVVNGIIHECDRLLRNSNLAENEDGEDKNKASTNED
FT                   GPKELPADFHSIYALALADLALFHSTDVNKVKEFFDAALERVDLGLQSHTGSIELLFTK
FT                   SRILINQIPLQYISQLTVESKVQDGVPKIDEKLDAALKIYEEAENQAKALKQYELFNED
FT                   NLEILQAFDDLLEIVDNFGKDNSEGDESDKEDDGDYEEEIQLSKKHPLYGIRNTDKYNE
FT                   WWRDHTIQFLQNVDQQLEKLGISYKQENETENALLPLRREICKRIGQSYLQEAEIPSTV
FT                   FTTLKYDEGFADVDQLEGLTRDESQKISQYLFKTALDYLKMAEDKEEPESWVNIAESMI
FT                   SLGNLYELDSEEQENYYTEAEKILTKANNATNGKYEDILENLQT"
FT   gene            <568682..>570397
FT                   /locus_tag="DEHA2E07128g"
FT                   /old_locus_tag="IPF_12323"
FT   CDS_pept        568682..570397
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07128g"
FT                   /old_locus_tag="IPF_12323"
FT                   /product="DEHA2E07128p"
FT                   /note="similar to uniprot|P36150 Saccharomyces cerevisiae
FT                   YKR069W MET1 S-adenosyl-L-methionine uroporphyrinogen III
FT                   transmethylase involved in sulfate assimilation methionine
FT                   metabolism and siroheme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65778"
FT                   /db_xref="GOA:B5RTW6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW6"
FT                   /protein_id="CAR65778.1"
FT                   /translation="MTNLLASLKCSDDIHLIIGASNVASLRINSILEAGAKPILISNQP
FT                   SEKFPKSIQDNIAKGNLKHIEKEYENGDLSSLGRSEVDNIVDRVFVTLPISQYEVKKEI
FT                   YQSCRKLRIPVNVSDSPEFCTFSLLSTFTSGDFQMGVSTSGKGCKLAARIKRELSHTLP
FT                   GNIGSICDKIGDLRTRIQEEDKLELEKLQGDIDWIGEHDDDAITTSKLNSLVEEFNMTK
FT                   EQRKLQRTRWLSQIVEYFPLTTLADLSLEDLSVAYKEYNSIVKTEAEPKEPSHKKLKTG
FT                   KKGSISLVGSGPGSISLLTLGALQEIHSADLILADKLVPQQVLDLIPKHRTKLFIARKF
FT                   PGNAERAQKELLDMGLESLMKNEKVVRLKQGDPYIFGRGGEEFNFFAEHGFTPLVLPGI
FT                   TSALAAPVLTNIPATHRDVADQVLICTGTGRRGTLPNLPEFIKSRTTVFLMALHRVVDL
FT                   IPKLIDDKNWDPNLPAAIIERASCPDQRIVRTTLSNVAQAVEACGSRPPGLLVTGYACE
FT                   VITKPNTDEKWVIEEGCASASNPLLEPFLQLARSIGKDHSHVSQPQTISLEQTA"
FT   gene            <571048..>572205
FT                   /locus_tag="DEHA2E07150g"
FT                   /old_locus_tag="DEHA0E07645g"
FT                   /old_locus_tag="DEHA-IPF12321"
FT                   /old_locus_tag="DEHA-CDS3306.1"
FT   CDS_pept        571048..572205
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07150g"
FT                   /old_locus_tag="DEHA0E07645g"
FT                   /old_locus_tag="DEHA-IPF12321"
FT                   /old_locus_tag="DEHA-CDS3306.1"
FT                   /product="DEHA2E07150p"
FT                   /note="similar to uniprot|P36151 Saccharomyces cerevisiae
FT                   YKR070W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87851"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ99"
FT                   /protein_id="CAG87851.1"
FT                   /translation="MLLTRHPINVVRPLGHYLRCSTRRFSKVSDIAFVFDIDGVLLRGS
FT                   KTLPTAKPALELLNEHKVPFILLTNGGGVTESARANFLSSAIGVPISPLQIVQSHTPMK
FT                   AFAHNNQFDRVLVVGGDKDNARECANEYGFKDVIMPIDIVNADPSISAHHRIAAEEFKY
FT                   ALSPEKLNIEKPVSAILVFNDARDMGTDTQIILDLLNSENGVIGTKRSITSINDKHKPS
FT                   IPIVFSNNDFLWANDYKLPRFGQGALRIMIEALYKEVNGLKENEKLQSEILGKPFPIQY
FT                   DFAHNVLIDWNTKMAENNTNDLNQLLPKLNEKPTNSPFRKIYMIGDNPASDIMGANVNG
FT                   WESLLLRTGVYKDADWDTIVAKPSAGVHDDVLESIRFALRENSVM"
FT   gene            complement(<572613..>573479)
FT                   /locus_tag="DEHA2E07172g"
FT                   /old_locus_tag="DEHA0E07667g"
FT                   /old_locus_tag="DEHA-IPF12320"
FT                   /old_locus_tag="DEHA-CDS4369.1"
FT   CDS_pept        complement(572613..573479)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07172g"
FT                   /old_locus_tag="DEHA0E07667g"
FT                   /old_locus_tag="DEHA-IPF12320"
FT                   /old_locus_tag="DEHA-CDS4369.1"
FT                   /product="DEHA2E07172p"
FT                   /note="weakly similar to uniprot|P40209 Saccharomyces
FT                   cerevisiae YMR136W GAT2 Protein containing GATA family zinc
FT                   finger motifs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87852"
FT                   /db_xref="GOA:Q6BQ98"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ98"
FT                   /protein_id="CAG87852.2"
FT                   /translation="MGSFDTNTSAKPRISTNDGERPRSNVKLPSIHELTSNSSIDGRGH
FT                   SSISPRVSHGNIHHQGMGNDTLDRYRYPINPSIPGYYTGSESRGSIGPSPIETHINPIN
FT                   KILPTPATSYSDKPPQTQYRYYQSPPALSYPHHIVYPPQQAVYYPQYAPPVPTVSGSNP
FT                   FVAPEVINKTNNVCQRCGTTETPEWRRGPGGVKTLCNACGLFHAKLVKRKGAALAAEEV
FT                   LNNKVCKGKNGRRISIKKNFIDDDRLNSGLFPSPAAPANTTKNTTKHVGELPPPATSSV
FT                   SPALIRH"
FT   gene            complement(<573737..>574021)
FT                   /locus_tag="DEHA2E07194g"
FT                   /old_locus_tag="DEHA0E07689g"
FT                   /old_locus_tag="DEHA-IPF12319"
FT                   /old_locus_tag="DEHA-CDS7455.1"
FT   CDS_pept        complement(573737..574021)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07194g"
FT                   /old_locus_tag="DEHA0E07689g"
FT                   /old_locus_tag="DEHA-IPF12319"
FT                   /old_locus_tag="DEHA-CDS7455.1"
FT                   /product="DEHA2E07194p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87853"
FT                   /db_xref="GOA:Q6BQ97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ97"
FT                   /protein_id="CAG87853.2"
FT                   /translation="MQAATSIQARENNVYMKVWRYRHRIEHYGSAGGHRKGTRLGERAW
FT                   AYGQVFLAWIFIYISESYIRGISYVSAYPLEISCNNKLNQATRFCALKE"
FT   gene            <577023..>577094
FT                   /locus_tag="DEHA2E07216r"
FT                   /old_locus_tag="Deha0E.7"
FT   tRNA            577023..577094
FT                   /locus_tag="DEHA2E07216r"
FT                   /old_locus_tag="Deha0E.7"
FT                   /note="tRNA His (GTG) cove score=61.27"
FT   gene            <578291..>578642
FT                   /locus_tag="DEHA2E07238g"
FT   CDS_pept        join(578291..578318,578416..578642)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07238g"
FT                   /product="DEHA2E07238p"
FT                   /note="similar to C. albicans fungus|CA0668|IPF18910.3f"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65779"
FT                   /db_xref="GOA:B5RTW7"
FT                   /db_xref="InterPro:IPR008698"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW7"
FT                   /protein_id="CAR65779.1"
FT                   /translation="MTVTEFPPLLSEEDLQKYKVPLRWRDRCAANFALYHICLKRQSAN
FT                   SSVDCKHDKHVWEECENLDFIRRQKELEQAKEKRRSELQ"
FT   gene            <579371..>580681
FT                   /locus_tag="DEHA2E07260g"
FT                   /old_locus_tag="DEHA0E07755g"
FT                   /old_locus_tag="DEHA-IPF12312"
FT                   /old_locus_tag="DEHA-CDS2852.1"
FT   CDS_pept        579371..580681
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07260g"
FT                   /old_locus_tag="DEHA0E07755g"
FT                   /old_locus_tag="DEHA-IPF12312"
FT                   /old_locus_tag="DEHA-CDS2852.1"
FT                   /product="DEHA2E07260p"
FT                   /note="weakly similar to uniprot|Q08412 Saccharomyces
FT                   cerevisiae YOR042W CUE5 Protein containing a CUE domain
FT                   that binds ubiquitin which may facilitate intramolecular
FT                   monoubiquitination"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87856"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR041807"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ94"
FT                   /protein_id="CAG87856.1"
FT                   /translation="MTKKNNKSTGDTLNVVSSEPIDSIEETGKNSKDSEEIETGAKAEA
FT                   DEKESDETNANVTKSSDIEEKSKDVTDVTDNKEQNTTVADKKSEANATDKEDSVASAVD
FT                   KKEVGVEKKEYAADQKVDASANTDAEQGGKTDSKGTEAEEEAPAPPPRPVSPLTQIKQD
FT                   LKDAFPNVEEKLVTAVLIASQGNPDPAFNALLYISDPSVEAEIPEPAPPVPSKQVNRPK
FT                   NTLTDDELLARKLQKEFELEDKRRRAQHHDRERRRRRHQSQPEDLEDDSVDEFGQIKES
FT                   FSQGFEEARTTLNGWVSGIAKKFQEPTDDAIQSKEPQSQNPKLFGALGGSSFTKQNKKN
FT                   TFDEDPRIISNDLHSEINLKDNDEDEQDAPTLPKRQRDQVNKEKSAQSDSYMDSNKKWQ
FT                   SLNSDVPVNSDAFLVTDSEDEDTGVTTYDTKKTKQSS"
FT   gene            <581000..>581380
FT                   /locus_tag="DEHA2E07282g"
FT                   /old_locus_tag="DEHA0E07777g"
FT                   /old_locus_tag="DEHA-IPF12309"
FT                   /old_locus_tag="DEHA-CDS6546.1"
FT   CDS_pept        581000..581380
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07282g"
FT                   /old_locus_tag="DEHA0E07777g"
FT                   /old_locus_tag="DEHA-IPF12309"
FT                   /old_locus_tag="DEHA-CDS6546.1"
FT                   /product="DEHA2E07282p"
FT                   /note="similar to uniprot|Q9I565 Pseudomonas aeruginosa
FT                   PA0880 Probable ring-cleaving dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87857"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ93"
FT                   /protein_id="CAG87857.2"
FT                   /translation="MNIESLDHLVLTVKNIEESIRFYTSVLGMQVESFKGNRKALRFGN
FT                   QKINLHEHGHEFEPKACHPVPGSADLCFVASTSIEEVADHLKKNDVTIIEGPVKRTGAI
FT                   GSITSLYIRDPDLNLIELSNYN"
FT   gene            complement(<582090..>582800)
FT                   /locus_tag="DEHA2E07304g"
FT                   /old_locus_tag="DEHA0E07799g"
FT                   /old_locus_tag="DEHA-IPF12308"
FT                   /old_locus_tag="DEHA-CDS4955.1"
FT   CDS_pept        complement(582090..582800)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07304g"
FT                   /old_locus_tag="DEHA0E07799g"
FT                   /old_locus_tag="DEHA-IPF12308"
FT                   /old_locus_tag="DEHA-CDS4955.1"
FT                   /product="DEHA2E07304p"
FT                   /note="similar to CA4068|IPF5922 Candida albicans IPF5922"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87858"
FT                   /db_xref="InterPro:IPR037830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ92"
FT                   /protein_id="CAG87858.2"
FT                   /translation="MAASLAEVKVSKRTIGELEDITNNDGYHNNKKMKMNMNFKNMYFK
FT                   GEGDERKRPQQQRSPSPSDLSSSSPTKSRTKSVTFELSQNKQYENSPLLTPKDDDDDYN
FT                   DDDVNGAVDMAENTVQNEALGAQLGTNCDYLALTSSLRLLNTNKGKIEREIVDLSQMLD
FT                   FHAKTPDKGEIIDFFSKLVDNKLNLPQQNKILRCPLIDWSKYHNGLTNVSKESFEACAN
FT                   EKSLFRTLNLFNSK"
FT   gene            <583230..>583412
FT                   /locus_tag="DEHA2E07326g"
FT                   /old_locus_tag="DEHA0E07821g"
FT                   /old_locus_tag="DEHA-IPF12306"
FT                   /old_locus_tag="DEHA-CDS8216.1"
FT   CDS_pept        583230..583412
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07326g"
FT                   /old_locus_tag="DEHA0E07821g"
FT                   /old_locus_tag="DEHA-IPF12306"
FT                   /old_locus_tag="DEHA-CDS8216.1"
FT                   /product="DEHA2E07326p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87859"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ91"
FT                   /protein_id="CAG87859.1"
FT                   /translation="MTCQEGICNTTLGHRDTRFMTLDTTLVYGSTIGSNALDANLTGYS
FT                   IPGFIPPRIFISSGN"
FT   gene            <583804..>585582
FT                   /locus_tag="DEHA2E07348g"
FT                   /old_locus_tag="DEHA0E07843g"
FT                   /old_locus_tag="DEHA-IPF12305"
FT                   /old_locus_tag="DEHA-CDS1851.1"
FT   CDS_pept        583804..585582
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07348g"
FT                   /old_locus_tag="DEHA0E07843g"
FT                   /old_locus_tag="DEHA-IPF12305"
FT                   /old_locus_tag="DEHA-CDS1851.1"
FT                   /product="DEHA2E07348p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87860"
FT                   /db_xref="GOA:Q6BQ90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ90"
FT                   /protein_id="CAG87860.2"
FT                   /translation="MTEYSDDLVSQHPLYLAMCKCIEDELEMYDYHDFYPDWEVMKVNY
FT                   RILIQELFGVERHELSSFLEDLRRDYRNFLTDFSRGYLPQVKRLCRLILSLPVCEYEIE
FT                   NDNSSSSSGSKGSSNNYTTQFPDFICDDGYLKELENDEVVHTVRKIFSQTENKQLDKTL
FT                   LDFAFHEYESIPRKGLLEDPYRQAFLGYLIQPICSMLRVALHIETKVETERPALWYEPV
FT                   PDGIHLQTRTDIVVSRGNLVYCVIETKKYPLLPKYNDNPSDGIISLFSKQKEITKQLIC
FT                   EMLYFKTDRGILTDSYTSVLVELDLDSFERNIHNSRLVKTDNEPKIIPIRYMIRDCHSA
FT                   KPTLRESLLSYIYNSVEADSKMAIKQERVQRLEEHLKLSGKTLMKSVSSDDNDNQSEGS
FT                   GSRPSTRDTNVDTLVSIPEGTRKEGDDFRTQLIKLESMYFEKSLLESIDDRFVVAKVYD
FT                   PRNMNRDQYKIYTPGQERHIRYEWFKTEKVCYSILSKDTEFNSSYVRKGVGQTVITMER
FT                   SYIAKGYFNLFRYIESIQLPKDRETYEKAKKQLEIIHRNGIIHRNIKEGNILYSKEGLV
FT                   YIIDFCACKTQNQYLY"
FT   gene            complement(<586431..>587555)
FT                   /locus_tag="DEHA2E07370g"
FT                   /old_locus_tag="DEHA0E07865g"
FT                   /old_locus_tag="DEHA-IPF12304"
FT                   /old_locus_tag="DEHA-CDS3408.1"
FT   CDS_pept        complement(586431..587555)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07370g"
FT                   /old_locus_tag="DEHA0E07865g"
FT                   /old_locus_tag="DEHA-IPF12304"
FT                   /old_locus_tag="DEHA-CDS3408.1"
FT                   /product="DEHA2E07370p"
FT                   /note="similar to CA4067|IPF5924 Candida albicans IPF5924"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87861"
FT                   /db_xref="GOA:Q6BQ89"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ89"
FT                   /protein_id="CAG87861.1"
FT                   /translation="MLLSRIGYGIRASTLRQTRVNILGLSLAQRFKSNLPEDFNPKKDL
FT                   PTSGEWKHMKHHIPGEAEQKNDLKSRIPKFPLGKEAVPTLLPRPGVPQVGPKYSFRQVI
FT                   QILKNKQKPELIYESEPHRLYFLASFCCSLVFTIYGFVLLEYAYFQANKDYEENEKELS
FT                   EPLRKREWFISLIKYSSIGVIALAVATGFAKFPTRLIRRMWYLPGPVEHIKFTSYPLFP
FT                   GAPTPVITLPLSSIARKHTARVWTGKGFYGTADNSMFCFVLKETGARSRNWFVDRKGFF
FT                   WSDGRVFDLLFGKETIAEAEAGIPYDEQVGMVNREVERKRKELRAKHGFFYKWKIQAQD
FT                   MKQDVQGATNYVNTLRGSKKPKSTNQINGKNDNM"
FT   gene            complement(<587846..>588397)
FT                   /locus_tag="DEHA2E07392g"
FT                   /old_locus_tag="DEHA0E07887g"
FT                   /old_locus_tag="DEHA-IPF12302"
FT                   /old_locus_tag="DEHA-CDS5554.1"
FT   CDS_pept        complement(587846..588397)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07392g"
FT                   /old_locus_tag="DEHA0E07887g"
FT                   /old_locus_tag="DEHA-IPF12302"
FT                   /old_locus_tag="DEHA-CDS5554.1"
FT                   /product="DEHA2E07392p"
FT                   /note="weakly similar to uniprot|P32588 Saccharomyces
FT                   cerevisiae YNL016W PUB1 Poly(A)+ RNA-binding protein
FT                   abundant mRNP-component protein hypothesized to bind a pool
FT                   of non-translatable mRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87862"
FT                   /db_xref="GOA:Q6BQ88"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034215"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ88"
FT                   /protein_id="CAG87862.1"
FT                   /translation="MNNNSNGIQKSKLNTTKSSDRRLAAGRQPANYLHNAILNQPSNIT
FT                   KVLPKSNTSHLSPETQKTVKRAGGGKIWEDSSLLEWNPKHFRLFVGNLGTDATDELLAN
FT                   AFGKYKTLSKVKVPMDNKTGKNKGYGFVAFESPDDYFQAFKDMNGKYIGQHPVQLKRAE
FT                   TNIKPTKKKSDSFKNNRKGR"
FT   gene            <588531..>589121
FT                   /locus_tag="DEHA2E07414g"
FT                   /old_locus_tag="DEHA0E07909g"
FT                   /old_locus_tag="DEHA-IPF12301"
FT                   /old_locus_tag="DEHA-CDS5393.1"
FT   CDS_pept        588531..589121
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07414g"
FT                   /old_locus_tag="DEHA0E07909g"
FT                   /old_locus_tag="DEHA-IPF12301"
FT                   /old_locus_tag="DEHA-CDS5393.1"
FT                   /product="DEHA2E07414p"
FT                   /note="highly similar to uniprot|P35718 Saccharomyces
FT                   cerevisiae YKL144C RPC25 RNA polymerase III subunit C25"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87863"
FT                   /db_xref="GOA:Q6BQ87"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ87"
FT                   /protein_id="CAG87863.1"
FT                   /translation="MFILSKLSDLVRIPPHTFNIPIQESITNELNKKFANKVISNLGLV
FT                   ISLWDLIDIKDGLLKPGDGASFVEVTFRCVVWKPFIGEVLTGWVSECSAEGIKVKLEFF
FT                   DEIFIPKNYFFENCLFKPVEKAWVWKPDDDTELYIDINEKIRFRIEEEIFVNIKPKSSS
FT                   EAFGLEEPTNKAPPYALLASCQSDGMGCVSWWD"
FT   gene            complement(<589204..>590544)
FT                   /locus_tag="DEHA2E07436g"
FT                   /old_locus_tag="DEHA0E07931g"
FT                   /old_locus_tag="DEHA-IPF12300"
FT                   /old_locus_tag="DEHA-CDS2763.1"
FT   CDS_pept        complement(589204..590544)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07436g"
FT                   /old_locus_tag="DEHA0E07931g"
FT                   /old_locus_tag="DEHA-IPF12300"
FT                   /old_locus_tag="DEHA-CDS2763.1"
FT                   /product="DEHA2E07436p"
FT                   /note="highly similar to uniprot|P33299 Saccharomyces
FT                   cerevisiae YKL145W RPT1 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87864"
FT                   /db_xref="GOA:Q6BQ86"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035245"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ86"
FT                   /protein_id="CAG87864.1"
FT                   /translation="MPPKADWDKYVAPNEDDESQDKIQPLSEGDIQVLKTYGAAPYASS
FT                   LKEIEKDLKTIEERIKENIGIKESDTGLAAPHLWDVMGDKQRMSEEQPLQVARCTKIIE
FT                   ATNPNPQAGLLQNADNKSKYVINIKQIAKFVVGLGERVSPTDIEEGMRVGVDRQKYEIQ
FT                   LPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFVKLGIDPP
FT                   KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKK
FT                   ACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTL
FT                   DPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKTMSCEKDIRWELISRLCPNATGAELR
FT                   SVCTEAGMFAIRARRKVANEKDFLKSVEKVIKGNMKFSSTSQYMQYN"
FT   gene            complement(<590883..>592814)
FT                   /locus_tag="DEHA2E07458g"
FT                   /old_locus_tag="DEHA0E07953g"
FT                   /old_locus_tag="DEHA-IPF12298"
FT                   /old_locus_tag="DEHA-CDS1385.1"
FT   CDS_pept        complement(590883..592814)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07458g"
FT                   /old_locus_tag="DEHA0E07953g"
FT                   /old_locus_tag="DEHA-IPF12298"
FT                   /old_locus_tag="DEHA-CDS1385.1"
FT                   /product="DEHA2E07458p"
FT                   /note="highly similar to uniprot|Q00711 Saccharomyces
FT                   cerevisiae YKL148C SDH1 Flavoprotein subunit of succinate
FT                   dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which couples the
FT                   oxidation of succinate to the transfer of electrons to
FT                   ubiquinone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87865"
FT                   /db_xref="GOA:Q6BQ85"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ85"
FT                   /protein_id="CAG87865.1"
FT                   /translation="MLSLRRSALAATKFSNNKRFFTSSCVKLQTIGDNIKGNDLNTAKY
FT                   MGKQYHVIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINA
FT                   ALGNMHKDDWHWHMYDTVKGSDWLGDQDAIHYMTREAPDSIYELENYGVPFSRNDEGRI
FT                   YQRAFGGQSKEFGKGGQAYRTCAVADRTGHALLHSLYGQALRHNTHFFIEFMAMDLLMQ
FT                   DGECVGVMAYNQEDGTLHRFRSHKTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLP
FT                   LEDMEFIQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSR
FT                   AITMEINEGRGVGPEKDHMHLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPVLP
FT                   TVHYNMGGIPTKYNGEVITKGPNGEDKVVPGLLACGEVACASVHGANRLGANSLLDLVV
FT                   FGRAVSHTIRDSLTPGTPLPPLAADSGKESIENLDKLRTADGSKSTAQIRLEMQKTMQK
FT                   GCAVFRTQETLDECIEHIGQVDKTFSDVGTTDRSMIWNSDLVETLELQNLLTCATQTAA
FT                   SAAARKESRGAHAREDYPDRDDVNWWKHTLSYQTNFGDDVKLDYRDVIQTTLDESECKP
FT                   VPPTVRAY"
FT   gene            complement(<593194..>595182)
FT                   /locus_tag="DEHA2E07480g"
FT   CDS_pept        complement(593194..595182)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07480g"
FT                   /product="DEHA2E07480p"
FT                   /note="weakly similar to uniprot|P38699 Saccharomyces
FT                   cerevisiae YHR178W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65780"
FT                   /db_xref="GOA:B5RTW8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW8"
FT                   /protein_id="CAR65780.1"
FT                   /translation="MDFYYRKSMGNGTVASKFKLSGNHSDSGTVIQSNQSNVRGPLEKE
FT                   AVEVAKAPRETVDGTDSANMKAVEFPETHHPYNCDRCYKLKKKCSRLYPECENCTKAGA
FT                   SCAYIDRSNKRRKKASHKIYDDRVNFESESPTFHIVDEKSNISLKNKGKNDGSVVVHKL
FT                   VSVSSLLSGETANRVSEQSNEIQTRQKKPIVHPGNSRNVANEQTISEKVALKSLNQQQM
FT                   KTNLKEEFITMKSIKNELALYFVLSYFHNYGTKYPFVNKEKFMEGFKKINFEQEMIINL
FT                   DVYLLMSIGCIIYDYNNGTSFFGEYFNEKAIESIIDILNFGANNNEGEDFANLTLLMLL
FT                   TIYAIKVFNSDLCWVLTGIISRMIIELDLYKPKAKDENQQKRTFWSIFNLDCELNILLH
FT                   KPTQLPNFAYIKLEMPLSTIFADDESGDSIIKDIHLHRLQNRILDLKLRESDDAAAVKQ
FT                   LSQDLENWRVSTSSVIHNTYSNGTNFQDHIALVNLNYYYLLIELDQLSASESFQFTLQF
FT                   LSNSFTLLISEPTSTSKPQVSLSVNSLFWYTKLFNVIKYNISSLHELLSLICSNRINEN
FT                   YSPSDLTLKLADFNSNLQLMLNLLKYLSQNRLKSHPLIDKVNTCIESLTSLNLKLLHFN
FT                   VFSCPHEDKSSLLDEVGAIQSTLQSSI"
FT   gene            complement(<595549..>596250)
FT                   /locus_tag="DEHA2E07502g"
FT                   /old_locus_tag="DEHA0E07997g"
FT                   /old_locus_tag="DEHA-IPF12291"
FT                   /old_locus_tag="DEHA-CDS4999.1"
FT   CDS_pept        complement(595549..596250)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07502g"
FT                   /old_locus_tag="DEHA0E07997g"
FT                   /old_locus_tag="DEHA-IPF12291"
FT                   /old_locus_tag="DEHA-CDS4999.1"
FT                   /product="DEHA2E07502p"
FT                   /note="weakly similar to uniprot|Q06630 Saccharomyces
FT                   cerevisiae YDR296W MHR1 Protein involved in homologous
FT                   recombination in mitochondria and in transcription
FT                   regulation in nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87867"
FT                   /db_xref="GOA:Q6BQ83"
FT                   /db_xref="InterPro:IPR024629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ83"
FT                   /protein_id="CAG87867.1"
FT                   /translation="MRKHLLDHLKTRKILGARIAKGEKTEQDLINLNMAPQVFMFKNLF
FT                   SGQVLYSQVPAFHQDQIDEQFTRPNWENRKPSRRNDLWRIMCVANFENYEYAIAAYKGL
FT                   VQLRQVRDVVQKKEAKALRKKNDEGNVWFSGQYRPTYSQEAVADLSHVIDEFELEGTSV
FT                   MWESLWRKGEDTHWRSDLVEHDTLPPFNPRDQTILLDELRAKAVEEFANLRQQAQQSEQ
FT                   QSQSELESQTA"
FT   gene            <596554..>598431
FT                   /locus_tag="DEHA2E07524g"
FT                   /old_locus_tag="DEHA0E08019g"
FT                   /old_locus_tag="DEHA-IPF12290"
FT                   /old_locus_tag="DEHA-CDS1130.1"
FT   CDS_pept        596554..598431
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07524g"
FT                   /old_locus_tag="DEHA0E08019g"
FT                   /old_locus_tag="DEHA-IPF12290"
FT                   /old_locus_tag="DEHA-CDS1130.1"
FT                   /product="DEHA2E07524p"
FT                   /note="weakly similar to uniprot|P38799 Saccharomyces
FT                   cerevisiae YHR078W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87868"
FT                   /db_xref="GOA:Q6BQ82"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="InterPro:IPR025969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ82"
FT                   /protein_id="CAG87868.2"
FT                   /translation="MSSFVSSFFGCIPFIVTFIFILTWAYTFIFRQNIVQTYSIRNHIP
FT                   KGQINEYIRRNINEKYGTGLMEVNVEGVEDDEYTNVDKRNMYGDNNNSLNRIIGVVFSL
FT                   TFSFSVELIILMMCELIDLFDERARLICFKFIINSLVFLLTCIQPFVMISLFLNEELIP
FT                   ISQSNLKRTYTAAAYIGWFFILHKCGDLSQAFTPDKTSFGTKTLIERKINEISIAGITT
FT                   MAILSGVGSTSTPFKVFSVRRIFSYFRNDGLHSSRKVEVNEADLNNFIQSYSHTSSLIN
FT                   KRKSELNNLQVVNGGTVYNLPNASSDNFLSYNSHKIGDLGGTPKKNKLGGLIHKVQSFA
FT                   SLSSLSLDKEKSEEKELRNEIDSMISLRQHIYNDLVKALFKFSHDREHVQNKNKIWVKA
FT                   ISIFNVAFAIYCVYRIINVFIIKQVLSFLREPNQDDTGIINDYDDDAASNTDALAITIS
FT                   KLILSTTQISMQETQLVNQISLILSGSLFVCSFSNVLKTFQSFTKYFPSITKISPTTKD
FT                   WLKNLVITELLGIYVISTAILIRTNLPTNLSNQISKILSLTGSSASNALLTSAKEVKFI
FT                   DDWFDKVFGIACASTLIVFAIKLFIDDEGDDIYDEEMMLEDNVAPYKTA"
FT   gene            <599061..>600725
FT                   /locus_tag="DEHA2E07546g"
FT                   /old_locus_tag="IPF_12286"
FT   CDS_pept        599061..600725
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07546g"
FT                   /old_locus_tag="IPF_12286"
FT                   /product="DEHA2E07546p"
FT                   /note="weakly similar to uniprot|Q7S5D5 Neurospora crassa
FT                   NCU06153"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65781"
FT                   /db_xref="GOA:B5RTW9"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTW9"
FT                   /protein_id="CAR65781.1"
FT                   /translation="MSVVELTKQSHEEPYKFRINHDDAQAVLGPYAKTPKDDKLPEVHT
FT                   TSNVAILGAGFSGIASSLTCLKNLNETDFVVFDKHDNYGGTWYANTYPGCASDIPAVWY
FT                   SFFNELNSNWSRLQPPQYEMEEYILTVCKKYDLYKHAKFKTIITAIDYNDDEGTWTLTG
FT                   RNITNGQRIKHTSRVLLCCQGGLVTPQQLLAPGIGNFKGEYLHSALWDHNVSFKGKKVV
FT                   VVGNGCSANQLVPALLKDYEPKSIVQVVRSKHYIMPPIPKIVHLTYRLLSFSRVGIVFV
FT                   RWLIATFAEARFPLYKGNGILARFVRWVNTQYSLFYMKSACPKKFQSMVIPDYKIGCKR
FT                   LIFDYSYLPSLHDPRVDITNESIDHVDEHSVVMKNGDVLEADIIVACTGYDVLQSFGNY
FT                   KIKGRNGTDVSKVWKEEGPSAYETILIRDCPNLFMIGGPNSATGHSSVVLAIENGCKYF
FT                   SKVAPKVLSGACKSICVKSSSYYNWFHTTQKELARSVFGTKFGGCASWYSEGGINSTTY
FT                   PYSQLSYWWRMRHPKWNDLEVETPYDWNKSGSKAKAE"
FT   gene            complement(<600858..>601637)
FT                   /locus_tag="DEHA2E07568g"
FT   CDS_pept        complement(600858..601637)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07568g"
FT                   /product="DEHA2E07568p"
FT                   /note="similar to CA5551|IPF5972 Candida albicans,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65782"
FT                   /db_xref="GOA:B5RTX0"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX0"
FT                   /protein_id="CAR65782.1"
FT                   /translation="MLVANQLGHKVSGAGGSTCGSHMKPLNRDYRKEEEKEENADKRVE
FT                   RDNDRKQDGEEDEVPDNKLGELIHKLKGILSGKGLASEDVDIERVKQVMEEYESNEEEW
FT                   GKYALHDQSRPYTRNGVVDINGNANLLILVWSPTRSSAIHDHANAHCCMKILKGSLQES
FT                   LYDVPTEEGHHLDPKKETVMHRDEVGYISDAIGLHKISNPLPDQYSVSLHLYTPPYASM
FT                   YGCSMYEANNGRKHHVDMSKYYSWQGKLVNTKSSSSC"
FT   gene            <602739..>604106
FT                   /locus_tag="DEHA2E07590g"
FT                   /old_locus_tag="DEHA0E08107g"
FT                   /old_locus_tag="DEHA-IPF12278"
FT                   /old_locus_tag="DEHA-CDS2648.1"
FT   CDS_pept        602739..604106
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07590g"
FT                   /old_locus_tag="DEHA0E08107g"
FT                   /old_locus_tag="DEHA-IPF12278"
FT                   /old_locus_tag="DEHA-CDS2648.1"
FT                   /product="DEHA2E07590p"
FT                   /note="weakly similar to uniprot|Q2VQ77 Saccharomyces
FT                   cerevisiae YPL092W SSU1 Plasma membrane sulfite pump
FT                   involved in sulfite metabolism and required for efficient
FT                   sulfite efflux"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87872"
FT                   /db_xref="GOA:Q6BQ79"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ79"
FT                   /protein_id="CAG87872.2"
FT                   /translation="MSSNSTVNSNTALKLEPQSTGCGDRTDTSAIRRLGHAIEHKLIKG
FT                   FTPAYFVTVMGTGVSSGILYRFPYPARWLEICGYIMFGIGVIFLLSAFVCFVVSMLRYP
FT                   QKFKAYHNDPAIAPYMGCLPMGYNTLVNFLYYITGTGWIIGILVLWWISVVLSLYTACV
FT                   VFYTAFLAKRRSGANYLDPKELHATLLLPIVTLTVAASSGNAFALDLPSVDFQVTTMIV
FT                   SYILWSNAISLAVIIISVYYWKLFVYKIPPTNIVFTSFLPIGVLGQGAFCIILFGNNVY
FT                   TLIVKHHDTLLSSHYLHFPKELDLSSVATLGIGISVGQAVLIITAMVCLFLISFGYFST
FT                   YIAVISCISKTSPFTKNYNIECAYNPTSSNRIKKLLTGFIAFNRTYWAMTFPLGTMVLS
FT                   NNELSKSFGGLRAFRVIATIYAVALLIITIGCICGVIYKIVCFAKYTLYGTCYEKI"
FT   gene            <604714..>606084
FT                   /locus_tag="DEHA2E07612g"
FT                   /old_locus_tag="DEHA0E08129g"
FT                   /old_locus_tag="DEHA-IPF12276"
FT                   /old_locus_tag="DEHA-CDS2673.1"
FT   CDS_pept        604714..606084
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07612g"
FT                   /old_locus_tag="DEHA0E08129g"
FT                   /old_locus_tag="DEHA-IPF12276"
FT                   /old_locus_tag="DEHA-CDS2673.1"
FT                   /product="DEHA2E07612p"
FT                   /note="weakly similar to uniprot|Q2VQ77 Saccharomyces
FT                   cerevisiae YPL092W SSU1 Plasma membrane sulfite pump
FT                   involved in sulfite metabolism and required for efficient
FT                   sulfite efflux"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87873"
FT                   /db_xref="GOA:Q6BQ78"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ78"
FT                   /protein_id="CAG87873.2"
FT                   /translation="MSSSNATAETNKNSEREQDVVIYERESNNNITGRLSFAVDQKLIK
FT                   GFTPAYFGAVMGTGVSSCVLYKFPYPSRWLEICGCIMFGIGVAFLLVTIVCFVASILRY
FT                   PKKFAAYNSDPTIAPFMGGLPMGVNTLINFLYYLTGDKWIMGIWVLWWISVALSLYTGC
FT                   IVFYSAFLAKKKPSSNYLNPKDIHAALLMPSVAFTVSASTANLLVADLPSLDLQITTMV
FT                   VSYVLWSNGVILTFIILSIYYWKLFVHKIPATNLVFTSFLPSGAVGQGAFCINLFGNNL
FT                   YDLMIKHHHSIFSSHYLHFPVELDLSSVDTLGVGISVGQVVLIATAMISLALISFGYFS
FT                   TYIAVVSSISKIYPFTKKYNLDFAYNPSTMNPFKRMFTGFIAFNKSYWAMTFPFGTMTI
FT                   CCNELSKTFGGLKAFKVIATIYAVALLIVTIGCLCGVVYRILYLAKYAIYSTNYEKI"
FT   gene            <606860..>608218
FT                   /locus_tag="DEHA2E07634g"
FT                   /old_locus_tag="DEHA0E08151g"
FT                   /old_locus_tag="DEHA-IPF12275"
FT                   /old_locus_tag="DEHA-CDS2660.1"
FT   CDS_pept        606860..608218
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07634g"
FT                   /old_locus_tag="DEHA0E08151g"
FT                   /old_locus_tag="DEHA-IPF12275"
FT                   /old_locus_tag="DEHA-CDS2660.1"
FT                   /product="DEHA2E07634p"
FT                   /note="weakly similar to uniprot|Q2VQ77 Saccharomyces
FT                   cerevisiae YPL092W SSU1 Plasma membrane sulfite pump
FT                   involved in sulfite metabolism and required for efficient
FT                   sulfite efflux"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87874"
FT                   /db_xref="GOA:Q6BQ77"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ77"
FT                   /protein_id="CAG87874.2"
FT                   /translation="MSLNASESTEKDIERKQNLLITKGESNSSILRRFGVAIDQTLIKG
FT                   FTPGLFVTVMGPGVSSCILYNFPYPSRWLEICGCIMFGVAVIFLIATLTCFVVSLWRYP
FT                   KKFASYTSDPKTAPYMGCLSMGYNTLVNFLYFLTENWAIGIFVLWWISVILALYTAFIV
FT                   FYSSFLAKQKSKSNYLDPKDLHTTLLLPMVTLIVSASSANLFALELPSVNLQIMTMIIS
FT                   YIMWSIGIMMATIIISVHYWRLFVFKIPPTNLIFTTFLPSGVCGQSSYFILLFGNNIYK
FT                   LLVKHHDTLLSSHFLHIPGYMDISSVNTLEISISMGQVVLIIAAMVGLFLLSFGYFCTY
FT                   VAVISCISKIPPFTNNYNLEYAYNPLSQNPFTRIFTGFIAFNRTYWAMTFPLGTMALSN
FT                   HQLAENFGGLEAFRVMATIYDVALLVITVGCICGVVYKIICFSKCVFNGTDYK"
FT   gene            <608382..>610223
FT                   /locus_tag="DEHA2E07656g"
FT                   /old_locus_tag="DEHA0E08173g"
FT                   /old_locus_tag="DEHA-IPF12274"
FT                   /old_locus_tag="DEHA-CDS1552.1"
FT   CDS_pept        608382..610223
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07656g"
FT                   /old_locus_tag="DEHA0E08173g"
FT                   /old_locus_tag="DEHA-IPF12274"
FT                   /old_locus_tag="DEHA-CDS1552.1"
FT                   /product="DEHA2E07656p"
FT                   /note="weakly similar to uniprot|P32893 Saccharomyces
FT                   cerevisiae YGR166W KRE11 Protein involved in biosynthesis
FT                   of cell wall beta-glucans"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87875"
FT                   /db_xref="GOA:Q6BQ76"
FT                   /db_xref="InterPro:IPR024662"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ76"
FT                   /protein_id="CAG87875.2"
FT                   /translation="MNLSITLPSKANHLEKYKDLSKFLFHLHSLPVRDIIFFDESILGF
FT                   IILKTPPNTQSYKPSKVFVDISILSADILESKADIENDKFNSSIINTTLGSDDIIFQGE
FT                   NNDEHYIIWKFEVPVTYPKKKVNNPNVSFSCFISDKETKDSPINDSGPIAEKKLADYQP
FT                   SYSRNLLSELNNQAKSAESKYLLTIEPDVQETQPSIIIDEKSASILKASITIPVSVSLV
FT                   IKLKSTKPAGRNNILLSSLNIESSEELIKLLSESKEHYYFNILNLSLDFKNGTIDDLNS
FT                   FKDKFPINFKLIDSVSLSYRLVNNEFLEKDLKQFDNTSNMNQFSKSISIRLTLQVQKFI
FT                   PDLNTFEDISNVITTSWSPFLDFSIIAPPINNSLKTTTNYSQFQSSPNSQPFKYNNVKK
FT                   NNLLKPKVLSSQASITSGNQINTGFSNFNINSTKRLSKALISSSSSSVTVNLTTSNNST
FT                   LSGLKLTFQGKLNLKLGEIVNWNLQAINNSPNKLNLSLVVQNPINLNYGQKNANTSNNT
FT                   SSSNLLNSTSDNKEILVYNKVQLFSLYHSLKLNTSGIIILNNDIRIGPLEPNSVFETNL
FT                   NLIGISQGIFNLDGIKIFDTSSGDGLDFGKLVEVFVV"
FT   gene            complement(<610281..>611900)
FT                   /locus_tag="DEHA2E07678g"
FT                   /old_locus_tag="DEHA0E08195g"
FT                   /old_locus_tag="DEHA-IPF12272"
FT                   /old_locus_tag="DEHA-CDS2042.1"
FT   CDS_pept        complement(610281..611900)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07678g"
FT                   /old_locus_tag="DEHA0E08195g"
FT                   /old_locus_tag="DEHA-IPF12272"
FT                   /old_locus_tag="DEHA-CDS2042.1"
FT                   /product="DEHA2E07678p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87876"
FT                   /db_xref="GOA:Q6BQ75"
FT                   /db_xref="InterPro:IPR028012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ75"
FT                   /protein_id="CAG87876.2"
FT                   /translation="MKADIRIANKYNSSILYELFSLYSLLLINMNFNFLNGSTMATPSS
FT                   FLTEEFSGYNEDSFGTIVESCFKTIDTSQTKYHSQGQDFATFLFEDFVGERPHSSSNHN
FT                   AWLNHQPRSDIRGIDTWENSNHRSERPYTLAKKVQSSKELFQRHNNLVPESELDAYTAS
FT                   NDPLGSIIAGRNEYCNEVSKTNGSYIKREADSCLIHDRIFDSEFTNRSQDEIFTSSANP
FT                   IELQSFSQPCFKIEEVSHISSYTYGNQNLDIGIVSPNIINPSFITNSFSASPQPNVNPA
FT                   LPENECMNTSKSKRSRFIKGSKNRLCTQREFSYDGIDVESYLETSDRLINVAKNEEPYN
FT                   FQEILSSKLLELKVNREHSICCIKRNRYVRENFDSILNFYKNVGYELNPNFHISKPYEP
FT                   QYVRFEIDETNGLPFNETRCGLCPYCPDINFKNLKTSTYSQHLALTHGVYTDNYLTPNP
FT                   IYYGIYIIKKTNTQRRTKAHEHERCGVVCPCCYAIVGTECSKTTASSKPLNNYMRHFKE
FT                   YHRQSKDKLDPIKFFNKTIPLN"
FT   gene            complement(<612280..>612387)
FT                   /locus_tag="DEHA2E07700r"
FT                   /old_locus_tag="Deha0E.40"
FT   tRNA            complement(join(612280..612316,612351..612387))
FT                   /locus_tag="DEHA2E07700r"
FT                   /old_locus_tag="Deha0E.40"
FT                   /note="tRNA Pro (TGG) cove"
FT   gene            complement(<612543..>614510)
FT                   /locus_tag="DEHA2E07722g"
FT                   /old_locus_tag="DEHA0E08261g"
FT                   /old_locus_tag="DEHA-IPF12271"
FT                   /old_locus_tag="DEHA-CDS1319.1"
FT   CDS_pept        complement(612543..614510)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07722g"
FT                   /old_locus_tag="DEHA0E08261g"
FT                   /old_locus_tag="DEHA-IPF12271"
FT                   /old_locus_tag="DEHA-CDS1319.1"
FT                   /product="DEHA2E07722p"
FT                   /note="highly similar to uniprot|P38088 Saccharomyces
FT                   cerevisiae YBR121C GRS1 Cytoplasmic and mitochondrial
FT                   glycyl-tRNA synthase that ligates glycine to the cognate
FT                   anticodon bearing tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87877"
FT                   /db_xref="GOA:Q6BQ74"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ74"
FT                   /protein_id="CAG87877.1"
FT                   /translation="MSTSRTPIPFSRESLEQVLKRRFFFAPAFEIYGGVSGLYDYGPPG
FT                   CALQANIMDTWRKHFILEEDMLEVDCTMLTPHEVLKTSGHVDKFADWMCRDLKTGEIFR
FT                   ADHLVEEVLEARLKGDKAARGVAINEGEEEDADKKKRKKKVKEIKSIKLDDEVVKEYEN
FT                   VLAQIDGYSGSQLGELMTKYKINNPATDGPLELPIEFNLMFETAIGPSGQLKGFLRPET
FT                   AQGQFLNFSKLLDCNNEKMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHYVDPDN
FT                   KSHSRFDEIKDLKLKFLPKGVQESGSNELTEKSLGEAVSSGMVDNETLGYFLARIYSFL
FT                   IKIGVDPSRLRFRQHMSNEMAHYAADCWDAELHTSYGWIECVGCADRSAYDLSVHSART
FT                   NEKLVVRQPLPEPVLVEKYEVNIAKKKFGPKFRKDAGTVENWLLARTQCELEDLCKELN
FT                   ENNKIVFKIDSIPNSIELDTEFVKIEKVKRTEHIREFTPNVIEPSFGIGRILYSIFEHQ
FT                   FWARPEDKDRTVLSLPPLVAPTKVLLVPLSSNAELQPIVKKISAFLRKEQVPFKVDDSS
FT                   ASIGKRYARNDELGTPFGITIDFDSVKDESVTLRDRDSTKQVRGSLEDIVEAIKDIAYN
FT                   NVSWTDGTSKLTPFDSQSEA"
FT   gene            complement(<615109..>615570)
FT                   /locus_tag="DEHA2E07744g"
FT                   /old_locus_tag="DEHA0E08283g"
FT                   /old_locus_tag="DEHA-IPF12268"
FT                   /old_locus_tag="DEHA-CDS6017.1"
FT   CDS_pept        complement(615109..615570)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07744g"
FT                   /old_locus_tag="DEHA0E08283g"
FT                   /old_locus_tag="DEHA-IPF12268"
FT                   /old_locus_tag="DEHA-CDS6017.1"
FT                   /product="DEHA2E07744p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87878"
FT                   /db_xref="GOA:Q6BQ73"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ73"
FT                   /protein_id="CAG87878.2"
FT                   /translation="MHIFEYLGKELPFEAWNRDKVYNVIKSRLDEIHSLEISHNDVTET
FT                   NIQVSESGIVSLIDFGLSEYPSSEEHISNDIISLKRIFRQYTHDNDSQGDPATQKSKNS
FT                   INDKSFTHSNYEIDDITSNEVDFDEMSSESHTAATTQLEKSKVLLQFNV"
FT   gene            complement(<615666..>615899)
FT                   /locus_tag="DEHA2E07766g"
FT                   /old_locus_tag="IPF_43173"
FT   CDS_pept        complement(615666..615899)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07766g"
FT                   /old_locus_tag="IPF_43173"
FT                   /product="DEHA2E07766p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65783"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX1"
FT                   /protein_id="CAR65783.1"
FT                   /translation="MAKMEENTEKVNCDVTQGNTYCRVVYDSANIYSSLESSLLSTVFV
FT                   KLYHYSKQLWKENDLACFTIPDTKCYYDMFFN"
FT   gene            complement(<616588..>616743)
FT                   /locus_tag="DEHA2E07788g"
FT                   /old_locus_tag="IPF_12266"
FT   CDS_pept        complement(616588..616743)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07788g"
FT                   /old_locus_tag="IPF_12266"
FT                   /product="DEHA2E07788p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65784"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX2"
FT                   /protein_id="CAR65784.1"
FT                   /translation="MSTVPDYSALVYISEAMVKAEIKRMTSDRFKNSFLATLDTAFNES
FT                   TNCNPC"
FT   gene            <618101..>622396
FT                   /locus_tag="DEHA2E07810g"
FT                   /old_locus_tag="DEHA0E08327g"
FT                   /old_locus_tag="DEHA-IPF12265"
FT                   /old_locus_tag="DEHA-CDS0132.1"
FT   CDS_pept        618101..622396
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07810g"
FT                   /old_locus_tag="DEHA0E08327g"
FT                   /old_locus_tag="DEHA-IPF12265"
FT                   /old_locus_tag="DEHA-CDS0132.1"
FT                   /product="DEHA2E07810p"
FT                   /note="similar to uniprot|P38873 Saccharomyces cerevisiae
FT                   YHR186C KOG1 Subunit of TORC1 a rapamycin-sensitive complex
FT                   involved in growth control that contains Tor1p or Tor2p
FT                   Lst8p and Tco89p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87880"
FT                   /db_xref="GOA:Q6BQ71"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ71"
FT                   /protein_id="CAG87880.2"
FT                   /translation="MRHGFDEDYNSENFLTLLANSFYIYFDDKRHNTNGNPITDEMKSS
FT                   SEYIKNYQPITDWKVMRERQKTISAVLVLCLNLGVDPPDVMKTYPCAKYEAWCDPSLFS
FT                   DTKKAIETIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHYNG
FT                   HGVPQPTPSGEIWVFNRGYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNFKKFAQ
FT                   KRIDDDNEGNHDLSAPSPTSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTCPIDIS
FT                   IKWFIMQSPLKKNYYNLLPRNATGTVIIPGKLTDRRTPLGELNWIFTAITDTIAWASLS
FT                   RPIFKRLFRQDLMVAALFRNFLLAKRIMPHLNCNPISDPPLPDTVRFHRMWDSWDLAID
FT                   QVFAQLLKNSNPDPQSGASLNQSQLVKQQPFPQSLLDKTGTNSQSKSNSSTQASITTSA
FT                   STGNLNSTVSAPPNLANYQHSTFFEQQLTAFEIWLKYAGSSTKEPPEQLPIVLQVLLSQ
FT                   VHRLRALILLSKFLDLGPWAVYLSLSIGIFPYVLKLLQSPAQELKPVLIFIWARIMAID
FT                   YKSTQQELCKDKGYNYFYIILNSNPLNQINGGDNINASGANILINDDHKAMSAFILTLF
FT                   IKDFKNGQRLCFSIELINNCLKFLSTSENPLLRQWCCLLLSQLWMNYPDGKWIIYKDGY
FT                   LNKFLMMINDPIPEVRTSIVLALTNFLSDSADFQPPQQSHQQQQRSHMNVGPDLRRDEL
FT                   RQQDLRLANTILSLLGDGSSMVRKEIVYFINKFISIYSKFFLVLAFNQLEEEIVLIDNS
FT                   NYLSEFRKKSPAYGSIFSSLWKSLLILSEDPHLEVKQMAEVLIDSVMVKLNESDLGPLV
FT                   KEMQDYLLSKSTININETFKPSKPIVNRQLASLNGSHPNRRQVSSGPTVERKNNMLTIN
FT                   GSSIKTRSASTNDMDRNTIASDDSDAESISSKLKNLSLFKLIKSFQMNDDNELKHFTRI
FT                   LNSGPIASSYGVEYKPKTPRFRPRKLSIEPKLPAESGFFEYSCEYFQEPQMSKNEIDEP
FT                   GSEEYVKRLWRRNRNEAIIQETQSQKSVAIRGDWNKSLTIMNNKSQPKLIKFTQFEKIL
FT                   VASDEKDNVSVWDWEMNKMVGKFSNCNPFGTKITDIKFLNEDDLPLLLTGSSDGVIKIY
FT                   KNFHTANNIGERNVELVSSWRALTDLLLTSKSSGLISEWQQSRGSLLVSGDVKIIRVWD
FT                   APRELCLVDIPARSSSSITSLTSDQVAGNIFIAGFDDGSLRVYDRRLDSRESMVKTWHS
FT                   KTRNANNPDQAYKNITGHGSIRNVHMQRGGYRELVSGSSDGFVNLWDIRLNDPVLTYTN
FT                   SPEKSMRCIDAHEHAPIITTGSKSVKLWTTSGDLLTTLKNPHDTYLSNRTSSYLSSTTF
FT                   HPHRMMMATNYNQDGHINVYTCNDVIQEY"
FT   gene            <622567..>623733
FT                   /locus_tag="DEHA2E07832g"
FT                   /old_locus_tag="DEHA0E08349g"
FT                   /old_locus_tag="DEHA-IPF12263"
FT                   /old_locus_tag="DEHA-CDS3616.1"
FT   CDS_pept        622567..623733
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07832g"
FT                   /old_locus_tag="DEHA0E08349g"
FT                   /old_locus_tag="DEHA-IPF12263"
FT                   /old_locus_tag="DEHA-CDS3616.1"
FT                   /product="DEHA2E07832p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257C MTM1 Mitochondrial protein of the mitochondrial
FT                   carrier family involved in activating mitochondrial Sod2p
FT                   probably by facilitating insertion of an essential
FT                   manganese cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87881"
FT                   /db_xref="GOA:Q6BQ70"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ70"
FT                   /protein_id="CAG87881.2"
FT                   /translation="MSMSSELAAGIEEDDLRFNNLSTIQKAKASLTSLSPKSSEDITLL
FT                   QRMISACSGSFVTSLVVTPFDVVRIRIQQQEILPISKPCCEVHFPADVIAKHKSTAGMP
FT                   PELFWLSQNYCKGAENCFKITSTFQGFSTISKHEGIFTLWRGLSLTLFMTIPSNIIYFT
FT                   GYEYIRDNSPLKSYILNPLVCGSCARVMAATFVAPIELLKTRLQSIPSDKSANPKILSN
FT                   LFKDSYSIVKQKGMGTLFRGLKITLWRDVPFSGIYWSCYELFKDKISTVLNADFQKSNI
FT                   AEPVEDWKIFATSFISGSLSGTIGAFCTHPFDVGKTRLQITSEQVGKETTHKRPSMFKF
FT                   LTTIYKQEGLRALYSGIGPRVLKIAPSCAIMISSYEIGKKFFRSGNRN"
FT   gene            complement(<623868..>624977)
FT                   /locus_tag="DEHA2E07854g"
FT                   /old_locus_tag="DEHA0E08371g"
FT                   /old_locus_tag="DEHA-IPF12261"
FT                   /old_locus_tag="DEHA-CDS3464.1"
FT   CDS_pept        complement(623868..624977)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07854g"
FT                   /old_locus_tag="DEHA0E08371g"
FT                   /old_locus_tag="DEHA-IPF12261"
FT                   /old_locus_tag="DEHA-CDS3464.1"
FT                   /product="DEHA2E07854p"
FT                   /note="weakly similar to A2127|IPF4897 Candida albicans
FT                   IPF4897"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ69"
FT                   /protein_id="CAG87882.2"
FT                   /translation="MSDSFMVRPTTAFMKVFDKFSAISGFGNTSGNNTDNINSFANSAS
FT                   KDKKQNNVSASQLQNKIGKISRLENRLMSLQDSLTSDLIDWGSGIPNPDSERMVKNFSL
FT                   LLAAQKDSSVLIIEKLDKLKLNLAFVNEREKKQNDLLAAKTKILKQLRYSEVKYGPNAS
FT                   STTLLKEKLEENVCNLGVVEIQYIRAITKNLKDALIDYLYALQSVSANISEATNDYYEV
FT                   LLSLESGHDLARNSPRKIGNGMGIGVGLNNRKDLNFNTSNSYGLSSKSANDADYSSPKN
FT                   SDFQERNSPIRMTSQVVEDYQNYTNCVECQKNNKYHHRLITPCTHNGQNIDSRTSKSTH
FT                   MSATRISPDSISEQGFEIKDGYSPSEHWN"
FT   gene            complement(<625457..>626194)
FT                   /locus_tag="DEHA2E07876g"
FT                   /old_locus_tag="DEHA0E08393g"
FT                   /old_locus_tag="DEHA-IPF12259"
FT                   /old_locus_tag="DEHA-CDS4856.1"
FT   CDS_pept        complement(625457..626194)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07876g"
FT                   /old_locus_tag="DEHA0E08393g"
FT                   /old_locus_tag="DEHA-IPF12259"
FT                   /old_locus_tag="DEHA-CDS4856.1"
FT                   /product="DEHA2E07876p"
FT                   /note="weakly similar to uniprot|P50087 Saccharomyces
FT                   cerevisiae YGR235C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87883"
FT                   /db_xref="GOA:Q6BQ68"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ68"
FT                   /protein_id="CAG87883.2"
FT                   /translation="MFARSSVHYGASLAVVGAFLIKPSQISNEPKRRFYEDESDVIPVP
FT                   GTITPSPGTEIEALGPNKLVDGISVRSTSTLESYFRAIRESAVQGINSVQHYMNQGYTK
FT                   YNETERQVTDTMAELHYKPEDLLPSTLYIVIATMSGNIMARQRGLIAKTTFPLVLGLAS
FT                   FRYFLPQTFNNVSGFVWNLEKRALPDLAEQQQLALAKADQFVQGVEKSSQRNQKRLEDS
FT                   ANSLRKSIAQVTGLNIDEEVSKK"
FT   gene            <626420..>628813
FT                   /locus_tag="DEHA2E07898g"
FT                   /old_locus_tag="DEHA0E08415g"
FT                   /old_locus_tag="DEHA-IPF12258"
FT                   /old_locus_tag="DEHA-CDS0839.1"
FT   CDS_pept        626420..628813
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07898g"
FT                   /old_locus_tag="DEHA0E08415g"
FT                   /old_locus_tag="DEHA-IPF12258"
FT                   /old_locus_tag="DEHA-CDS0839.1"
FT                   /product="DEHA2E07898p"
FT                   /note="weakly similar to uniprot|P36056 Saccharomyces
FT                   cerevisiae YKL155C RSM22 Mitochondrial ribosomal protein of
FT                   the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87884"
FT                   /db_xref="GOA:Q6BQ67"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR016522"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ67"
FT                   /protein_id="CAG87884.2"
FT                   /translation="MIRGLSRRSTAFKLRRFGIPNQSVVRYKSTSNDHDKLKLDSSTYE
FT                   FIKDDDFGSSVSSEASSLPFEMRRHGELFGQLVRSESLKKDNNLNETDEDYVKRQGTQN
FT                   EQYMYDSPFRNEDGSFIKGDTAEEARLHDLTLVGRSDRSVTKLPSEIANCINNNILRMV
FT                   YPDRLREKAAKIYQSLNKDQIQNAPETALDCDAHIAALFLQDYSHVRQVLLELQKRVGK
FT                   DIFNPKSVLDIGYGPATGMVALNEIMGDEYIPDEKDAYIVGRNNFEMKKRAKIILSRQM
FT                   NENLTEEEVEEDSANDLSAVNNIKESDKSQIDEESEIQEEEQEEQEELDEEYVGPVSTS
FT                   DIKLKTKLRDSLPVTKKYDLIIVNQALLTREFNFPRDIDINIHMILKLLSPGGHLVLVE
FT                   RGNALGFETIARARQIMIRPESYSTEIGKVPRPYVKGSKLKPQKLKKDDQLITEDDIKF
FT                   EEELLAKYEREDEELFEQELNDKYGKPSEDDLKFEMEDNEEFEVIPVEEEAKLGTESVD
FT                   FHISIIAPCPHHGKCPLQLGDPKYYKIPSHKHRLNFCSFNKTVERPKYTMELKKGRRLS
FT                   TAWDKSSEDGFGIDKLSKKTLQNLEGSGRPSGRNTESGSFSYLIAERALNDVETIKKIE
FT                   SEREYNNSNKLDEFDPTNWPRVVDNPTKIKNNVKLNVCASSGNIETWQIPKSLGKQVYH
FT                   DARKADRGDSWALGKKSVIVKNQISDKTREKLDFLSKAHKKTFLKEQRKKKFKKIVSSS
FT                   ENAFEDDIVTFADSLATSMESSKKYKTKGKKAGFTVNPTDYDGK"
FT   gene            complement(<629107..>629355)
FT                   /locus_tag="DEHA2E07920g"
FT                   /old_locus_tag="DEHA0E08437g"
FT                   /old_locus_tag="DEHA-IPF12255"
FT                   /old_locus_tag="DEHA-CDS7737.1"
FT   CDS_pept        complement(629107..629355)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07920g"
FT                   /old_locus_tag="DEHA0E08437g"
FT                   /old_locus_tag="DEHA-IPF12255"
FT                   /old_locus_tag="DEHA-CDS7737.1"
FT                   /product="DEHA2E07920p"
FT                   /note="highly similar to uniprot|P38711 Saccharomyces
FT                   cerevisiae YHR021C RPS27B Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87885"
FT                   /db_xref="GOA:Q6BQ66"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ66"
FT                   /protein_id="CAG87885.1"
FT                   /translation="MVLVKDLLHPSPATERQSHKLKTLVQEPRSYFMDVKCQGCLNITT
FT                   VFSHAQTAVSCDNCSTVLCAPTGGKAKLTEGCSFRKK"
FT   gene            <629658..>632225
FT                   /locus_tag="DEHA2E07942g"
FT                   /old_locus_tag="DEHA0E08459g"
FT                   /old_locus_tag="DEHA-IPF12254"
FT                   /old_locus_tag="DEHA-CDS0687.1"
FT   CDS_pept        629658..632225
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07942g"
FT                   /old_locus_tag="DEHA0E08459g"
FT                   /old_locus_tag="DEHA-IPF12254"
FT                   /old_locus_tag="DEHA-CDS0687.1"
FT                   /product="DEHA2E07942p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87886"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ65"
FT                   /protein_id="CAG87886.2"
FT                   /translation="MIGFWMDANEGKEKSLIVEKSVEGNRHKKETGALVNGHSVKSKGG
FT                   ANDKRQLYYQRKMERLGHGKAKQEGSSRSEEYEKEIDIFNSDIEAILSPFKQMEKSDSK
FT                   IDRGIIKYFALVVILLPSIIGIMTPAMGENGRTSIDMANLVTDSFMVILVSWFINFTIE
FT                   WPWNWHKNIIEAQSKLLESTNAFVHRVSTTEEVNSEILTKKIKAFKKLCKYENYSLSLC
FT                   FVCTCMGAGIMRWSRNYINIEDTRRRLVFSNLNIMLFSFLEIFRLVLILTERLQKHTVD
FT                   DIQDKINKDRVKSNGLKTAHMDFVIPSSSSSEDNNKMGGLMNGLGSLVTTGKLNANIEG
FT                   GVVSYKKSIEVLQDKANRQDEMIQSLLITQANEYAKINMSLKKLEKVISQINNHKNEGL
FT                   DNQRSVFLKPFPLNLSSSENKLTQKSYKRLSLPSMLNNDKQPMHTIFEESDIEEEDGDE
FT                   NQLNSELMELQERREQEARDEKGIGKMLGGIVDKQEKFSDNISKRVRPQKSISSSTNLS
FT                   SFNESIFEQPHSHRIDIKQSDLENVSDYNSNYFDDDCEKEDKHKGVGSGYFSLHGLPFS
FT                   SSIKNLVTRNLVYEDNNSNIPYIPDNLLDYRINELIGYGSEQSSIMGNMEEKNSNILFK
FT                   LKLIVSNILQNISIIDLIKDPLTTKQILHSEVKPILMSFCKEQIENYTATTRLLKSLIW
FT                   EILTKHLFLTTEKLETIINTYLAPLERLKNLFTLVCFKIPFNILRFYVAVLSFFPKIFY
FT                   HIFIAYPIINQTSKDKDSDGAKRIKNTDHREPGSKPFLAMKQFHLSPNAARSGKIKTNT
FT                   ESDKALYDLKARKMVFNKLSRYYDLRTLPENSLFTPVRLYDEE"
FT   gene            <632741..>633826
FT                   /locus_tag="DEHA2E07964g"
FT                   /old_locus_tag="DEHA0E08481g"
FT                   /old_locus_tag="DEHA-IPF12251"
FT                   /old_locus_tag="DEHA-CDS2538.1"
FT   CDS_pept        632741..633826
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07964g"
FT                   /old_locus_tag="DEHA0E08481g"
FT                   /old_locus_tag="DEHA-IPF12251"
FT                   /old_locus_tag="DEHA-CDS2538.1"
FT                   /product="DEHA2E07964p"
FT                   /note="similar to uniprot|Q06640 Saccharomyces cerevisiae
FT                   YDR306C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87887"
FT                   /db_xref="GOA:Q6BQ64"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ64"
FT                   /protein_id="CAG87887.2"
FT                   /translation="MEIRKEEFESASKMMKLPVEIIVYILEILEAKGKLKPKYLRVCKL
FT                   FYLIALPMIYRRPTLKATNFFAFVDTISSNKTIGNNIRELDLSYIIQTGKNAFVAKLLK
FT                   RSRANLEVFVAPQTSFGLGPLIALKNCTKLKILDLRLVSETLNLIELFNSINSLDELTH
FT                   LSFPRSSIEIHDFKSIHWPTRLSFLRLSGGITDDFLMQSEFPSTITQLELAHCPAIKDF
FT                   GLHSLLFSFGKNLTSLKIQYPMPGLKDNALDLVFNYCPNLTVLEISVDYVSSAFFDEEN
FT                   LSYLAYPRPLKTLYIESSGMLGTSTKLDPIDLAIAINEDRLPFLKNIRCTAKLGWDPKS
FT                   EYVTFIVDALDERGGGLYIGY"
FT   gene            <633997..>636225
FT                   /locus_tag="DEHA2E07986g"
FT                   /old_locus_tag="IPF_12247"
FT   CDS_pept        633997..636225
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E07986g"
FT                   /old_locus_tag="IPF_12247"
FT                   /product="DEHA2E07986p"
FT                   /note="similar to uniprot|P33775 Saccharomyces cerevisiae
FT                   YDL095W PMT1 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65785"
FT                   /db_xref="GOA:B5RTX3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX3"
FT                   /protein_id="CAR65785.1"
FT                   /translation="MSSYKSEKSKLPPGYKPGKWRPFHVAGPSSLTIERTTITRFDHFL
FT                   TFVLLALSILIRLYNIPFPNKVIFDETHFGGFARSYFRGEFFVDVHPPLAKLMYYSIAI
FT                   LCGWNGDFEFAEIGDTFDDNVPYVAMRLFSGICGVLTVLLTFGILRASNCRSAVAFFGA
FT                   FLVLIENSLVTQSRLIMLDGPLIFGVALSVLGFKRFQLAEPFTKKWFKFLIMTGIGLGI
FT                   TMSIKLTGLFTVAWVGVLTVIQLWSYLGDLEVSDRQWFKHVYYRVFGLIVVPLTIYLGC
FT                   FAIHFINLPFNGPGSGAVSPSFKATFHDSQDLKNTPVDVSYGSTVTIKHKNMESYLHSH
FT                   DHTYYTGSHEQQVTLYGFDADENNEWIIETKNKSPIGQLQGKFRPVKDGDIVRLYHKST
FT                   GKYLTVNEEKPPISERDYSNEVACSGDRDMLGNENYEFKVRIVKSETHATSNLPMIKVR
FT                   ATETLFQLVHRSRGCVVIAHEDKLPDWGFNQNEVLCIDEPTIPNTMWYIEHNSHPMLDN
FT                   DSDAEKVHFKSYSFFNKLVEYHLAMWRINKSFTDKHPYSSSPESWPFLLRGINFFSNEA
FT                   GSSNELHDEDGSHIYLLGNVAIYYVGFILISLVIAKNIIKLFKVMNPFGLTYDPPYVST
FT                   FQSNGFEFVVGWMLHYFPSYQMSRQLFLHHYLSSLFFSILVIAQVTEYQMTKRKIFGYI
FT                   WMVSITVLAIYCFVAFTPIIYGFDWNRSECNHAKWFPSWDFNCMSYTH"
FT   gene            complement(<636306..>636827)
FT                   /locus_tag="DEHA2E08008g"
FT                   /old_locus_tag="DEHA0E08547g"
FT                   /old_locus_tag="DEHA-IPF12246"
FT                   /old_locus_tag="DEHA-CDS5687.1"
FT   CDS_pept        complement(636306..636827)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08008g"
FT                   /old_locus_tag="DEHA0E08547g"
FT                   /old_locus_tag="DEHA-IPF12246"
FT                   /old_locus_tag="DEHA-CDS5687.1"
FT                   /product="DEHA2E08008p"
FT                   /note="similar to uniprot|P47822 Saccharomyces cerevisiae
FT                   YDR308C SRB7 RNA polymerase II holoenzyme component"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87890"
FT                   /db_xref="GOA:Q6BQ63"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ63"
FT                   /protein_id="CAG87890.1"
FT                   /translation="MTDRLTQLQVCLDQLVEQFNATVNYVNTNSEPGLLDEDPSSVSNL
FT                   AANAPIPGVQQQPSQGSGGGSNKQTNAGNSVSNQPSAKAEAESNFENTINELSTDIILK
FT                   SRQITMLIDSLPGIGVSPESQLNMVEDLAKQLEEVEKERIKKIEEKDKLLKWCESLIVE
FT                   VATGISESRE"
FT   gene            <636946..>638124
FT                   /locus_tag="DEHA2E08030g"
FT                   /old_locus_tag="DEHA0E08569g"
FT                   /old_locus_tag="DEHA-IPF12245"
FT                   /old_locus_tag="DEHA-CDS3244.1"
FT   CDS_pept        636946..638124
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08030g"
FT                   /old_locus_tag="DEHA0E08569g"
FT                   /old_locus_tag="DEHA-IPF12245"
FT                   /old_locus_tag="DEHA-CDS3244.1"
FT                   /product="DEHA2E08030p"
FT                   /note="weakly similar to uniprot|Q06651 Saccharomyces
FT                   cerevisiae YDR313C PIB1 RING-type ubiquitin ligase of the
FT                   endosomal and vacuolar membranes binds
FT                   phosphatidylinositol(3)-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87891"
FT                   /db_xref="GOA:Q6BQ62"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ62"
FT                   /protein_id="CAG87891.2"
FT                   /translation="MLSNAYKKAINTRYLKAINSMSRSDNGPLWQDDTEVSSCFLCDLN
FT                   YTIFHRRHHCRKCGRVVCGNCSEQSIKYFPNTLIANPQQESECSVSLETYRTCDECVAE
FT                   VKMIRRALYEARTSVIDTETSASNEAEIASDNERNETNEDSSVDNNSTTKYSTKTSTRL
FT                   VRSSTHSSCANLHHSGCNYRRRIQDGASDDNLCPVCANNLLKEYMRQFKKRKGDIDCDE
FT                   FESYKESHINDCLIAFDFNGDRDRPDSPVRSKKRSHKRNKMLVYNMPPIPRPKYETIPN
FT                   AEGNSYDTLRLHPHSIQSPIDSQIEDESDFQVSNPNDFVGSMTSNLTIQPGAEKQLPYD
FT                   SVDSECVICLEELKPGDKVGRLECLCVFHYKCIKDWFNKKGYGECPVHFLHQ"
FT   gene            complement(<638390..>639823)
FT                   /locus_tag="DEHA2E08052g"
FT                   /old_locus_tag="DEHA0E08583"
FT                   /old_locus_tag="DEHA-IPF12243"
FT                   /old_locus_tag="DEHA-CDS3024.1"
FT   CDS_pept        complement(638390..639823)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08052g"
FT                   /old_locus_tag="DEHA0E08583"
FT                   /old_locus_tag="DEHA-IPF12243"
FT                   /old_locus_tag="DEHA-CDS3024.1"
FT                   /product="DEHA2E08052p"
FT                   /note="highly similar to uniprot|P38712 Saccharomyces
FT                   cerevisiae YHR065C RRP3 Required for maturation of the 35S
FT                   primary transcript of pre-rRNA and is required for
FT                   cleavages leading to mature 18S RNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87892"
FT                   /db_xref="GOA:Q6BQ61"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ61"
FT                   /protein_id="CAG87892.2"
FT                   /translation="MSVKVDGMINKKSKTHSKKLDARALAEKIKKNALKQQAQEEPAKE
FT                   ENVAENFDTVVDPTAELKFKSFNELKLIPELLEAIQQMKFTKPTPIQSEAIPHALEGKD
FT                   IIGLAQTGSGKTAAFAIPILQALWEAQAAYYGLVLAPTRELAYQIKETFDALGSSMGLR
FT                   SVCIVGGMDMMDQARDLMRKPHILVATPGRIMDHLEHTKGFSLKNLKYLVMDEADRLLD
FT                   MDFGPALDKILKIIPTQRTTYLFSATMTNKIAKLQRASLHNPVRVAVSNKYQTADNLVQ
FT                   SMMLVSDGYKNTYLIHLLNEFLGKSIIIFTRTCAHSQRTALLARILGFSAVPLHGQLTQ
FT                   AQRLGSLNKFKAGKANILIATDVAARGLDIPSVDIVINYDIPTDSKAYIHRVGRTARAG
FT                   KSGKSISLITQYDLEMYLRIESVLGKKLPKDPSPSKAVLDTLHVHVDRASAEAIRQTKD
FT                   FHEKRNPKKNRDDRDREER"
FT   gene            <640025..>641281
FT                   /locus_tag="DEHA2E08074g"
FT                   /old_locus_tag="DEHA0E08591g"
FT                   /old_locus_tag="DEHA-IPF12242"
FT                   /old_locus_tag="DEHA-CDS3006.1"
FT   CDS_pept        640025..641281
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08074g"
FT                   /old_locus_tag="DEHA0E08591g"
FT                   /old_locus_tag="DEHA-IPF12242"
FT                   /old_locus_tag="DEHA-CDS3006.1"
FT                   /product="DEHA2E08074p"
FT                   /note="similar to uniprot|Q12153 Saccharomyces cerevisiae
FT                   YDR312W SSF2 high copy suppressor of G beta subunit
FT                   temperature sensitive mutation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87893"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ60"
FT                   /protein_id="CAG87893.2"
FT                   /translation="MAKRRQKTRTHKKVSEEELAKIPRSMVIRLGSSLRNHSLSQLVKD
FT                   FRNIMQPHTAINLRERKSNKLKDFIVMAGPLGVSDLFIFNQSEETGSISLRIGKMPRGP
FT                   TLQFRVNNYSLIKDVSRILKHPKSVGKDSPEFLNPPLLVLNGFSNKLNEVENHEKLLIT
FT                   VFQNMFPPIQPQSTKVSSIKRVLMVNKNAETGEIDLRHYAIDTKLVDGSRNVKKLLNSH
FT                   HNLKKSLPNLSANSDVSDLLLDPYSVGGITSDSEVEDDAIVEIKNSEDANVLKKKTASE
FT                   EKETANPQTRKRAIKLTELGPRINMTLMKIEENLTGSSKTLYHANINKSEAEQNELNRK
FT                   HELRQKQKAERRAKQQANVDAKEETKKAKKERRKARQNGEEPEQGEDEPMTESDSDSDA
FT                   PEIKAEDYENDSDLYSDVE"
FT   gene            complement(<641304..>641957)
FT                   /locus_tag="DEHA2E08096g"
FT                   /old_locus_tag="IPF_12241"
FT   CDS_pept        complement(641304..641957)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08096g"
FT                   /old_locus_tag="IPF_12241"
FT                   /product="DEHA2E08096p"
FT                   /note="weakly similar to uniprot|P38784 Saccharomyces
FT                   cerevisiae YHR060W VMA22 Protein involved in vacuolar
FT                   H+-ATPase assembly or function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87894"
FT                   /db_xref="GOA:Q6BQ59"
FT                   /db_xref="InterPro:IPR040357"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ59"
FT                   /protein_id="CAG87894.1"
FT                   /translation="MSNSIDKITSIFEDISIKYEEPSDEGFKLISKSETSLSPIDDKTI
FT                   RLLGLIDSYERLTNENRLNYINGFLNLSRANYNNGSLSKKYGADSFDFRPYGACKKIKV
FT                   SDKFELVDLLKEQKTRNEKPKVDNINEEDAAQSTLKNRKTNEIETEKESDDINEIESQE
FT                   PKLKDPITQFGGLVPYQLRQSQNFFGNSLAISIKIINLQRAIKELIEDIEEISK"
FT   gene            complement(<642045..>643109)
FT                   /locus_tag="DEHA2E08118g"
FT                   /old_locus_tag="IPF_12240"
FT   CDS_pept        complement(642045..643109)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08118g"
FT                   /old_locus_tag="IPF_12240"
FT                   /product="DEHA2E08118p"
FT                   /note="weakly similar to uniprot|Q12524 Saccharomyces
FT                   cerevisiae YLR151C PCD1 Peroxisomal nudix pyrophosphatase
FT                   with specificity for coenzyme A and CoA derivatives may
FT                   function to remove potentially toxic oxidized CoA disulfide
FT                   from peroxisomes to maintain the capacity for
FT                   beta-oxidation of fatty acids"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65786"
FT                   /db_xref="GOA:B5RTX4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX4"
FT                   /protein_id="CAR65786.1"
FT                   /translation="MPVTSEELFLINVRTYQPPNISCPSHSIWHKVPVARRSAVFVLLF
FT                   LGNMGELRVILTKRSSKLRSFPGHISLPGGKADSGLETEWQVARREMEEEIGLEANNEK
FT                   LMKHYGFKIDHLNLLPCYLSRTFSAVKPCIGFMNLSSEHEQELFGNLKLNLNPDESSSI
FT                   FSCPLKDFLYPSTKSPSRECIKRQFFKIEWGGIPWNLRSYTFAHENEHEIHWLREVSDT
FT                   SMSSEEEPEDNPSMKEKAKSMPKRDLSTWGRLGTRRDSDTDQKINDVWGLTANILHDLA
FT                   QIIYCQPTVYKNKTFGEEELINSVFTQGNLMQEKERSEEEVKLIHSKTINEEFGFNSIL
FT                   PKDEFLRLKEIYRH"
FT   gene            complement(<643323..>644432)
FT                   /locus_tag="DEHA2E08140g"
FT                   /old_locus_tag="DEHA0E08657g"
FT                   /old_locus_tag="DEHA-IPF12238"
FT                   /old_locus_tag="DEHA-CDS3463.1"
FT   CDS_pept        complement(643323..644432)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08140g"
FT                   /old_locus_tag="DEHA0E08657g"
FT                   /old_locus_tag="DEHA-IPF12238"
FT                   /old_locus_tag="DEHA-CDS3463.1"
FT                   /product="DEHA2E08140p"
FT                   /note="uniprot|Q6VPR1 Debaryomyces hansenii GPD Sn-glycerol
FT                   3- phosphate dehydrogenase NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87896"
FT                   /db_xref="GOA:W0TYS3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS3"
FT                   /protein_id="CAG87896.1"
FT                   /translation="MTSTPFNIEKPFRVAIIGSGNWGTAVAKIVSENTAEKPEVFEKQV
FT                   NMWVFEEEVDGQKLTEIINTKHENVKYLPEVKLPENLVANPDVVDTVKDADLLIFNIPH
FT                   QFLPRVCKQLVGHVKPSARAISCLKGLEVGPEGCKLLSQSINDTLGVHCGVLSGANIAN
FT                   EVARERWSETTIAYNIPEDFRGKGRDIDEYVLKQLFHRTYFHVRVINDIIGASFAGALK
FT                   NVVACAVGFVIGAGWGDNAKAAIMRIGIREIIHFASYYQKFGVKGPAPESTTFTEESAG
FT                   VADLITTCSGGRNVKVARYMIENNVDAWEAEKIVLKGQSSQGILTAKEVHELLTNYNLS
FT                   NEFPLFEATYRIIYENADVNEFPVILERD"
FT   gene            <644878..>645045
FT                   /locus_tag="DEHA2E08162g"
FT                   /old_locus_tag="DEHA0E08679g"
FT                   /old_locus_tag="DEHA-IPF12235"
FT                   /old_locus_tag="DEHA-CDS8488.1"
FT   CDS_pept        644878..645045
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08162g"
FT                   /old_locus_tag="DEHA0E08679g"
FT                   /old_locus_tag="DEHA-IPF12235"
FT                   /old_locus_tag="DEHA-CDS8488.1"
FT                   /product="DEHA2E08162p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87897"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ57"
FT                   /protein_id="CAG87897.2"
FT                   /translation="MFCNFRSTSNGVCDLLGLEEGIESVAAIKEQYERKLEANKRLGTK
FT                   GVCEGYCNYH"
FT   gene            complement(<645571..>646812)
FT                   /locus_tag="DEHA2E08184g"
FT                   /old_locus_tag="IPF_12233"
FT   CDS_pept        complement(645571..646812)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08184g"
FT                   /old_locus_tag="IPF_12233"
FT                   /product="DEHA2E08184p"
FT                   /note="weakly similar to uniprot|O74211 Yarrowia lipolytica
FT                   YALI0E06831g Peroxin Peroxisome biogenesis factor 20"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65787"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX5"
FT                   /protein_id="CAR65787.1"
FT                   /translation="MDAANCGPSNALQNLSKHTQRDNTLQNEIIRNQPQQGNGFRNQAI
FT                   VDQRLNQDFQQFSNGQAFNQYQPEPVHQQFHQHHRQHNQAQHSQHHPQQGWVQDFSKMS
FT                   INQQPRHQAGNIQNGKVQNDWHQQFMNQTSQHPAQNNVAYQPQHQMGGFRMNMRTNLSN
FT                   SLYQTRGNVPEHKEMHKMEEENQIFDAQFDQMERELQHENMSNEQTAEVQMDGNEFEKE
FT                   QFAKTAKQVQESMLKGENAETNAKFQNSNFLKLMSSISNRSVELSAEGDKLVSKQSGED
FT                   IRDNPEVVTSQTPTPVPVSQYDQYTNHIPMSQDDMPTQEPQTSHLPDPLAHIKKGSIEG
FT                   DVSPFQAAQIVTGNQVKTSDWMEDDDWLDMTEDAPFPVMGGPQRMPPKHPRNNIMSDEW
FT                   QEVYDDYKHDDDFN"
FT   gene            complement(<647084..>648172)
FT                   /locus_tag="DEHA2E08206g"
FT                   /old_locus_tag="DEHA0E08723g"
FT                   /old_locus_tag="DEHA-IPF12230"
FT                   /old_locus_tag="DEHA-CDS3545.1"
FT   CDS_pept        complement(647084..648172)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08206g"
FT                   /old_locus_tag="DEHA0E08723g"
FT                   /old_locus_tag="DEHA-IPF12230"
FT                   /old_locus_tag="DEHA-CDS3545.1"
FT                   /product="DEHA2E08206p"
FT                   /note="similar to uniprot|P36059 Saccharomyces cerevisiae
FT                   YKL151C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87899"
FT                   /db_xref="GOA:Q6BQ55"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ55"
FT                   /protein_id="CAG87899.2"
FT                   /translation="MLKNKTQKELLQLCRTIIQPLAPNFHKGQSGKIAVIGGSEDYTGA
FT                   PFFASHSSALLGADLSHIICEKMASPVLKSYSPDLMVHPYLYELQSPEMKEHLSKSEVD
FT                   ALLRLTVEDVVVKDQRQLDEIIEDVILPKIVGLLERIDIVVIGPGFGRDPLMLKTLVKI
FT                   IEQLKVMNKPMILDADALYLLSIDPSLVKNYSKAIITPNVVEFDRLAKKLNVKFSINET
FT                   DVSNLIESSINLSQKLGNVTVIQKNFKEIMVRDGEYLINELEGSNRRVGGQGDTLTGAI
FT                   ATFVNWSNNYNDGLWDPTSKKDKLSSEDSNLLACFAASSTVRLAASKAFAKYGRSMQTS
FT                   NVHEFLGKAYDELFENDNYIKL"
FT   gene            <648490..>649389
FT                   /locus_tag="DEHA2E08228g"
FT                   /old_locus_tag="DEHA0E08745g"
FT                   /old_locus_tag="DEHA-IPF12228"
FT                   /old_locus_tag="DEHA-CDS4243.1"
FT   CDS_pept        648490..649389
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08228g"
FT                   /old_locus_tag="DEHA0E08745g"
FT                   /old_locus_tag="DEHA-IPF12228"
FT                   /old_locus_tag="DEHA-CDS4243.1"
FT                   /product="DEHA2E08228p"
FT                   /note="similar to uniprot|P36060 Saccharomyces cerevisiae
FT                   YKL150W MCR1 Mitochondrial NADH-cytochrome b5 reductase
FT                   involved in ergosterol biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87900"
FT                   /db_xref="GOA:Q6BQ54"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ54"
FT                   /protein_id="CAG87900.1"
FT                   /translation="MSFTRQLTKNLTSFKVLAPFAAAVGSVGIAYQYSTSSIMNETGKT
FT                   FTGNDEWIDLKLAKSWDTTHNTKHFVFELANQDDVSGLINASCLLTKFVTPKGNNVIRP
FT                   YTPISDVDGKGSIEFVIKKYDGGKMSSHIHDLKPNDTLAFKGPVVKWKWEPNQYKSIAL
FT                   IGGGTGITPLYQLMHEITKNPEDKTKVNLFYGNLTEKDILIKKELDTIAEKHKDQVNVV
FT                   YFLDKAPENWNGETGYISKEFLQSKLPGPGKDNKVFVCGPPGLYKALSGPKKSPTDQGE
FT                   VEGALADLGYTKENVFKF"
FT   gene            <649567..>651108
FT                   /locus_tag="DEHA2E08250g"
FT                   /old_locus_tag="DEHA0E08767g"
FT                   /old_locus_tag="DEHA-IPF12227"
FT                   /old_locus_tag="DEHA-CDS2233.1"
FT   CDS_pept        649567..651108
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08250g"
FT                   /old_locus_tag="DEHA0E08767g"
FT                   /old_locus_tag="DEHA-IPF12227"
FT                   /old_locus_tag="DEHA-CDS2233.1"
FT                   /product="DEHA2E08250p"
FT                   /note="weakly similar to uniprot|P24309 Saccharomyces
FT                   cerevisiae YKL149C DBR1 RNA lariat debranching enzyme
FT                   involved in intron turnover"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87901"
FT                   /db_xref="GOA:Q6BQ53"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007708"
FT                   /db_xref="InterPro:IPR041816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ53"
FT                   /protein_id="CAG87901.2"
FT                   /translation="MQSTRTLRIAVEGCCHGELDKIYQALPDKLDLLLICGDFQAIRNM
FT                   VDLKTMSVPEKYKKLGDFHDYYSGVKVAPVLTIFIGGNHESSSYLKELKYGGWVAPNIY
FT                   YLGEFGCVWFKGLQIGGISGIYNQRSFYDSIRSDNKDEKLPYNPHTIRSIYQVKAKNYL
FT                   KMYLMDHHRLDIVLSHDWPQHIEKKGNLGKLLKEKHFFKADINNGTLGSPLNNVLLDRL
FT                   KPRYWFASHLHVRFQALVKHSAKRSNNEVSDSVSKKSKSNIDESNDNKQNNEKIELEMD
FT                   DDTDTNKLELNMDEVENNEAIKLDMDDNSSNEETKLGIDNRSNTEEIKLNMDDFDSTPS
FT                   TSDQLQPKVDNEVLETHFLALDKCLPRRKFLEIMEIEVPDENISHPSYSQDNKASLDLK
FT                   TQQPSLYYDKRSIAINKVIESFIDGNLKIWNSIHQGDFYNFIHKQFDLHNELRDEIDFE
FT                   LNKLSNLPSDALQIDPNSFQVIAPTSNGERIPLKYWENNQTTEYCSKFQVPYNKL"
FT   gene            <651374..>651445
FT                   /locus_tag="DEHA2E08272r"
FT                   /old_locus_tag="Deha0E.8"
FT   tRNA            651374..651445
FT                   /locus_tag="DEHA2E08272r"
FT                   /old_locus_tag="Deha0E.8"
FT                   /note="tRNA Gln (TTG) cove score=66.25"
FT   gene            <651533..>652798
FT                   /locus_tag="DEHA2E08294g"
FT                   /old_locus_tag="DEHA0E08811g"
FT                   /old_locus_tag="DEHA-IPF12226"
FT                   /old_locus_tag="DEHA-CDS2979.1"
FT   CDS_pept        651533..652798
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08294g"
FT                   /old_locus_tag="DEHA0E08811g"
FT                   /old_locus_tag="DEHA-IPF12226"
FT                   /old_locus_tag="DEHA-CDS2979.1"
FT                   /product="DEHA2E08294p"
FT                   /note="weakly similar to uniprot|P53270 Saccharomyces
FT                   cerevisiae YGR117C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87902"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016520"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ52"
FT                   /protein_id="CAG87902.2"
FT                   /translation="MNIETHIAQFLKENNYPETLKAFEREYGKPFSVSPNESLQSIIED
FT                   RYNYKALNAQTKDLELSTPLNDELNAILNNQVNEWAVPYPKDPKLVTDSIDGLVISSCL
FT                   VFNENTPILFLGTSKTKLYVINLSSNEVLLESTGFIGKCVIKNITIASDNKLVLSGMNG
FT                   KLHLCEYSYGETFEIKSIDELQAHPRLIVDTKSIQFNNDTYVFTLGWDFTLKVFTVRDR
FT                   FTPITQYKLSTQGTSFDVTVFADKITLVVGLNETTLLSVFHLIETDLVLSYKISLNDAQ
FT                   FTLSTFSPRCISIQSLPSGVPLIAVATSHEPYMRLIIVPLKDSTAKGSVPIERDQILKN
FT                   LSTLSPQDKYSQPIIRWKSSSNSKNNGVWVVGEDGTIRGIDLIQERVITNYQKHDGRIK
FT                   SFTLAGDRLITCGTDKLVYQWV"
FT   gene            <653081..>654106
FT                   /locus_tag="DEHA2E08316g"
FT                   /old_locus_tag="DEHA0E08833g"
FT                   /old_locus_tag="DEHA-IPF12224"
FT                   /old_locus_tag="DEHA-CDS3770.1"
FT   CDS_pept        653081..654106
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08316g"
FT                   /old_locus_tag="DEHA0E08833g"
FT                   /old_locus_tag="DEHA-IPF12224"
FT                   /old_locus_tag="DEHA-CDS3770.1"
FT                   /product="DEHA2E08316p"
FT                   /note="similar to uniprot|Q06497 Saccharomyces cerevisiae
FT                   YPR128C ANT1 Peroxisomal adenine nucleotide transporter
FT                   involved in beta-oxidation of medium-chain fatty acid
FT                   required for peroxisome proliferation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87903"
FT                   /db_xref="GOA:Q6BQ51"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ51"
FT                   /protein_id="CAG87903.1"
FT                   /translation="MSLTPLEKAASGALASAFANSLVYPLDLSKTLIQTQVKKHDKEVL
FT                   GGEPSTPEDSQTLKNTKDGEVKYKNTLDVLRKIYAKKGVLGWYHGLASSILGTTAQNFS
FT                   YFYWYTIVKRVYANLYKHIPNHKPTTATELFLGALAACISQLFTMPIGVITTQQQTDKT
FT                   HKNLYQLFREILDQDGICGLWRGLRVSMVLCINPSITYGSYERLKQILYNSKEFLGPLE
FT                   SFSIGVLAKSMATIVTQPLIVSKAMLQKKAHKKQTPTGDKEAYGNEEEDDEEDIKFDAF
FT                   THALAHLWKTEKFRGLYKGVAPQLLKGVFVQGLLFMFKDQIDLFFLFLLKLIKTKKIIS
FT                   R"
FT   gene            <654634..>655071
FT                   /locus_tag="DEHA2E08338g"
FT                   /old_locus_tag="DEHA0E08855g"
FT                   /old_locus_tag="DEHA-IPF12222"
FT                   /old_locus_tag="DEHA-CDS6176.1"
FT   CDS_pept        654634..655071
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08338g"
FT                   /old_locus_tag="DEHA0E08855g"
FT                   /old_locus_tag="DEHA-IPF12222"
FT                   /old_locus_tag="DEHA-CDS6176.1"
FT                   /product="DEHA2E08338p"
FT                   /note="highly similar to uniprot|P32827 Saccharomyces
FT                   cerevisiae YPR132W RPS23B Ribosomal protein 28 (rp28) of
FT                   the small (40S) ribosomal subunit required for
FT                   translational accuracy"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87904"
FT                   /db_xref="GOA:Q6BQ50"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ50"
FT                   /protein_id="CAG87904.1"
FT                   /translation="MGNSKPRGLNSARKLRVHRRNNRWADQAYKSRLLGTAFKSSPFGG
FT                   SSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKRVTAFVPNDGCLNFVDENDEVLL
FT                   AGFGRRGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
FT   gene            complement(<655377..>656591)
FT                   /locus_tag="DEHA2E08360g"
FT                   /old_locus_tag="DEHA0E08877g"
FT                   /old_locus_tag="DEHA-IPF12220"
FT                   /old_locus_tag="DEHA-CDS3130.1"
FT   CDS_pept        complement(655377..656591)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08360g"
FT                   /old_locus_tag="DEHA0E08877g"
FT                   /old_locus_tag="DEHA-IPF12220"
FT                   /old_locus_tag="DEHA-CDS3130.1"
FT                   /product="DEHA2E08360p"
FT                   /note="similar to uniprot|Q06505 Saccharomyces cerevisiae
FT                   YPR133C IWS1 Protein that interacts with Spt6p and
FT                   copurifies with Spt5p and RNA polymerase II probable
FT                   transcriptional elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87905"
FT                   /db_xref="GOA:Q6BQ49"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ49"
FT                   /protein_id="CAG87905.2"
FT                   /translation="MSDKEGETALYNDREEEARQFFSDSAEPQSQGGSNELAVNENEDN
FT                   NNDEVEDDADENIYSIQAHKITGDEENNREVTMKKNVRKAKKYDEFKNERDEQGFVPMG
FT                   ENPEYGGMDYSNEDPQARKRRLLEEKMESAIKSKTSRRRRADEDDLERMQDDRIDFLKD
FT                   QMIKAANLDVEKNSQGQIATEKLKLLNEVVDILSKADLAISILDNNLLEAVRLWLEPLP
FT                   DASMPAYQIQKELIHSLTVLPIKTDHLIASGIGKVLVYYQRSKRTEANLKKVVDRLIGD
FT                   WTRPILNKSDSYKDRTIQFNEYNKNRFTNQLSSARRSKPKEAKSLYEESAERRKRAAIP
FT                   AARTTAYKIAPKVDPSLLRRQQLNSNGNNDERFKRINQKLTSMNFKKKSSKKSGPSIEG
FT                   RNLTI"
FT   gene            <657206..>658183
FT                   /locus_tag="DEHA2E08382g"
FT                   /old_locus_tag="DEHA0E08899g"
FT                   /old_locus_tag="DEHA-IPF12218"
FT                   /old_locus_tag="DEHA-CDS3959.1"
FT   CDS_pept        657206..658183
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08382g"
FT                   /old_locus_tag="DEHA0E08899g"
FT                   /old_locus_tag="DEHA-IPF12218"
FT                   /old_locus_tag="DEHA-CDS3959.1"
FT                   /product="DEHA2E08382p"
FT                   /note="similar to uniprot|P45978 Saccharomyces cerevisiae
FT                   YPR129W SCD6 Protein containing an Lsm domain may bind RNA
FT                   and have a role in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87906"
FT                   /db_xref="GOA:Q6BQ48"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025609"
FT                   /db_xref="InterPro:IPR025761"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR025768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ48"
FT                   /protein_id="CAG87906.2"
FT                   /translation="MSQYIGKTISLISNKGLRYVGLLDNINADDATVALKSVRSFGTEG
FT                   RMAASGNANLEVHPGTDVYDYVVFRGSDVKDLTVLDTPIDQVKPEPYTQAPAPGGYPAY
FT                   QQQPQTQTQQKPQKAPAPSTTSAAPAKAASAPTQTSAPKQRAQKPSETQTQPQAPTPSQ
FT                   TQQQSQPQATPTSARTEETGKEENASPAQPRPQEHPQSGLQKNVSKVSNVPETAFDFES
FT                   ANAKFSRDIDSEKDAEQPMYNKQSSFFDNISSSADEKNTMRWAEEKNLNLDTFGESSVN
FT                   NRGRGRGRGRGNWRGGRGNWRGGRGRGRGGNRSNNDYNSKPEWA"
FT   gene            complement(<658258..>660714)
FT                   /pseudo
FT                   /locus_tag="DEHA2E08395g"
FT                   /note="similar to uniprot|P50505|HAK1_DEBOC High affinity
FT                   potassium transporter"
FT   gene            complement(<660813..>660926)
FT                   /locus_tag="DEHA2E08404g"
FT                   /old_locus_tag="DEHA0E08965g"
FT                   /old_locus_tag="DEHA-IPF12210"
FT                   /old_locus_tag="DEHA-CDS8801.1"
FT   CDS_pept        complement(660813..660926)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08404g"
FT                   /old_locus_tag="DEHA0E08965g"
FT                   /old_locus_tag="DEHA-IPF12210"
FT                   /old_locus_tag="DEHA-CDS8801.1"
FT                   /product="DEHA2E08404p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87909"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ47"
FT                   /protein_id="CAG87909.1"
FT                   /translation="MTSVLLNIGQNTLSDVKTPPIKFYFNSEGFIINVQYS"
FT   gene            complement(<660947..>661120)
FT                   /locus_tag="DEHA2E08426g"
FT                   /old_locus_tag="IPF_43154"
FT   CDS_pept        complement(660947..661120)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08426g"
FT                   /old_locus_tag="IPF_43154"
FT                   /product="DEHA2E08426p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65788"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX6"
FT                   /protein_id="CAR65788.1"
FT                   /translation="MSLYYSNECEFIVVNRPIRYKIANTNQKSRSKSQAIVRQYGIFCY
FT                   PGTVNNKILKAK"
FT   gene            complement(<661509..>662870)
FT                   /locus_tag="DEHA2E08448g"
FT                   /old_locus_tag="DEHA0E08987g"
FT                   /old_locus_tag="DEHA-IPF12209"
FT                   /old_locus_tag="DEHA-CDS2698.1"
FT   CDS_pept        complement(661509..662870)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08448g"
FT                   /old_locus_tag="DEHA0E08987g"
FT                   /old_locus_tag="DEHA-IPF12209"
FT                   /old_locus_tag="DEHA-CDS2698.1"
FT                   /product="DEHA2E08448p"
FT                   /note="weakly similar to uniprot|P38866 Saccharomyces
FT                   cerevisiae YHR176W FMO1 Flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87910"
FT                   /db_xref="GOA:Q6BQ46"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ46"
FT                   /protein_id="CAG87910.2"
FT                   /translation="MMSVRYTRIAIIGGGPAGLAAAKSFGLSPTNFEVDLFERNDNLGG
FT                   VWLYTGKKPNGLKEIKDINNPSVGRNELFSPMYKYLETNITGKLMQYANSTFPPDAFVY
FT                   PTRQEVFQYLQEYSNTIPQSTKIHLNSNVLSLTKKNSIWEVQVENLKDKKTSIKQYDAI
FT                   VLANGHFEVPFIPRVNGLNSWHIKSPSSITHAKYFTDPNDFANKNVLVVGSSSSGTDIA
FT                   IQLTVRCNKVYVSNRSNSLGPEFKNLRAKVIGLITKYDFDNNRSVTTAEGETVSDIDAV
FT                   IFCTGYRYDFPFLKSYMDDGSIIDAEGTMVHNIYKQMFYIPDPSLAFFALPKQIVPMPL
FT                   AESQAAVLSRVFSGKMELPDKETMISEYSKELEMKGKEFHNLKFPADADYCKSLQEWID
FT                   SNNLTNYGLHAPTWDKEKYEDRSISGSMKSDRISEVIEHANTLRDKGEGFRLLR"
FT   gene            <663717..>666401
FT                   /locus_tag="DEHA2E08470g"
FT                   /old_locus_tag="IPF_12206"
FT   CDS_pept        663717..666401
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08470g"
FT                   /old_locus_tag="IPF_12206"
FT                   /product="DEHA2E08470p"
FT                   /note="similar to uniprot|Q01454 Saccharomyces cerevisiae
FT                   YPR135W CTF4 Chromatin-associated protein required for
FT                   sister chromatid cohesion"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65789"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX7"
FT                   /protein_id="CAR65789.1"
FT                   /translation="MIEDKITAFPNGNSFVRYHPAIEKLVIGNSEGLIKIFNINEPDLE
FT                   PVSIDINENLTSLSFHSNSLLVTNTSGNLELINLNENESKGTIYRSELPLRDSVFINEG
FT                   KRLLCGGDDNKLVLIDMLNDKSVSTLPIPDQLLNMAYNMTGEILSLSLSNGNIQIYSVI
FT                   NEVPNLIETITSILPVKINSSLDTIDYIGENNDELISTKTQWSSNGESLLIPTSSNSIK
FT                   VYDRSSWTDFVKEFKLDHSDVRIVDFELSPNNKHLAVGYKDLTLKVFDFNSKKLLKDVK
FT                   LELQDGHYPTNLIWSEIPRSSNYNLCIGTTNGCIVTYSDLVGKDSEPISGNLFLDEAEE
FT                   SDANNTDDLFNDSDDEEQALAKPNGILHEEDSLVIDQDDEDENDNNEMPDYYNKDVDSY
FT                   LDERRSNKRFKLNGSKYKSPSPYISDRSSENKEFELQPYSPGSTPWSQSQSKSLSDTDR
FT                   RYLAMNSIGYIWSVKTASNPENLNQQSITISFFDRSINKDYHFIDYYQYDLCSMNEKGV
FT                   LLACSGYKDKTGKLGGKVLYRFHDTVQDSWERNIPLLKDEFITSVSLTNNSRIENDYSD
FT                   ALIIIGTNLGYVRFFNLHGLCINLIKTPPVVTLMASSSSIIFMINQISPNVYTYSIIDV
FT                   NQDYKFIQQDVLLPLKKCTKYPNLPLIKGVFFNEYNDPCLVPGIDDTVLILSTWRETNN
FT                   AKWIPILNCKEVITENGNSESKKNWKCWPLGLYKDQLNCLILKTDNQYPGFPLPLPIEL
FT                   DIKLPVTNGKSKENEVNGGTDASKNEDDAEETFLRASTMGRIVNDSLNDGENEEFNDEI
FT                   LERLQNYSMIFDKSLLKLFASACQESRLNKALSIAKLIKNDKALMAASKISERLEFLNL
FT                   ASKISKLREDLVNLSEGEDDDEN"
FT   gene            complement(<666541..>666690)
FT                   /locus_tag="DEHA2E08492g"
FT                   /old_locus_tag="DEHA0E09031g"
FT                   /old_locus_tag="DEHA-IPF12205"
FT                   /old_locus_tag="DEHA-CDS8863.1"
FT   CDS_pept        complement(666541..666690)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08492g"
FT                   /old_locus_tag="DEHA0E09031g"
FT                   /old_locus_tag="DEHA-IPF12205"
FT                   /old_locus_tag="DEHA-CDS8863.1"
FT                   /product="DEHA2E08492p"
FT                   /note="similar to uniprot|P80967 Saccharomyces cerevisiae
FT                   YPR133W-A TOM5 Small mitochondrial outer membrane protein
FT                   crucial to a binding relay for the import of proteins into
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87912"
FT                   /db_xref="GOA:Q6BQ44"
FT                   /db_xref="InterPro:IPR019603"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ44"
FT                   /protein_id="CAG87912.1"
FT                   /translation="MFGGPGSQPSEDQKKLQEKYAVDTLKTAGFIAGALWVAPIIFHYI
FT                   KRQL"
FT   gene            <666875..>667462
FT                   /locus_tag="DEHA2E08514g"
FT                   /old_locus_tag="DEHA0E09053g"
FT                   /old_locus_tag="DEHA-IPF12204"
FT                   /old_locus_tag="DEHA-CDS5409.1"
FT   CDS_pept        666875..667462
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08514g"
FT                   /old_locus_tag="DEHA0E09053g"
FT                   /old_locus_tag="DEHA-IPF12204"
FT                   /old_locus_tag="DEHA-CDS5409.1"
FT                   /product="DEHA2E08514p"
FT                   /note="similar to uniprot|Q06504 Saccharomyces cerevisiae
FT                   YPR131C NAT3 Catalytic subunit of the NatB N-terminal
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87913"
FT                   /db_xref="GOA:Q6BQ43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ43"
FT                   /protein_id="CAG87913.2"
FT                   /translation="MTSIKPFQIEDLFEINPVNLDPLTENFNLQFYFQYLIEWPSLFFK
FT                   SVEVSNDFNQDHEISGYMMGKNEGKLSKKEWHTHITAVTVNAQYRRIGLASDLCLHLEN
FT                   LVKDEPYETLFIDLFVKVTNVLAQHLYEKLDYSVYRRVVGYYGRDPPTDKNATDDQIDA
FT                   FDMRKSLPKDVKNETVRANGREVNVFPHEVAF"
FT   gene            <667901..>669583
FT                   /locus_tag="DEHA2E08536g"
FT                   /old_locus_tag="DEHA0E09075g"
FT                   /old_locus_tag="DEHA-IPF12203"
FT                   /old_locus_tag="DEHA-CDS1877.1"
FT   CDS_pept        667901..669583
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08536g"
FT                   /old_locus_tag="DEHA0E09075g"
FT                   /old_locus_tag="DEHA-IPF12203"
FT                   /old_locus_tag="DEHA-CDS1877.1"
FT                   /product="DEHA2E08536p"
FT                   /note="similar to CA0962|IPF9145 Candida albicans IPF9145"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87914"
FT                   /db_xref="InterPro:IPR007701"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039777"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ42"
FT                   /protein_id="CAG87914.2"
FT                   /translation="MPMRPSGHKKFLQEDVKSNSSSRSASRVRTPKVDGEENGSLDVNF
FT                   QSIEELLTMKLESLQSLLEKQSLQDESTITGNTDSQDYKQKSISNLNQARIQSGSTTIN
FT                   DIIHSLSMSRTEVSSQSREMLLAQLYKLIVSKPLVVYNEENAGTKNYVSEDKVLELIKL
FT                   LTSGDYRSPSEFLLLFRSCIGLLASDIDEFGELISQDFLNLVQRLIQDPTTQTVNSENK
FT                   ASVITGYTGLLMILHNGSSSYGIDDKVTSLIELAEGYNASSNTLTAQLRSGDREYSTFF
FT                   AEDVDKKIISDSVNQANGEAAVAIAALHGAGCLLTLIERGEYLNDYITDTMPKLVALVD
FT                   NENIEIAKAAGRIIALCYEIFTYDNSGDADEETEYNANSPYYEQEELSAIIERLANFST
FT                   HKITKKNKKETHSIFRDILYTIANYTSYEKRIEILKKSPEGIDIINSLMDSNYIKLSKT
FT                   RSLAINSWFLYLRLIHLKWCFSFGVHNQLVSNDTIRDILKEPPSDYQLKYGGNDAYGDE
FT                   DYDDSFNISVSDKFATDDKKRTEQIRKARVNKLAETIEDLEIK"
FT   gene            complement(<669635..>670360)
FT                   /locus_tag="DEHA2E08558g"
FT                   /old_locus_tag="DEHA0E09097g"
FT                   /old_locus_tag="DEHA-IPF12202"
FT                   /old_locus_tag="DEHA-CDS4909.1"
FT   CDS_pept        complement(669635..670360)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08558g"
FT                   /old_locus_tag="DEHA0E09097g"
FT                   /old_locus_tag="DEHA-IPF12202"
FT                   /old_locus_tag="DEHA-CDS4909.1"
FT                   /product="DEHA2E08558p"
FT                   /note="similar to uniprot|P38774 Saccharomyces cerevisiae
FT                   YHR044C DOG1 2-deoxyglucose-6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87915"
FT                   /db_xref="GOA:Q6BQ41"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ41"
FT                   /protein_id="CAG87915.1"
FT                   /translation="MSHKSIIADFLLFDLDGTLVNSTLAVEKTWIEQCNNHNSTNEVPI
FT                   DAEILLNSAHGTRTAETIKRWFPYLQNDKESINLFEKAIVTNYGHLAEEVKGATHLIDS
FT                   INKFGSNQWAIITSGTKDLAYGWFEKLFVNSGKPKVFITANDVSQGKPNPEGYLEAFSQ
FT                   LKETNKLVGHEFSAVVFEDAPVGIQAGIAAGFHVIGIATTFDKDTLINAGSSFVVEDLS
FT                   KIHITKTTSTSFQLDLDIL"
FT   gene            complement(<670727..>672347)
FT                   /locus_tag="DEHA2E08580g"
FT                   /old_locus_tag="DEHA0E09119g"
FT                   /old_locus_tag="DEHA-IPF40043"
FT   CDS_pept        complement(join(670727..672103,672165..672347))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08580g"
FT                   /old_locus_tag="DEHA0E09119g"
FT                   /old_locus_tag="DEHA-IPF40043"
FT                   /product="DEHA2E08580p"
FT                   /note="similar to uniprot|O93999 Candida albicans Possible
FT                   zinc- finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87916"
FT                   /db_xref="GOA:Q6BQ40"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ40"
FT                   /protein_id="CAG87916.2"
FT                   /translation="MTERVLKSNLDSSISPYNRYGGVNRTKVAKNAPKNLKKNGTLRGK
FT                   KRSKNGCLSCKKLRIKCDESKPRCEYCVHTSRECVYPVEEVARIEDGSKDTIDINGTIN
FT                   TKDTRLETVQTKWQMVEEEQDPAKTFGGLTCELMLNSSTKLLNISTFELRLLNFFNAYC
FT                   IPLISFGVNMRADRTWRTQVPKLFLQSDLVRQSIFSFSSINLWPLCDFEKLIDVDTDHA
FT                   VRRDMERMGNVVNYKLLTESLSLEKPEQDPSNNLFLKTSKYFMNTLKHTGNIIDRTTTD
FT                   VEPEIDEITASELSVSGILIFSFLGIHPHRLVPLVSFDHEIETDFLSIVRGVRNAIKVS
FT                   YKALATSDYFGILPLINSSIESNPITRSLRSQLSEYYDDQVKTSITSDNFATLQNSIAS
FT                   LELHMSKTIFLNYPVPLFAWILLIPDDLHELIRAKHFFALRMLYVFACLCCVTKFQLYD
FT                   SKNIWNDYIFWFKDYNFQCFNGTWNSEFDEKLYRVIFERKFRIPNNSFHLLGKFDPNSF
FT                   FE"
FT   gene            <672854..>673714
FT                   /locus_tag="DEHA2E08602g"
FT                   /old_locus_tag="DEHA0E09141g"
FT                   /old_locus_tag="DEHA-IPF12199"
FT                   /old_locus_tag="DEHA-CDS4390.1"
FT   CDS_pept        672854..673714
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08602g"
FT                   /old_locus_tag="DEHA0E09141g"
FT                   /old_locus_tag="DEHA-IPF12199"
FT                   /old_locus_tag="DEHA-CDS4390.1"
FT                   /product="DEHA2E08602p"
FT                   /note="similar to CA3657|IPF7459 Candida albicans IPF7459"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87917"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ39"
FT                   /protein_id="CAG87917.2"
FT                   /translation="MVSNTTSWEIVAYVQLIFFAIMLIGLGVVVVQKWMKGTDRGIIKR
FT                   FVGYFGIFTVLKVAGGICGIVLLHQSQYSSGLTMATYILDNVSLGLLIKSVLPFLELMV
FT                   TEKDPEALVENPFKYDTGSEDQMMNVRNVGLGKLVGTTSKKNLPFRVLTLMITAAVICT
FT                   IVGATGINSNGSNSGSSPMKAGSILFLVIIIFMAVLIAWGHSLNEDHRTMAKILLGSIA
FT                   FYIIRAVYSILSSFAGINFENPSKFLLIFGEYQYYTFLAFLEECIISMILLVNLFVFHS
FT                   PPVIQ"
FT   gene            complement(<673845..>675803)
FT                   /locus_tag="DEHA2E08624g"
FT                   /old_locus_tag="DEHA0E09163g"
FT                   /old_locus_tag="DEHA-IPF12197"
FT                   /old_locus_tag="DEHA-CDS1337.1"
FT   CDS_pept        complement(673845..675803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08624g"
FT                   /old_locus_tag="DEHA0E09163g"
FT                   /old_locus_tag="DEHA-IPF12197"
FT                   /old_locus_tag="DEHA-CDS1337.1"
FT                   /product="DEHA2E08624p"
FT                   /note="highly similar to uniprot|O14400 Schizosaccharomyces
FT                   pombe gut2 Glycerol-3-phosphate dehydrogenase mitochondrial
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87918"
FT                   /db_xref="GOA:Q6BQ38"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ38"
FT                   /protein_id="CAG87918.1"
FT                   /translation="MSKIFQTKLAKTALAAAAGVGGTIVYLDFIRPPVVSDLNNSYKPL
FT                   RKELATPPSRESLLNKLETTPKFDVIVVGGGATGTGTAVDAATRGLNVCLLEKSDFASG
FT                   TSSKSTKMAHGGVRYLEKAIFQLSKAQLDLVIEALNERGNMLRTAPHLCSVLPIMIPVY
FT                   KWWQVPYFFVGCKMYDWFAGHQNLRSSTVFSREMTSAIAPMMDDSNLKATCVYHDGTFN
FT                   DARMNATLAITAIDQGATVLNYMEVKQLVKKDDKITGVLAVDRETGKEYNINATATVNA
FT                   TGPFADKLLEMDKDPQGLPPKIDQPPRMVVPSSGVHVVLPEYYCPRDMGLLDPSTSDGR
FT                   VMFFLPWQGKVLAGTTDTPLKSVPENPIPTEEDIQDILQELQKYIVFPVNRTDVLSAWS
FT                   GIRPLVRDPSTIPEDEQPGSGSTQGLVRSHFISQSPSGLLTISGGKWTTYREMAQETVD
FT                   TLVKNYDFDGKNNALLPCQTNKIILAGGEDYSKNYSARLIHEYRIPLKLAKHLSHNYGS
FT                   RASLILELYHQSDYNKLPITLAANKSFEPSEDKESEENILSYQSFDEPFTIAELKYSLK
FT                   YEYARTPVDFLARRTRLAFLNAREALTAVDGVCAIMEHELKWDEETTKKMKFEANDYIG
FT                   KMGISPKRFDVEDFIVQ"
FT   gene            <677397..>679175
FT                   /locus_tag="DEHA2E08646g"
FT                   /old_locus_tag="DEHA0E09185g"
FT                   /old_locus_tag="DEHA-IPF12192"
FT                   /old_locus_tag="DEHA-CDS1672.1"
FT   CDS_pept        677397..679175
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08646g"
FT                   /old_locus_tag="DEHA0E09185g"
FT                   /old_locus_tag="DEHA-IPF12192"
FT                   /old_locus_tag="DEHA-CDS1672.1"
FT                   /product="DEHA2E08646p"
FT                   /note="weakly similar to uniprot|Q04228 Saccharomyces
FT                   cerevisiae YML013W SEL1 UBX (ubiquitin regulatory X)
FT                   domain-containing protein that interacts with Cdc48p has a
FT                   ubiquitin-associated (UBA) domain interacts with
FT                   ubiquitylated proteins in vivo and is required for
FT                   degradation of a ubiquitylated model substrate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87919"
FT                   /db_xref="GOA:Q6BQ37"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ37"
FT                   /protein_id="CAG87919.2"
FT                   /translation="MSIDELSDERKDLISQFQAITGLGPEEETENIHKLLRVNDWNLNN
FT                   SISTYFDSKFASVESQPISSGFEELDNQDNNTHLSHRSFGDRDNVMNLQSQFALDSFLP
FT                   RLPKAPRISNNWQLDVGIHSSLKSASSTSDAKSWEQKKSPVTSIWLILLIIPKAVLQII
FT                   ISIFRFLFGSSGNRSTSVNKFPRGFDYDNYDDSHSYLSWLASELNSESEMDINSSNEKF
FT                   DDVVEKVEEVDVRRPSVLDNFNIIDSGFNGTHEQTQSNYTWLLVILVNNDQESQDFLQN
FT                   LLINDHFNRIFNKNDGIFKETSIYLNNVEKDPESFEVGQAYKVKKLPYIMLVGNVSNNP
FT                   SILSSMSIVYKSNIPHAFISNGENIGTIKKILKNVHKLMDNFNAQLITQRIDKQEIEIS
FT                   RLLKQQQDDAYTESLEKDRLKRVQKENEIKMKHDLEELVKLRENFLFSLIQTKWFEALN
FT                   DDSSPKIKISIKLPNGKRIIEVISTSITVNDLHLYIESKIFVNDLINSTLNDCNNEDEI
FT                   FSYISSLHLPDETISVDDYVEKFSFKFELIQPFPKKVFASTNNPVSSIPELKSGVSLLV
FT                   EYLQEDSDDSESDYQT"
FT   gene            <679390..>680811
FT                   /locus_tag="DEHA2E08668g"
FT                   /old_locus_tag="DEHA0E09207g"
FT                   /old_locus_tag="DEHA-IPF12191"
FT                   /old_locus_tag="DEHA-CDS2630.1"
FT   CDS_pept        679390..680811
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08668g"
FT                   /old_locus_tag="DEHA0E09207g"
FT                   /old_locus_tag="DEHA-IPF12191"
FT                   /old_locus_tag="DEHA-CDS2630.1"
FT                   /product="DEHA2E08668p"
FT                   /note="weakly similar to uniprot|P32351 Saccharomyces
FT                   cerevisiae YIL154C IMP2 Transcriptional activator involved
FT                   in maintenance of ion homeostasis and protection against
FT                   DNA damage caused by bleomycin and other oxidants contains
FT                   a C-terminal leucine-rich repeat"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87920"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ36"
FT                   /protein_id="CAG87920.2"
FT                   /translation="MASKLSKLEAEQMAIRRQSGTMNRGRSHSPSKSGHNSRSSSISND
FT                   EFNRDLKWSITNHDPSERLVQKDIGEQNENKDDVNELWINEVSEEEHISDNEDNEKFHY
FT                   DDTGNILPNYACQDDKINEISSILENSNLHDRAVTKRLEELTANERAFANAKNIGSNVD
FT                   KDFLDKLKNDKHELTGNGLDLSKSEQDAASRKQKLENYSIYRKKIIDQENDNLKPNESN
FT                   EDESSSSSDRPEESNEKDFMIPYTSAVEDKLDSEFASKLNETIKEGEIDSNKSNSRAIQ
FT                   VITRGNFFQLINPRVKPKIFLVCMDFSPESIFALEWCLGTVLVDGSVLFIVCVIEENDN
FT                   NHHLKGNTLNESTRENQRLNTLNKAKQQVLNLLKLTKLQIHIVIEIIHHPIPRHLILEI
FT                   IENLQPTLAVVGSKGQSAIKGVLLGSLSNYLVTKSTVPVMVVREKLKKINRFKTGSSVF
FT                   SNNIKPLTLSEARVD"
FT   gene            complement(<680995..>682233)
FT                   /locus_tag="DEHA2E08690g"
FT                   /old_locus_tag="DEHA0E09229g"
FT                   /old_locus_tag="DEHA-IPF12189"
FT                   /old_locus_tag="DEHA-CDS3072.1"
FT   CDS_pept        complement(680995..682233)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08690g"
FT                   /old_locus_tag="DEHA0E09229g"
FT                   /old_locus_tag="DEHA-IPF12189"
FT                   /old_locus_tag="DEHA-CDS3072.1"
FT                   /product="DEHA2E08690p"
FT                   /note="weakly similar to CA3970|IPF6497 Candida albicans
FT                   IPF6497"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87921"
FT                   /db_xref="InterPro:IPR038886"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ35"
FT                   /protein_id="CAG87921.2"
FT                   /translation="MPKDPIDMSRNGEYLANMENEGENGALDSQQEVIEILTDDEEDNR
FT                   ESSFGSNNITNSEEPLFVREHNDDDDIQITGANTMNANERAPRIIRRRSNAAHMDQSRN
FT                   VRRRHNDDEDDIQIIDERPAERQLIPPVDMLPSYASDSLRRRVQGIETPIGVFQSNENS
FT                   STSFSGSESERGLRYTEPPRRNPLRSRRARRMRPPRNDFVALDHFVLSQQLYHNLYGNW
FT                   NGHEDLPNADAVEGSVMARIERDNENAVDQRLQNENIFNRAALKNKKEIAEKELPGYTN
FT                   DIKPDSNICCDLCGIILGEGIPDDFKPDVYYNDEENFKKFCEDYKVQAPWFCIRQCLPV
FT                   DVDLSKRVFVAKCGHIYCGRCVKNIGNRPSGRRKQNQKLTIDNPLVYAPRKCTNSECNS
FT                   SFTGKKSFTELYF"
FT   gene            complement(<682662..>683651)
FT                   /locus_tag="DEHA2E08712g"
FT                   /old_locus_tag="DEHA0E09251g"
FT                   /old_locus_tag="DEHA-IPF12188"
FT                   /old_locus_tag="DEHA-CDS3917.1"
FT   CDS_pept        complement(682662..683651)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08712g"
FT                   /old_locus_tag="DEHA0E09251g"
FT                   /old_locus_tag="DEHA-IPF12188"
FT                   /old_locus_tag="DEHA-CDS3917.1"
FT                   /product="DEHA2E08712p"
FT                   /note="highly similar to uniprot|P15646 Saccharomyces
FT                   cerevisiae YDL014W NOP1 Nucleolar protein component of the
FT                   small subunit processome complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87922"
FT                   /db_xref="GOA:Q6BQ34"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ34"
FT                   /protein_id="CAG87922.1"
FT                   /translation="MAFGAPRGRGGDRGGFGGRGGSRGGFGGARGGRGGSRGGFGGDRG
FT                   GRGGSRGGFGGDRGGRGGRGGPRGGARGGRGGARGGARGGAKVVIEPHRHAGVFIARGK
FT                   EDLLVTRNIAPGESVYGEKRISIEEPSKEEGAAPTKIEYRVWNPFRSKLAAGIMGGIDE
FT                   LGIAPGKKVLYLGAASGTSVSHVADVVGPEGMVYAVEFSHRPGRELIGMAKKRPNVIPI
FT                   IDDARHPQKYRMLIGMVDAVFADVAQPDQARIIALNSHLFLKDQGTVVISIKANCIDST
FT                   VDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYVRSGLKK"
FT   gene            <685759..>686308
FT                   /locus_tag="DEHA2E08734g"
FT   CDS_pept        join(685759..685761,685865..686308)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08734g"
FT                   /product="DEHA2E08734p"
FT                   /note="similar to uniprot|P38293 Saccharomyces cerevisiae
FT                   YBR173C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87923"
FT                   /db_xref="GOA:Q6BQ33"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ33"
FT                   /protein_id="CAG87923.2"
FT                   /translation="MSLKIVPDNNQHSSINSTKFGEPASHAPGLQDILKTQEGPLNLAS
FT                   KINNRHPLEGRISNWEETQYQTRLETYRRVFGAGEPIKRTMELELVEATDFKPQLLGGS
FT                   DSMHKDVLLNKDASVDWEDIYRGGLESGSHVQDFHTEMEKKMGM"
FT   gene            <686506..>689525
FT                   /locus_tag="DEHA2E08756g"
FT   CDS_pept        join(686506..686507,687008..689525)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08756g"
FT                   /product="DEHA2E08756p"
FT                   /note="weakly similar to uniprot|P32909 Saccharomyces
FT                   cerevisiae YBR172C SMY2 partial suppressor of myo2-66,"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87924"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ32"
FT                   /protein_id="CAG87924.2"
FT                   /translation="MSRKAQQSEFGNGHIESNQDNSQRIQSESMSPSFANSNPTIPPNK
FT                   GGKRYNMNEVFQVWFENKDQILGSNAELPVQHNENYKLSTPGQIYHLDLQPSGPTSGGQ
FT                   ANYNGSTSELIEPLENLSTTDEMDFASQMKSQGPPPGMNHPKYDPQPDYEQSSGQPQLT
FT                   ILTPDKIEWFYVDPSGNEQGPFNGDMMQEWLTDGYLNLDLKIRRKEERNYQTLKELCDK
FT                   VQNYIQPFKVPLPDLSNVGSNDDQASFSASAMHPSSSQFHQFLSSGPGNLGVGNMRLNT
FT                   SINPQSNLFGNDFMNHHNDPFSSPLTPSATNAFSNSNQFGIDPMNSGIGFNHSQPLSNP
FT                   LQHINNMPSLLSQQNPVLSGGNSGWGIDHQKRMGSTPGTPVSVAPVLPSQMSQAPMSPW
FT                   LSGVQSSSRVNSPFVPSSALAGSEKQGGSEQPSPNQDPSNQHDPVLDGIHTSVVTDILN
FT                   DGEEDLAEPVVEQPKLKQKQQKQQKQQNTTLIQEDKKNDENKAPYQSQPETQQAPESKA
FT                   GVGSSTMRVESLVQEDNEPKSTNAQPKLAPWASVTSTNQDSNTKPALTLKEIQTFEAEK
FT                   VKEQKQIEAAIKSEQLAKAKLEERVVEEKPSLPKTSNWGINANSKPVVTKKTLAEIQRE
FT                   EFEAAKAKAKVTNVSPVVSAAPKSSFATALANSVPKDDSPWTVVTPKKPLVKKPSQPTI
FT                   PTTTTPASKANPQLLRSVSAIKPTKSTANNMALKEEFLIWARSSMTNLYPTVSKDDLLD
FT                   IFTTLPSNNDSSQLISETIYSSSATMDGRRFAQEFLKRRQKVEQQIGAQDEVSWGSAII
FT                   SSADKVSTIDEEGWSTSVKSKKKGKKF"
FT   gene            <689979..>690344
FT                   /locus_tag="DEHA2E08778g"
FT                   /old_locus_tag="DEHA0E09317g"
FT                   /old_locus_tag="DEHA-IPF12177"
FT                   /old_locus_tag="DEHA-CDS6643.1"
FT   CDS_pept        689979..690344
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08778g"
FT                   /old_locus_tag="DEHA0E09317g"
FT                   /old_locus_tag="DEHA-IPF12177"
FT                   /old_locus_tag="DEHA-CDS6643.1"
FT                   /product="DEHA2E08778p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87925"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ31"
FT                   /protein_id="CAG87925.2"
FT                   /translation="MRKSNFIQKIVDNPLIQILLKASLMVSWCYQGCSELDKLFRLYDT
FT                   LLDSNNNNLSEYFQSRTLVYYMTLRDKFIDYFSYRQIKKTLHFRSIINIIQVFSCVEYH
FT                   SLQITIGRLNYPYIYIL"
FT   gene            complement(<690403..>691803)
FT                   /locus_tag="DEHA2E08800g"
FT                   /old_locus_tag="DEHA0E09339g"
FT                   /old_locus_tag="DEHA-IPF12176"
FT                   /old_locus_tag="DEHA-CDS2596.1"
FT   CDS_pept        complement(690403..691803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08800g"
FT                   /old_locus_tag="DEHA0E09339g"
FT                   /old_locus_tag="DEHA-IPF12176"
FT                   /old_locus_tag="DEHA-CDS2596.1"
FT                   /product="DEHA2E08800p"
FT                   /note="similar to ca|CA0742|IPF3259 Candida albicans
FT                   IPF3259 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87926"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ30"
FT                   /protein_id="CAG87926.2"
FT                   /translation="MHTQAHLNPTELSILSIPRENCWIFASPILRLLHYESLKVNRFNA
FT                   GYESDFSTEEGEDEADEVDRKEEYEECDDDMIQQIITGLSSSWCIPKSTKRSSRRNESM
FT                   LLMSSSGYLEKSGLQVDNSSKADPQRDTFNSSDESIGSESIGGEDKGIENEKHDDNYFF
FT                   HIAFTPIECTVICSSHLMKKLFEEPLNLCQQLNYDKVKLIDEFFLSLLIDSDGSFDNSS
FT                   QILELTKPLSENDISLFFLSSHFSNIVLIPYNLKEKVIAILSKQNFEFSDISNSYIVNQ
FT                   IDDDSESEDVDISPEVEAINLEYKAFQLLKQTNIQPRINSNIHLLLTGARPGEVKNTIL
FT                   KTAKNISSGTIPEYFSITRTSVNEVSLLLPKSPRRRSSMGFSSKNIIGSIQDVIIPITV
FT                   DLYKLPLDSTGIVAGLASRIINGVKLAARTDYPFEMNYLSMAQSAIIMVPKENLSLVSD
FT                   ILSNVSYD"
FT   gene            complement(<692080..>694077)
FT                   /locus_tag="DEHA2E08822g"
FT                   /old_locus_tag="DEHA0E09361g"
FT                   /old_locus_tag="DEHA-IPF12174"
FT                   /old_locus_tag="DEHA-CDS1284.1"
FT   CDS_pept        complement(692080..694077)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08822g"
FT                   /old_locus_tag="DEHA0E09361g"
FT                   /old_locus_tag="DEHA-IPF12174"
FT                   /old_locus_tag="DEHA-CDS1284.1"
FT                   /product="DEHA2E08822p"
FT                   /note="similar to uniprot|Q92331 Saccharomyces cerevisiae
FT                   YOR069W VPS5 Component of the retromer coat that retrieves
FT                   proteins from late endosomes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87927"
FT                   /db_xref="GOA:Q6BQ29"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR035803"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ29"
FT                   /protein_id="CAG87927.2"
FT                   /translation="MDHEDLTASHWDDVISPHSEYTYSATSSSVPPLSNQFSELSVDDS
FT                   EDDEEDDEEEDEEEEDEVQNPQTPRHGYSNPVDEQRDELEKDERNDHKHKLLSELTHGS
FT                   EENQLESFIKSPERINTSESLFNEKDSPIKPSTSVSNEQPVSPKRVSNLKTSKYKPTRL
FT                   RKFSSKTIVQHLGNENNTKEPLGPLGEPTDRGIDKEPAPSSSNGDSQNSNNKDLLVQQL
FT                   DAPLYDIDSGTKNESPHKIDQSSQKSASNDDSNVAHTVNVPSSLEISVGDPMKVGDITN
FT                   AHIVYSIKTKNKKPDSQLLPHGTDTFIVSRRYKDFRWIYHQLQNNHPGKIIPPPPTKQT
FT                   YIGRFNENFIENRRLSLEKMLSKISHSPSLQEDPDFIMFLVSEDFGNESKEREKLSGSG
FT                   ASLQNDEFLDNDSNTSNTDSAPVTVGNNTGGFMSSIFSMSQKIEEPDEYFIQKKEYIES
FT                   LEHNLRVFYKSIELINNQRQEMAGLVDEISLTIDELASLEISKITTDLLSSFSDVQLKL
FT                   KENLDRINLQDQLTLGFTIEEYLRIIGSIKYVFESRSKIYQQYYNFNQDYIKKQAQLNK
FT                   LNKKFKVQNDKAGNLNFEVDKLRAKVQTFEKKFNLISETIKSELERFEFEKIDDFRNSV
FT                   EIFIESSIESQKEAIELWETFYERENLSEI"
FT   gene            complement(<694737..>694844)
FT                   /locus_tag="DEHA2E08844r"
FT                   /old_locus_tag="Deha0E.39"
FT   tRNA            complement(join(694737..694773,694808..694844))
FT                   /locus_tag="DEHA2E08844r"
FT                   /old_locus_tag="Deha0E.39"
FT                   /note="tRNA Pro (TGG) cove"
FT   gene            <695602..>696459
FT                   /locus_tag="DEHA2E08866g"
FT   CDS_pept        695602..696459
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08866g"
FT                   /product="DEHA2E08866p"
FT                   /note="weakly similar to uniprot|P32573 Saccharomyces
FT                   cerevisiae YNL202W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87928"
FT                   /db_xref="GOA:Q6BQ28"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ28"
FT                   /protein_id="CAG87928.1"
FT                   /translation="MTVEQVQGAQSVCNKDIGTLPAQFPTLPDSVLELFLLTGKSAVVT
FT                   GGISGIGFCISEGYCQAGLAKLAIIDYAENQLVLEKLQQKYPKTQINFYNCDVRKAEQV
FT                   KNVIEQIHSDFTEVDIFVANAGIAWTSGAMIDQDDDDEWHNVMNVDLNGVYYCAKHIGR
FT                   VFRQQGRGSLVMTASMSAHIVNVPQLQAAYNAAKAGVLHLGKSLAAEWAPFARVNTVSP
FT                   GYIATELSDFVPDDIKNVWYSMTPKGRQGLPRELVGAYLYLGSDASSFTTGTDIIVDGG
FT                   YCSL"
FT   gene            <697952..>699835
FT                   /locus_tag="DEHA2E08888g"
FT   CDS_pept        697952..699835
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08888g"
FT                   /product="DEHA2E08888p"
FT                   /note="highly similar to uniprot|Q00711 Saccharomyces
FT                   cerevisiae YKL148C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65790"
FT                   /db_xref="GOA:B5RTX8"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTX8"
FT                   /protein_id="CAR65790.1"
FT                   /translation="MLRRYFGTSATRFQTIGNIKGTQLNATKYLSKDYHVIDHQYDCLV
FT                   VGAGGAGLRAAYGLSEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYD
FT                   TVKGSDWLGDQDAIHYMTKEAPASIYELENYGVPFSRNEEGRIYQRAFGGQAKEFGKGG
FT                   QAYRTCAVADRTGHSLLHTLYGQSLRNDTHFFIEFFAMDLMMQDGECIGVIAYNQEDGT
FT                   IHRFQAHKTIIATGGYGRTYFSCTSAHTCTGDGFAMVSRAGLPLEDMEFVQFHPSGIYG
FT                   SGCLITEGARGEGGFLLNSEGERFMERYAPHAKDLASRDVVSRAMTLEINEGRGVGKEK
FT                   DHIYLQLSHLPPSVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNYKTE
FT                   VLKKGADGKDEIVPGLFACGEAACASVHGANRLGANSLLDLVVFGRAVGHTISEQLTPG
FT                   TPFKPLDEHMGKESIENLHHLRTADGSQTTASIRAEMQKTMQKGCAVFRTQDLLDQCVE
FT                   DIDKIDKTFEHVKTTDRSMIWNSDLVETMELQNLLTCATQTAYSAAARKESRGAHARDD
FT                   YPNRDDENWRKHTLSYQKNFGDKVELDYRDVVRTTLDESDCKPVPPAVRVY"
FT   gene            <700086..>700925
FT                   /locus_tag="DEHA2E08910g"
FT                   /old_locus_tag="DEHA0E09493g"
FT                   /old_locus_tag="DEHA-IPF12168"
FT                   /old_locus_tag="DEHA-CDS4465.1"
FT   CDS_pept        700086..700925
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08910g"
FT                   /old_locus_tag="DEHA0E09493g"
FT                   /old_locus_tag="DEHA-IPF12168"
FT                   /old_locus_tag="DEHA-CDS4465.1"
FT                   /product="DEHA2E08910p"
FT                   /note="similar to uniprot|P32573 Saccharomyces cerevisiae
FT                   YNL202W SPS19 late sporulation specific gene which may
FT                   function during spore wall formation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87931"
FT                   /db_xref="GOA:Q6BQ25"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ25"
FT                   /protein_id="CAG87931.1"
FT                   /translation="MSHPTSVINEELGPLPTKAPQLSKNVNDLFSLKGKVASVTGSSGG
FT                   IGWAVAEAYAQAGADVAVWYNSKNADAKAEYLTKTYGVKSKAYKCNISDPEDVEKVIGQ
FT                   IEKDFGTIDVFVANAGVPWTEGRSIEADGYDAWKKIVDLDLSGVYYCAKTVGKIFKKHG
FT                   KGSLVLTASMSGHIVNVPQMQAPYNAAKAGVLHLGKSLAIEWAPFARVNTISPGYIATE
FT                   ISDFVPAEVKAKWWQLIPLGREALAQELVGAYLYFASDASTYTTGSDLLVDGGYSAP"
FT   gene            complement(<701553..>702362)
FT                   /locus_tag="DEHA2E08932g"
FT                   /old_locus_tag="DEHA0E09515g"
FT                   /old_locus_tag="DEHA-IPF12167"
FT                   /old_locus_tag="DEHA-CDS4585.1"
FT   CDS_pept        complement(701553..702362)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08932g"
FT                   /old_locus_tag="DEHA0E09515g"
FT                   /old_locus_tag="DEHA-IPF12167"
FT                   /old_locus_tag="DEHA-CDS4585.1"
FT                   /product="DEHA2E08932p"
FT                   /note="highly similar to uniprot|P32610 Saccharomyces
FT                   cerevisiae YEL051W VMA8 vacuolar ATPase V1 domain subunit
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87932"
FT                   /db_xref="GOA:Q6BQ24"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ24"
FT                   /protein_id="CAG87932.2"
FT                   /translation="MSGAGNREQVFPTRMTLGLMKGKLKGAQQGHSLLKRKSEALTKRF
FT                   RDITQRIDDAKRKMGRVMQTAAFSLAEVQYATGDNISYSVQESVQNARFQVKAKQENVS
FT                   GVYLPTFESHINEDINDFKMTGLGRGGQQVQKAKMVYTKAVETLVELASLQTAFIILDE
FT                   VIKVTNRRVNAIEHVIIPRTENTISYINSELDELDREEFYRLKKVQEKKQEAAAIAETE
FT                   EAEEAESKAKTSQQIDETAVRKEVADLDVKAHGEQDLLKETEDDVIF"
FT   gene            <702559..>705111
FT                   /locus_tag="DEHA2E08954g"
FT                   /old_locus_tag="DEHA0E09537g"
FT                   /old_locus_tag="DEHA-IPF12166"
FT                   /old_locus_tag="DEHA-CDS0702.1"
FT   CDS_pept        702559..705111
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08954g"
FT                   /old_locus_tag="DEHA0E09537g"
FT                   /old_locus_tag="DEHA-IPF12166"
FT                   /old_locus_tag="DEHA-CDS0702.1"
FT                   /product="DEHA2E08954p"
FT                   /note="weakly similar to uniprot|Q04048 Saccharomyces
FT                   cerevisiae YDR416W SYF1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87933"
FT                   /db_xref="GOA:Q6BQ23"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ23"
FT                   /protein_id="CAG87933.2"
FT                   /translation="MSGSVWDIEGLLCEDDIPYEQEVAKNPNNLSNWLRYYRFKSSTSS
FT                   CTFQNRVFILERAVKQLPRSYKLWMIYIDVVLQEVQTSVSYKSKSEILSVNMVFERSLQ
FT                   LLNRAPILWIKYLEFLVETQPYEITLLRRKFNECLYNLPISQHHLIWPLYIRFADDVGG
FT                   MTGVKVYLKYLQYANPESLQGLNNEQEGELGITIDDIISKLVEFGDVKEASKLFQHILQ
FT                   HTDKFIGLSKSPLQLWIEYIDLLVNSVSKNKRSTVNYNEFDYFFEKLIKDGLQKFPDQI
FT                   GKFYLKLTFYFIKRKNLFKARYYFDEGLKTCVSVKDFTMIFDSYTEFEENILTNMSEKL
FT                   EKLGEDSDLNNELDLRMNVFEKLINDRPYLLNDMMLRQDVNNLDEWFKKIVLYKKDSDI
FT                   NMMLDTYAAALRTINPLKAHSLANKKENTLPNLWINYANVYASQNDVKTANLIFSKSVK
FT                   SQFQSPDDLATLYIEWCELFVKHNDDKKAIEIVEDICTSERGKFDYNDSSIDIHIRVQK
FT                   SIKLWSFYLDLLESMIENNNQIDEIEKVINAYNITIDLKIATPLTIINFANFLEEWNFY
FT                   ERSFSAYEMGLKIFKDSKIKFEIWNIYLSKIIKHELNIERIRDLFEQCLNESSIEGYNG
FT                   CPANLCKPVYLLYSQYEQSKGWFTKSVKILQQGLSKLDDGYNQEFYTKAEKDTILRDKF
FT                   DIYQVLISKILKLNDHNETRKIYEQSLKDNQLTLPNLIQLTMEFINFETELMEFNRVRS
FT                   LFKYVCQLSNPQSPLIEPIWHNWETFELNHGNEATFKDMLRFKRKIVTEFEKDIILKNS
FT                   LNPMGFVKSSQGPKVSSIAISAPKEENNPDSIDLDMDM"
FT   gene            complement(<705243..>707813)
FT                   /locus_tag="DEHA2E08976g"
FT                   /old_locus_tag="DEHA0E09559g"
FT                   /old_locus_tag="DEHA-IPF12165"
FT                   /old_locus_tag="DEHA-CDS0686.1"
FT   CDS_pept        complement(705243..707813)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08976g"
FT                   /old_locus_tag="DEHA0E09559g"
FT                   /old_locus_tag="DEHA-IPF12165"
FT                   /old_locus_tag="DEHA-CDS0686.1"
FT                   /product="DEHA2E08976p"
FT                   /note="weakly similar to uniprot|P38814 Saccharomyces
FT                   cerevisiae YHR103W SBE22 involved in bud growth"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87934"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ22"
FT                   /protein_id="CAG87934.2"
FT                   /translation="MNHANHSQSSLNDNNYYDISIGRNVSGNGMSGNKTFPSVYPPRRV
FT                   GSLSSLLTLNDSKRPGDYYIQKMSNSSINLTGSNPKQKHTGTVNVANRPKSGESILSLQ
FT                   SNYSDETSSANSSQFDVPDSRLSSLTSNSLISPSQSPSHNSYGANNNSSANSSANTSNP
FT                   ASESNDKTNDKINEENENEDESNDQINSSLSTLTLKNQSMDSNSDLSYNQSPSTSQVVR
FT                   PRLKASSTTNIIKQRPPKLQTMKSATSLQRAKTKFLNAKETKERQQLRKKLYDENDDDD
FT                   DILANDLDIFNVPVIKNHAELYINNNSSKYLSRHDLVTDDSKYNVNSSTEMKPCPLPGR
FT                   LNSTSDISCSSIIRTDISDDSILEESENSFSFGTDNDSKISQNISNFYNQRSESVSKLK
FT                   KMTREQNMLYKLPTFIKSQSSIEDINLISPEKINCLDQTRPINLPPKTTTDKSKHNKEF
FT                   QRVLNNYENNTKIFNESRKRVSESMVNQQQQWFKLMMSNKKECNKKLTSDKAMVRKLSW
FT                   ESNCPDKFRYEFFMNALSQDNEQSITNLKNSFEASKNKYSNLSDSIKVNKDIEFKNLID
FT                   LILQRPLYDSIMKEFNENSEVNFSLDDFKTDFKYLLYIKSLSESGLRKQDEIFLIPFFL
FT                   ILFQNENTMQEIYVLIELVNHEVLDSQFLKELNKSLGAWTNVNNFSSSNILYKFLYKFN
FT                   NLKEFENLNSIHFFEMLIQINDKLPLSLSAPSTPVVSQSGQFSFTSPKTNGGDSNNSSK
FT                   TNSIDQISELSIQNALNSSAYNLTLKFLQLIIVYAHSKKTKSKNNLKVFQSFLMIIFQY
FT                   YHINWNNYSELVKLNRSIKLNNSADQSANLDCFVDKWKDAFKKF"
FT   gene            complement(<708807..>710279)
FT                   /locus_tag="DEHA2E08998g"
FT                   /old_locus_tag="DEHA0E09581g"
FT                   /old_locus_tag="DEHA-IPF12163"
FT                   /old_locus_tag="DEHA-CDS2144.1"
FT   CDS_pept        complement(708807..710279)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E08998g"
FT                   /old_locus_tag="DEHA0E09581g"
FT                   /old_locus_tag="DEHA-IPF12163"
FT                   /old_locus_tag="DEHA-CDS2144.1"
FT                   /product="DEHA2E08998p"
FT                   /note="similar to uniprot|P32317 Saccharomyces cerevisiae
FT                   YEL052W AFG1 Putative ATPase of the CDC48/PAS1/SEC18 (AAA)
FT                   family and highly similar to CA3775|CaAFG1 Candida albicans
FT                   CaAFG1 ATPase family gene"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87935"
FT                   /db_xref="GOA:Q6BQ21"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ21"
FT                   /protein_id="CAG87935.2"
FT                   /translation="MYSLVHGRLNYSRLKSLSYIPRNLFHYSNTLSLQSPLEAYDSKVE
FT                   EGRLNDDPYQRKIITSLSKLHDRLADYTPPKVETPTIRDLKPKIGLRKIIGTFFSNSSN
FT                   NKSSGLPPEHEMKGIYLYGDVGCGKTMLMDLFYVTIPEHLSKRRLHFHQFMQHLHKRSH
FT                   SLKLEHNHEELDVIPLLAAEIAQESTILCFDEFQVTDVADAMLLRRLMMLLLSPDYGVI
FT                   LFATSNRAPDDLYMNGIQRVSFIPCIQQIKRQTRVIYLNSPTDYRKLPRPVSSVYCFPK
FT                   PGVKYMSKVHQANCKKHIEQWYEYFNNENDNKEVHTDFSLSVWGRKLNVPKSSFPYVAQ
FT                   YTFEELCGSPMAAGDYLTMANAFQSFIISDIPYLSIDVRDKVRRFIIFLDAVYDVHGRL
FT                   AVTCAAPFKDLFVEPENLMKDNFSLYKKQQDMGKEETFQDDELVVKHGFDKSIAKKASM
FT                   FANDEEKFAFARALSRLSQMSTTDWVDNVRSL"
FT   gene            complement(<710511..>713024)
FT                   /locus_tag="DEHA2E09020g"
FT                   /old_locus_tag="IPF_12160"
FT   CDS_pept        complement(710511..713024)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09020g"
FT                   /old_locus_tag="IPF_12160"
FT                   /product="DEHA2E09020p"
FT                   /note="weakly similar to uniprot|Q06628 Saccharomyces
FT                   cerevisiae YPR185W ATG13 Phosphorylated protein that
FT                   interacts with Vac8p required for the cytoplasm-to-vacuole
FT                   targeting (Cvt) pathway and autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65791"
FT                   /db_xref="GOA:Q6BQ20"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="InterPro:IPR040182"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ20"
FT                   /protein_id="CAR65791.1"
FT                   /translation="MVSPGQNDLSSDKSQIDPFVKKQNAKLTQVIQNFFSKSVQIVLQS
FT                   RIQSESHNKEEQLKVGGDVGGHNVSSKINKWFNLHMYNDNLPKEELKLWKNINDVSQMP
FT                   PMIIEVYLDLRQLTAIQTVILRDDNGNPWTVAKGGSKKHEVVLERWLIEFDANTVSGTI
FT                   VDELPLIYKQAIILFRSLYGYTRLMPTFKLKKNLNKSNLNIGCKILDGKQPISSKGRIG
FT                   LSKSIIPHQMLTTESHMSHKHFLPIQTTLGTLKISIAYRNHHEFSIHDNEELLSTHFVN
FT                   IDDNDKDSEITPVEIEFKEELKIDRDSTTNEKVNEPEDDESHHADVESSQEHLQSEEPD
FT                   ESFEQDAKHISGSRKKFSISNNASMSLSPCSSGPQTVTEDSPSHNKPSANTTPIVSQRP
FT                   TINPFKVGSISTSPPATTNFGGSSLERKVSITSNKSASNASLAAMLRNPRSSTSSTNTT
FT                   ANIPIANNNSNNQYNSTFPRSVSSSHGSNLAHDNDNLLGFSNPDNTSNTPRFSSSFGSR
FT                   ASRRFSNTSGRQSSLPSGNMNDTSLLATSAGSASSDAPMSGLYIDDDIGDFVRMIDSKS
FT                   DLRFSGYNSNNDSKISYNQGSNSQIDALNKFQMLKNQHQQLSDSVSASLILHHNQLSGS
FT                   RPSSRKSSHSIHSPPPSLPSGSYDNSHLPSINSKLRENSSTSGNDDNLARDSGTPSSRK
FT                   NSFDYSTNSNTTFLKSPITNKLVSSPVTSTTPIHSCLHKTNNESGVISGLATTPSIYND
FT                   RRQIHYESVFDDDDDDYANNTADNRDQDDSLKLYLTNKLANAPKSNTNSRSLKSSTNPP
FT                   NIGEDDDDDDDDLLFTMSDMNLAKH"
FT   gene            complement(<713406..>717686)
FT                   /locus_tag="DEHA2E09042g"
FT                   /old_locus_tag="DEHA0E09625g"
FT                   /old_locus_tag="DEHA-IPF12157"
FT                   /old_locus_tag="DEHA-CDS0137.1"
FT   CDS_pept        complement(713406..717686)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09042g"
FT                   /old_locus_tag="DEHA0E09625g"
FT                   /old_locus_tag="DEHA-IPF12157"
FT                   /old_locus_tag="DEHA-CDS0137.1"
FT                   /product="DEHA2E09042p"
FT                   /note="similar to uniprot|P17883 Saccharomyces cerevisiae
FT                   YPR189W SKI3 dsRNA virus protection family member contains
FT                   8 copies of the tetratricopeptide (TPR) domain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87937"
FT                   /db_xref="GOA:Q6BQ19"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039226"
FT                   /db_xref="InterPro:IPR040962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ19"
FT                   /protein_id="CAG87937.2"
FT                   /translation="MRRNNEAIGLLNTMSTLKRCLKEAKSSIEQNDPEGALEAVEEALE
FT                   FDSENYFAYIFQGKSYQLLNDNDKAIKSFDKATSLEPENLLGWKGYFQVAKAQTDYDLF
FT                   FQVLTNIIEQQINQGIGIGETLKDTRNYLEHNKYKSNPELYEKYLRNIMPGTELGNLVG
FT                   SELGKPEDNLKALIDILKRKEKDTISRTLSKEKMRFPRILTIDQKNYLNKVTWSIHEKS
FT                   GLSSIYEMFLNISNNDELRKLIQEEYLKYKYDLLKVAPEKSGLLEEIKDLMEGMILVRT
FT                   TSLFCWTLYLDWVDVQDLDQLEKDKIIFFLKNFHNEGLGMMLYSFLMSDISPFDKTEIV
FT                   KELAVITKNKKINDSMNNDKLEGIDDENDAKLLEKVQESEDNDVFENTLSPDQVLKLML
FT                   EGYQRCTNSVLANRIICRYYIYLREYDQGSEKCRQAIKLLADLQRSLGVNLANSREDLL
FT                   CSLAIIYTYYEAPKNYSRALQLYERILESNDANVNAIIGKGLILIEKNEPIRAKELLED
FT                   VLKHHPSNNSALMEFGWCEINLGNYLDGRNALITALNKIQGMDLNSRKTRAHVHWRIAK
FT                   SYLLENKDSNNIDEAYNHLIKSLKDSQNHAPSYTLLGVLYKEYFNDFPRAQKCFYKSFE
FT                   LDVAEIEATKYLVEDLAAKNDWDIAEILCKRIVQSETSRRTLLSKTYQDEDRSWPYRVL
FT                   GCSALNKQDDAKAVEWFQTALRMAAMDTQCWLGLGEAYYNCGRLDAASKVFRHTLDIGE
FT                   GSWIVKYMLGLITCEMGEFDEGLLYLDQALGEKPEEECILNAIYESMIENANKLIAGGF
FT                   FGRAMESISKAIDYILKGSEVNKSSQNMWKSLGQCLRVFLIIQGRVDILPLNHLIEVFK
FT                   ATDLSSSTNQLLQELVSIDGGVNLAKATSLYESEEYTESVSIFIILAAKAAISVLPNKV
FT                   GKLLISVVYYNLGLAYLECFNVIDKSSYRESAIKCFKKAIQLESNNALFWIGLGNSYVS
FT                   SNPQVSQHCFIKATSLESRDGDIWTNLASLYLRYGDSELAQQAFARAQSVAPQNPQPWL
FT                   GNALTAQANGEDAKASNLFTHAYVLSNGRSPLAQLLYGLAIIDKRIGMSGSDPRDIETA
FT                   QEFSIANFAMMNYLKFSPEDETGLKVALIIAERCKNYDAGVTIGEKLCSVLEAKYEKSE
FT                   SQVALSDYTKAKTQLSRVYLGLSEYEKALENAQVVLDILEDGDEVTQEHKTSILSSRVS
FT                   IGLSFFLNDQFDEALEQLQLILADHNDSARLITLTAQILNAFGTGETKQAALDQLFSYI
FT                   EQSGSSLIVILTLGAISIVDNLNEYFSAIKDELRNLPLDELTKDSFRIVPTLLTEINSR
FT                   LDATNEDQIWQRNAMLFPSDYSVWKRMNNQMALAIASLRETKINAVDLSKSYIKIGELR
FT                   HIQRGLIIHPGNDIGRKALNGCFT"
FT   gene            <717829..>719649
FT                   /locus_tag="DEHA2E09064g"
FT                   /old_locus_tag="DEHA0E09647g"
FT                   /old_locus_tag="DEHA-IPF12154"
FT                   /old_locus_tag="DEHA-CDS1593.1"
FT   CDS_pept        717829..719649
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09064g"
FT                   /old_locus_tag="DEHA0E09647g"
FT                   /old_locus_tag="DEHA-IPF12154"
FT                   /old_locus_tag="DEHA-CDS1593.1"
FT                   /product="DEHA2E09064p"
FT                   /note="similar to uniprot|P32349 Saccharomyces cerevisiae
FT                   YPR190C RPC82 RNA polymerase III subunit C82"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87938"
FT                   /db_xref="GOA:Q6BQ18"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ18"
FT                   /protein_id="CAG87938.2"
FT                   /translation="MNAVVPDSAKTQSAKSNLYTTLAKTHLGEVAAIIVSTLISYGRLT
FT                   AKDLSNKSEVPLKLVKSTLVSLIQLSCISYWKEESSKQVFYSFNENGLLIFLHSGDIIN
FT                   HIKLTYGDESAGIIQNIIEVGHMKIEDYLQNIEDPEVVFNKENLLLKLFSDGWLSRVQM
FT                   SNFQPIDDLWNQLYQETLKNTPRSTTISEIKRVNEAKDKTKLKFTNLLESGNSAKELFQ
FT                   IENGIKKLAPSLVIAFNLSRFEKHRRTEQLTNLAKARIGILTSKVYECALQLIEQHSPD
FT                   LRHSFLKISGLINDPVEEQAFVNSIENQLVDDKKIVFNVKDLVKIAPKDLDLRNSILTH
FT                   NFLKPTFNPKKRVNDDIPDTNPKKIKTEDGMNNLMIDLDPDVSENNLDFDMHNTDNSEP
FT                   HSVSLINHHLKLLSSGVIPFLIEITPGTYTVPYTDLMKYVKQCNYDTLIKTTLGLDSFR
FT                   LLRCLKSLKLADEKTLANTILLKEKTVRNELFKLMNLNMIEIQEVPRSADRAASKTFYL
FT                   FRHKEFSAYNFLYNSLTFCMADILSNIQQFKNDNKILLEKCEREDVKGNEEELLLESEL
FT                   KTLKNLQLREINNIGKFNRIKTLYEIFDNF"
FT   gene            <720036..>725894
FT                   /locus_tag="DEHA2E09086g"
FT                   /old_locus_tag="IPF_12153"
FT   CDS_pept        720036..725894
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09086g"
FT                   /old_locus_tag="IPF_12153"
FT                   /product="DEHA2E09086p"
FT                   /note="weakly similar to ca|CA0392|IPF17450 Candida
FT                   albicans IPF17450 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65792"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY0"
FT                   /protein_id="CAR65792.1"
FT                   /translation="MGIDQFPSPFKVKPLIKKQKSETPAQSEIHTPSKSKVIENSRTIT
FT                   SIEHDNRQEDVLSWIDDLDSRIKRTLSRQYIESIELKNQTNMEDMREKYRQVPFDDSFR
FT                   KLSSILKKGNEVDSDQEASYEVAEGKLPTDNEDDEMDFSEDVETNETPELESEGQSDDD
FT                   IIEIISSEREEAFDSGNISNNYEENEQDEEVTPGLNINALRTQGVTYHIKNGRPRLSDN
FT                   YMNINDSEQNEKSEYSSEYSNGNDDGIDIDETNGDEDEDEDEHENGNEVEYEGEYEEEH
FT                   EERRNQDDSDDEIIILDSDEENNNTQINKEKNFDSGSNPASFSFYEDSENGIQDNLSNG
FT                   VDHEDNEDEDEDEDENEHQEYVYPNNNLENNSSISSVYSNQVELLNENKVIDEKDNLMS
FT                   LAEAVLKESNDMSDENSFMTARGSDSLYQDDKSGIAQYSTNINSGYTADYDSTDVNYQA
FT                   ANLSGIEEENKEVTDPVAHTHEPFLKEDSVSSDSIQLVDDFENISEGSLADEEQDYEDS
FT                   SNNDRGFTLNKHKIYEHSGAYEIKEEESNEDNYSIEVEHINEVPIFKTVAEEDPETVLF
FT                   KLKEAEQKFHIRLNSIKCLEDELILKNGHLPESYIPNQFVEEDQNDISSNKTYGKEVVA
FT                   DFGSIPKPIPKPLLQDLSILDETTILETMNDGDNKEGSISSPVLKQLDDGKTVIDETSI
FT                   MDDNDNDSQKGFKPEYVSGPILGQIGLDQSDNTPVNDIEESKHEVFQGPNLNPIYYDTP
FT                   EVKDSTYNVSHDVRQHDTDGDEIDHIRGPLLDQIDDNKSQTNDIIMSRMDEEKECIDVP
FT                   ALEEHDSDQSRIYNTTMNEMEVDMNENISNDVLEHTESSQSNSNDKILEQAEQDEKYIN
FT                   VLSLEQVEADQSRIDDTTMNDSVEENQESISTPALEQIEIDQSRIDDTTMNESVEENQE
FT                   SIPTPALEQIESDQSRIDDTTMNETVEENQESIPIPALEQVEADQSRIDDTTMNETLEE
FT                   NQESISTPALEQIEVDKSTINDTTVNETVEENQESIPTPALEQIEADQSTINDTTVNET
FT                   VEENQESISTPALEQIEVDQSRIDDTTVNETVEENQESISTPALEQIEVDQSRIDDTTV
FT                   NETVEENQESISTPALEQIEVDQSRIDDTTMNDSVEENQESISTPALEKIEVDKSTIND
FT                   TTVNETVEENQESIPTPALEQIESDQSRIDDITMNETVEENQESIPIPALEQVEADQSR
FT                   IDDTTMNETLEENDRINVPKLKQIGVEQSGVADTTIIEMNIEQDDNVPNDLLSPDMEQV
FT                   ESHESIIDTPDEMADDNQGLLNSPKSEVIEQSNFGLATDEIQEMKDKLLPEVTESLREK
FT                   SISEMLYPSITQELDDIHNGHDESKIDIETTIADNEVVNKDIDAKYESYTEKEKNALDQ
FT                   IPINIDKNDIDLNKDVEFDTSDEYENKRSLSSEQIVEEPQEADENIIFEYEQTTYVNVM
FT                   GDGILHPSYIMEPIEEQQETQLPDYIEQLEIITGTSAIDDMEVLEPSTIIEPSDTETDR
FT                   AELINSAFEQQFEIIEPTGVLEPPSRSQTPKLSGTHRESINAEEIFEKGSSKGSRKRNR
FT                   ESESFVRSKLRKLIYKPFQWLSKNRKSSPISPTHIEAPKLRPLDDNTANSSSNKNARKP
FT                   IQKDADIKPDDSVDKNKKKYYELMRHLKRSVDLKSSEVEKNNLNNLVDYEKEEDNSDDH
FT                   MIDDEDKSDYSAVNENEPSINAPTNVKEKTFEDENLEQSINESHAKNSSFATNSDYNPP
FT                   FTELEINDSAKNSKSTKQRSTSTKSKRPRKVLGLDMSEAHIEPVRSLRSGHKYGPEEND
FT                   HQTSDLLASPNKTLRSNKELPKLRINKRRHLSNTKALDNSSPIEIDSKQSSPSSRKSSG
FT                   SKWVESSLDHPALRTRSKSPLKRSIYQISSDLEEDSNLPRRSSRLRHPNEKLNDDAALE
FT                   NENTEAEEEVKRGRPTKRH"
FT   gene            complement(<725991..>727010)
FT                   /locus_tag="DEHA2E09108g"
FT                   /old_locus_tag="DEHA0E09691g"
FT                   /old_locus_tag="DEHA-IPF12150"
FT                   /old_locus_tag="DEHA-CDS3803.1"
FT   CDS_pept        complement(725991..727010)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09108g"
FT                   /old_locus_tag="DEHA0E09691g"
FT                   /old_locus_tag="DEHA-IPF12150"
FT                   /old_locus_tag="DEHA-CDS3803.1"
FT                   /product="DEHA2E09108p"
FT                   /note="weakly similar to uniprot|Q12375 Saccharomyces
FT                   cerevisiae YOR130C ORT1 Ornithine transporter of the
FT                   mitochondrial inner membrane exports ornithine from
FT                   mitochondria as part of arginine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87940"
FT                   /db_xref="GOA:Q6BQ16"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ16"
FT                   /protein_id="CAG87940.2"
FT                   /translation="MESSNRGIPAITGQLDYSNAIHVFPDALQPFRSTILAYGASFIST
FT                   TVGFPMDTVKTRMQTHKHFLSYLDCVKKTYHHEGAKGFFRGIWAPLISTSISKSLSVMI
FT                   FTEVKPYCYNMIYGKYDNNHTVHPLLRNVPVCMISGTLAGAGISAFACPFEFTKIYAQI
FT                   LKLVQKKSMKDLPKHLQTNHQEITNISTSQTIRQIIKHEGVRGLYSGYKYHLIRDSLSS
FT                   GIYYSIYESMKWTMNELIKTNPNESSHISILLAGGFSGIFSWILIFPIDTTKSLIQRDS
FT                   VANILRKEQGLEPLPIKERKLEGFHRKLYRGLGISVTRSFIVNMVFFSVYEFVMAHVA"
FT   gene            complement(<727517..>728074)
FT                   /locus_tag="DEHA2E09130g"
FT                   /old_locus_tag="DEHA0E09713g"
FT                   /old_locus_tag="DEHA-IPF12148"
FT                   /old_locus_tag="DEHA-CDS5526.1"
FT   CDS_pept        complement(727517..728074)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09130g"
FT                   /old_locus_tag="DEHA0E09713g"
FT                   /old_locus_tag="DEHA-IPF12148"
FT                   /old_locus_tag="DEHA-CDS5526.1"
FT                   /product="DEHA2E09130p"
FT                   /note="similar to ca|CA1669|IPF11393 Candida albicans
FT                   IPF11393 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87941"
FT                   /db_xref="GOA:Q6BQ15"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ15"
FT                   /protein_id="CAG87941.1"
FT                   /translation="MFSNIVNKRFSGVVNRGLVSRPPFGVTSVRFNSSFDELAKAMKQQ
FT                   TNKKEDNNKDRNSNAISDIDNLLSSTFDFQSNSHYSNKSNDYILDNSLKHPRDVAKSIR
FT                   LQGPIAGRSVDVQYGNFNRALGGIFTVVKSNKIRYLQKVQSRFIPPAKYRKQKKREWWR
FT                   RKFAQGFKELMSQVRDAKRRGY"
FT   gene            <728325..>729179
FT                   /locus_tag="DEHA2E09152g"
FT                   /old_locus_tag="DEHA0E09735g"
FT                   /old_locus_tag="DEHA-IPF12147"
FT                   /old_locus_tag="DEHA-CDS4417.1"
FT   CDS_pept        728325..729179
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09152g"
FT                   /old_locus_tag="DEHA0E09735g"
FT                   /old_locus_tag="DEHA-IPF12147"
FT                   /old_locus_tag="DEHA-CDS4417.1"
FT                   /product="DEHA2E09152p"
FT                   /note="weakly similar to ca|CA1668|IPF11396 Candida
FT                   albicans IPF11396 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87942"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ14"
FT                   /protein_id="CAG87942.2"
FT                   /translation="MNDIISTKLFETEDVSVFRIPPGELSLSKWDINDSNIIWRGSLRL
FT                   TEEELIQEDKGVFLNGSNGVESECFSSFTVGDKPSAFFSKDTEVAPIKPYKGLRLKLEL
FT                   FNFDDSSVAPPNESGMEDEKIWAEVWYNPLPAEQDNELNPAQYSIANNKQETIQMTPQS
FT                   AKFYKLIVQLPGSGYHPFIQEEEQIEDGYLLQVALGLKISENFAAISFSESLSIYRRRF
FT                   KNFVDQYNYELRLSEIECRQKHLSINTENNPEESGTDHGSGNKTTEDNNDNEEDEFGDF
FT                   VGG"
FT   gene            complement(<729434..>731992)
FT                   /locus_tag="DEHA2E09174g"
FT                   /old_locus_tag="DEHA0E09757g"
FT                   /old_locus_tag="DEHA-IPF12145"
FT                   /old_locus_tag="DEHA-CDS0698.1"
FT   CDS_pept        complement(729434..731992)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09174g"
FT                   /old_locus_tag="DEHA0E09757g"
FT                   /old_locus_tag="DEHA-IPF12145"
FT                   /old_locus_tag="DEHA-CDS0698.1"
FT                   /product="DEHA2E09174p"
FT                   /note="highly similar to uniprot|Q00578 Saccharomyces
FT                   cerevisiae YIL143C SSL2 DNA helicase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87943"
FT                   /db_xref="GOA:Q6BQ13"
FT                   /db_xref="InterPro:IPR001161"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ13"
FT                   /protein_id="CAG87943.2"
FT                   /translation="MSRRPGGVSYSELDQGNFSDDSFDDEVDQAQQRNNKNDDDDYSYG
FT                   SNRRKGTKKTNGNASRKRKAENAVEVIRAQAPSADYSDEELVDLTPDIPEDYVPDAVSK
FT                   AFGKSDFSYLKLKPDHFSRPIWISPIDARIILESFSPLAEQAQDFLITIAEPISRPSHV
FT                   HEYRITAYSLYAAVSVGLETDDIISVLNRLSKVPVAESIIAFIRGATISYGKVKLVLKH
FT                   NRYYVESTQADILQMLLRDPVIGQLRIQSTENTTTSNGLVQSSAPTQGDLSIPGTKKPG
FT                   SNDEKKDNEVEDIFASVVGNKANGEEDDYDDLETVHSFEIANESVEIVKRRCQEIEYPV
FT                   LEEYDFRNDDRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVG
FT                   ITAACTIRKSVIVLCTSSVSVMQWRQQFLQWCTIQPENVAVFTSENKEMFTSDAGLVVS
FT                   TYSMVANTRNRSHDSQKVMDFLTSREWGFIILDEVHVVPAAMFRRVVTTIAAHAKLGLT
FT                   ATLVREDDKIDDLNFLIGPKLYEANWMDLAQKGHIANVQCAEVWCPMTSEFYQEYLRES
FT                   ARKRMLLYIMNPTKFQACQFLIHYHEKRGDKIIVFSDNVYALQGYALKLGKPFIYGSTS
FT                   QQERMKILQNFQHNDQVNTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRIL
FT                   RAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLSGMEQLPDLAY
FT                   SSARERRELLQEVLLKNEDAAGLEIGDDADTNFIPREQREKRAKLESNGSSATRTAGSL
FT                   AGLAGGEDMAYIEYNKNKNKEIKEHHPLIQKMYYNKNQKK"
FT   gene            complement(<732272..>733333)
FT                   /locus_tag="DEHA2E09196g"
FT                   /old_locus_tag="DEHA0E09779g"
FT                   /old_locus_tag="DEHA-IPF12143"
FT                   /old_locus_tag="DEHA-CDS3634.1"
FT   CDS_pept        complement(732272..733333)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09196g"
FT                   /old_locus_tag="DEHA0E09779g"
FT                   /old_locus_tag="DEHA-IPF12143"
FT                   /old_locus_tag="DEHA-CDS3634.1"
FT                   /product="DEHA2E09196p"
FT                   /note="similar to uniprot|P32583 Saccharomyces cerevisiae
FT                   YKR092C SRP40"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87944"
FT                   /db_xref="GOA:Q6BQ12"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="InterPro:IPR039191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ12"
FT                   /protein_id="CAG87944.1"
FT                   /translation="MASRELALSLISNYLQKDAELAKVSKALAKEVTKQSIDLPTTELN
FT                   LEDLIVQAGETKEESSSASSSDSDSSSSSSDSDSDSSSDEDESSKEGATNTESAPIASG
FT                   KSDSDSSDNDSSDSNSSDSDNSDNDSSGSDSSDSDSSDSDSSDSDSNSKSKSDSDSSDS
FT                   DSDSDSSDSDPDSDSDSDSDSDSDSDSDSDSDSKSKSKSKSDSSDSSDSSDSSDSDSDS
FT                   ESDLKSSKKRSSDEKGHSHKKQKLETSSSQTESFSPSPVSDEIISASQEPELKQGQRNH
FT                   FSRIDRSKISFEDRTLADNTYKGAAGSWGEIANEKLLQVRGKDFTKNKNKMKKGSYKGG
FT                   SITFASGSYKFTD"
FT   gene            complement(<733593..>734807)
FT                   /locus_tag="DEHA2E09218g"
FT                   /old_locus_tag="DEHA0E09801g"
FT                   /old_locus_tag="DEHA-IPF12140"
FT                   /old_locus_tag="DEHA-CDS3129.1"
FT   CDS_pept        complement(733593..734807)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09218g"
FT                   /old_locus_tag="DEHA0E09801g"
FT                   /old_locus_tag="DEHA-IPF12140"
FT                   /old_locus_tag="DEHA-CDS3129.1"
FT                   /product="DEHA2E09218p"
FT                   /note="weakly similar to uniprot|Q12405 Saccharomyces
FT                   cerevisiae YOR084W Putative lipase of the peroxisomal
FT                   matrix"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87945"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ11"
FT                   /protein_id="CAG87945.2"
FT                   /translation="MYPNRPDLYSSEVKAADAVFIRQKGAVLLERSSDSIVDNTLKICY
FT                   RRYQGKSNESSSTKTKLNLVLFHGTGMNKGLWHYHINKLFEFFNTGKDNGTNLHLNVVC
FT                   AFDAVNHGESAELNKSKLGYLYDWRDSSKDVVKVLTEDEAATFIEAENKMSIIIGHSMG
FT                   GFVSLYGTYLAPALFDSCILVNPVSHVSPSEYAERDMEFKVWYERNYMKDNFDIQDGNN
FT                   WYNEIESFLKTKSFYRKFHPTVLANLLEDELPKEVKQSPKAAYNKIKLNTTVEAQLHTY
FT                   WGMVKSIPCGMPTFREIKVPVFHIVSDFDISSDENRSFMRNNLSQVVQCINFPNSKHLL
FT                   NGEEPDPLIKLFTSIIQGREVIHSRKTVIDEEYLVKKYGKNYRKLLSDARLESLIKNGA
FT                   TVPKL"
FT   gene            complement(<735002..>736180)
FT                   /locus_tag="DEHA2E09240g"
FT                   /old_locus_tag="DEHA0E09823g"
FT                   /old_locus_tag="DEHA-IPF12139"
FT                   /old_locus_tag="DEHA-CDS3565.1"
FT   CDS_pept        complement(735002..736180)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09240g"
FT                   /old_locus_tag="DEHA0E09823g"
FT                   /old_locus_tag="DEHA-IPF12139"
FT                   /old_locus_tag="DEHA-CDS3565.1"
FT                   /product="DEHA2E09240p"
FT                   /note="weakly similar to uniprot|Q12405 Saccharomyces
FT                   cerevisiae YOR084W Putative lipase of the peroxisomal
FT                   matrix"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87946"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ10"
FT                   /protein_id="CAG87946.2"
FT                   /translation="MSELYTLEKKTTDAAFPRGPGSTILSTDRLKVVYNKYLNTKGTIS
FT                   KDKIKINLIFAHGTGMNKSLWNYHIKKLFEHSQSASTWVLNSVLSIDAIGHGDSSLLNE
FT                   GKIGWVYKWEDGGKDIIQVVKHEQQSTNEFVNNATTKNILIGHSLGGYMAVIAGFYEPS
FT                   LFDTIIPIEGVLYMDPKTDGRFLGIFSKLSSILIDKFNSEKEYNEYFTKFSIYKSFHPE
FT                   VLKDFMEDEKATFIDPETKKTKFMTKASTPNQMTTYYSAGLSIPLVMAIFPQIKVPIVH
FT                   VIGKNATWNPPESITFVRDAVPKEYLLDTIDIPNAEHLVNGDKPDVIVKIIEDTIKKRV
FT                   ATAIENRPNDPEVKYGGNKSKILTSQWDLKMSIIAEQQKAAKAGRKQKASKL"
FT   gene            <736493..>737431
FT                   /locus_tag="DEHA2E09262g"
FT                   /old_locus_tag="DEHA0E09845g"
FT                   /old_locus_tag="DEHA-IPF12138"
FT                   /old_locus_tag="DEHA-CDS4351.1"
FT   CDS_pept        736493..737431
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09262g"
FT                   /old_locus_tag="DEHA0E09845g"
FT                   /old_locus_tag="DEHA-IPF12138"
FT                   /old_locus_tag="DEHA-CDS4351.1"
FT                   /product="DEHA2E09262p"
FT                   /note="similar to uniprot|P40459 Saccharomyces cerevisiae
FT                   YIL145C PAN6 Pantothenate synthase also known as
FT                   pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87947"
FT                   /db_xref="GOA:Q6BQ09"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ09"
FT                   /protein_id="CAG87947.2"
FT                   /translation="MTLPSSSPIRVLRTIQQVRQWRLSCLLNRESVGLVPTMGALHAGH
FT                   CSLVSQSLKENDRTVVSIFVNPSQFAPHEDLEAYPRTLDTDMETLSNFKGKQVDAIFVP
FT                   KISEMYPSGITLDVNKQKGAFVSVLGCSEQLEGAQRPQFFRGVATIVTKLLNVVTPDQI
FT                   YFGQKDAQQYVVIKNLVKDLLINTNVRVMPTSRESYGLALSSRNAYLSDPAKKRAAVIY
FT                   EALHTGEEYYNKHSQGNQVKSSEIIERIMPIFNEADFEFEMEYLAVSHPESLENLEYVE
FT                   PGVGAIVSTAIRVPKENSDEKIRLLDNILLK"
FT   gene            complement(<737486..>740803)
FT                   /locus_tag="DEHA2E09284g"
FT                   /old_locus_tag="IPF_12137"
FT   CDS_pept        complement(737486..740803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09284g"
FT                   /old_locus_tag="IPF_12137"
FT                   /product="DEHA2E09284p"
FT                   /note="similar to uniprot|P15938 Saccharomyces cerevisiae
FT                   YKR086W PRP16 RNA helicase in the DEAH-box family involved
FT                   in the second catalytic step of splicing exhibits
FT                   ATP-dependent RNA unwinding activity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65793"
FT                   /db_xref="GOA:B5RTY1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY1"
FT                   /protein_id="CAR65793.1"
FT                   /translation="MKEKEEKGNAKIPKRPNNSLEKKKNDRSSKKPKFALSFDDNEELE
FT                   EELNNLNPSSEVNLRKTNFKKIRSKNLPSYNDIKHDFSIDDSLDSNQEHETKAKEGPKF
FT                   KFKKIKKEDALRIKEDETHLPIMPMPKSEESNQKTDISANTKHKNATLSLSELAELEKQ
FT                   QQTELQKETRSFDEFSDNDNDLENDREWYTIDELDHNDLHDDFEDEVFTETTKQISSLK
FT                   RPKEFNIPEGTGGGFDDITGEYYDYDHNQDQSQDLSRIPITSHYFIPPFLEDSKEYLSL
FT                   QIGHDRNDSKIRGIGPTISPIKDPDSELASMAKQGSMVVKERKSKNERSKQAKERSTLS
FT                   GTALGNVLGVETHDKANGSNEKLHENKFSNENEIETQDEKAIIQQQRRSLPAFAVKKNL
FT                   LRTIAENQVTVVIGETGSGKTTQLTQYLYEEGFGSNLEQSGKNRMIGCTQPRRVAAMSV
FT                   AKRVSEEMNCKLGDEVGFAIRFEDKTNPRKTVIKYMTEGVLLREILVDPNLDKYSCIIM
FT                   DEAHERSLNTDVLLGLFKMLLTRRKDLKLIVTSATLNADRFTRYFGNAPQFTIPGRTFP
FT                   VDVLFSKSGCTDYVETAVKQVLTIHLQNSAKSNNNDGDILVFMTGQEDIEVTCELLQEK
FT                   LDLLDNPPPLDIFPIFSTMPADLQKKIFNKTNLERRKVVVATNIAETSLTVDGVKYVID
FT                   TGLVKSKVYNPKLGMDMLQVIPISIANAQQRSGRAGRTGPGVAYRLYTERSAEEQMYLQ
FT                   PIPEIQRTNLSNVMLQLKSLKIEDVPNFPFLDPPPKDLLSCSLYDLWGIGAIDNCGELT
FT                   QLGQSMSRFPMEPALSKLILLSCNSEFHCSEEIIIIVAMLSVPSVFYRPKERANEADAI
FT                   REKFSISESDHLTLLNVYNQWKSHSEKPQMNMKRLTNWCSRNFFHSKSLLRARDIKNQL
FT                   LLIMEKNRLKLLKSRSDEDIRKCLCAAFYQQSAKIMKINIGNTGNSEYIHLRHNYMKMF
FT                   LHPTSALNGGTSMAPTYVVYHELILTNREYMSCVTSVDPLWLLEFGYIFFEVSAKVQAR
FT                   LCGHIDFNLMDPTQLERSLEEDRIKYQAKLQEKKLKRQRNNNSNSITKSKFNKRRAF"
FT   gene            <741175..>741990
FT                   /locus_tag="DEHA2E09306g"
FT                   /old_locus_tag="IPF_12133"
FT   CDS_pept        741175..741990
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09306g"
FT                   /old_locus_tag="IPF_12133"
FT                   /product="DEHA2E09306p"
FT                   /note="weakly similar to ca|CA0538|IPF10901 Candida
FT                   albicans IPF10901 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ07"
FT                   /protein_id="CAG87949.1"
FT                   /translation="MNIKNINNLNNRLSVYFMHHIFVKIRMSPSPTTTKEVFHLYQNFK
FT                   KLGGSLEYFEISRGKNGLNTYSNEVSLIYNPSSQLSQLDPFNGTNKNMKETTAELLALR
FT                   TKLTDTIHSICAIPRYSYVENDEQYVKGEIEIPYKFRLNRDGLKYDKRYSISTSTVNNQ
FT                   FCFISPAPTLENDDKNIMNDSIITNFKSHMRHNFQKFHKFDNITISPAIPNINHIIGRQ
FT                   KLDPLIKQTDGIKYSSLMDLNSDINTMGAETGINLKLQRLSLGFTGFYD"
FT   gene            complement(<742060..>743874)
FT                   /locus_tag="DEHA2E09328g"
FT                   /old_locus_tag="DEHA0E09911g"
FT                   /old_locus_tag="DEHA-IPF12132"
FT                   /old_locus_tag="DEHA-CDS1606.1"
FT   CDS_pept        complement(742060..743874)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09328g"
FT                   /old_locus_tag="DEHA0E09911g"
FT                   /old_locus_tag="DEHA-IPF12132"
FT                   /old_locus_tag="DEHA-CDS1606.1"
FT                   /product="DEHA2E09328p"
FT                   /note="similar to uniprot|P48837 Saccharomyces cerevisiae
FT                   YGR119c NUP57 Essential subunit of the nuclear pore complex
FT                   (NPC) functions as the organizing center of an NPC
FT                   subcomplex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87950"
FT                   /db_xref="GOA:Q6BQ06"
FT                   /db_xref="InterPro:IPR024864"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR025712"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ06"
FT                   /protein_id="CAG87950.2"
FT                   /translation="MFGSTSNSSGSGLFGSNNNTGGGLFGGAKPASTGFGSTPGGTNTG
FT                   FGSNTSTNANTGGGGLFGSNNNTNAPGSSTNAASGGLFGASNNNPVGGSNTGQPASGGL
FT                   FGSQNNANQSAPSGGLFGNNANSAASNASGGLFGNSNANANNNTNNASTNTSGGLFGSS
FT                   GNTSNTGGGLFGSNNANNTTTSGNTGATGGLFGNKPASGGGLFGSSNNTSNTGGGLFGS
FT                   NNTSGSTGGGLFGSSNNATANMNTGSGGLFGSSSGNTQQQQQQQQAPNSQQSGGLFGQN
FT                   TTNNQQPSFGWSNQNQASNQTSQPLFDTTNKLNNPSLNNPNANLNSNTNAASNYNNYTP
FT                   AINDQLIKIKEQWDPNSAKCALKTHLYNKLNDQEINVLLSQQRPSNESPEDWDNAMSKR
FT                   PSPHHYPIKVTSFTDVAQRIETQLDHVAKSRILLNGINEKQSSLSSKHDLDNTTRILKA
FT                   KARHVKLSRRLLRLATVLAILKLKGYPLLPEEEELSKQFDLLNQKLNDPNGSLGKLNDV
FT                   FARLAILKERSEDLSYQFDSSLNSMNNVHGNNIEPNNEKDIIDDGKNNDEVINKLSKLL
FT                   LKQQVGLNHLNDVLEKDLESVNKLTIKN"
FT   gene            complement(<744381..>744893)
FT                   /locus_tag="DEHA2E09350g"
FT                   /old_locus_tag="DEHA0E09933g"
FT                   /old_locus_tag="DEHA-IPF12128"
FT                   /old_locus_tag="DEHA-CDS5732.1"
FT   CDS_pept        complement(744381..744893)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09350g"
FT                   /old_locus_tag="DEHA0E09933g"
FT                   /old_locus_tag="DEHA-IPF12128"
FT                   /old_locus_tag="DEHA-CDS5732.1"
FT                   /product="DEHA2E09350p"
FT                   /note="similar to ca|CA0540|IPF10896 Candida albicans
FT                   IPF10896 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 22K
FT                   chain precursor (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87951"
FT                   /db_xref="GOA:Q6BQ05"
FT                   /db_xref="InterPro:IPR016680"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ05"
FT                   /protein_id="CAG87951.2"
FT                   /translation="MVLGDYFIGRHNWENVDKNTLPSDIPEVDEVGATSAPLLSASYFI
FT                   GSKCKPYNDDFMLCKDENNGGTLECLKEGRRVTRCAISVLSDINKYCFDEFKLHYECLE
FT                   QENHRSGHCRNSESVLNKCIFQNMKLEKKIPDVENQIHLNKNPIYQGTSKDKAKTAEFL
FT                   KAKEANN"
FT   gene            complement(<745075..>745872)
FT                   /locus_tag="DEHA2E09372g"
FT                   /old_locus_tag="DEHA0E09955g"
FT                   /old_locus_tag="DEHA-IPF12127"
FT                   /old_locus_tag="DEHA-CDS4633.1"
FT   CDS_pept        complement(745075..745872)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09372g"
FT                   /old_locus_tag="DEHA0E09955g"
FT                   /old_locus_tag="DEHA-IPF12127"
FT                   /old_locus_tag="DEHA-CDS4633.1"
FT                   /product="DEHA2E09372p"
FT                   /note="similar to ca|CA0970|IPF10894 Candida albicans
FT                   IPF10894 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87952"
FT                   /db_xref="GOA:Q6BQ04"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="InterPro:IPR024602"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ04"
FT                   /protein_id="CAG87952.2"
FT                   /translation="MSGPDYQLNYINGEEFPYPVTINREDFQQELNCDNFQVDEFLYQN
FT                   HRFTSIDSLIKDLTHLLDNLNNELLDLVNNDYTDFIKLGKSINGGLQLMHNIQIDLQNF
FT                   NSNLSSVRKHFQTSNDLVVNSLEKKQELIELKTKIKLCLLLNDHVNNFENILNLDDLNT
FT                   ENVKLVTKLKTLTALYLSLSKLFALITSNERDNSVAFVNKNLKVKIMSLKFEFKGYLDE
FT                   MLTSFKSKRISNQNVILELLNIYKITGHERDFIAIMNAKSSSI"
FT   gene            complement(<746007..>746120)
FT                   /locus_tag="DEHA2E09394g"
FT                   /old_locus_tag="IPF_43124"
FT   CDS_pept        complement(746007..746120)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09394g"
FT                   /old_locus_tag="IPF_43124"
FT                   /product="DEHA2E09394p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65794"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY2"
FT                   /protein_id="CAR65794.1"
FT                   /translation="MQQQYKIVDPALFHPCIGSYTKYHKLINIDPVKLSNR"
FT   gene            complement(<746998..>747225)
FT                   /locus_tag="DEHA2E09416g"
FT                   /old_locus_tag="IPF_43123"
FT   CDS_pept        complement(746998..747225)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09416g"
FT                   /old_locus_tag="IPF_43123"
FT                   /product="DEHA2E09416p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65795"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY3"
FT                   /protein_id="CAR65795.1"
FT                   /translation="MSLKSVSHITETHIRLAGSRSGRTDGYKTVDYTSVVRMECSFAGL
FT                   SRTLFPMSVRSVLLCLQFIASVETLIIELP"
FT   gene            complement(<747880..>748050)
FT                   /locus_tag="DEHA2E09438g"
FT                   /old_locus_tag="IPF_12126"
FT   CDS_pept        complement(747880..748050)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09438g"
FT                   /old_locus_tag="IPF_12126"
FT                   /product="DEHA2E09438p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65796"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY4"
FT                   /protein_id="CAR65796.1"
FT                   /translation="MQDAGKNTFCHEYYFIFDIVFGSLYNRQHGRERFARGITIVPYPT
FT                   INKPMPSITMH"
FT   gene            <748589..>750426
FT                   /locus_tag="DEHA2E09460g"
FT                   /old_locus_tag="DEHA0E09969"
FT                   /old_locus_tag="DEHA-IPF12125"
FT                   /old_locus_tag="DEHA-CDS7016.1"
FT   CDS_pept        join(748589..748706,749474..750426)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09460g"
FT                   /old_locus_tag="DEHA0E09969"
FT                   /old_locus_tag="DEHA-IPF12125"
FT                   /old_locus_tag="DEHA-CDS7016.1"
FT                   /product="DEHA2E09460p"
FT                   /note="some similarities with uniprot|P25042 Saccharomyces
FT                   cerevisiae YPR065W ROX1 Heme-dependent repressor of hypoxic
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87953"
FT                   /db_xref="GOA:Q6BQ03"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ03"
FT                   /protein_id="CAG87953.2"
FT                   /translation="MLLIVDLAHFDDRLVIPTSSLYYESQLRPSDDSCDVVYSSGNADQ
FT                   KFVYQSQPSPDVFSQSGSVSQPSSANTTPASSLSVGSQYVAPASAPVEKCTCKTNTNRI
FT                   PRPRNAFILFRQKNHQSVLEEGSVIRTNPDVSRELGRRWRSLSVPEKNHWNKLAEEEKV
FT                   AHAKKYPGYKYTPRRNGKNKGCPACRQKSLKQQQVQLHNQQMYQLQQGQYQQYMQMQQQ
FT                   QQAAANLQTPIPQNIASSNPNGQPLVNVPLTQFIVPPNPYPQQNFQFAFNNDMNVINQQ
FT                   QLQQQLQQDKASPLSVIPGQVPTINQANSDFLNPVNASQMQLNYDQNPQSARFNSLPTP
FT                   MGSNYGFEFGNMHQQS"
FT   gene            complement(<752254..>753273)
FT                   /locus_tag="DEHA2E09482g"
FT                   /old_locus_tag="DEHA0E09999g"
FT                   /old_locus_tag="DEHA-IPF12120"
FT                   /old_locus_tag="DEHA-CDS3802.1"
FT   CDS_pept        complement(752254..753273)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09482g"
FT                   /old_locus_tag="DEHA0E09999g"
FT                   /old_locus_tag="DEHA-IPF12120"
FT                   /old_locus_tag="DEHA-CDS3802.1"
FT                   /product="DEHA2E09482p"
FT                   /note="similar to uniprot|P36152 Saccharomyces cerevisiae
FT                   YKR071C DRE2 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87954"
FT                   /db_xref="GOA:Q6BQ02"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="InterPro:IPR031838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BQ02"
FT                   /protein_id="CAG87954.2"
FT                   /translation="MTRILLLLHPTAVTDEQLVTKVKSEISSTNSDADVVQHIIDRVAN
FT                   KIVKLENNTFDEVIYINPNEGEFNRQLPVSTITIIYDSLVEDGVLKGDLPTNQNLDAIM
FT                   SGFIVGEQGNWIKPKAVGESVSIPLKKKEVAVGGASKQCLPSFKKLSSTHAAVGLTDTS
FT                   ASNTDEENDDVNSKRKLQETKLAYFSESDDEDEEDQIIDENNLISEVRTANLVVPKKCE
FT                   LPNGKKRRKACKDCTCGLKEIEAQETSDKSTLQNSILNQMVQSANLEAMKIEEKMKNAV
FT                   KFDDNDLAEIDFTVEGKKGGCSSCSLGDAFRCDGCPYLGLPPFKPGEVVSIDNFGEDI"
FT   gene            complement(<753676..>756207)
FT                   /locus_tag="DEHA2E09504g"
FT                   /old_locus_tag="DEHA0E10021g"
FT                   /old_locus_tag="DEHA-IPF12116"
FT                   /old_locus_tag="DEHA-CDS0722.1"
FT   CDS_pept        complement(753676..756207)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09504g"
FT                   /old_locus_tag="DEHA0E10021g"
FT                   /old_locus_tag="DEHA-IPF12116"
FT                   /old_locus_tag="DEHA-CDS0722.1"
FT                   /product="DEHA2E09504p"
FT                   /note="similar to ca|CA2553|IPF9096 Candida albicans
FT                   IPF9096 probable mannosidase (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87955"
FT                   /db_xref="GOA:Q6BQ01"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ01"
FT                   /protein_id="CAG87955.2"
FT                   /translation="MTMTSQTTYNTLSNWSYKRANKDSTKWQPCSKKTNGNQIHTDLLN
FT                   NGEIPDPFIDRNEKDLQWIGEEDWEYKTTFKVDSNKKHELVFEGLDTFATIYVNDKQVL
FT                   TTDNMFRTYTLDVTNCSQESNELRIVFKSALKVSRALEEKHGKFTCFNGETSRVHARKA
FT                   QYHYGWDWGPLLLTCGPWKPIKLVTYSTAKINDFYVKQSVDENLQAELSFEVEVESISD
FT                   DCQLSIEIFSSAGKLIRTIKESANKSYTFDPIKLEDPELWYPKGYGKQPLYKFVAKLHQ
FT                   TDQIIDSVVSEVGVRRARLVQEPVKGQDGSSFYFEVNNIPIFCNGSNWIPSHSFSCSLI
FT                   DDDYVDLIRLVDEGNQNMIRVWGGGFYENDILYKQCDKLGILIWQDFMFGCAIYPGYKE
FT                   FIDNVTHEVIDQLKRLRNYCSIVFYVGNNEDYQVAEDLYKKNTFTDEEFPAKKLYERIL
FT                   PDMVSKLTSGVGYQFGSPISPGQGVPTTDVTVGDIHQWNVWHGTQEKYQDWGKLVGRFV
FT                   SEFGMLAFPDIKTLKDCITDEKQLYPQSETMDHHNKSIGFERRLALYVMENFSVSSMAL
FT                   ADWIYITQLMQSDCLAYAYRNWKREWGSKNERKCGGALVWQINDCWPVTSWAIIDFYHR
FT                   PKLAYYAIKRECQPLMLGIYRTETRLRQPGEPDLEKQAPLHDYSPREYTIDVWGVNSTL
FT                   QDFSGTLEVELYHCETGELVSNLEKSKITLAPNQTTELVTKSKIDSNKLVVHAKLVDSA
FT                   SKLVSNTSDWPQPLKYIIWPKDTKLDVSIPENGTIKLSTNKPVKGIALNIEGDYYLHDN
FT                   SIDLLPNNDHYIKVDNLQSDDVAKISVNYLK"
FT   gene            complement(<756881..>758185)
FT                   /locus_tag="DEHA2E09526g"
FT                   /old_locus_tag="DEHA0E10043g"
FT                   /old_locus_tag="DEHA-IPF12114"
FT                   /old_locus_tag="DEHA-CDS2873.1"
FT   CDS_pept        complement(756881..758185)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09526g"
FT                   /old_locus_tag="DEHA0E10043g"
FT                   /old_locus_tag="DEHA-IPF12114"
FT                   /old_locus_tag="DEHA-CDS2873.1"
FT                   /product="DEHA2E09526p"
FT                   /note="weakly similar to ca|CA0769|IPF10967 Candida
FT                   albicans IPF10967 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BQ00"
FT                   /protein_id="CAG87956.2"
FT                   /translation="MSGEKPTTPISSPKLPKTMKLETPTTPPSRHKQKRISASFLKTPE
FT                   QPSDMLAFSPSYKRNSSGNYKSPDYKFNAHVAPSPYSSLKTPRHTGYDSDDSNERIKFQ
FT                   KTPQYLSPGKKLFNDDSNNKEGLSEISLQLKSKLSSAADKLHQQQRQQDKVPAKIDFNE
FT                   LSFSSATSPTKKQKSNQEKQWNPTSSGQTANLNLQTLQQSPVPASSPSFLSTPSFQQSR
FT                   GLKQSPTLPNDHQSHTIHIPSIDDEESSAHNALMAALTRQRRKSRTSFSSSQRRPSSTP
FT                   TLYDSQPSNLAQPLSASGSLQHIATHGQSSHHSQQPPLKLPPINANNPKDSDKPVNEQD
FT                   AVLSLMSLSSPQSVKFSHSRTQSLNNNSPGSSRSSSVAINSPGHQSTNTKLPPISGLIN
FT                   PATSRDAKKNYDNDETDVEDDATDDDIDNGINNNV"
FT   gene            <759006..>760958
FT                   /locus_tag="DEHA2E09548g"
FT                   /old_locus_tag="DEHA0E10065g"
FT                   /old_locus_tag="DEHA-IPF12113"
FT                   /old_locus_tag="DEHA-CDS1496.1"
FT   CDS_pept        759006..760958
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09548g"
FT                   /old_locus_tag="DEHA0E10065g"
FT                   /old_locus_tag="DEHA-IPF12113"
FT                   /old_locus_tag="DEHA-CDS1496.1"
FT                   /product="DEHA2E09548p"
FT                   /note="similar to uniprot|P40460 Saccharomyces cerevisiae
FT                   YIL144W TID3 Component of the evolutionarily conserved
FT                   kinetochore-associated Ndc80 complex
FT                   (Ndc80p-Nuf2p-Spc24p-Spc25p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87957"
FT                   /db_xref="GOA:Q6BPZ9"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="InterPro:IPR038273"
FT                   /db_xref="InterPro:IPR040967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPZ9"
FT                   /protein_id="CAG87957.2"
FT                   /translation="MNVDYPMNNIPQASSLLRKNNGKRLSMASAARTSLLGNLNLNGTS
FT                   GGASGRNSNIIDSSSLSMGNTGKRRSLLSTPASINRRRQSSLLQAPMSSSQMSSQSQQA
FT                   SQQTQAPFNQDQRPLRDKNYQTLIQQEIYDFLLANKFELEMNHPLTFKTLKQPTQKDFV
FT                   VIFQFLYNKIDPYYRFTKSIETEVFLLLKILNYPYLDGINRSQISAVGGQNWPNFLGML
FT                   YWLVKLNLSVLNLNSKVDLISPDDEFDKIFINYITQSYRAFIDERDDYSEYYDEMKSRF
FT                   DELNNNIIQDIENISNENNELLNQYNELNGQLDILENSEKKSKALENDLIKFKAYIETM
FT                   ESRKSKWSEILNKITQEIGNCEVELNNIESVKRDYEAQIGQQGLTPNDIDNLNTERDKL
FT                   SKSIDLISNSLEDLKDVYHNKQINLQKNYQSLENFLKQYNNLIYKIQLKNHNYDYNFEI
FT                   NFRNNTIINETPDLLKPNEIINKNLKDEKIQLLNYKSIINTNVHMHQDEQIKLQEQIDL
FT                   ISELIMERREEIETLEAKLTANKSTYDEIYETMINDTTTYSMQIEKLERELRSIKINTN
FT                   QGFIEVENKFQNIQIEYDELLYEIHSNRSILHDKIQKIIESTIGFKINIQSNLEDLENL
FT                   AFDEFEKEDKKLNKN"
FT   gene            complement(<761062..>761610)
FT                   /locus_tag="DEHA2E09570g"
FT                   /old_locus_tag="DEHA0E10087g"
FT                   /old_locus_tag="DEHA-IPF12111"
FT                   /old_locus_tag="DEHA-CDS5567.1"
FT   CDS_pept        complement(761062..761610)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09570g"
FT                   /old_locus_tag="DEHA0E10087g"
FT                   /old_locus_tag="DEHA-IPF12111"
FT                   /old_locus_tag="DEHA-CDS5567.1"
FT                   /product="DEHA2E09570p"
FT                   /note="weakly similar to uniprot|P22354 Saccharomyces
FT                   cerevisiae YKR085C MRPL20 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87958"
FT                   /db_xref="InterPro:IPR024388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ8"
FT                   /protein_id="CAG87958.1"
FT                   /translation="MLRNNIRRYSIKNIPFEAQPKNKYNAQRSAFNLKPVPTQGLVHNP
FT                   PASVPIARNTPKAFLPPNDPRLHKLEGKYKTYSADVLEDMPVIYGMAKEKDYSMTAETA
FT                   REILKLRTEDPSKWTVSKLAKEFNVSKQSVNVVTMKNEKRGEEVISQLEVLQEKWTNNK
FT                   LMSRNDRRKRVQMWLRNEY"
FT   gene            <762424..>763374
FT                   /locus_tag="DEHA2E09592g"
FT                   /old_locus_tag="DEHA0E10109g"
FT                   /old_locus_tag="DEHA-IPF12110"
FT                   /old_locus_tag="DEHA-CDS4054.1"
FT   CDS_pept        762424..763374
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09592g"
FT                   /old_locus_tag="DEHA0E10109g"
FT                   /old_locus_tag="DEHA-IPF12110"
FT                   /old_locus_tag="DEHA-CDS4054.1"
FT                   /product="DEHA2E09592p"
FT                   /note="weakly similar to uniprot|Q12218 Saccharomyces
FT                   cerevisiae YOR009W TIR4 Cell wall mannoprotein of the
FT                   Srp1p/Tip1p family of serine-alanine-rich proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ7"
FT                   /protein_id="CAG87959.2"
FT                   /translation="MLVGCILPLALLAAAGVEAAETTTTLQSTITITKTLYSPEESSSM
FT                   SAASEASVSEASVASVSSASSASAASAASASKASEVSAASKASAASVASSASEASAASV
FT                   ASYAFEAKAASAASKASAASAASDASIASAASKASAASAASDASVASEASVASVASKAS
FT                   VASDASVASVASVASVSSASAAAAAKLTSVAPAPTAEFNVLKGNAIAGEFRVVNQTTTS
FT                   APPSSTYVAPNTGYNATVIGSHSKNTTAIGGHHSKNTTVAGGKRSSTSSPVRSSTKASS
FT                   GSSSSSSQAGAVVNFGDASKGVALGFIGVVAAALL"
FT   gene            complement(<763689..>765296)
FT                   /locus_tag="DEHA2E09614g"
FT                   /old_locus_tag="IPF_12106"
FT   CDS_pept        complement(763689..765296)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09614g"
FT                   /old_locus_tag="IPF_12106"
FT                   /product="DEHA2E09614p"
FT                   /note="similar to CA2547|IPF14911 Candida albicans IPF14911
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65797"
FT                   /db_xref="GOA:B5RTY5"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037791"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY5"
FT                   /protein_id="CAR65797.1"
FT                   /translation="MSDPNISNIADDPLGPESADGTLVIIVCRAKHLPNRRKLDKQSPY
FT                   VTLRIGTTAKKTSSHFRAGQTPEWTHEIRFELTRDRRPIMKLDVLDETKNDPTPIGTVD
FT                   IDCSTVFANPNNEKDGKYIFDKWHDLTLNGRRAGMIYLEMTFYPSAPILPPKFTGPLYN
FT                   EQDVDAFHHSVSSRKDLPPPPPKHPSQAHPHTVADDIFVTSESEKGSKRMPFFKNSDGS
FT                   LGGRFSGSNGSGGDDVFEPAKDSNSSPPKKYKLKLMNKFKKFQNKEPITNIWQKGNGQG
FT                   SPERGTSPISEYRVEDFGEVANEKKKEYYKLPEMPDKFKESDEEDFELRPPIPPPHLVN
FT                   QQAKSELPPSTPPSSKNQSSNHPSRKPPQDLDDQSHIKPVSNTSIPFSADTIGLDEGEE
FT                   DGCDGTLPTKVYFLDQQVKSLTFTGREDASKGHQINPDEIDPKYYAPTPNEHFGRAYQP
FT                   RFSANGEQNGYLGDGKWNRDPKFSPSVFDRMPLIGDENFGFENKPHVPPKIPKGLTEQE
FT                   YYVLEKEKYLKDVNGRRL"
FT   gene            <765492..>766238
FT                   /locus_tag="DEHA2E09636g"
FT                   /old_locus_tag="DEHA0E10131g"
FT                   /old_locus_tag="DEHA-IPF12104"
FT                   /old_locus_tag="DEHA-CDS4819.1"
FT   CDS_pept        765492..766238
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09636g"
FT                   /old_locus_tag="DEHA0E10131g"
FT                   /old_locus_tag="DEHA-IPF12104"
FT                   /old_locus_tag="DEHA-CDS4819.1"
FT                   /product="DEHA2E09636p"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151C RPC31 RNA polymerase III subunit C31"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87960"
FT                   /db_xref="GOA:Q6BPZ6"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ6"
FT                   /protein_id="CAG87960.2"
FT                   /translation="MDKLEPVVNGRGCILLQYIHQTMSFRTRNSNRVLLPFGLDYSDIS
FT                   SADHTTEQPQLVLPVNGPLTPNEEAAAKQSIAFSSLMLDGPFYTGSTLNTSKEQATTTG
FT                   PDGIERYSDKYKKIKKIGRTIEEHPYQLEFYPDELYSVMGISNKQKKKLLSLSTFKADG
FT                   GLKQYAARESEPDSAQSMLEKLKDMAEDLDSNNTNNATKEDENEEIEEEMDDDFEEDDD
FT                   DDYNAEKYFDDGDDDVADDGDDEAAF"
FT   gene            complement(<766363..>767988)
FT                   /locus_tag="DEHA2E09658g"
FT                   /old_locus_tag="DEHA0E10153g"
FT                   /old_locus_tag="DEHA-IPF12103"
FT                   /old_locus_tag="DEHA-CDS2028.1"
FT   CDS_pept        complement(766363..767988)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09658g"
FT                   /old_locus_tag="DEHA0E10153g"
FT                   /old_locus_tag="DEHA-IPF12103"
FT                   /old_locus_tag="DEHA-CDS2028.1"
FT                   /product="DEHA2E09658p"
FT                   /note="similar to uniprot|Q06506 Saccharomyces cerevisiae
FT                   YPR137W RRP9 part of small (ribosomal) subunit (SSU)
FT                   processosome (contains U3 snoRNA)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87961"
FT                   /db_xref="GOA:Q6BPZ5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039241"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ5"
FT                   /protein_id="CAG87961.2"
FT                   /translation="MAGDSFLSDPSKKRRRSGKATSTTNKSKRSSRTSTPSASKEQDEE
FT                   ISGGSDSEDEQGNVSIGSGDEDVDRDNEEIESDEEFVDENAADKRRRLAKQYLDNLKSS
FT                   TEMGGDFNDFDAQDLDDDILATRLQVDVAENKGYVYKFIGERVSSQIDEIKTVITRIGS
FT                   KNLTGLSVRYPSLYTVSKDIEIIKWDISSDKKKPQRIKHTRGGSKYFKLFNNPSQNHHW
FT                   DTINCVAASPDGKFIVTGGNDSRLIIWSTENLACLKVLETRSPVNSVSFRRGTDQLYAA
FT                   CADLRVRTYSINQFAQLEVLYGHQDNISDISALAKETCVSVGSRDKTALFWKISEESRL
FT                   TFRGGDSTDRRAKKSYKKKQNKEEEPSDEQPFHAEGSIDVVSMVDESHFVTGSDNGNIA
FT                   LWSLAKKKALFTQRLAHGLQPEYAPSQASAEKSIDNASRQIPERQPYWITAIHAVPYSD
FT                   LFVSGSFDGSLHVWRISQEGLRSFELIGKISNVKGCVVRIDSAEIGNNKVVIHALVSKE
FT                   HRLGRWLEKIEGGRNSLVSFAFDI"
FT   gene            complement(<768321..>768698)
FT                   /locus_tag="DEHA2E09680g"
FT                   /old_locus_tag="DEHA0E10175g"
FT                   /old_locus_tag="DEHA-IPF12101"
FT                   /old_locus_tag="DEHA-CDS7397.1"
FT   CDS_pept        complement(768321..768698)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09680g"
FT                   /old_locus_tag="DEHA0E10175g"
FT                   /old_locus_tag="DEHA-IPF12101"
FT                   /old_locus_tag="DEHA-CDS7397.1"
FT                   /product="DEHA2E09680p"
FT                   /note="similar to uniprot|P53903 Saccharomyces cerevisiae
FT                   YNL149C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87962"
FT                   /db_xref="GOA:Q6BPZ4"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ4"
FT                   /protein_id="CAG87962.1"
FT                   /translation="MFEIIFQYIDHDSFYKYLRLLIIVGMYLMCRNIYSEYAKQSQVKR
FT                   QIALDEKEKLEKPAKEERERAEKEEALEKDAASFGWGKKTRKNVKIQESILQQESEDLR
FT                   QRYQSGYDAAEDHDIEDLLED"
FT   gene            complement(<769049..>769798)
FT                   /locus_tag="DEHA2E09702g"
FT                   /old_locus_tag="DEHA0E10197g"
FT                   /old_locus_tag="DEHA-IPF12100"
FT                   /old_locus_tag="DEHA-CDS4809.1"
FT   CDS_pept        complement(769049..769798)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09702g"
FT                   /old_locus_tag="DEHA0E10197g"
FT                   /old_locus_tag="DEHA-IPF12100"
FT                   /old_locus_tag="DEHA-CDS4809.1"
FT                   /product="DEHA2E09702p"
FT                   /note="similar to ca|CA2543|IPF16925 Candida albicans
FT                   IPF16925 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87963"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ3"
FT                   /protein_id="CAG87963.2"
FT                   /translation="MSDINVYITSDLTSSERRISPQWDIQYLKKKLELITGIAPKDQTI
FT                   QHYAIPSSNEFIVISDANKYSAAEDSTSHVSDYNVLPFSRLHIHDNNPDSQLNQLQGDD
FT                   ATEEFKLSEEEYAKRTDSVLHWKSTNKLGRFDPEYELQKARQLEENLKISSSLHVGDRC
FT                   RIINIEGERRGAIKYVGKIMLLDEGENVWVGIEFDEPVGKNNGSISGTKIFECRENHGS
FT                   FVKPKQVEVGDFPELDPFASDDDDDEI"
FT   gene            <770506..>771017
FT                   /locus_tag="DEHA2E09724g"
FT                   /old_locus_tag="DEHA0E10230g"
FT   CDS_pept        join(770506..770514,770585..770804,770878..771017)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09724g"
FT                   /old_locus_tag="DEHA0E10230g"
FT                   /product="DEHA2E09724p"
FT                   /note="similar to uniprot|P53905 Saccharomyces cerevisiae
FT                   YNL147W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87965"
FT                   /db_xref="GOA:Q6BPZ1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPZ1"
FT                   /protein_id="CAG87965.2"
FT                   /translation="MDNPRQNNNNNNTNRRRNNNSSKPDGPKREAILDLNNYKDKQIRV
FT                   KFIGGRQVIGVLKGFDQLMNLVLEDVKENIRDPEDDNVLTDKTRDIGFVVVRGPSLLTI
FT                   SPVDGSEIIDNPFANQEE"
FT   gene            <771555..>772211
FT                   /locus_tag="DEHA2E09746g"
FT                   /old_locus_tag="IPF_12095"
FT   CDS_pept        771555..772211
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09746g"
FT                   /old_locus_tag="IPF_12095"
FT                   /product="DEHA2E09746p"
FT                   /note="highly similar to uniprot|P18562 Saccharomyces
FT                   cerevisiae YHR128W FUR1 Uracil phosphoribosyltransferase
FT                   synthesizes UMP from uracil"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65798"
FT                   /db_xref="GOA:B5RTY6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY6"
FT                   /protein_id="CAR65798.1"
FT                   /translation="MSKCQEVSDNVILLPQTNQLRGLYSIIRDHSTKRGDFVFYSDRII
FT                   RLLVEEGLNLLPVEEATIQCYGNQTFKGAKFLGKICGVSIVRAGESMEMGLRDCCRSVR
FT                   IGKILIQRDEETALPKLFYEKLPEDISERYVFLLDPMLATGGSAMMAVEVLLSRGVKMD
FT                   RIFFLNLLAAPEGIKAFHDNYPDVKIITGGIDEKLDENKYIVPGLGDFGDRYYCI"
FT   gene            complement(<772271..>773533)
FT                   /locus_tag="DEHA2E09768g"
FT                   /old_locus_tag="IPF_12094"
FT   CDS_pept        complement(772271..773533)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09768g"
FT                   /old_locus_tag="IPF_12094"
FT                   /product="DEHA2E09768p"
FT                   /note="highly similar to uniprot|P38696 Saccharomyces
FT                   cerevisiae YHR129C ARP1 Actin-related protein of the
FT                   dynactin complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65799"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY7"
FT                   /protein_id="CAR65799.1"
FT                   /translation="MESETLYNQPVVIDNGSGNLKAGFAGEDKPKAYASAIIGRPKYQK
FT                   IMAGSLISSGDDKTGEDTFIGDIAQQNRGLLRLSYPIEHGIVNNWDDMEKLWYHTYTQD
FT                   LKTNAEEHPLLITEAPLNPRINRDKMCQILFESFNVPCIYVSIQAVLSLYASGRTTGVV
FT                   IDSGDGVSHIVPVYEGFALPTSIKRMDIAGRDITENLSFNLRRMTGISLQSSSELEIVR
FT                   LIKEKCCYISKDPTKDETLYSSSAYNHYLNTNSQNIKESDLFASYKLPDGHTIQLGAER
FT                   FRSTEILFNPQLIGDESPGLHELASLAIAKTDLDLRPVLYQNLVLSGGNTLLKNFGDRL
FT                   LVELKNQQSQQAGSYGIWNTSSNTNNYDTKMKIKIHAPPERKYSTWIGGSILAGLSTFK
FT                   KMWVTASEYAEDPEIIHKKCM"
FT   gene            <773789..>774295
FT                   /locus_tag="DEHA2E09790g"
FT                   /old_locus_tag="DEHA0E10296g"
FT                   /old_locus_tag="DEHA-IPF12093"
FT                   /old_locus_tag="DEHA-CDS6303.1"
FT   CDS_pept        773789..774295
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09790g"
FT                   /old_locus_tag="DEHA0E10296g"
FT                   /old_locus_tag="DEHA-IPF12093"
FT                   /old_locus_tag="DEHA-CDS6303.1"
FT                   /product="DEHA2E09790p"
FT                   /note="weakly similar to uniprot|Q06580 Saccharomyces
FT                   cerevisiae YPR188c MLC2 Regulatory light chain for the type
FT                   II myosin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87968"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY8"
FT                   /protein_id="CAG87968.2"
FT                   /translation="MSALNTLSNNQKTQLRNAFTLIDGESRDSVITKQDLINLYKTLGI
FT                   KVPTDKQLDSMLTVDGSSKKEEKSINFTQFSNIMAKELSQFEDRETIYNALKVFSDDKE
FT                   SKDLTIDVEALKEACCSVQLGEIGSGDHRLSRATFDKLVDGFVKEQVDGRKIFSASKWI
FT                   DAYID"
FT   gene            complement(<774482..>774958)
FT                   /locus_tag="DEHA2E09812g"
FT                   /old_locus_tag="DEHA0E10318g"
FT                   /old_locus_tag="DEHA-IPF12091"
FT                   /old_locus_tag="DEHA-CDS5904.1"
FT   CDS_pept        complement(774482..774958)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09812g"
FT                   /old_locus_tag="DEHA0E10318g"
FT                   /old_locus_tag="DEHA-IPF12091"
FT                   /old_locus_tag="DEHA-CDS5904.1"
FT                   /product="DEHA2E09812p"
FT                   /note="similar to uniprot|P20435 Saccharomyces cerevisiae
FT                   YPR187W RPO26 RNA polymerase subunit ABC23 common to RNA
FT                   polymerases I II and III"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87969"
FT                   /db_xref="GOA:Q6BPY7"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR028363"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY7"
FT                   /protein_id="CAG87969.1"
FT                   /translation="MSDIEESAYNEAPENFEDFDQADHFSEDDFNEPAAENENVNNGDV
FT                   EMKATDGRTIINGGLGPDEVQPRPKSARELAVPKEDRTTTPYMTKYERARVLGTRALQI
FT                   SLNAPVLVDIEGETDPLQIAMKELAQRKIPLVVRRYLPDGSFEDWGCDELIIDH"
FT   gene            complement(<775417..>776547)
FT                   /locus_tag="DEHA2E09834g"
FT                   /old_locus_tag="DEHA0E10340g"
FT                   /old_locus_tag="DEHA-IPF12089"
FT                   /old_locus_tag="DEHA-CDS3388.1"
FT   CDS_pept        complement(775417..776547)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09834g"
FT                   /old_locus_tag="DEHA0E10340g"
FT                   /old_locus_tag="DEHA-IPF12089"
FT                   /old_locus_tag="DEHA-CDS3388.1"
FT                   /product="DEHA2E09834p"
FT                   /note="similar to uniprot|P07257 Saccharomyces cerevisiae
FT                   YPR191W QCR2 40 kDa ubiquinol cytochrome-c reductase core
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87970"
FT                   /db_xref="GOA:Q6BPY6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPY6"
FT                   /protein_id="CAG87970.1"
FT                   /translation="MLSRVSARSYSSAAQSIKLTAREAPGNLSTLSVVVNNAGSKAGKS
FT                   GVAHLLSKYNFLNNEAKSALRFTRESELLGGIVSSDVTRDSIVLKTQFLKQDLPYFVEA
FT                   LGNVLTKTSFRDHELPETVLPAAKAQNAEAQGSNAFKAFESLHEISFRKGLGNPLYYDG
FT                   TSPISVDEIKQFASEAYNTSNVSVFGSGVNEGDLKKFIGESAFSALPAGSSKTTPVELH
FT                   NGKESRIRAAGGSVALIGVPIKTADFAKYEVLSAAIGSTYLPGSSAPLSQIPGAISKVL
FT                   KYQDAGLFVICVCNSDAAVVAQGVKAAKKAVDSVSASDLSSATKAAELAVALQSRFESP
FT                   VDVKIDASAAKSPAKLSEFNYVAVGNVDLLPYANEL"
FT   gene            complement(<776785..>778074)
FT                   /locus_tag="DEHA2E09856g"
FT                   /old_locus_tag="DEHA0E10362g"
FT                   /old_locus_tag="DEHA-IPF12084"
FT                   /old_locus_tag="DEHA-CDS2914.1"
FT   CDS_pept        complement(776785..778074)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09856g"
FT                   /old_locus_tag="DEHA0E10362g"
FT                   /old_locus_tag="DEHA-IPF12084"
FT                   /old_locus_tag="DEHA-CDS2914.1"
FT                   /product="DEHA2E09856p"
FT                   /note="similar to uniprot|P41733 Saccharomyces cerevisiae
FT                   YLR459W GAB1 GPI transamidase subunit involved in
FT                   attachment of glycosylphosphatidylinositol (GPI) anchors to
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87971"
FT                   /db_xref="GOA:Q6BPY5"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY5"
FT                   /protein_id="CAG87971.2"
FT                   /translation="MERLTLVLLIGALIRFVLPTSLPSLPLDLSSSIEIATPLTSFKSL
FT                   KEAFYYLQHNIDLYDGGVNHHPPLLVILLNLIDEYLPKRLGDIVFNGLYTGVDLMIASR
FT                   LIHVNKWYNKHMSQRTGRSIQGFSDDMIAAFYLFNPLLILTNISHSTLCFTFLAITESL
FT                   YQLVIDRNVARSVISMAIASYLSFRPIFLIIPLLGLAHSLDSDWQTVYAHGIALFSSAC
FT                   GILVLTSSVMTESFQFLDSCYGIVIKFNKITPNLGLWWYIFTEMFDFFTPFYVGVFNLF
FT                   SVIFVIPFTLRLFEFNHKSGKPTGDAFLAVVTSYLWLSFTKSYPSVGDLAFALSLIPIF
FT                   KDTIIPHCKYHFLTALVLLVALLLSPIFYYCWIVLGTGNSNFFYSINLVWGVVHGLILT
FT                   DLVWGKLNYDYIELNDIPADEVSKLRLTQI"
FT   gene            <778261..>778699
FT                   /locus_tag="DEHA2E09878g"
FT   CDS_pept        join(778261..778269,778403..778699)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09878g"
FT                   /product="DEHA2E09878p"
FT                   /note="similar to uniprot|P54999 Saccharomyces cerevisiae
FT                   YPR182w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87972"
FT                   /db_xref="GOA:Q6BPY4"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="InterPro:IPR034100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY4"
FT                   /protein_id="CAG87972.1"
FT                   /translation="MSSFQPINPKPFLKTLIGKQVIVRLKWNKTEYKGTLISIDNYMNL
FT                   QLDKTSEVIYEDGEKKEEVIGEIFIRCNNVLFIREDKEVQNGSDSGEADVKMEDGN"
FT   gene            <779098..>780036
FT                   /locus_tag="DEHA2E09900g"
FT                   /old_locus_tag="DEHA0E10406g"
FT                   /old_locus_tag="DEHA-IPF12080"
FT                   /old_locus_tag="DEHA-CDS4095.1"
FT   CDS_pept        779098..780036
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09900g"
FT                   /old_locus_tag="DEHA0E10406g"
FT                   /old_locus_tag="DEHA-IPF12080"
FT                   /old_locus_tag="DEHA-CDS4095.1"
FT                   /product="DEHA2E09900p"
FT                   /note="similar to ca|CA1341|IPF11344 Candida albicans
FT                   IPF11344 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87973"
FT                   /db_xref="GOA:Q6BPY3"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY3"
FT                   /protein_id="CAG87973.2"
FT                   /translation="MSEPQVAPYGGLLTKTLDDEKARESKLQEQCIEVQVNNQTEVLRP
FT                   EALHIRGVDSLSTEDIKAFIDYYVNYTVTEQQEQVEGQDEPASKIVYEPFPIDEQITFR
FT                   IQWINDTSVNVSFKSMEDAHSALKSISISSNPNIQVELNEDQKIQDAIQERETKPYAPI
FT                   IAFRKQQNLSNRLGVATGDDKEQPPVEQDNTMDEDDTSIVLFVRQSFQSDRKVKNASAY
FT                   SRYYLMHGEPERKPRHHNKYRSRESHHSRRRERKPDQEQDQEEDLFAHKLRQSKPANGR
FT                   RGRDNEEDLFPGRSRSRTASRDRSRSPMRID"
FT   gene            complement(<780178..>781467)
FT                   /locus_tag="DEHA2E09922g"
FT                   /old_locus_tag="DEHA0E10428g"
FT                   /old_locus_tag="DEHA-IPF12079"
FT                   /old_locus_tag="DEHA-CDS2913.1"
FT   CDS_pept        complement(780178..781467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09922g"
FT                   /old_locus_tag="DEHA0E10428g"
FT                   /old_locus_tag="DEHA-IPF12079"
FT                   /old_locus_tag="DEHA-CDS2913.1"
FT                   /product="DEHA2E09922p"
FT                   /note="highly similar to uniprot|P52917 Saccharomyces
FT                   cerevisiae YPR173C VPS4 Defective in vacuolar protein
FT                   sorting"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87974"
FT                   /db_xref="GOA:Q6BPY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY2"
FT                   /protein_id="CAG87974.2"
FT                   /translation="MSGASDFLSKGIDLVQKAIDADTATRYEEAYKLYYNGLDYLMLAL
FT                   KYEKNQKSKELIKSKFTEYLTRAEQLKDHLEKQAKSNTAEGSSDGSTKAKKSGDGDDDD
FT                   TKKLRGALAGAILSETPNVKWDDIAGLESAKEALKEAVILPVKFPQLFTGNRKPTSGIL
FT                   LYGPPGTGKSYLAKAVATEAKSTFFSVSSSDLISKWMGESERLVKQLFTMARENKPSII
FT                   FIDEVDALCGPRGEGESEASRRIKTELLVQMNGVGNDSNGVLVLGATNIPWQLDAAIRR
FT                   RFERRIYIALPEAEARTRMFEINIGTVPCECSGQDYKMLADMTEGYSGHDIAVVVRDAL
FT                   MQPIRKIQQATHFKTVMTEDGEEKLTPCSPGDEGAREMGWQEIDTDELKEPELTIKDFI
FT                   KSIKNNRPTVNQSDIGNHTKFTEDFGQEGN"
FT   gene            <782649..>784517
FT                   /locus_tag="DEHA2E09944g"
FT                   /old_locus_tag="DEHA0E10450g"
FT                   /old_locus_tag="DEHA-IPF12076"
FT                   /old_locus_tag="DEHA-CDS1509.1"
FT   CDS_pept        782649..784517
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09944g"
FT                   /old_locus_tag="DEHA0E10450g"
FT                   /old_locus_tag="DEHA-IPF12076"
FT                   /old_locus_tag="DEHA-CDS1509.1"
FT                   /product="DEHA2E09944p"
FT                   /note="similar to uniprot|P53918 Saccharomyces cerevisiae
FT                   YNL125C ESBP6 involved in transport of monocarboxylates
FT                   such as lactate pyruvate or acetate across the plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87975"
FT                   /db_xref="GOA:Q6BPY1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY1"
FT                   /protein_id="CAG87975.2"
FT                   /translation="MPYDKSFEDDPKMMTDTESHLSNDSIRHEPYQLQAITSGRSSIGS
FT                   RNTRDSMKRIKSNNSELSRIITAIRDDHQQDHEEFQQYRDDVDLDRILDTQLDRTSRRS
FT                   VADEENNIEQRESYEKDASADEEEGEHGDKEDIDEPPDGGYGWVAAFCAMMAAFSTWGA
FT                   NAGYGVFLNYYLSTDTFPGGGAYDYALIGGLVVFLAQVLAPFSALAYKILGFYTLCFIG
FT                   IFLQTCGYILASFATKLWQIYLTQGVLVGVSFSLIFIPPTLILPQYFKKYRAFAMGIAV
FT                   SGAGLGGIVFALSTSKLIQETGDQRWALRMTGFVTLTSALIATILNKPRNYNPMPYSTT
FT                   LKKKFIIDNFKLVFDIKIFKSYPLVLVSLWFSLCLLGYTLMLFSMAAYSSSVGLSAHDA
FT                   STVTALLNVGQVFGRPTLGLVADRVGRNNLAASVSLLISILLWAFWINATTFPVISVFA
FT                   IILGFFIGIGSLMCQSLAADIIQAPEKIPAAWSIINIIVSFFCLVAEVIALAIRDESSD
FT                   RPFLNTQIFSGCCFFAAFLLLLIDREWLVRRTLYNRLLAAKSGFSCLEKKRHRYLNTDD
FT                   LQEDGAEINSSKMELELLEARVTKYERLLRKSAVYFFIRMVYPIRV"
FT   gene            complement(<784712..>785383)
FT                   /locus_tag="DEHA2E09966g"
FT                   /old_locus_tag="DEHA0E10472g"
FT                   /old_locus_tag="DEHA-IPF12074"
FT                   /old_locus_tag="DEHA-CDS5113.1"
FT   CDS_pept        complement(784712..785383)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09966g"
FT                   /old_locus_tag="DEHA0E10472g"
FT                   /old_locus_tag="DEHA-IPF12074"
FT                   /old_locus_tag="DEHA-CDS5113.1"
FT                   /product="DEHA2E09966p"
FT                   /note="highly similar to uniprot|P26783 Saccharomyces
FT                   cerevisiae YJR123W RPS5 Protein component of the small
FT                   (40S) ribosomal subunit the least basic of the non-acidic
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87976"
FT                   /db_xref="GOA:Q6BPY0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPY0"
FT                   /protein_id="CAG87976.1"
FT                   /translation="MSDVEEQQEQQPVVQEELQLVELATPIPAEVQAAQQEVKLFNKWS
FT                   FEDVEVKDVSLVDYIQIRQPVFVPHTAGKYANKRFRKAQCPILERLTNALMMNGRNNGK
FT                   KLKAVRIIQHALEIIHVLSEQNPIQVVVDAIVNSGPREDSTRIGSSGTVRRQAVDVSPL
FT                   RRVNQAVSLITIGAREAAFRNIKTIAECLAEELINAAKGSSTSYAIKKKDELERVAKSN
FT                   R"
FT   gene            <786434..>787930
FT                   /locus_tag="DEHA2E09988g"
FT                   /old_locus_tag="DEHA0E10494g"
FT                   /old_locus_tag="DEHA-IPF12072"
FT                   /old_locus_tag="DEHA-CDS2346.1"
FT   CDS_pept        786434..787930
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E09988g"
FT                   /old_locus_tag="DEHA0E10494g"
FT                   /old_locus_tag="DEHA-IPF12072"
FT                   /old_locus_tag="DEHA-CDS2346.1"
FT                   /product="DEHA2E09988p"
FT                   /note="similar to uniprot|P53322 Saccharomyces cerevisiae
FT                   YGR260W TNA1 High-affinity nicotinic acid transporter
FT                   (Nicotinic acid permease)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87977"
FT                   /db_xref="GOA:Q6BPX9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX9"
FT                   /protein_id="CAG87977.1"
FT                   /translation="MEKEGAISKDEDFGGSLSINSQLTPSEQVDELAKEYGINQKKLMW
FT                   KIDLCVVPPFCFLYFLSFLDRVNISNAKLYGLAEDLNLTGNQYNTALTLFFVPYVFFEV
FT                   ISNYIIKFISPHIWLSGCIMIFGAVSIGMGFVTNFSGLAACRFFIGMAEASTFPSLFYL
FT                   LSTYYHKAEAQRRFSAFFSVTCLAGAASGAISYRINELDGKHGLSSWQWIFVIDGIITC
FT                   GGAIILFFTVADFPEESRFLSDNEKKFIKEKLAVFSGAESGFEIKNKVSDVAKCFKDYL
FT                   VWLPALAYFGLIIPSYGYAYFAATIINQMGYTAESANQHSVYPWLAAFGLNNIVSFISD
FT                   RSKLRLPFALGSCVIAIIGLALILGERYDPQARYAGCFLAASGLYTAMPLLVCWSSLNF
FT                   GGHLRKSVGTAWQIGFGNIGGIIATFIFLQKDAPVYKPGLGVSLAAVVFAMVMMVTYFF
FT                   AVYRLNKVKKSDAYIQKFNALDDRSRILAGDKNPKFEYLY"
FT   gene            <788352..>788729
FT                   /locus_tag="DEHA2E10010g"
FT                   /old_locus_tag="DEHA0E10516g"
FT                   /old_locus_tag="DEHA-IPF12070"
FT                   /old_locus_tag="DEHA-CDS6599.1"
FT   CDS_pept        788352..788729
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10010g"
FT                   /old_locus_tag="DEHA0E10516g"
FT                   /old_locus_tag="DEHA-IPF12070"
FT                   /old_locus_tag="DEHA-CDS6599.1"
FT                   /product="DEHA2E10010p"
FT                   /note="similar to uniprot|P38216 Saccharomyces cerevisiae
FT                   YBR016W Plasma membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87978"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX8"
FT                   /protein_id="CAG87978.1"
FT                   /translation="MSYNKAQDSYAPPTGAPPNWSESNNASSGGYVPQAQPAYGQQNQD
FT                   RGWGGSQQQGYGGGYQQGYPQQGYSQQGYPQQGYPQQGGYYQQQQQPMYVQQKHSSGGG
FT                   QSCLMGCLAALCVCCTLDAIF"
FT   gene            <789012..>789084
FT                   /locus_tag="DEHA2E10032r"
FT                   /old_locus_tag="Deha0E.9"
FT   tRNA            789012..789084
FT                   /locus_tag="DEHA2E10032r"
FT                   /old_locus_tag="Deha0E.9"
FT                   /note="tRNA Arg (TCT) cove score=75.37"
FT   gene            complement(<789175..>790803)
FT                   /locus_tag="DEHA2E10054g"
FT                   /old_locus_tag="DEHA0E10560g"
FT                   /old_locus_tag="DEHA-IPF12068"
FT                   /old_locus_tag="DEHA-CDS2019.1"
FT   CDS_pept        complement(789175..790803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10054g"
FT                   /old_locus_tag="DEHA0E10560g"
FT                   /old_locus_tag="DEHA-IPF12068"
FT                   /old_locus_tag="DEHA-CDS2019.1"
FT                   /product="DEHA2E10054p"
FT                   /note="similar to ca|CA4264|IPF2280 Candida albicans
FT                   IPF2280 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87979"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX7"
FT                   /protein_id="CAG87979.2"
FT                   /translation="MPAAIKFRITNAPDKLLEIYSLCGTEWGGKLSPRQFGETLTQNHL
FT                   KDIENGKKPIAFYFEDVETGKVIMCAVVKQMKGFYKDADRSSAISSIPDPATFGVRNVT
FT                   VLLLCYVFCHKDYRGRGLAKDLIEKVIEYTEDKLVDEHIASSKEEKKDSFKSMVMTDGK
FT                   IDKNLANYYLGKQYFWVLYSGVQDYYKIFGFKSYPLDFYKVPTSIITDEQERIVRSLIN
FT                   KEGTNDPSHVGKHLRFLHSSKKQDQDIIQFILQDKELEILTDLNKSIFHSELAGSHKSS
FT                   SSLTNLSSMLQMSKLGSNIALTAINEGDNQGSLGRRKSSIQEVSVPKFSFKPDYNSFLN
FT                   LVSLEQASAKSLNDENALEYTDIQGAILTNELQEKSYYILWCSFKQQMLCILAIGELKF
FT                   DMFGSMADPTGMGGRRSRRGSSFTGLNDLGGFNFQDLDLLISTACLVAKNRPIPKDNSV
FT                   FVSVNDLPTNIPIPVLYDYFMNYLPKNFEMVHSPADETTPAETSVEIVTDADVKLGVLP
FT                   MLRRFGKTSPEFNLDWTSDGLWSWG"
FT   gene            <791864..>793615
FT                   /locus_tag="DEHA2E10076g"
FT                   /old_locus_tag="DEHA0E10582g"
FT                   /old_locus_tag="DEHA-IPF12065"
FT                   /old_locus_tag="DEHA-CDS1724.1"
FT   CDS_pept        791864..793615
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10076g"
FT                   /old_locus_tag="DEHA0E10582g"
FT                   /old_locus_tag="DEHA-IPF12065"
FT                   /old_locus_tag="DEHA-CDS1724.1"
FT                   /product="DEHA2E10076p"
FT                   /note="similar to uniprot|P19145 Saccharomyces cerevisiae
FT                   YKR039W GAP1 General amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87980"
FT                   /db_xref="GOA:Q6BPX6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX6"
FT                   /protein_id="CAG87980.2"
FT                   /translation="MSKTMSGESMDINSKSSDSNNVYVNYVSSHDGGSRWHHFRDSFKR
FT                   AERDNTFDDQELNGLEKAIQKTSKTDLTQNLKKRQLQMIAIGGCVGSGLFIGVGPALVN
FT                   GPASLLIAWGLVSTFLYCTMQSLAELAALFPISGSFSTYATRFVDPSWGFAVGWNYAIF
FT                   WVVVLPLELVASSMTINFWNSNINSVAWVAIFYVLIIGLNLCGNKGFGEAEFIASLIKV
FT                   LGIIGFNILAIVLICGGGQKGGFIGAKYWHNPGAFAAGFKGVVSVLITATYSLAGTELV
FT                   GLTAAETAGNPRIVLPSAIKQVFWRILLFYMITLTLVGFLVPYNSPELLRGSSSSDSSA
FT                   SPFVIAIEAGGITALPSIFNVVVLISLLSIGNSSVYGFSRTILSLAEQGLAPKCFDFVD
FT                   RKGRPLVGILASAIVGLLSFVAASPKQTDVFAWLMALSGLSTLFTWFSVNLSHIRFRMA
FT                   MKKQGRSLDELPYRALTGFWGSVYAAVLLFVVLCLQFWISLFPLGEAPNAAKFFENYLG
FT                   AVVVLVFFVAHKLYSRKLNTIVPLDTMDVDTGRRETDIDKLKQELKEEKDIRSAYPMYR
FT                   KIWNFLF"
FT   gene            complement(<793748..>795103)
FT                   /locus_tag="DEHA2E10098g"
FT                   /old_locus_tag="DEHA0E10604g"
FT                   /old_locus_tag="DEHA-IPF12064"
FT                   /old_locus_tag="DEHA-CDS2717.1"
FT   CDS_pept        complement(793748..795103)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10098g"
FT                   /old_locus_tag="DEHA0E10604g"
FT                   /old_locus_tag="DEHA-IPF12064"
FT                   /old_locus_tag="DEHA-CDS2717.1"
FT                   /product="DEHA2E10098p"
FT                   /note="similar to uniprot|P47159 Saccharomyces cerevisiae
FT                   YJR124c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87981"
FT                   /db_xref="GOA:Q6BPX5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX5"
FT                   /protein_id="CAG87981.2"
FT                   /translation="MHLARSLKQSNCDIRLLWGSVFMRMASYGLTNQVLTLYLESLGVS
FT                   ETNIGLFMTLTLVGDTIISYFLTWYADHIGRRLVMIIGTLMMITSGLTFAFCSNFMILL
FT                   IAAIFGVISPSGDETGPFKSVEEASIAHLTPHNHRPEIFAFHGLFATAGAALGSLFCGI
FT                   IVDHLHLNLGWSTENSYRFIFIVYSGIAVVKFVFMIFLTEKCEVYYDDNELSDDSTEES
FT                   SLLDENVYGEESSNAVRGSNGKSKFSGLSPQTKHYLSRLLVIFMLDSLGYGFMPSSWVV
FT                   YYFKKVFKVTSTGLGVLFFLTNSIDSISSLPSAYFAKILGPVKAILFTQAPSAIFFILI
FT                   AFTNKFIAASVCLLLYFSTSTMDVVPRQVLLTSIMPNNELTKAMGIVNIGKTFARCVGP
FT                   IFTGKLAEKKLLHYAFVINGSCVLLADLILATNFLQLDKEILKKQKIDYNIQ"
FT   gene            <795311..>798154
FT                   /locus_tag="DEHA2E10120g"
FT                   /old_locus_tag="IPF_12062"
FT   CDS_pept        795311..798154
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10120g"
FT                   /old_locus_tag="IPF_12062"
FT                   /product="DEHA2E10120p"
FT                   /note="similar to uniprot|P08638 Saccharomyces cerevisiae
FT                   YLR451W LEU3 Zinc-finger transcription factor that
FT                   regulates genes involved in branched chain amino acid
FT                   biosynthesis and ammonia assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65800"
FT                   /db_xref="GOA:B5RTY8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY8"
FT                   /protein_id="CAR65800.1"
FT                   /translation="MSDGLHQTSLHNLAHIANMSHELQVLNQQLNDETSSGNKNNNQMS
FT                   PETTDSNQMKNGKTKRMACVECRQQKSRCDAHEKHPAPCSRCAKKGLQCNLKSDYKRTY
FT                   KRARIAQIEKEFSELKKKLTTTQAAELLSKVPTLSNDPTSAISSISPQPQITNDRNQLQ
FT                   YQPEKSHIQRTQNIPESWPSSVSPYNTQYDARYFHDSSETNTSIPNTPSITRPMVQANP
FT                   PEKRYVPKAEKVKILEQDLLCEEKRLEDVSLSSEIIRALFLEYVDYYHPILPVVDVSMG
FT                   PERIYRLCPALFWVIMFVSLRRYQDNLQKSLLLKLSPIIKGILAEITISPITRYNPTVE
FT                   DEPIMNASSVYSVQAFLLYTYWPPITSSLSADSSWNTIGVALFQAIRIGLHTPGSLVAH
FT                   DSKEPKSLQELAMAQEQAKTWIVCNTVSQDVATAFGFPAFVQFDTSVYNSRKAGSDLQI
FT                   PKSIQFMMEIAHFEDQVAKTLNSNPTDSCGLIDPTERLPLLKILSRQLDELELKVKNDL
FT                   PADDGFREFQLLTARVHLLTYYFMDSSRIANFELQKGLVRLYNAAIALVNHAQICQSKT
FT                   QTFIKYLPGVYILNIWQASCIIGKLSHSPLKKVIDLGSGRQSYLTAISLAAKASILKHD
FT                   MAHRSSGIMRNMWSLFASLDEKKSTSLSINIRTRMAASVFFDCLYLLRDQAGMIILNNR
FT                   NQNQENDGEEENDVVSGEDDEEYGYADNDEAVASDEEKSNEEGQRGSGSQKSTPSSNTS
FT                   SRTKRQRSLSGTINAESKARKIIQTIPLDPQPIPVHGNRSSLFKSTESNNSYKRARENS
FT                   DSPQQGTQNVAGTPPYKNANTPSHHDNDQFRQKIYTGYNQHAKTAANGDGDRMSDPQRM
FT                   NMYYSTQNARSNSSRETNSNNGNRNNMDMPLTDMVLNESPIQGGLENLEIDHLDINTDL
FT                   LWKDVDSVMNDFGFHTR"
FT   gene            <798418..>800007
FT                   /locus_tag="DEHA2E10142g"
FT                   /old_locus_tag="IPF_12060"
FT   CDS_pept        798418..800007
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10142g"
FT                   /old_locus_tag="IPF_12060"
FT                   /product="DEHA2E10142p"
FT                   /note="highly similar to uniprot|P32481 Saccharomyces
FT                   cerevisiae YER025W GCD11 Gamma subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65801"
FT                   /db_xref="GOA:B5RTY9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTY9"
FT                   /protein_id="CAR65801.1"
FT                   /translation="MSYDDIENATPDIVIGGSAEDHELDVHYEHDVESDNEHVEEPQEA
FT                   SKEKKSVAFAGLDDEFDEETARREFEEGGGLPEQPANPDFSELTPLSAEIINRQATINI
FT                   GTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCDNEECPEPDCYR
FT                   SFKSDKEIRPKCQREGCEGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLVAGN
FT                   ESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHQKSILSFIRGTIADGAPI
FT                   VPISAQLKYNIDAVNQFIVNSIPIPPRDFMATPRLIVIRSFDVNKPGAEIDDLKGGVAG
FT                   GSILNGVFKIGDEIEIRPGIVTKDDNGKIQCKPIFSNIVSLFAEHNDLKFAVPGGLIGV
FT                   GTKVDPTLCRADRLVGQVVGAKGNLPSIYTDIEINYFLLRRLLGVKTDGQKQGAKVRKL
FT                   EVGEVLMVNIGSTATGARVIAVRADMARLQLTSPACTEVDEKIALSRRIEKHWRLIGWA
FT                   TIKKGTTLEPVA"
FT   gene            complement(<800164..>802263)
FT                   /locus_tag="DEHA2E10164g"
FT                   /old_locus_tag="IPF_12057"
FT   CDS_pept        complement(800164..802263)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10164g"
FT                   /old_locus_tag="IPF_12057"
FT                   /product="DEHA2E10164p"
FT                   /note="similar to uniprot|P11972 Saccharomyces cerevisiae
FT                   YLR452C SST2 Protein involved in desensitization to
FT                   alpha-factor pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65802"
FT                   /db_xref="GOA:B5RTZ0"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTZ0"
FT                   /protein_id="CAR65802.1"
FT                   /translation="MKIKNILNINNSGDASKTLHETVLKNFNKTPSGKIYENELKDIYG
FT                   MMLICLELKDTLGTRIRFNPLAKTYPYSFHIEDALEKMTHLEVKIELSKTTTTISYSIK
FT                   PELGSALLTKFFNAKLLHSPADRTRSKPKNAVLLQPTPKGVAILQDFYKKIGGKREGIP
FT                   PILLSNLNSMDLFKFDRDPISDKILYSDYFLQLIFVKLMSSSPNVWSPDKKADTLPSID
FT                   SKLDFNECFSDGFDFSMLGIDKATVNLQNLYPGCEGVNFWDSQSNGSSITVDEKDKKSY
FT                   IVSPIHHRYFTNPESDSHVQYYVSNTGVRFHQNKIFRSSTGEDMNINLCISGKAICQWL
FT                   CDCTDVISIHHATEIADLLLKVKLLVPITSSPSNANYKRFQPDRSSFYVLGEQGLNIVH
FT                   WMDIKENELVNNIEEASADRHTYKELSSQSIESFIDNCMSRDLKSQRNSKVPITTLQEN
FT                   LKDPGMRYLFKKHLEKEFCSENLEAYLQLKQFHKKITILSELLIFKRNCMKHTTKSIDC
FT                   QIVQLANTCLGMAYHIYFTYLSSDSPFLLNINYNLKEQITTIMLNKSMVSSATTQDYTK
FT                   TTIQESLGDNRSAPQGISGDIELEITPTSPVSSTKSNASSRETRIIGDSNIKRQDIVYQ
FT                   EFDFQFKSPMEQNIRNTLNILVQVSAIFDATANHIYRLMEVDSFPKFLDSDIYQHATSY
FT                   IELRK"
FT   gene            complement(<802671..>804761)
FT                   /locus_tag="DEHA2E10186g"
FT                   /old_locus_tag="DEHA0E10714g"
FT                   /old_locus_tag="DEHA-IPF12056"
FT                   /old_locus_tag="DEHA-CDS1162.1"
FT   CDS_pept        complement(802671..804761)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10186g"
FT                   /old_locus_tag="DEHA0E10714g"
FT                   /old_locus_tag="DEHA-IPF12056"
FT                   /old_locus_tag="DEHA-CDS1162.1"
FT                   /product="DEHA2E10186p"
FT                   /note="weakly similar to uniprot|P54791 Saccharomyces
FT                   cerevisiae YPR162C ORC4 Subunit of the origin recognition
FT                   complex which directs DNA replication by binding to
FT                   replication origins and is also involved in transcriptional
FT                   silencing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87986"
FT                   /db_xref="GOA:Q6BPX2"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032705"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX2"
FT                   /protein_id="CAG87986.2"
FT                   /translation="MTSNNNIDLDFEGEFAPIKPLSSEELQNDRLIKRIKLQKKLEKLE
FT                   DHDLSSDYKTNLISEYEDTIAIDNPVKTYEKRRSIDGISDSQANKSTRINIDWINAQKA
FT                   RIHNPHVNKEHKNKSVDEPNTIQESKSRNLKDDSRIVSKGAQEDSAKQKNEKRLRAEKL
FT                   KNFKLTDSGFDSLIRRSRLKEQRSMKGEDEISQQEINTEPDGFDQPQEYKEFRANENDV
FT                   KLLRKQVLSQLVNKTTNFPNLLESPNLISKYKEVYKMFEHTVRDNEGHSSLIIGPRSSG
FT                   KTAIIQHALDDLSSKYPGQFITVRLNAYLHSDDIVALREVARQLDYNAKQLRTSDDVSF
FT                   GNFEQRSISDTFTNILSILDKNNNNNNNNNATHNEQEAVSIIFIIEEFENFTSGSKQTL
FT                   LYNLFDLSQSSSTPICVVGVSTKITARELLEKRVRSRFSQRIISINKSNTMEEFWANAK
FT                   LGLVLSNEFIETLGDQNYGFSWNQYVESMYSSKSSYLRKLIFQNYFTIKNFKDFNNNCI
FT                   LPVSKISTSQPFPVDGDFKQYSINQSINNIQSIVKSLSVLELLLIIAATRWIEKFDLQV
FT                   VNFNLAYKEYEDMIKNFNINSATVNSSSLIDNNILSNITINQKIWSPKILKNCWESLYK
FT                   LGLLLDYGAATTNADGQVVSTTTSNRNIIIEDNKMVQLDITLDELHHLIDDSNVYRSLT
FT                   KL"
FT   gene            <804894..>805424
FT                   /locus_tag="DEHA2E10208g"
FT                   /old_locus_tag="DEHA0E10736g"
FT                   /old_locus_tag="DEHA-IPF12054"
FT                   /old_locus_tag="DEHA-CDS5651.1"
FT   CDS_pept        804894..805424
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10208g"
FT                   /old_locus_tag="DEHA0E10736g"
FT                   /old_locus_tag="DEHA-IPF12054"
FT                   /old_locus_tag="DEHA-CDS5651.1"
FT                   /product="DEHA2E10208p"
FT                   /note="similar to uniprot|Q06199 Saccharomyces cerevisiae
FT                   YLR456W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87987"
FT                   /db_xref="GOA:Q6BPX1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX1"
FT                   /protein_id="CAG87987.1"
FT                   /translation="MSTKLPESVTKLLNSTRYVHLATCLDNIPHVSLMNYTYYHGNEDY
FT                   IIMTTPKGTTKYENMVANPNVSLLLHDWMAAKTTSEDTSEATGKRRNSLYEFLTNLNKT
FT                   EISRVSVMINGRAEELSVDAEKHNFFKSLHLNNSSIDEVQAENYIKDGNTALFIIKIDL
FT                   CKVTDTENNVEEY"
FT   gene            complement(<805562..>805633)
FT                   /locus_tag="DEHA2E10230r"
FT                   /old_locus_tag="Deha0E.38"
FT   tRNA            complement(805562..805633)
FT                   /locus_tag="DEHA2E10230r"
FT                   /old_locus_tag="Deha0E.38"
FT                   /note="tRNA His (GTG) cove score=61.27"
FT   gene            complement(<806224..>806448)
FT                   /locus_tag="DEHA2E10252g"
FT                   /old_locus_tag="DEHA0E10780g"
FT                   /old_locus_tag="DEHA-IPF12052"
FT   CDS_pept        complement(806224..806448)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10252g"
FT                   /old_locus_tag="DEHA0E10780g"
FT                   /old_locus_tag="DEHA-IPF12052"
FT                   /product="DEHA2E10252p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87988"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPX0"
FT                   /protein_id="CAG87988.2"
FT                   /translation="MLYAPSSGSCLSKQLIGLGQTCLKCGVWKKAQNKSLSRIYFDSFD
FT                   MIWNAESIGFQNVYTNYQHRCTSSSCMVQ"
FT   gene            <806868..>807890
FT                   /locus_tag="DEHA2E10274g"
FT                   /old_locus_tag="DEHA0E10802g"
FT                   /old_locus_tag="DEHA-IPF12053"
FT                   /old_locus_tag="DEHA-CDS3785.1"
FT   CDS_pept        806868..807890
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10274g"
FT                   /old_locus_tag="DEHA0E10802g"
FT                   /old_locus_tag="DEHA-IPF12053"
FT                   /old_locus_tag="DEHA-CDS3785.1"
FT                   /product="DEHA2E10274p"
FT                   /note="similar to ca|CA0424|IPF10795 Candida albicans
FT                   IPF10795 putative transcription factor (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87989"
FT                   /db_xref="GOA:Q6BPW9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPW9"
FT                   /protein_id="CAG87989.2"
FT                   /translation="MNSRVMMNYYPEMYPSSTNYPQTPSNVGQYYEQSKLPSIYVPYQN
FT                   QPSMMANSGDYYYSNQQVMGQQMQQQSVSQQYSHPQIQTHNPVSSHSIQQMQQTQRIVS
FT                   PMYYQPSVVSSQNMLHPYQYGHAPMINTSQSPQAKGYPVSPLSNNNSEMIPMNSPPRLA
FT                   SKLEDKQPLPIDYSSLVSYTISPSLKRRRKSKQKIVDTTQSFPCSQCSKVFQKPYNLKS
FT                   HMKTHSDEKPFKCSVCDKTFARSHDKKRHESLHVGEKNFKCEGFLKDGTTKWGCGKKFA
FT                   RSDALSRHFRTETGWLCIKPLMDEANESENNPDHSIQEQHQDDTFMDNATFIKRFIQPK
FT                   "
FT   gene            <808687..>811287
FT                   /locus_tag="DEHA2E10296g"
FT                   /old_locus_tag="DEHA0E10824g"
FT                   /old_locus_tag="DEHA-IPF12051"
FT                   /old_locus_tag="DEHA-CDS0658.1"
FT   CDS_pept        808687..811287
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10296g"
FT                   /old_locus_tag="DEHA0E10824g"
FT                   /old_locus_tag="DEHA-IPF12051"
FT                   /old_locus_tag="DEHA-CDS0658.1"
FT                   /product="DEHA2E10296p"
FT                   /note="similar to uniprot|P40017 Saccharomyces cerevisiae
FT                   YER024W YAT2 Carnitine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87990"
FT                   /db_xref="GOA:Q6BPW8"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPW8"
FT                   /protein_id="CAG87990.2"
FT                   /translation="MTYTYEYEEGLPRLPVPSLTNTSTQLLNTLKPLLSVDEYNELLQE
FT                   SSEFLSHEVINLIQRHLVAASLNPNNTCYLNCVNNGTSPGIYGEIRGDILPRNPYLILE
FT                   EDPYAKTVNPPNQSQRAANLVNSSLKFVTSLRNDTLQPDRTPKNGNPLSMNCYNILFGT
FT                   TRVPLTEDENSYQSATIQKFNDINDSRHIVIICNNQYYCLEVLTEYSEEEYKESKTKHK
FT                   IWFSDYELSIIFQGIINNSNTIDRVESINNSIGSLTTQSFSIWKISRSELNKSNKKNLE
FT                   LIDNALFIVVLDPNLPDSDQEKTSVIAHGTSELLKGTNMQVGSCTSRWYDKLQLVVTKN
FT                   SVAGVVWESSSTDGTAILRFISDIYADSILKLAKNINGAEYTLFDDNVGFVSADGSIKK
FT                   PESERLIITRTPELLNLIRLSETRLADLIHQHEYKTLTLKLNTYLVNKFELSIDSVLQV
FT                   AFQIANYTLYGSMANTLEPITTRKFRDSRTELIPVQNDHISRLVKLFITNSNSSLKWDL
FT                   FRECCSVHTKQYRNAMNGKGFERHFNAIISVLGRPHAVETLNKLNADVPDLEPIPDIKK
FT                   IKNLHIPLLSNPTIEKLSSPELLISNCGNPALHMFGIPPAADQGFGIGYVIHGDKIIIT
FT                   VSSKFRQTERFLRTFKGVMKEFLSIIKQKSNFLININDSESRKSELQRLRIEHELKNIN
FT                   KSLPSTKHPIELTVEKTRIPIENVSIEGNGDSVQSRSSRSNSLSDDYKEDYDILGGYGY
FT                   FNFGDLDMRSDELSREESFLNSTPPSLSSLNSKQHSSTNLHKAAMTNNNSPSDIKQKFN
FT                   LSAEIRDRLSLQDDYSSTSSVAGSMEDASSEGSNENSSKPKKLIGRELDISDVH"
FT   gene            <811445..>812833
FT                   /locus_tag="DEHA2E10318g"
FT                   /old_locus_tag="DEHA0E10846g"
FT                   /old_locus_tag="DEHA-IPF12050"
FT                   /old_locus_tag="DEHA-CDS2624.1"
FT   CDS_pept        811445..812833
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10318g"
FT                   /old_locus_tag="DEHA0E10846g"
FT                   /old_locus_tag="DEHA-IPF12050"
FT                   /old_locus_tag="DEHA-CDS2624.1"
FT                   /product="DEHA2E10318p"
FT                   /note="similar to ca|CA3390|CaCAF17 Candida albicans
FT                   CaCAF17 Component of CCR4 transcriptional complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87991"
FT                   /db_xref="GOA:Q6BPW7"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPW7"
FT                   /protein_id="CAG87991.2"
FT                   /translation="MKIPVSGISALNRSLLQIKGPDATKFLNGLSTSRFLPNIVKKKQH
FT                   TIDEAENRHAKLSEIININDNWGLMHEDIYDPDNNIFVRRDGLNSMFLSSKGRVVTDCF
FT                   LYSQPFHNLNGTFEGQISEPTYLIEIDSSFTSQLQMLLKLHKLSAKVSIETIKSMHSYY
FT                   YYNDTAEFDEYLDFIQQEFFRSRDPVDALNNANSFIKSEVLFNPKLAGNILGFSIDNRI
FT                   PNFGIKVLMDKEIGDDDNKIPVDDLFSSSFKDNFVVPEILKPESITRRRFMNGLFETQD
FT                   SPKESSLLPFEMNLDLTNGLSLEKGCYVGQELTIRTYNNGIIRKRIVPIQFFEINDDNL
FT                   SALDESEYLTLDPNDPVIRELQDLHSSTLSKLEITPLIEKKDSPPPEPEQQSSSPFANS
FT                   KPVRRRTASSGKLLSIQDNLGFVLANLSDIENVDLYKIELPCLEGGVKHVGIKVFKPEW
FT                   WPID"
FT   gene            <812945..>813017
FT                   /locus_tag="DEHA2E10340r"
FT                   /old_locus_tag="Deha0E.10"
FT   tRNA            812945..813017
FT                   /locus_tag="DEHA2E10340r"
FT                   /old_locus_tag="Deha0E.10"
FT                   /note="tRNA Ala (TGC) cove score=80.01"
FT   gene            <813112..>814050
FT                   /locus_tag="DEHA2E10362g"
FT                   /old_locus_tag="IPF_12046"
FT   CDS_pept        813112..814050
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10362g"
FT                   /old_locus_tag="IPF_12046"
FT                   /product="DEHA2E10362p"
FT                   /note="some similarities with uniprot|P47112 Saccharomyces
FT                   cerevisiae YJR046W TAH11 DNA replication licensing factor
FT                   required for pre-replication complex assembly and similar
FT                   to ca|CA3612|IPF3852 Candida albicans IPF3852"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65803"
FT                   /db_xref="InterPro:IPR032054"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTZ1"
FT                   /protein_id="CAR65803.1"
FT                   /translation="MAIDHKVIKEEVFQDLIKFFTAIETNLNLHYSNHTIDPSLNKILD
FT                   SAARLIGRRITTEDLLCILQIYPNAYAIRYNNKDNDHSEYLLSLPESIPVNTFNQCIPS
FT                   RKEQFLKNINTWVAMNKNASEITYPSIGQIVRKQNNASPSKIHKPQSNTSSPTKVSKSE
FT                   LINGMKNDSSKFVFRSKDEHAEKEKNNGLSLLERIRLKEKLKNEQKVKDTPEMKYHMYI
FT                   QCKLVPIYDILFHIHRSQDKQQYKSYPLSKLISMIEDSLDYPTSQSEIKDAVYLLEKKL
FT                   GSDKIQILSRGGVTAIKVIELDRDSDLKVLK"
FT   gene            complement(<814124..>817750)
FT                   /locus_tag="DEHA2E10384g"
FT                   /old_locus_tag="IPF_12045"
FT   CDS_pept        complement(814124..817750)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10384g"
FT                   /old_locus_tag="IPF_12045"
FT                   /product="DEHA2E10384p"
FT                   /note="similar to uniprot|P39986 Saccharomyces cerevisiae
FT                   YEL031W SPF1 Sensitivity to a killer toxin (SMK toxin)
FT                   produced by Pichia Farinosa"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65804"
FT                   /db_xref="GOA:B5RTZ2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTZ2"
FT                   /protein_id="CAR65804.1"
FT                   /translation="MSELVSNPAVQAADLLVPKPLISRPYVWPFAIIYPVFLQVYTQHY
FT                   DKYIGGSEWTFVYLIAICSLNMLFWLMPHWNIDIDGKFNYSSVKTISEATHIKIVPAPN
FT                   SGVGEICEIVREQFHDGEKQVSFLHQKRRHLYHPELDHFSPPEFVFDQSPKLTVFQNSK
FT                   GLKGDLEKMQRNFGENKFDIPIPTFLELFKEHAVAPFFVFQIFCVALWCMDEQWYYSLF
FT                   SLFMLVSFEMTTVFQRRTTMSEFQSMGIKPYSIYVYRDLKWKQLQTTELLPGDLVSITR
FT                   TSEDGALPCDLLLVDGSCIVNEAMLSGESTPLLKESIKLRPSDEVLNIEGFDKNSLLHG
FT                   GTMALQVTKPESPIVPLAPDNGSLAIVAKTGFETSQGSLVRMMIFSSERVSVGNKEAFF
FT                   FILFLLIFAIAASWYVWVEGTKMGRIQSKLILDCIIVITSVVPPELPMELTMAVNASLG
FT                   ALQKYYIYCTEPFRIPLAGRIDVCCFDKTGTLTAEDLVFEGLAGFQPNDIHHLYSCSEA
FT                   PEAASWVLGSAHALVKLDDGDVVGDPMEQATLKAAHWTVGAKDSVERTKENGKIEKIKI
FT                   MRRFQFSSALKRSSSISSVNTLQNQLLVSAKGAPETIRHMLIDAPENYEEIYKSFTRSG
FT                   SRVLALGYKYLDQSVKVLKIDRKDVESRLHFAGFIVFHCPLKDDAVETIKMLNESSHRC
FT                   IMITGDNPLTACHVAKEVQITEKDVLILDEPEEHHNVKSENLVWRNINETVVIPFNSVD
FT                   KIDIKLFEKYDICVTGYALGHLSEHDQILELLKHTWVYARVSPAQKEFILTSYKEAGYS
FT                   TLMCGDGTNDVGALKQAHIGVALLNGTEAGLKKMAENRRVEATQKVYEKQVKLLVSWGK
FT                   PAPPVPPIIAHLYPPGPSNPKYLEAMEKKGIEITDDMKKAVEAANQTGIVGTQSKATND
FT                   GFAETVLGAMNEAETGDEVPTLKLGDASVAAPFTSKLANVSTVTHIIRQGRCALVSTIQ
FT                   MYKILALNCLISAYSLSVLYLAGIKFGDGQATVSGILLSVCFLSISRGKPIEKLSKERP
FT                   QNGIFNIYIMGSILGQFAVHIVTLIYITREIYILEPREPQVDLEKEFSPSLLNTGMFLL
FT                   QLAQQVSTFAVNYQGLPFRESIKDNKGMYYGLLGVAALAIAGSTEFFPELNEAMKFVKM
FT                   DSLFKVKLTTCILLDLGVTWSIELTLKHFFMNHHAADIAVRD"
FT   gene            <818358..>819479
FT                   /locus_tag="DEHA2E10406g"
FT                   /old_locus_tag="DEHA0E11000g"
FT                   /old_locus_tag="DEHA-IPF12043"
FT                   /old_locus_tag="DEHA-CDS3418.1"
FT   CDS_pept        818358..819479
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10406g"
FT                   /old_locus_tag="DEHA0E11000g"
FT                   /old_locus_tag="DEHA-IPF12043"
FT                   /old_locus_tag="DEHA-CDS3418.1"
FT                   /product="DEHA2E10406p"
FT                   /note="similar to ca|CA4252|IPF4290 Candida albicans
FT                   IPF4290 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87997"
FT                   /db_xref="GOA:Q6BPW2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPW2"
FT                   /protein_id="CAG87997.2"
FT                   /translation="MSFQQIPVIDLQLAFNSDTKPEFLQILRHALIEVGFLHLINYETE
FT                   GPSRKELEEIREQAERFFELPDEVKLGCEMINSPHFLGYTRLANEVTALHTDWREQIDL
FT                   GTELPSPGPEEPIYRNIEGPNLWPDAKYAPDFKPVVLNYIAKMTRLGTVFRKLVCEAIG
FT                   LEAASLDGFFKPGQQCKMKIIAYPDSDQLSNESSNALDDMPSTGQGCGPHRDSDLLTYI
FT                   YQPTSHSESLQVQNFQGKWVTVDNIPNALVVNAGQTLEAITQGVCKATIHRVLIPKAGT
FT                   GTRISIPFFQTIDLDSHKTVAKGIPKEVLHLKDERDEKISNWAVDVGFQFSPEVGKYPV
FT                   GHAVFKNRIKSHQDVSAKWYPNVLKDVLAEYNT"
FT   gene            <819614..>820617
FT                   /locus_tag="DEHA2E10428g"
FT                   /old_locus_tag="DEHA0E11022g"
FT   CDS_pept        join(819614..819726,819780..820617)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10428g"
FT                   /old_locus_tag="DEHA0E11022g"
FT                   /product="DEHA2E10428p"
FT                   /note="similar to uniprot|P53257 Saccharomyces cerevisiae
FT                   YGR096w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG87999"
FT                   /db_xref="GOA:Q6BPW0"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPW0"
FT                   /protein_id="CAG87999.2"
FT                   /translation="MNAASDTSSGRENHLKKGSKVSPYEALIAGSLSGAIARGIIAPLD
FT                   TIKIRLQLQIQGYDTYKGASKTFVSICKNEGVKALWKGNVPAEILYILYGAIQFTSYSA
FT                   LSKALSEFEKNNRNLFTISNSTHSLIAGSGSGLASTFFTYPFDLLRTRLAANSEAHFLS
FT                   MSSTIKSIYEMHGIGGFCKGLTPGLLSVASSTGLMFWSYELAREFSNNYKDVIPFLEGF
FT                   CGFIAGATAKGLTFPLDTLRKRIQMLSKTRDIDQNSIKAIQLCKTILKNEGIFGFYKGF
FT                   SISILKSAPTSAISLFTYEYSLSAIKEFTSKHKKL"
FT   gene            complement(<820655..>822216)
FT                   /locus_tag="DEHA2E10450g"
FT   CDS_pept        complement(join(820655..822088,822154..822216))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10450g"
FT                   /product="DEHA2E10450p"
FT                   /note="some similarities with uniprot|Q99299 Saccharomyces
FT                   cerevisiae YPL158C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV9"
FT                   /protein_id="CAG88000.2"
FT                   /translation="MSSVVVLKINNEKNNFERPNEADWNDDKQLKLENYVQSIASETGN
FT                   VNDFFERVEWSYLTTYLSMGNQQFIQMKVDEIYEEQYATKVNESGVNTIIDGWKNKDNP
FT                   IYKEVSQLVENLNIQAFKVNEENGLSEGTDEIQAPVNGNPDRMDGNLLEDNMDEDSSLP
FT                   EGVSNKNGKASTSPKIDFPKLTTTQRRMSLDLMYTVPRFSTGIPDQIPDLTKKRPNLSK
FT                   PASATTTNINVTTKTDIITNSNQKQLMVSNSNRFQKFSRKIKSKITRNVNEVTSSPKSP
FT                   LIVQLDDTLKGKPENIVDDSKNVNGKQGKDRNRYKLSGLEKGRRLSLVGENLPLYIRQQ
FT                   LEPNYSNQNPVLENSSFQVDSASSRSLSRRQSRMHNLLENSQSLYSQSKDLSLVGSGTN
FT                   QDDNTMPNTSEIERLNENNDETENGSDDDKEYISPDSLARYYGSDANEEDLITNINEIE
FT                   DAFDFINVRSYDAYEDMEEEDEEEEDDEDYNEDDEYLFKI"
FT   gene            <822393..>824573
FT                   /locus_tag="DEHA2E10472g"
FT                   /old_locus_tag="DEHA0E11066g"
FT                   /old_locus_tag="DEHA-IPF12038"
FT                   /old_locus_tag="DEHA-CDS1046.1"
FT   CDS_pept        822393..824573
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10472g"
FT                   /old_locus_tag="DEHA0E11066g"
FT                   /old_locus_tag="DEHA-IPF12038"
FT                   /old_locus_tag="DEHA-CDS1046.1"
FT                   /product="DEHA2E10472p"
FT                   /note="similar to ca|CA5372|CaMLH3 Candida albicans CaMLH3
FT                   DNA mismatch repair by homology"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88001"
FT                   /db_xref="GOA:Q6BPV8"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR028830"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV8"
FT                   /protein_id="CAG88001.2"
FT                   /translation="MKSIRQTDCSIHKLPESVLSCLQSQITISSFQAAIRELLQNSLDA
FT                   NANEVIIKLDFRSLSVCVEDDGRGMRPEELEKVGKRYFTSKIDSLESLKDIETFGFRGE
FT                   ALHSIGCISRLSIISKHTSNSQVFKLKEIKQEQSACIYKFEEEISNYLENHFKFDPISQ
FT                   SGTIVTATSLFANVPVRRSQILKIPEHKLMEDVRQVILQSLIGRPNVKLTLIKLDSTSG
FT                   DFQKTIYVERSHESELQARYATIFKSIYGHSLLSEYETVRANFQDYKLDGIIGLFPSQS
FT                   KAFQYIFVNQRPLLISNEDSKYLNKIFVTANFGGMLTSTASNISLSPSKVSPNKQYTSK
FT                   SFSRFPVFIINIQCPIIIEDLFQDPSKSIYYSNHMKLILNMLRNVFSSFLSAQGYECVT
FT                   RDPSVSPSPSPSPKRQKSERPPLKQNISFIPVLKPSLKRETLKSTIDFIDGNHTPKFPF
FT                   NQLASTDTQRFSANEFNLQSICYTGNNKSMNANARDLDLQETIIDKNDLIDGNYRIISQ
FT                   VDRKFILLVMPASNSVSSTKSPTILVVDQHACDERIRVEALFKDFILMLLDKTLGIELN
FT                   KPLTFTASDREKNLFNSYGSNFESLGINYATNAEHKLIVTHLPHILIEKVGTDIDFLKS
FT                   CLLQHLFDLEYHKKKVNISNLATEGWFQNVVQLPQVIIDCINSKACRSAIMFGDKLTVE
FT                   EMMYLIKSLSECNQPFQCAHGRPSIVPLANIG"
FT   gene            <824713..>826134
FT                   /locus_tag="DEHA2E10494g"
FT                   /old_locus_tag="DEHA0E11088g"
FT                   /old_locus_tag="DEHA-IPF12036"
FT                   /old_locus_tag="DEHA-CDS2527.1"
FT   CDS_pept        824713..826134
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10494g"
FT                   /old_locus_tag="DEHA0E11088g"
FT                   /old_locus_tag="DEHA-IPF12036"
FT                   /old_locus_tag="DEHA-CDS2527.1"
FT                   /product="DEHA2E10494p"
FT                   /note="weakly similar to ca|CA0334|IPF19562 Candida
FT                   albicans IPF19562 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88002"
FT                   /db_xref="GOA:Q6BPV7"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV7"
FT                   /protein_id="CAG88002.2"
FT                   /translation="MAVEHFSTPVSQRVYSSDHIYAGNDTTTDMEQFSTPLQKLSNNSL
FT                   NDVRLPNKAREVSSERYYNIREDNNAQKRDDLSSEENTLNPPNNNNASLTPLSDVAFQL
FT                   YQTKLTIDSHMGHPHHTNTFQQQRATGSGKEPIYYRPPSSSESTQYGIKSFLPPNLEKG
FT                   SIRDRTTNKIPIAINAPQIDRNNSLFVKDDDEIDEIEDANNNPTGDWFNPIVKEALRRQ
FT                   PRKEVEIKRIGANLLYLLAFRLSVAIGNYILTLYEYKRMPFQSVGVYYPPIRHDHTHPG
FT                   TVGFYAVLIIRMIYGILILNCVLSFYRLTKGQDQCLDLPLNRKQRELLGLKIDQIAKDS
FT                   FNEKEGYEDDAQLTIKQRRFESSHKSNYNLPKYTKSNIYSAHQVRPATKIDEKFHDPSD
FT                   LTLSDKLVKSRLIHNPSHKLKPRDTNKDLEASFHKNYSIEFNYSDDEDDLPVPPAILPN
FT                   KSFEMKNYRQNVFRR"
FT   gene            <826451..>827458
FT                   /locus_tag="DEHA2E10516g"
FT                   /old_locus_tag="DEHA0E11110g"
FT                   /old_locus_tag="DEHA-IPF12035"
FT                   /old_locus_tag="DEHA-CDS3749.1"
FT   CDS_pept        826451..827458
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10516g"
FT                   /old_locus_tag="DEHA0E11110g"
FT                   /old_locus_tag="DEHA-IPF12035"
FT                   /old_locus_tag="DEHA-CDS3749.1"
FT                   /product="DEHA2E10516p"
FT                   /note="similar to ca|CA1609|CaTES11 Candida albicans
FT                   CaTES11 Thiosterase (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88003"
FT                   /db_xref="GOA:Q6BPV6"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV6"
FT                   /protein_id="CAG88003.1"
FT                   /translation="MSAKIEDFEEAFRVIKIDENNYVGAHPLRLPMSIARGVYGGHICA
FT                   QALVVGMESAPGYVPDSFHLYFIGAGSNKIPMSYKVTKVLHGDAYASRLIEVVQYGQIK
FT                   SNCMVTLRKKGVLAQSSKSSRDKNLDNPSEVPHVHTKDEDPNKLHIVHHTDYIRNAYSD
FT                   EFLDHELVPHEKDQDPSDRWITVYSGIEQRKSFKDPLFNYVGIADLSDSALLTTLARVM
FT                   HFPWNPTEKYAPEEFDSNRDARTLLKVSFNILHIFHYNAMSLDHHIYFHSDDYTKAFDV
FT                   CQDWLTFTYQVKRLSNHRSLVRGHLYNNEGRCVATVVQEGLAYLFSDVANHLKL"
FT   gene            <827721..>828701
FT                   /locus_tag="DEHA2E10538g"
FT                   /old_locus_tag="DEHA0E11132g"
FT                   /old_locus_tag="DEHA-IPF12034"
FT                   /old_locus_tag="DEHA-CDS3951.1"
FT   CDS_pept        827721..828701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10538g"
FT                   /old_locus_tag="DEHA0E11132g"
FT                   /old_locus_tag="DEHA-IPF12034"
FT                   /old_locus_tag="DEHA-CDS3951.1"
FT                   /product="DEHA2E10538p"
FT                   /note="similar to ca|CA1608|CaTES12 Candida albicans
FT                   CaTES12 Thiosterase (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88004"
FT                   /db_xref="GOA:Q6BPV5"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV5"
FT                   /protein_id="CAG88004.2"
FT                   /translation="MSDVSINNSITVQQSRLEKAFELRKLSDVKYEGVKPLAKPSLNSR
FT                   GVYGGNLCGQALLVAMETCEAGFTPHSLHSYFIKAGDDTMPCQYEVEKLNDGKNFANRL
FT                   IRVSQKGQMKYIVMISLTKKNSRANTAKEYAKDPKKQSPFEFQAPVASNFYKYKHEDLP
FT                   VTYNDHTKTLQHKIPPDFVDHKLNPDESKKSAAERDLSFWLRIDDASKDPKYKYAGFGI
FT                   VSDSLYLTSLSRVLHLPISGNGIGSSGGKGDHFFSVSLDHSIYFHDDSFDPSKWVFFNF
FT                   STPRFSNNRVLLQGGYYDENGKLFASIVQEGLVFFHSGSEHKAKL"
FT   gene            <828971..>830071
FT                   /locus_tag="DEHA2E10560g"
FT                   /old_locus_tag="DEHA0E11154g"
FT                   /old_locus_tag="DEHA-IPF12032"
FT                   /old_locus_tag="DEHA-CDS3185.1"
FT   CDS_pept        828971..830071
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10560g"
FT                   /old_locus_tag="DEHA0E11154g"
FT                   /old_locus_tag="DEHA-IPF12032"
FT                   /old_locus_tag="DEHA-CDS3185.1"
FT                   /product="DEHA2E10560p"
FT                   /note="weakly similar to ca|CA1608|CaTES12 Candida albicans
FT                   CaTES12 Thiosterase (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88005"
FT                   /db_xref="GOA:Q6BPV4"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV4"
FT                   /protein_id="CAG88005.2"
FT                   /translation="MVKWNTHINIVYVLRFKYGVIIVHFIVIFTPYITPEVTMSIAEVY
FT                   DNVTVCKIEEKFSLQKITDTVLEGNYPLEPFQAGARGTYGGEFVAQGILAAWETVEDPD
FT                   FSPHSFHSYFLKAGSHESVMRWEVTKTMQGRNYCNRLVHCYQKHNNQLCFILTASFTRN
FT                   NSIHQRKLDYATNPDNKIPFEFQRSPQYFFDKYYDKLDEMPYYEHTNGNLQHIIPPEFR
FT                   TGMPSDFLSQETGMRDIGFFLRVNDDVNLAKDKLKAKLVSMAFASDSLYLSLLVCSLGI
FT                   PLTIDVFEFFRVSLDHTVYYHDIDFDPTKWLFLDYRFSRMSNDRVLCQCQVFNEKGNMV
FT                   VSIIQEAIALIPKKFIEKAVGGSYKL"
FT   gene            <830336..>831307
FT                   /locus_tag="DEHA2E10582g"
FT                   /old_locus_tag="DEHA0E11176g"
FT                   /old_locus_tag="DEHA-IPF12031"
FT                   /old_locus_tag="DEHA-CDS3978.1"
FT   CDS_pept        830336..831307
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10582g"
FT                   /old_locus_tag="DEHA0E11176g"
FT                   /old_locus_tag="DEHA-IPF12031"
FT                   /old_locus_tag="DEHA-CDS3978.1"
FT                   /product="DEHA2E10582p"
FT                   /note="similar to ca|CA1608|CaTES12 Candida albicans
FT                   CaTES12 Thiosterase (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88006"
FT                   /db_xref="GOA:Q6BPV3"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV3"
FT                   /protein_id="CAG88006.2"
FT                   /translation="MEDVEYNLGVKQISKTRFQGNAPLTKPHPSSRGVYGGNLAGQALL
FT                   VAIRSSPEGFTPHALHSFFVKACSPDTVVDYEVEVVSQGNNFCNRSVKAIQDGEIKYIA
FT                   NISLTRRNSNKDSTEKYLKYKKKVEEHGEDEDETPVQKPFGFGTPYPKWLKDSPAESLK
FT                   LDVRGKNRLIYHKIPPQMNQLDITKNEDKIAPSERKLSFYVKWGNDGEVEIKDPAFHYV
FT                   GLGVLSDSFFLTRLARVLRIPGLEYSNTVHYFSLSLDHIMYFHDTDFDVTEWMGFSFKN
FT                   VKFSNNRALLEGEMYNEKGVHVATIIQEGLVHFNGIERDAKL"
FT   gene            <831453..>833525
FT                   /locus_tag="DEHA2E10604g"
FT                   /old_locus_tag="DEHA0E11198g"
FT                   /old_locus_tag="DEHA-IPF12030"
FT                   /old_locus_tag="DEHA-CDS1200.1"
FT   CDS_pept        831453..833525
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10604g"
FT                   /old_locus_tag="DEHA0E11198g"
FT                   /old_locus_tag="DEHA-IPF12030"
FT                   /old_locus_tag="DEHA-CDS1200.1"
FT                   /product="DEHA2E10604p"
FT                   /note="weakly similar to uniprot|P20795 Saccharomyces
FT                   cerevisiae YLR396C VPS33 vacuolar sorting protein essential
FT                   for vacuolar morphogenesis and function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88007"
FT                   /db_xref="GOA:Q6BPV2"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027121"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV2"
FT                   /protein_id="CAG88007.2"
FT                   /translation="MAIDSNMLDQRLKSLNKQAIDNLIDILHGVYTTKNLLILDQRLST
FT                   LINFLTPFSKLKEIAKIDKTIWIGDNVEQDILQSFDGFIFIFNESHDNLQALLKTIKQI
FT                   GKKKIHIIVKQLTKSFIYETNKALNGNVTFEKICDINTGKEVIKFTSMIRLYNWEINPI
FT                   VIDEEARVLSIEAPYGGLDSYFNQPLLQLYELSNSFITLLENSFKASDMSFLKLKNIYG
FT                   KGDHANLLINIINNERIPEYLSLKLSSLEQEFYLTKARGNTDLIVVERNLDFISVILNQ
FT                   LNYQGLIDDLFGIDIDNVKVGENRYKLNDELYNELKHLNFASIGVKLNKLAIFIQNEFS
FT                   TRDNLQSLGEMKKLVSNLGNLTSKQDLIKKHTFLSESILNYIRNGDIENKPTRSSKKYN
FT                   EYEKFLNFENELFDIDYKTHISYLRDFLSENFNYKIVLSTIILISTVNDGIKERDFDWV
FT                   YNEILDNFGMEIIFVIDNLVDNKVVKINDNNDLLGGALTYLTNQDKSDDNDKENKVNTK
FT                   LGISGGSNTYKSNYTLINKFWNLHPLVEETTGTKSGLLIDEYPNPSFTLPSSTVPLLSR
FT                   IIESLYVRDFLQYKPVNNTSKRPNWDKLGLDTMFQGKTTDINIDDTSDDRNTDSNAGQG
FT                   EQYVVVIFVGGVTRGEISCLRYLEQRLQTIGIIKRFIILTSGIVNSDKLLDVFKR"
FT   gene            complement(<833891..>834076)
FT                   /locus_tag="DEHA2E10626g"
FT                   /old_locus_tag="DEHA0E11220g"
FT                   /old_locus_tag="DEHA-IPF12029"
FT                   /old_locus_tag="DEHA-CDS8415.1"
FT   CDS_pept        complement(833891..834076)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10626g"
FT                   /old_locus_tag="DEHA0E11220g"
FT                   /old_locus_tag="DEHA-IPF12029"
FT                   /old_locus_tag="DEHA-CDS8415.1"
FT                   /product="DEHA2E10626p"
FT                   /note="similar to uniprot|P07255 Saccharomyces cerevisiae
FT                   YDL067C COX9 Subunit VIIa of cytochrome c oxidase which is
FT                   the terminal member of the mitochondrial inner membrane
FT                   electron transport chain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88008"
FT                   /db_xref="GOA:Q6BPV1"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPV1"
FT                   /protein_id="CAG88008.1"
FT                   /translation="MAIAPITGTLKRKIITDISIGFACGFALATGYWYIEHKPLIVKRE
FT                   AYYAKLKAQQEAEDSA"
FT   gene            <834304..>834549
FT                   /locus_tag="DEHA2E10648g"
FT                   /old_locus_tag="DEHA0E11242g"
FT                   /old_locus_tag="DEHA-IPF12028"
FT                   /old_locus_tag="DEHA-CDS7770.1"
FT   CDS_pept        834304..834549
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10648g"
FT                   /old_locus_tag="DEHA0E11242g"
FT                   /old_locus_tag="DEHA-IPF12028"
FT                   /old_locus_tag="DEHA-CDS7770.1"
FT                   /product="DEHA2E10648p"
FT                   /note="weakly similar to uniprot|P04039 Saccharomyces
FT                   cerevisiae YLR395C COX8 Subunit VIII of cytochrome c
FT                   oxidase which is the terminal member of the mitochondrial
FT                   inner membrane electron transport chain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88009"
FT                   /db_xref="GOA:Q6BPV0"
FT                   /db_xref="InterPro:IPR004202"
FT                   /db_xref="InterPro:IPR036636"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPV0"
FT                   /protein_id="CAG88009.1"
FT                   /translation="MLARSKLITQKVSTRNFQTSARSFNDIFGSPKSGVYSNIPFKVKN
FT                   RKIPISFWFWGITGSLFAFPFVSTYWHLKKAGSFME"
FT   gene            complement(<834575..>835822)
FT                   /locus_tag="DEHA2E10670g"
FT                   /old_locus_tag="DEHA0E11264g"
FT                   /old_locus_tag="DEHA-IPF12027"
FT                   /old_locus_tag="DEHA-CDS3040.1"
FT   CDS_pept        complement(834575..835822)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10670g"
FT                   /old_locus_tag="DEHA0E11264g"
FT                   /old_locus_tag="DEHA-IPF12027"
FT                   /old_locus_tag="DEHA-CDS3040.1"
FT                   /product="DEHA2E10670p"
FT                   /note="some similarities with uniprot|P39081 Saccharomyces
FT                   cerevisiae YDR228C PCF11 mRNA 3' end processing factor
FT                   essential component of cleavage and polyadenylation factor
FT                   IA (CF IA) involved in pre-mRNA 3' end processing and in
FT                   transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88010"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU9"
FT                   /protein_id="CAG88010.2"
FT                   /translation="MDIDEPFNPDYYQHLLSSLTLNSRTLITELTTIAEKSTDQASEIV
FT                   DIIEERIKKCLPQYKLFTVYLLDSICKNIGNPYNLLFGSRLYKIFTETYLVVTDTPTRQ
FT                   NLINLFKTWSNGRTNSGLELFPAKVIQKIEQFIIRATSISQTNQPSLPLKLTPDMLLRE
FT                   GNCLLQYIIVLNGELEKFPQTNEKVKEFLDANNRIRNNVISVINNVSDSILSNSKQEFE
FT                   NNVTSYHTDLQGARKVMDDQSFQQKQFLGSNTFKEDTSQIKIEIDLTPNLKFFHFNTPI
FT                   SEDPDLLEYVNDWGKPIVERISQIPKPEVARPVKAPFNNLQEEPKSSSSTPEPLTNSLG
FT                   LNLGSVNFMDSFLGSPKNEISKSPINEINENPVDSYDPEHSIVDEDWIHPPTSHPNLKR
FT                   KNSIDKPVIKKVRFDI"
FT   gene            <836532..>837845
FT                   /locus_tag="DEHA2E10692g"
FT                   /old_locus_tag="DEHA0E11286g"
FT                   /old_locus_tag="DEHA-IPF12025"
FT                   /old_locus_tag="DEHA-CDS2896.1"
FT   CDS_pept        836532..837845
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10692g"
FT                   /old_locus_tag="DEHA0E11286g"
FT                   /old_locus_tag="DEHA-IPF12025"
FT                   /old_locus_tag="DEHA-CDS2896.1"
FT                   /product="DEHA2E10692p"
FT                   /note="highly similar to uniprot|P21954 Saccharomyces
FT                   cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
FT                   isocitrate dehydrogenase catalyzes the oxidation of
FT                   isocitrate to alpha-ketoglutarate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88011"
FT                   /db_xref="GOA:Q6BPU8"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU8"
FT                   /protein_id="CAG88011.2"
FT                   /translation="MFRNGVMRNPAMSGYSKYSMRSFSSSLINLDKIKVKNPIVELDGD
FT                   EMTRIIWQRIKDKLINPYLDVDLKYYDLGIESRDKTDDQITIDAANAIKEYGVGVKCAT
FT                   ITPDESRVEEFNLKKMWLSPNGTIRNILGGTVFREAIIIPRIPRLVPGWKEPIVIGRHA
FT                   HGDQYKATDLVINEPGKLEMTFTPENGGAPETRTVYDYKGPGVGLAMYNTDESIIGFAH
FT                   SSFKMALTKKLPLYLSTKNTILKKYDGRFKDIFHEIYESTYKKEFETNNIWYEHRLIDD
FT                   MVAQMIKSKGGFVMALKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKTFESEAAHGTV
FT                   TRHFRQHQQGKETSTNSIASIFAWTRGIAQRGRLDDTPDVVKFAEIVEKATFDTVQEDG
FT                   IMTKDLALALGRTDRESYVTTTEFLDAVSDKLQKQVQV"
FT   gene            <839715..>841448
FT                   /locus_tag="DEHA2E10714g"
FT                   /old_locus_tag="IPF_12024"
FT   CDS_pept        839715..841448
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10714g"
FT                   /old_locus_tag="IPF_12024"
FT                   /product="DEHA2E10714p"
FT                   /note="weakly similar to ca|CA1796|IPF11259 Candida
FT                   albicans IPF11259 unknown function and some similarities
FT                   with uniprot|P40489 Saccharomyces cerevisiae YIL101C XBP1
FT                   Transcriptional repressor that binds to promoter sequences
FT                   of the cyclin genes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65805"
FT                   /db_xref="GOA:B5RTZ3"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTZ3"
FT                   /protein_id="CAR65805.1"
FT                   /translation="MIPFNTPRQFSYDSYQTGYAQYFPTNNPPNNENGGNTGNNVYDRT
FT                   NTINANANMNTESKLNYGSNNEFDMNFAPIAYTPEKNGFGPPAIGKHKKSKSFPKTQFP
FT                   LINKFQNSVNETSTKTHSNSGVHLCNKVNFPVHQLSLDIPQGNISSLQSIYPQIETKKY
FT                   STSAIDPLRNYVTVFEYNINNHWIIWDYETGFVHLTGIWKASINDEVNTHRNLKADIVK
FT                   LLESTPKQYHQHIKRIRGGFLKIQGTWLPFDLCKMLAKRFCYHIRFQLIPIFGNAFPSE
FT                   CLKPDDKGFGELKLDEDVNDTAAENGSRQGKKTHKIDKRRSTSLLESPIIKRSSSTSHL
FT                   TMPSANQIPTPNSMPVNNIPQRLPQFTFPQTTGVSNQQFQYQENTPQYALSSSTHNSYH
FT                   TPNASSFSLPQNQSAPLISTRSLSLQIPYQNSMYVSPNAQTSSSYHSPRHFSHTADHTF
FT                   HTPYHTPQHSFHTPSHTNSVSKHSVQHTPSSDMPYHEMVDLVNASKCLQSLSQTQISPI
FT                   SHEPESNRDYVASIPKSPTGNNTSGNGISSILLAAGVSEEHYQKSNRSRRISMKINDIL
FT                   S"
FT   gene            <841752..>844079
FT                   /locus_tag="DEHA2E10736g"
FT                   /old_locus_tag="DEHA0E11330g"
FT                   /old_locus_tag="DEHA-IPF12023"
FT                   /old_locus_tag="DEHA-CDS0907.1"
FT   CDS_pept        841752..844079
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10736g"
FT                   /old_locus_tag="DEHA0E11330g"
FT                   /old_locus_tag="DEHA-IPF12023"
FT                   /old_locus_tag="DEHA-CDS0907.1"
FT                   /product="DEHA2E10736p"
FT                   /note="similar to uniprot|P53959 Saccharomyces cerevisiae
FT                   YNL041C COG6 Component of the conserved oligomeric Golgi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88013"
FT                   /db_xref="GOA:Q6BPU6"
FT                   /db_xref="InterPro:IPR010490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPU6"
FT                   /protein_id="CAG88013.2"
FT                   /translation="MDFIDFDSFQQDEIPQPQPALSLPITSNIENLGKRFSNFNSLTKN
FT                   LLKFDEKDDIKVDGDESEETKLAEKYANLSLNLINSLEDDNEEENESDLNRSKTTTTLS
FT                   TRLSRVLNNSMPDSLVREIFANLDLKIENIAALVEPGITGSNSRKKLRGEIENDLIKTQ
FT                   GLMLKEYQPVIKNLSNLENDLKNLNGLRDSITEKVNKDFQSTKDLNGEVKNLNDTKSLI
FT                   NLKKGLLISFQNKFALDVYEEYVLQNGEINDEFFQVLIKCEKIHENCSILLSVDNPQLG
FT                   LKIMSKFNQLINKSVERIINFTNKTLNNLYSLNTTTKLTTLHQCLKFLRKRLNYFNTVI
FT                   DNFVDTRSRLIIDEFLNQINGDLDKSGDNRSGSIQHDRPIILSAHDPVRFIGDLLAYIH
FT                   SVVVNETETISSIFGISKEENEDDDIEYKDIIDDVTGRILNSLSRSVKSKIEQVITSET
FT                   KLATIYAIYSLVELYTIMFAKHLKESSNDKHNLLMTVRELVSSSQNKIISIIQNKLTTI
FT                   KSSNSAQLELNTDLQPPEWIIEFYSDILPIIDQNTSDTFMNLSTENNAEFMKMIINKPI
FT                   EIFNEHIENNISKLFNRRDQVILKLNFLDLILSKIMPIILLSDKILELNDLTEKLSLEL
FT                   TNLQLDSLISGCQLTNFYNIINMICPFSDDFFDVSIYQPITENKLFSEDNIIAANDIIQ
FT                   NFLPSALLDIQQSLFKVNSPMIVNNIITNSSLEFIKFYLKFNLIINEYLDDASLIWSDI
FT                   EVATLLGVEEPYQQTKKSMSFD"
FT   gene            complement(<844103..>845365)
FT                   /locus_tag="DEHA2E10758g"
FT                   /old_locus_tag="DEHA0E11352g"
FT                   /old_locus_tag="DEHA-IPF12021"
FT                   /old_locus_tag="DEHA-CDS2986.1"
FT   CDS_pept        complement(844103..845365)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10758g"
FT                   /old_locus_tag="DEHA0E11352g"
FT                   /old_locus_tag="DEHA-IPF12021"
FT                   /old_locus_tag="DEHA-CDS2986.1"
FT                   /product="DEHA2E10758p"
FT                   /note="highly similar to uniprot|P40487 Saccharomyces
FT                   cerevisiae YIL103W DPH1 Protein required for synthesis of
FT                   diphthamide which is a modified histidine residue of
FT                   translation elongation factor 2 (Eft1p or Eft2p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88014"
FT                   /db_xref="GOA:Q6BPU5"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPU5"
FT                   /protein_id="CAG88014.2"
FT                   /translation="MEPKPEELEKKKVVRRKFIGKRSSVKGDEASLVKSANKTRHVGRV
FT                   MNQIPQEILNDKDLNEAIRLLPSNYNFEIHKTVWNIKKNGAKRVALQMPEGLLIYSLII
FT                   SDILEQFCEVETVVMGDVSYGACCIDDYTARALDCDFIVHYAHSCLVPIDITDIKVLYV
FT                   FVTINIDEQHLINTIKLNFDKGSQLAVFGTIQFNPTIHSIKSKLENDEEKTMYLIPPQT
FT                   MPLSKGEVLGCTSARLNKEQIKAMIYIGDGRFHLESSMIHNPEIPAYRYDPYSRKFTKE
FT                   YYDQKQMIEVREDAVKIASNAKKIGLILGALGRQGNPVTLNNLETKLSAKGIQVVKIIL
FT                   SEIFPQKLSMFNDIDAFIQVACPRLSIDWGYAFNKPLLTPYEAMVMLENDTKWNETYYP
FT                   MDYYSKEGYGRGKVPDHSNVI"
FT   gene            <845533..>847092
FT                   /locus_tag="DEHA2E10780g"
FT                   /old_locus_tag="DEHA0E11374g"
FT                   /old_locus_tag="DEHA-IPF12020"
FT                   /old_locus_tag="DEHA-CDS2193.1"
FT   CDS_pept        845533..847092
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10780g"
FT                   /old_locus_tag="DEHA0E11374g"
FT                   /old_locus_tag="DEHA-IPF12020"
FT                   /old_locus_tag="DEHA-CDS2193.1"
FT                   /product="DEHA2E10780p"
FT                   /note="similar to uniprot|P40486 Saccharomyces cerevisiae
FT                   YIL104C SHQ1 Essential nuclear protein required for
FT                   accumulation of box H/ACA snoRNAs and for rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88015"
FT                   /db_xref="GOA:Q6BPU4"
FT                   /db_xref="InterPro:IPR007009"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR039742"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU4"
FT                   /protein_id="CAG88015.2"
FT                   /translation="MITPFFTINQDDEFIFIDVKISHVRFNSQNIEMMVDNELFIFSLS
FT                   PYYLRIRLPFACIDDERSHAQFDSKSESVKIKIPKLNKGEFFPDLDLSSKLLARSINGT
FT                   HEEALLKEAGEINDGNSQTPKETSTKPLIQELDVNNDLSTTPGNLEKDIAEGERFNWEV
FT                   AQTMPDEQNDENSHINITKVRYGFNNEYDSIVGVSISNGNDINELGDPEATPASDRIVE
FT                   RLIKENIKFDPEYYAADYIMEKFPSPDDDKLFTDLIEWKSPITRNFMKWYKAQKELPEE
FT                   DKEQIMHVEFSKDEQEKMLNLPRKTYLINDVYKPQLLGLLVSLLFAYHFDLRETVGDHT
FT                   IESAWTVGKLTPQFACLDSQIAISGEQNKENFLKSIAITSIRRALSFPLHRNYKLVSRV
FT                   WDDVYYNLRGGKRLVLKSLLDLKELFRYHDVYYVYDKIWLEDLCSWIISDQVTEGMIRN
FT                   LAHDLRKEYVALSKTEITFEKLEKQEDNDNIGEDNEDEMVALNIQEVEIMAQESFDAYQ
FT                   NQ"
FT   gene            complement(<847506..>848933)
FT                   /locus_tag="DEHA2E10802g"
FT                   /old_locus_tag="DEHA0E11396g"
FT                   /old_locus_tag="DEHA-IPF12019"
FT                   /old_locus_tag="DEHA-CDS2514.1"
FT   CDS_pept        complement(847506..848933)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10802g"
FT                   /old_locus_tag="DEHA0E11396g"
FT                   /old_locus_tag="DEHA-IPF12019"
FT                   /old_locus_tag="DEHA-CDS2514.1"
FT                   /product="DEHA2E10802p"
FT                   /note="similar to ca|CA1790|IPF13971 Candida albicans
FT                   IPF13971 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88016"
FT                   /db_xref="InterPro:IPR021216"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU3"
FT                   /protein_id="CAG88016.2"
FT                   /translation="MSSDSMSVHSLIDKFSNSERVSNEQRGVGTRKRGSEVHQKSQQQQ
FT                   TQQDEVNQEHVKEANTNSIDETGLLSLLGPNVKSFPLSEEAYIESIKLRTEQEKTKQSY
FT                   YKLETANKNLLMLNTALKANIPPNLIPLMYVPNEDVNAKPNIDPGFKSGVKSESSSAVS
FT                   SPFQQGNRAGVRNLYQQDTSSSSLVPPINYKFGGSNTPNATRRPLSPAKIGAAAVANLA
FT                   TPTNPYKNNRRNILPSHQRHFSMPAPTSSVTPNRNRATPGDLNAIDTTLQPQNKLKPPS
FT                   NISTLNASGNTSDSGTLQSPLGATSSIQVKPSPAQPLHKSTRSANPPSQESMTSFQHII
FT                   QFHHWKPDGPSVGSSTGGSPMRMHKRHKSSSENMSIDLTPNSFSNINENAPVIRVNNSH
FT                   DIDINSNDDQDVDDDEDDDDNDNDVDDDDDITMETSTITDINVSKIPRTESFDDSNNDT
FT                   SSNIGRYPHDILSPSNS"
FT   gene            complement(<849141..>851342)
FT                   /locus_tag="DEHA2E10824g"
FT                   /old_locus_tag="DEHA0E11418g"
FT                   /old_locus_tag="DEHA-IPF12018"
FT                   /old_locus_tag="DEHA-CDS1014.1"
FT   CDS_pept        complement(849141..851342)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10824g"
FT                   /old_locus_tag="DEHA0E11418g"
FT                   /old_locus_tag="DEHA-IPF12018"
FT                   /old_locus_tag="DEHA-CDS1014.1"
FT                   /product="DEHA2E10824p"
FT                   /note="similar to ca|CA0942|IPF8619 Candida albicans
FT                   IPF8619 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88017"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU2"
FT                   /protein_id="CAG88017.2"
FT                   /translation="MPKGKKSKSKSNVKPEEKLAEGNVEAMPEEAKSESIQSEESGPEG
FT                   VDSSNELPKEEEQDSKEQLDKGSEDIEQKGKGVIEDKLESTPEAPKAAASPADESNAED
FT                   TEEDDIKVKEIEPDTKRPNAPENRDLNDDDESGTSGTAPVKKEANRKKSVGFAPAPEED
FT                   LKEHHDVLKKKEEQKRKGNSFHNIPPELSYLQKKPDAPKPLHSSTSNTPPSSRRRMSKE
FT                   LGDLRNMPIKEISLQNKETELNFNYPTVHLPIRAHHMLVDTKFGSLNSFDLAKVNNYIL
FT                   NLSDTKVGLGYEFSGKVIEVGAKYQSEFAVGDNVFGCTNSLSRKGALSTSLLINPTKDV
FT                   LISVDDKLLEKLGDVDIELSFKNAPEDGNFEISSTSSSSLDSEPIAKQPTNLHNKLAGF
FT                   TLQEELSPLAKLSTFPVLYCRAKQALDHSNAIFESTGKANILINGADTNLGFTILQLLN
FT                   SSAYSAVLNEMNLILTIREKSFDKMTNLVNHFTKGKYFDPSRRKRIHLVTFDMENEDLV
FT                   LPGEKVPMNYKKPELFASDVLNALFGDAEEQINKDNAINHKLDLIIDLVGCKKFLQTSS
FT                   IRYKKLETLSLPYLSKFSSDSSLSQVLKANTKEPFLMKLLKPKSYGSCFVSCCKFNLSF
FT                   PSYNIDELFDYSTNNVSLNPWSMKWSSSLANSLTNYYYFEELSLRIKKAWILEGLNLLV
FT                   EDELKFKIDDFIDWRNNFKKYIKSLKKDDGKVVFMIEDF"
FT   gene            <851519..>853522
FT                   /locus_tag="DEHA2E10846g"
FT                   /old_locus_tag="DEHA0E11440g"
FT                   /old_locus_tag="DEHA-IPF12015"
FT                   /old_locus_tag="DEHA-CDS1258.1"
FT   CDS_pept        851519..853522
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10846g"
FT                   /old_locus_tag="DEHA0E11440g"
FT                   /old_locus_tag="DEHA-IPF12015"
FT                   /old_locus_tag="DEHA-CDS1258.1"
FT                   /product="DEHA2E10846p"
FT                   /note="weakly similar to uniprot|Q6CIE0 Kluyveromyces
FT                   lactis KLLA0F27401g"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88018"
FT                   /db_xref="GOA:Q6BPU1"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU1"
FT                   /protein_id="CAG88018.2"
FT                   /translation="MWFLPLLCYIFALVLTLTGIQYHISIFKYPAYLVIPFTLAVFIPL
FT                   SITFLLPLDYVAHNSPSSIIWFDLPDKVILYLWKFNYWITFLLTWLILPLLQEFFRSGY
FT                   FNILSKFKDAVKRNIKFQLIILGVSTAGLVYLILEVGLSLSHLKLMIIALSHIYSLVLA
FT                   LWLMAHGLISIPRNKWISGSLLQDLNHHYLKVPKLVDNLEDIKITFKEDVLQVLVLTKN
FT                   FTSTSGEDFRFRDWILQLHKKIPLDIKEFMEQQYTHDDPGNTISRDQVTTHFMTKLTAN
FT                   FNSNLNKLNSYEAEFNSVLKKIVSLEDVLNCSANDNLQQRSRLVYRIDNHLTLLSPKNK
FT                   FMLEYYIRPVINRLLSIVLFVSSFIILESEFFHSTPISLMNILIYSTGINNHNLLQLIV
FT                   CCITFSYMLFASLNSLTRLKIFNMYHLVPHNSDPVSACFYTTYIARLTIPLSYNFITLF
FT                   VSRNSIFESWFGKSIHLTGLFNSMNNWIPRFVLIPVLLTVFNVYDKLKKKMGLTSDMYD
FT                   SWAVFDDDENGEPNGDIENLSNKRKDLIIVEAKRIINREMLKLSQQRSSRPESLRPFNL
FT                   TNAANLNYETNRLQFNNSLMEPTNQRVDASYNDDVPDNTNDVNGSGIQNSNIWGKLGGV
FT                   INGIRSNVATTFNQNNARAYRDDPDDPDNILL"
FT   gene            <853739..>855082
FT                   /locus_tag="DEHA2E10868g"
FT                   /old_locus_tag="DEHA0E11462g"
FT                   /old_locus_tag="DEHA-IPF12014"
FT                   /old_locus_tag="DEHA-CDS2756.1"
FT   CDS_pept        853739..855082
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10868g"
FT                   /old_locus_tag="DEHA0E11462g"
FT                   /old_locus_tag="DEHA-IPF12014"
FT                   /old_locus_tag="DEHA-CDS2756.1"
FT                   /product="DEHA2E10868p"
FT                   /note="similar to uniprot|P25646 Saccharomyces cerevisiae
FT                   YCR079W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88019"
FT                   /db_xref="GOA:Q6BPU0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPU0"
FT                   /protein_id="CAG88019.2"
FT                   /translation="MIQTPRKFPHPLHNFNQCTQNNKRFVSGVIAFTAIDKSSKYPRSS
FT                   NMVHKLGKLRVPLLKSPYYFGHFTSRVNRLYNEDKYSANVLTLPEDRTVFNFNIFDGHG
FT                   GEQCSTFLKDNLSQEIENANELSQEDNSSVRNELAKSYWKNIGGYWKRWYKHKDANFEA
FT                   MSPENNSMKLTNIKHTQDDLSLRLPLSFLETDYKFFKDEDKSGSTCTSAFLETIYSEST
FT                   EADSSFEKYYFNRNTISKLTIAQVGDTRAILVDKNGQAHALTQSHHPSNPTESKRLRKY
FT                   AANFFMTDSFGEERFIALANTRAFGDVSYKEMGVTSEPDVIQLIVGDNTAIKKQLTAEE
FT                   IKNYTVGALGGDESFLVLCTDGVTDILTDQEIGDIVMVHYNMKGHPKASPQLCAEEVVK
FT                   FVEYVGGDDNATCLVIRLNGWGSWPISDRTGQLRQERMKDYSPRGERV"
FT   gene            complement(<855276..>855551)
FT                   /locus_tag="DEHA2E10890g"
FT                   /old_locus_tag="DEHA0E11484g"
FT                   /old_locus_tag="DEHA-IPF12013"
FT                   /old_locus_tag="DEHA-CDS7529.1"
FT   CDS_pept        complement(855276..855551)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10890g"
FT                   /old_locus_tag="DEHA0E11484g"
FT                   /old_locus_tag="DEHA-IPF12013"
FT                   /old_locus_tag="DEHA-CDS7529.1"
FT                   /product="DEHA2E10890p"
FT                   /note="highly similar to uniprot|P53733 Saccharomyces
FT                   cerevisiae YNR037C RSM19 Mitochondrial ribosomal protein of
FT                   the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88020"
FT                   /db_xref="GOA:Q6BPT9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT9"
FT                   /protein_id="CAG88020.1"
FT                   /translation="MKPSLHILKGRSSWKGPHVVPLPIANAIKTGVPIRTNARSCTVLP
FT                   QFVGLKFQIHNGKEYAEVEITDDMVGSKLGEFAATRKRFTYKFSKN"
FT   gene            <856023..>857753
FT                   /locus_tag="DEHA2E10912g"
FT                   /old_locus_tag="DEHA0E11506g"
FT                   /old_locus_tag="DEHA-IPF12012"
FT                   /old_locus_tag="DEHA-CDS1223.1"
FT   CDS_pept        856023..857753
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10912g"
FT                   /old_locus_tag="DEHA0E11506g"
FT                   /old_locus_tag="DEHA-IPF12012"
FT                   /old_locus_tag="DEHA-CDS1223.1"
FT                   /product="DEHA2E10912p"
FT                   /note="similar to uniprot|P53734 Saccharomyces cerevisiae
FT                   YNR038W DBP6 Essential protein involved in ribosome
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88021"
FT                   /db_xref="GOA:Q6BPT8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPT8"
FT                   /protein_id="CAG88021.2"
FT                   /translation="MSSDTEEASEEIEGNQNQHVNKQPENDDKMDIVEDEETPEEPIEN
FT                   DPNYMSKHHSVFQKFKSSVHDVKGEEVDEETPEEKEDIEMQDLVPLPQPELPRDKRLVS
FT                   TAAHLNNLDWLTTPIYTAPEETKPFAEFQNPPLSSLMIKNLRNMGFESAFSVQISVLNL
FT                   MLKDIERNRLQPDMRGDLLVNASTGSGKTLAYSIPIIESLQTVKVPRVRAIILVPTKPL
FT                   INQVKTTLNQLSKGTNLSIVSLKNDLSIKEEGIKLQTNEPDIIVSTPGRLVDHLTNGYI
FT                   SLKNLQYLVIDEADRLLNQSFQNWCQILISKIDEFTNIKERNISNSWKLNVQKMIFSAT
FT                   LTTDAGKLSLLKFHKPRLIIVNNKEQLVNEMFSLPATLNEFKLQFGSAKSSLKPLILSK
FT                   FLLSKNKLANVLIFTKSNDASLRLSRLLSLIMNKLGSETINIAYINSTNNTTSVRSKIL
FT                   KDFSKQTINILVATDLIARGIDILSITDVINYDLPNSSREYVHRVGRTARANQEGFAYN
FT                   FCFGKGEAKWFKKLMAQVGRSEKNIEELELDTKQLIEDNDESMYKESLDELQQQVFNRA
FT                   "
FT   gene            <857787..>861260
FT                   /locus_tag="DEHA2E10934g"
FT                   /old_locus_tag="DEHA0E11528g"
FT                   /old_locus_tag="DEHA-IPF12007"
FT                   /old_locus_tag="DEHA-CDS0291.1"
FT   CDS_pept        857787..861260
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10934g"
FT                   /old_locus_tag="DEHA0E11528g"
FT                   /old_locus_tag="DEHA-IPF12007"
FT                   /old_locus_tag="DEHA-CDS0291.1"
FT                   /product="DEHA2E10934p"
FT                   /note="similar to uniprot|P40352 Saccharomyces cerevisiae
FT                   YJR035W RAD26 Protein involved in transcription-coupled
FT                   repair nucleotide excision repair of UV-induced DNA
FT                   lesions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88022"
FT                   /db_xref="GOA:Q6BPT7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT7"
FT                   /protein_id="CAG88022.2"
FT                   /translation="MRQFFCTSSLLVSLLPYYITLQIAMEEEESPLDQLGVKFVDQDEL
FT                   EHDITKKANEALINKDTELDQKRLDKANNDYNKASSKLRILRNRLSNPRTKISQRKPLK
FT                   DECDWIEKNELEPLKQDIVDITNRLNENKSQLSESKNQCNQKKSTQSINEKLPGESERD
FT                   FLIRTGKITAFGNENAFHQDKTNEPDDIKSHVFLRAPGFEDANVTTQNDDDYDYGATEN
FT                   AMPSSYNETNKRKQSEMEGSENESDYSPLEENQNASEEEDIDNDNVVDDDYDIYSAPNE
FT                   VVTETKNLDAQRNVDDGDEYLYQIRLKNWIKRRSELRKKTEEVTNETNDKEEWFKPHPT
FT                   IPDAVLNSKFKLPGDIYPSLFDYQKTCVQWLWELYSQKTGGIIGDEMGLGKTIQIISFL
FT                   AGLHYSGLLEKPVLVVVPATVMNQWVNEFHRWWPPLRCVILHSIGSGMGKNAIHSEEKI
FT                   EAFLETTDPSSVKNDSFKGINSHMRAKEIIDTVMEKGHVLVTTYVGLRIYSKFILPRQW
FT                   GYVVLDEGHKIRNPDSDISLTCKQIKTYNRIILSGTPIQNNLIELWSLFDFIFPGRLGT
FT                   LPVFEQQFSVPINMGGYANASNVQVQTGYKCAVILRDLISPYLLRRLKSDVAQDLPKKN
FT                   EMVLFVKLTQYQQDLYEKFLSSEDLHAILKGKRNILMGVDILRKICNHPDLVDREILQR
FT                   RKNYNYGNPAKSGKLQVLKNLLQLWQMQGHRTLLFCQTKQMLDILEKFVTNLPSLNENG
FT                   EEVRGTFNYLRMDGSTNIGRRQALVDTFNEDKQYHVFLLTTKVGGLGINLTGADRVIIY
FT                   DPDWNPSTDIQARERAWRLGQKKDITIYRLMTAGSIEEKIYHRQIFKTFLTNKILKDPK
FT                   QRRFFKVNDLHDLFSLGDQDEVGTETGDLFNGSETKFNGKKDRKSNKLFKPKHKNDDDF
FT                   YQVANINGVSKLDNFEGDNQEKDGEQDGNKDESRIMEGLFANSGVHSALKHDDIMDSSK
FT                   QEVSIIEKEANRVAAEAAEALKRSRKLTRKNNIGTPTWTGKFGLAGKFGPKVKRTKLSS
FT                   NDKPSKLLSSTSILSELKQKKNKSDTVFAKKSANDDKKFDRQEMLDKLIGFLAKQTDHF
FT                   STSNNILTDLKLELNDEKDMILVRSMLREIATWDTPRKGWILKQEFLTNS"
FT   gene            <861415..>862236
FT                   /locus_tag="DEHA2E10956g"
FT                   /old_locus_tag="DEHA0E11550g"
FT                   /old_locus_tag="DEHA-IPF12005"
FT                   /old_locus_tag="DEHA-CDS4475.1"
FT   CDS_pept        861415..862236
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10956g"
FT                   /old_locus_tag="DEHA0E11550g"
FT                   /old_locus_tag="DEHA-IPF12005"
FT                   /old_locus_tag="DEHA-CDS4475.1"
FT                   /product="DEHA2E10956p"
FT                   /note="weakly similar to uniprot|Q04689 Saccharomyces
FT                   cerevisiae YML050W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88023"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPT6"
FT                   /protein_id="CAG88023.2"
FT                   /translation="MNIARRYLSRFVEKCPIERGCECNILSELPNDKPIDFEKNLNGTS
FT                   VIPWKHLLVLSHGFNHADEWPSKLELLPGSLTNEMDLLKRKVVSPYHPIMISNAIVPNV
FT                   TRGAKEKVYLYPDNKMIEFDIKDTKDFMHTYLVPPEEEMAQFEPVYNPFKKTTAITWEK
FT                   KKIDFKEQDIGKDLILVCGHTQRDVRCGKIAPILVDQFKKSLKDRGLDVDVGVVSHIGG
FT                   HAYAGNVIYFPSDKTKKSIWYGRVFPEKVAGIVDETVIGGNIIKELYRGEV"
FT   gene            <864043..>865824
FT                   /locus_tag="DEHA2E10978g"
FT                   /old_locus_tag="DEHA0E11572g"
FT                   /old_locus_tag="DEHA-IPF12001"
FT                   /old_locus_tag="DEHA-CDS1658.1"
FT   CDS_pept        864043..865824
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E10978g"
FT                   /old_locus_tag="DEHA0E11572g"
FT                   /old_locus_tag="DEHA-IPF12001"
FT                   /old_locus_tag="DEHA-CDS1658.1"
FT                   /product="DEHA2E10978p"
FT                   /note="weakly similar to uniprot|P53438 Saccharomyces
FT                   cerevisiae YMR016C SOK2 Nuclear protein that plays a
FT                   regulatory role in the cyclic AMP (cAMP)-dependent protein
FT                   kinase (PKA) signal transduction pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88024"
FT                   /db_xref="GOA:Q6BPT5"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT5"
FT                   /protein_id="CAG88024.2"
FT                   /translation="MSNLEPHQSLDYRTAYHTNSGGYAGHQGQSSNGPAGVSQSSTGTP
FT                   STGAQGPSSQAQPSSQTSTSSAAQQQPSLQPLHSNPQLQSQHPRGSSSMPQYQQYPSNY
FT                   YSDQYQQQYQQLVNGTNQSSISSQSSQPQLATQQQPHQQPPQPVNAGAMGQYQSSMGVP
FT                   QQFPYSYYMQFNQSQNQSNDMNYPYSRYSNYPPTAAAASTSSSAAPPQNYSVYQQSVPQ
FT                   VNNQITQPQPQHYSNVNNHGTTPAPGGETAAGYSSNYTPVPDTLSSSNNSSVGQYQPPG
FT                   VRPRVTTTMWEDEKTLCYQVDANNVSVVRRADNNMINGTKLLNVAQMTRGRRDGILKSE
FT                   KVRHVVKIGSMHLKGVWIPFERALAMAQREGIVDLLYPLFVRDIKRVIQTGVTPANNAS
FT                   AEPTTGSGTPGVTAPAAAPNNQLSTPSQSTAGTSTMNLNNYYPPYAQYPQPQTGGTDPA
FT                   TASNQSPQQNVSDFHSSQAHQQPGQQQVYSYQQPYYAPNQYYQPYNPQSNYSSYNSQPA
FT                   YAGYGYVNQQSQQSQQSQPQAGHQQSQQLPQTQGQSAQPQSSLPQPSDPNNSSLDAGHA
FT                   NETSPTTDDKPKPEEKD"
FT   gene            complement(<866195..>866806)
FT                   /locus_tag="DEHA2E11000g"
FT                   /old_locus_tag="DEHA0E11594g"
FT                   /old_locus_tag="DEHA-IPF11998"
FT                   /old_locus_tag="DEHA-CDS5317.1"
FT   CDS_pept        complement(866195..866806)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11000g"
FT                   /old_locus_tag="DEHA0E11594g"
FT                   /old_locus_tag="DEHA-IPF11998"
FT                   /old_locus_tag="DEHA-CDS5317.1"
FT                   /product="DEHA2E11000p"
FT                   /note="similar to uniprot|P35723 Saccharomyces cerevisiae
FT                   YKL065C YET1 Endoplasmic reticulum transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88025"
FT                   /db_xref="GOA:Q6BPT4"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="InterPro:IPR041672"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT4"
FT                   /protein_id="CAG88025.2"
FT                   /translation="MSIQMSLVFGALILEMVTLLSMVLPLPHPVRVKIMDIATVLRNSK
FT                   NFKIGFWFTVILLSMQFADCIQRLQRFGTLGNPYFALNSQNKQFGTMSYDQLASKFYSQ
FT                   RNLYITGAVLYLMLAIYTVSTILKKLVSKEAEFRQLSANEKEGASKIAGEEGEESSEVA
FT                   KYKKLIEQKELDIATLKKQVGGLQKSYDDLNPSQVIDKDE"
FT   gene            complement(<867020..>870022)
FT                   /locus_tag="DEHA2E11022g"
FT                   /old_locus_tag="DEHA0E11616g"
FT                   /old_locus_tag="DEHA-IPF11997"
FT                   /old_locus_tag="DEHA-CDS0443.1"
FT   CDS_pept        complement(867020..870022)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11022g"
FT                   /old_locus_tag="DEHA0E11616g"
FT                   /old_locus_tag="DEHA-IPF11997"
FT                   /old_locus_tag="DEHA-CDS0443.1"
FT                   /product="DEHA2E11022p"
FT                   /note="similar to uniprot|P35724 Saccharomyces cerevisiae
FT                   YKL064W MNR2 Putative magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88026"
FT                   /db_xref="GOA:Q6BPT3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT3"
FT                   /protein_id="CAG88026.2"
FT                   /translation="MPKNKNKNKNKNWKSGNYSSSPLNDDNQDNESTTSSNANNDGSEN
FT                   KDNSIKGGSYIDHRMYDNLAHIHSSPARSRRRGIQSTSAQGNLASRRHTTTSAEYNNKN
FT                   PPFKKQPSLPLTNRNLQNLLVQNDTNPGTGYSPTDTRSYGSIALDMDQYAKEQRQMTHG
FT                   WNDPFNEEGDSRSDDGSINSLEFGGSNPPSDHSSDSTSLDDVCFPDYYDRVDGRGDRED
FT                   SYEWPDLKILEQFVREELDEYADDEKNEDGSGDHFKMDQQMEDQHNVNFQQPLAVSVNG
FT                   KADDKKKKKKKKKNNNNKQKSSPDETVESTPLLENAQINEIESMSSMNESFRIRPTPIQ
FT                   PWEKSKDRIPTILNNPNDPVRNPKQQTSFKNAKPDGKLCRFTYFREDLNKTIHSPTISG
FT                   LLADSISNKVAEDTVSLARKWGKNAKDENNEHDEQNEDNFEDESTTLRELFSPNFYSQK
FT                   TSSSSSSASIHGSHHTPTSSGTPVPLTALNEANIGEMNKLGGTSLKGNYLEPSPAPGTI
FT                   VGSEVHLDCNPFWLDVLDPTEEEMKVLSKTFGIHPLTTEDIFLGETREKVELFKSYYFI
FT                   CFTSFDIVYERRKQRAKEQEKKLNKLQEMYENSNDGNSVFGTQERKSKIWKFFRKLVKG
FT                   NENKPASNFHTTKESSSNKSRVKKIREGELSPLNMYMIVFKHAVITFHFSPTPHPVNVR
FT                   RRARLLKDYLTVSSDWICYAIIDDITDSFAPMIESIEEEVNLIEDAILKMHSGDTDSED
FT                   DSDDNSSDDESENNHHALNTRNTNNVFYKRKRSKSTVDNSGFSSRYKTYAPLSTKSESK
FT                   KSSKSSSSKSTSSKILGWKRKGDMLRRIGECRKRVMSVLRLLGSKADVIKGFSKRFSEK
FT                   LEADNFRNSSGSPKSEIGMYLSDIQDHIVTMVQSLNHYEKLLARFHSNYLAQINIDMTQ
FT                   VNNDTNDVLGKITVLGTIVLPINVVTGLWGMNCIVPGQDYEGLAWFWSIISGMILFSIF
FT                   AYNYAKRVYGI"
FT   gene            complement(<870495..>870902)
FT                   /locus_tag="DEHA2E11044g"
FT                   /old_locus_tag="DEHA0E11638g"
FT                   /old_locus_tag="DEHA-IPF11996"
FT                   /old_locus_tag="DEHA-CDS6381.1"
FT   CDS_pept        complement(870495..870902)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11044g"
FT                   /old_locus_tag="DEHA0E11638g"
FT                   /old_locus_tag="DEHA-IPF11996"
FT                   /old_locus_tag="DEHA-CDS6381.1"
FT                   /product="DEHA2E11044p"
FT                   /note="some similarities with uniprot|P54000 Saccharomyces
FT                   cerevisiae YMR039C SUB1 transcriptional coactivator and
FT                   similar to ca|CA4375|IPF11309 Candida albicans IPF11309"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88027"
FT                   /db_xref="GOA:Q6BPT2"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT2"
FT                   /protein_id="CAG88027.1"
FT                   /translation="MAYKRSFSNKNTSDTSSSNDKVIELDKKKQITVRKFNNVNLVDIR
FT                   EFYVDKDTNEKKPGKKGISLTEDVWLKLVQSSSDVQDALDVLNGVEPSRKKAKQTENND
FT                   DDAADAKAEANNEDQKTDTKEEEDVSDEDAE"
FT   gene            complement(<871135..>872226)
FT                   /locus_tag="DEHA2E11066g"
FT                   /old_locus_tag="DEHA0E11660g"
FT                   /old_locus_tag="DEHA-IPF11995"
FT                   /old_locus_tag="DEHA-CDS3535.1"
FT   CDS_pept        complement(871135..872226)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11066g"
FT                   /old_locus_tag="DEHA0E11660g"
FT                   /old_locus_tag="DEHA-IPF11995"
FT                   /old_locus_tag="DEHA-CDS3535.1"
FT                   /product="DEHA2E11066p"
FT                   /note="similar to uniprot|Q04212 Saccharomyces cerevisiae
FT                   YMR041C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88028"
FT                   /db_xref="GOA:Q6BPT1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT1"
FT                   /protein_id="CAG88028.2"
FT                   /translation="MTITLVKPIRGTHTQKFRSIKDLPPLIIGGAVFNYIYTSDPAGIP
FT                   AYDLLDLAFKNGLLALDTSPYYGRSEELLGKALKQLEDKWERESYFICTKAGRIGEKEF
FT                   DYSKDGVRKSVLRSLERLNTTYLDLVYMHDVEFVTEEEIYDALKELRLMKDEGLVKNIG
FT                   ISGYPVKLLYRVALQCNTNYSGTIGPLDAVLSYSNGCLQNTILYDLYQDFFDKCGIQKL
FT                   MNGSILSMSLLNSRKTLDFHPASQELKDKIAEIAEYLKVNHNNLELADLSTRFAYMTWL
FT                   FGSSNKEVGFHDLTWNQNCSIVLGVSGIEELEAAISNYWLVKENIGNVNDKDQILFTKV
FT                   KRRLGPKHYNETWESGLEQHNNY"
FT   gene            complement(<872416..>874599)
FT                   /locus_tag="DEHA2E11088g"
FT                   /old_locus_tag="DEHA0E11682g"
FT                   /old_locus_tag="DEHA-IPF11992"
FT                   /old_locus_tag="DEHA-CDS1040.1"
FT   CDS_pept        complement(872416..874599)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11088g"
FT                   /old_locus_tag="DEHA0E11682g"
FT                   /old_locus_tag="DEHA-IPF11992"
FT                   /old_locus_tag="DEHA-CDS1040.1"
FT                   /product="DEHA2E11088p"
FT                   /note="similar to ca|CA4373|IPF5287 Candida albicans
FT                   IPF5287 signal transduction protein (by homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88029"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPT0"
FT                   /protein_id="CAG88029.2"
FT                   /translation="MTRIDRIRSENTTFVNNFWGRRDSGFKVIQTKIKHALTTLEELLD
FT                   FYRERIQIEKDYNKKLEKLNGKILLGSHETGSLKKSLDKLSLENKHMVKDNSKFIKSLS
FT                   QTNYDKLNHFYAIYYKKVSKIESHMQKIINKQNDLFKTLEMNKNKYQEECSQIKSFRLL
FT                   VQTTWGKELEKNEAKLNKITSSNINTKKHYQIAVTNFTDLNEIFVRDWSIALKDFYQLE
FT                   VERIQICKVNCFTFCNNIATLCVDNDQSVDLARSVFALVSPPQDLQDFGDTYGTGDKIY
FT                   KSPEFVDFMDGYGDEQRDSEFTRAEFENPDSDRLSRSYSSYSQGTQQSLPTRETVAKTP
FT                   LPLVKESLEKASLPPPPTNNIPISAPNGFLGSPSRKPPAGFDRSSSVYSTQDKNDVFSV
FT                   GEKETSHKFSNSNGSSNYSNPTNYTGSNYSGSSNNERNWASPRRKEKQLSQFQEQINLK
FT                   SKELPSFPNNSHDTNETAQNVPIMKDFSIDFIAKALEDLNSGGDGDINQYRRSVRGTGN
FT                   PEEPRAKTAPSTPFGKLKTHSDFVDDRDEVATRHDSIMFSSPTRNQNSAELDGSPIKRG
FT                   RRQRPKSMLDPLSNDRLSDYPIGDHMDHSVDTCIIKKPTEQFQTPHRKHQRSLSKSPTK
FT                   SYTNLNAMIQQSSNPILTPIGNTPYLSKAKAMYTYKPQDHGELYFKKGWFMYIIHKQED
FT                   NWFVCELAQNCKDRAGMIGLVPGNYLHEEQDLF"
FT   gene            <875538..>876884
FT                   /locus_tag="DEHA2E11110g"
FT                   /old_locus_tag="DEHA0E11704g"
FT                   /old_locus_tag="DEHA-IPF11988"
FT                   /old_locus_tag="DEHA-CDS2741.1"
FT   CDS_pept        875538..876884
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11110g"
FT                   /old_locus_tag="DEHA0E11704g"
FT                   /old_locus_tag="DEHA-IPF11988"
FT                   /old_locus_tag="DEHA-CDS2741.1"
FT                   /product="DEHA2E11110p"
FT                   /note="similar to uniprot|Q05131 Saccharomyces cerevisiae
FT                   YMR034C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88030"
FT                   /db_xref="GOA:Q6BPS9"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS9"
FT                   /protein_id="CAG88030.2"
FT                   /translation="MVTISEIKETKAYKVLSSVVSFLISQWFFLFLGAFVAIAHSYPEF
FT                   AKQGGTIRAEYSIQYGAVAVIFLISGLSMSTASLRVNLLNWRAHFTVLSTSFLITSSII
FT                   YGIACGIKAANDPSMDEWLLAGMIVTHACPTTVSSNVVMTKQAHGNDVLTLLEVSVGNI
FT                   LGAFVTPALVQMYLVGTWEFANPTHQSSGDTTIQDLYREAMKQLGLSLFVPLFVGQVIQ
FT                   NVFPKQTKWTLTTFKLAKVGSFMLLLIMFQSFSTAFAQDAFTSVSHESIIFLVFFNIGI
FT                   YLFFTVMTYFYSRPLFILRYFNEEPNESHSKAYKYGYKLLRPFYYNRRDTVAIMLCGPA
FT                   KTAALGVSIISSQYGSKNENLGKLLVPLVLYQAEQVITAQVLVNFMRKWIYAEDKKPDD
FT                   IESDEHGDKNSPIESEQSNSVGDNNDSESQVSRHNSSITNLGDTNKLSP"
FT   gene            complement(<877259..>877618)
FT                   /locus_tag="DEHA2E11132g"
FT                   /old_locus_tag="DEHA0E11726g"
FT                   /old_locus_tag="DEHA-IPF11985"
FT                   /old_locus_tag="DEHA-CDS6752.1"
FT   CDS_pept        complement(877259..877618)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11132g"
FT                   /old_locus_tag="DEHA0E11726g"
FT                   /old_locus_tag="DEHA-IPF11985"
FT                   /old_locus_tag="DEHA-CDS6752.1"
FT                   /product="DEHA2E11132p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS8"
FT                   /protein_id="CAG88031.1"
FT                   /translation="MTSRQDQTYTATPSYTPTGSENNTSNTDNGSGDQSNTETSTPTGS
FT                   DSGDDSGDGSDNGSGSGSGSGSGSGSGSDKGPGSGYSASASSTATISAYEGTVPMNKIS
FT                   SFSIALVPLALMALI"
FT   gene            <877838..>877939
FT                   /locus_tag="DEHA2E11154g"
FT                   /old_locus_tag="DEHA0E11748g"
FT                   /old_locus_tag="DEHA-IPF11983"
FT                   /old_locus_tag="DEHA-CDS8875.1"
FT   CDS_pept        877838..877939
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11154g"
FT                   /old_locus_tag="DEHA0E11748g"
FT                   /old_locus_tag="DEHA-IPF11983"
FT                   /old_locus_tag="DEHA-CDS8875.1"
FT                   /product="DEHA2E11154p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88032"
FT                   /db_xref="GOA:Q6BPS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS7"
FT                   /protein_id="CAG88032.1"
FT                   /translation="MELDQLGATSDPAALLGISITLFGSPYSATLLH"
FT   gene            complement(<880072..>880362)
FT                   /locus_tag="DEHA2E11176g"
FT                   /old_locus_tag="DEHA0E11770g"
FT                   /old_locus_tag="DEHA-IPF11980"
FT                   /old_locus_tag="DEHA-CDS7269.1"
FT   CDS_pept        complement(880072..880362)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11176g"
FT                   /old_locus_tag="DEHA0E11770g"
FT                   /old_locus_tag="DEHA-IPF11980"
FT                   /old_locus_tag="DEHA-CDS7269.1"
FT                   /product="DEHA2E11176p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS6"
FT                   /protein_id="CAG88033.1"
FT                   /translation="MHIVLKNFVNREPRMSCALMTIKFLRSVWVSGWYSGSMASKECSS
FT                   NPKIGKATTEGCCDSILEQVSIVRWTKADTEREAWRKERTVGNGREPWWEP"
FT   gene            <880503..>881897
FT                   /locus_tag="DEHA2E11198g"
FT                   /old_locus_tag="DEHA0E11792g"
FT                   /old_locus_tag="DEHA-IPF11978"
FT                   /old_locus_tag="DEHA-CDS2610.1"
FT   CDS_pept        880503..881897
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11198g"
FT                   /old_locus_tag="DEHA0E11792g"
FT                   /old_locus_tag="DEHA-IPF11978"
FT                   /old_locus_tag="DEHA-CDS2610.1"
FT                   /product="DEHA2E11198p"
FT                   /note="similar to ca|CA2479|CaCCN1 Candida albicans CaCCN1
FT                   G1 cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88034"
FT                   /db_xref="GOA:Q6BPS5"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS5"
FT                   /protein_id="CAG88034.2"
FT                   /translation="MQLQGSKTGSEAKYGPPTHVRRKPYNLMLELLESQANRKLVSEYQ
FT                   ADGTKVLAQLEASRGVNPAMIELQPEIQWFMRPFLLDFLIELHSSFKLQPQTLFLCLNI
FT                   IDRYCAKRIVFKRHYQLVGCTALWIAGKYEDKKSRVPTLRELSIMCRNAYDEEMFIQME
FT                   MHILATLEWSLSHANLEECLQLAISSCDITTHGTPCKYNNIDDKSNTMNNTSKVSAVTA
FT                   VGRFLCELSLYDKFFLSLPPSLIAVTANLMACSMLQIPNASASLRAIFKKYTSESEIPG
FT                   FDFNEYDENSENRQPEVEGPFLSGFDSSSLNTIRKICLMLIVQLGKITDVLSKKYDDLG
FT                   VIQVVKNFNNRYSFAVSAIYENQNIVQEASMIELTNSKLYNLADIVLQLPNSNLETRNE
FT                   NHVPLTPPSATSQYSVFSNKSSVSVCTPIHSTYLPSSERMDDFSPMQDPGNNGWSSPAS
FT                   SAKIHI"
FT   gene            complement(<882001..>884976)
FT                   /locus_tag="DEHA2E11220g"
FT                   /old_locus_tag="DEHA0E11814g"
FT                   /old_locus_tag="DEHA-IPF11976"
FT                   /old_locus_tag="DEHA-CDS0459.1"
FT   CDS_pept        complement(882001..884976)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11220g"
FT                   /old_locus_tag="DEHA0E11814g"
FT                   /old_locus_tag="DEHA-IPF11976"
FT                   /old_locus_tag="DEHA-CDS0459.1"
FT                   /product="DEHA2E11220p"
FT                   /note="similar to uniprot|P39104 Saccharomyces cerevisiae
FT                   YNL267W PIK1 Phosphatidylinositol 4-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88035"
FT                   /db_xref="GOA:Q6BPS4"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS4"
FT                   /protein_id="CAG88035.2"
FT                   /translation="MDQAYESLLESTESPTFDIFQCLYQLKINIDNIGVHHYLVKKLYN
FT                   FSYLEVEFHIPQLIQLLVSFETDSMALNEFMLDYSRKYPHFCLITFWNLQAYVFELKND
FT                   PESYSFHIVRSFINELQNVMFNQEALYDSPVAQKKHGEFRENLQPSIAMCGAVLASIAV
FT                   PQINVYAKPIIASQGKQQKSLLFKLANFHKSLTKNLTLKNRGRATSHSEHANIDQGHRS
FT                   LSNPGTTKTHEESAKESADSTSKASRKLQNSATMSSLDTWEDRHYNSDYSLERDMKINT
FT                   RIISKKSYIRRAKELEQSGLGSESLIDVNADIYTRPPLKDNKIAFHSMPDLRSNNREGS
FT                   LDEMPITPVISGSSSTSLASLDLQEHKYANNHRILPMHQDQKIKYLQVNYFKKETEFMM
FT                   GLQNISTRLSQVPKEARLTSLRAELSIINNTIFPSEIDIPQLLPISSNQNKKFHRIIKL
FT                   NVNEACVLNSAERVPFLLLIEYLSEEMDFDPLNEHNKSIILSKSTNDFVYASGRRNKTP
FT                   TTDFTRSSNDSTRQTDSTEPNTGFDEADLGDMSVVALSNEKSFITNHLNSRQANDMNTH
FT                   RVDISSPAPQKANMERRQTPDLTSPSSPGTPTFDTRDLSTQMRIAAVMLQQLEKSGQTN
FT                   TEQTAAIRARIIDSMKALQDKFENIDYKQIQAMQSVHVGRNSSDAGERKLENDFKLSED
FT                   WATKKNRIRQASAYGHLKNWDLCSVIAKNGDDLPQEAFACQLISMISNIWKANNVGVWT
FT                   KNMKIIVTSANTGLVETINNAMSIHSIKKTLTDLTLKSGENPKGKVASLKDYFNKVYGD
FT                   EDSYKYKKAQSNFARSLAAYSVICYVLQIKDRHNGNIMLDNEGHIIHIDFGFLLSNSPG
FT                   SVGFEAAPFKLIFEYVEVLGGLEGAQYLKFKELCKECFKALRKNCDHLINIVDLMQKDS
FT                   SLPCFKNGAQTSVLLKQRLQSDLSDEECDAFVETGLIGKSIGSVYTRLYDQFQLLTQGI
FT                   YS"
FT   gene            <885234..>885434
FT                   /locus_tag="DEHA2E11242g"
FT                   /old_locus_tag="DEHA0E11836g"
FT                   /old_locus_tag="DEHA-IPF11974"
FT                   /old_locus_tag="DEHA-CDS8252.1"
FT   CDS_pept        885234..885434
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11242g"
FT                   /old_locus_tag="DEHA0E11836g"
FT                   /old_locus_tag="DEHA-IPF11974"
FT                   /old_locus_tag="DEHA-CDS8252.1"
FT                   /product="DEHA2E11242p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88036"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS3"
FT                   /protein_id="CAG88036.2"
FT                   /translation="MVSVAAKRCEYPRRSGWINANTGEPMMYSEEDNERARKLLERIDW
FT                   SKVKHSTGRPFEGLLVLQSQK"
FT   gene            complement(<885580..>887019)
FT                   /locus_tag="DEHA2E11264g"
FT                   /old_locus_tag="DEHA0E11858g"
FT                   /old_locus_tag="DEHA-IPF11973"
FT                   /old_locus_tag="DEHA-CDS2485.1"
FT   CDS_pept        complement(885580..887019)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11264g"
FT                   /old_locus_tag="DEHA0E11858g"
FT                   /old_locus_tag="DEHA-IPF11973"
FT                   /old_locus_tag="DEHA-CDS2485.1"
FT                   /product="DEHA2E11264p"
FT                   /note="similar to uniprot|P38755 Saccharomyces cerevisiae
FT                   YHR001W OSH7 Member of an oxysterol-binding protein family
FT                   functions in sterol metabolism and similar to
FT                   ca|CA0759|IPF11167 Candida albicans IPF11167"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88037"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS2"
FT                   /protein_id="CAG88037.2"
FT                   /translation="MGLTSKLDKLKLKSDKGQSSNSNSGTTTPVGEAATEGGIPEGNKH
FT                   NANDTDDIDEIDNEGQSILMGIISQLRPGCDLSKITLPTFILEKKSMLERITNFFEIPD
FT                   LLLEADATDDDLMRFVLMVKWYLASWHIAPKAVKKPLNPVLGELFACYWDNLPDNSTAY
FT                   YISEQTSHHPPKSSYFYLVPERKIRVDGVVIPQSKFLGNSSAALMNGWGHVQLGNRGDE
FT                   TYIMNQPNVYCRGILFGKLRYELGDHMVIKCPKTGFEANIEFKTKGFISGTYDAIEGTI
FT                   KNTNTGETLYSITGKWNEVMDIKNLATGKKEVLFDTATTKIFEPKTRPIEEQLEYESRR
FT                   LWAPTINALGKRDHELATNEKAKVEGEQRIKAKKRLEDGVEFHPKLFRPVTEKDKGAQN
FT                   LEYVIYKRFDLASDPETLRQAIFDTMPILPGQVDHESLQIPAFDKNSTPSPAPPADAPP
FT                   ADADAPFVDASDAPHADTSPV"
FT   gene            <887397..>889112
FT                   /locus_tag="DEHA2E11286g"
FT                   /old_locus_tag="DEHA0E11880g"
FT                   /old_locus_tag="DEHA-IPF11968"
FT                   /old_locus_tag="DEHA-CDS1805.1"
FT   CDS_pept        887397..889112
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11286g"
FT                   /old_locus_tag="DEHA0E11880g"
FT                   /old_locus_tag="DEHA-IPF11968"
FT                   /old_locus_tag="DEHA-CDS1805.1"
FT                   /product="DEHA2E11286p"
FT                   /note="similar to uniprot|P29468 Saccharomyces cerevisiae
FT                   YKR002W PAP1 Poly(A) polymerase one of three factors
FT                   required for mRNA 3'-end polyadenylation also required for
FT                   mRNA nuclear export"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88038"
FT                   /db_xref="GOA:Q6BPS1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS1"
FT                   /protein_id="CAG88038.2"
FT                   /translation="MNYQAYGVTPPISVANPTPKENSLNDSLIKELKSRGSFESEAATK
FT                   KRVEVLHILQKLTEEFVYTVSINKNMNEGMAKDAGGKIFTFGSYRLGVYGPGSDIDTLV
FT                   VVPKHVTRSDFFEVFDKILRKRPELEEIASVSDAYVPIIKMEFGGISIDLICARLDIPR
FT                   IPKDLKLDDKNLLRNIDEKDLRSLNGTRVTDEILTLVPKPTVFKHALRCIKMWAQQRAI
FT                   YANVFGFPGGVAWAMLVARICQLYPNAVSAVIVEKFFHIYAQWSWPQPVLLKPIEDGPL
FT                   QVRVWNPKLYPHDRQHRMPVITPAYPSMCATHNITSSTQKIILDEFKRGIDIMSQISMN
FT                   KSTWSDLLARHTFFYKYKFYLCIVAATQGSSEDHLKWGGMVESRLRLLIQKLEMTEGIE
FT                   IAHPYVKPFENSYACENQAQAEEVINTYGTLQGESITKDLPEPLKKKEEENNETENKEE
FT                   EKEGKQNSDSIEVHLTKLFVGLDIDLNKGSDKKLDIQYPCSEFFNICKGWQTYDEKLHS
FT                   IQIKHVKLYDLPNDVYIEGEERPVKNSKRKRSAAKDQGKKRPKSVGTATTVASS"
FT   gene            complement(<889191..>890939)
FT                   /locus_tag="DEHA2E11308g"
FT                   /old_locus_tag="DEHA0E11902g"
FT                   /old_locus_tag="DEHA-IPF11966"
FT                   /old_locus_tag="DEHA-CDS1733.1"
FT   CDS_pept        complement(889191..890939)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11308g"
FT                   /old_locus_tag="DEHA0E11902g"
FT                   /old_locus_tag="DEHA-IPF11966"
FT                   /old_locus_tag="DEHA-CDS1733.1"
FT                   /product="DEHA2E11308p"
FT                   /note="similar to uniprot|P19145 Saccharomyces cerevisiae
FT                   YKR039W GAP1 General amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88039"
FT                   /db_xref="GOA:Q6BPS0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPS0"
FT                   /protein_id="CAG88039.1"
FT                   /translation="MSDKEDARSVVESAIGGSSSNDTGSNEKASSKWQNFRDSFKRPAE
FT                   EKEIEYGQNDNLNDIEKANIGASKSPLMRDLKNRHLQMIAIGGSVGTGLLIGSGSSLRT
FT                   GGPAALLIAWGLVGTMVFCTIHALGEMCVAFPVSGAFSSYATRFVDPSWGFAVGWNYAI
FT                   MWLIVLPLELVAAAMSIQYWDSTINPVAWVAIFYIFIFVINLFGVKGYGEAEFYLAIVK
FT                   IIAIIGFIILGIVLVCGGGPTHEFIGGKNFHNPGAFANGFKGVCTVFVTASYSLAGSEM
FT                   VGLAAAETANPKKTLPKAIKQVFWRIFLFYILSLTFIGLIVPYDSEELLGSSSTGSASP
FT                   FVIAIKIGGINALPSIFNAVILISVLSVGNSAVYGCSRTIQSLGAQGLGPKILNYVDRR
FT                   GRPLAGLAISGIFGLLCFLSAYENEGEVFTWLLSVSGLATIFSWFSIGLCHLRFRAALR
FT                   YQGRSTDELSFTSIAGIWGSIYSMIFLIVVLGVQFWVALFPIGSDGKPNVTSFFQNYLG
FT                   VFVILLFYVCHKVYSRNWKFYIKLSEIDLDTGRRETDVDLMNYEMEEDTIKEGVPMYLR
FT                   LWRSLV"
FT   gene            complement(<892075..>893406)
FT                   /locus_tag="DEHA2E11330g"
FT                   /old_locus_tag="DEHA0E11924g"
FT                   /old_locus_tag="DEHA-IPF11964"
FT                   /old_locus_tag="DEHA-CDS2789.1"
FT   CDS_pept        complement(892075..893406)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11330g"
FT                   /old_locus_tag="DEHA0E11924g"
FT                   /old_locus_tag="DEHA-IPF11964"
FT                   /old_locus_tag="DEHA-CDS2789.1"
FT                   /product="DEHA2E11330p"
FT                   /note="similar to ca|CA2533|IPF12790 Candida albicans
FT                   IPF12790 inositol polyphosphate 5-phosphatase (by
FT                   homology)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88040"
FT                   /db_xref="GOA:Q6BPR9"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR9"
FT                   /protein_id="CAG88040.2"
FT                   /translation="MTDTNENIPLYLLTYNCNKQKLDYDLVIPKIMESLPDQLSTLYVF
FT                   GLEELCSIIDGCFVENASNHLIKFNKFFIEALNRKYGTEDVKFHTIGMNHIGAIGIIAI
FT                   TPYPSKFHKLRLGRSGCGYGYSSMKGAAGIRLSYIPEGRHESTKSPVEMTFANFHLSAY
FT                   EGDHYFQKRNNEVNSLMRSMDFGDGYSLLKPRAHCFVMGDLNYRTTKKYDPNSASFNQL
FT                   LNLQDQSKLDHGDIEELVKNYDELTEERHNGNIFAGFSEACINFRPTYKYHLNTAIYNR
FT                   KRSPSWCDRILYQSTYKNNLSSVLSRKKESSPVLPQVHEYGSIQSILSSDHQPVYLSIT
FT                   VPTSPPESIISAHGYLQVLPSETPNNHFRHDTNDQGMDVSDESIIGATQIYMKSTVLDR
FT                   LIQGYIRKISDFSIGQGLWFSSTSKGRLALLLVALFCWGAYYVI"
FT   gene            <893531..>895087
FT                   /locus_tag="DEHA2E11352g"
FT                   /old_locus_tag="DEHA0E11946g"
FT                   /old_locus_tag="DEHA-IPF11963"
FT                   /old_locus_tag="DEHA-CDS2201.1"
FT   CDS_pept        893531..895087
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11352g"
FT                   /old_locus_tag="DEHA0E11946g"
FT                   /old_locus_tag="DEHA-IPF11963"
FT                   /old_locus_tag="DEHA-CDS2201.1"
FT                   /product="DEHA2E11352p"
FT                   /note="similar to uniprot|P19736 Saccharomyces cerevisiae
FT                   YDL030w PRP9 Subunit of the SF3a splicing factor complex
FT                   required for spliceosome assembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88041"
FT                   /db_xref="GOA:Q6BPR8"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031590"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR8"
FT                   /protein_id="CAG88041.2"
FT                   /translation="MSLLESQRSILEEIDVLEQSISQRVQRNPSLLPSSQKPSDVTISS
FT                   SKKRPLKEELLQQHELKFLKNKYRRHCSTVLGNKDTKRNHFEEESNKLKDPAYEFKLFD
FT                   SMLNDIKQHHELQTETNQAEDISKIYRMYSSAPRVEEKHNKKDELKVKRKYILSAAASH
FT                   IDFDGMFTPDELYGKYLDLFPFYETYKSIVDHNVTYVEYLSIYDQVPYEVVKRNNTAYS
FT                   KYIKDLAEYLLKFIEKVQPLSNIDELQEGMTKQFSASSKIQTDGKSNDRGEVYCEACDK
FT                   LFAKDSVYKGHLSGKKHQRNIKNRASSESDIPNSNRVKDLEFDEFKVRFLGEKLNDYRS
FT                   PTISNAERKAALTDRERIAETISIVGDESDYTTINSTSGGESDSNESSDNDEYNMKDLP
FT                   IGVDGKPIPYWLYKLQGYHKTYECEICGNTTYKGRAVFAKHFNSAKHQHGLGCLGISDD
FT                   YMALFKSIVKIDEALDLWRRLKKERRIKEGDTENAIEVEDEEGNVLSEKDYLELKKQGL
FT                   L"
FT   gene            <895282..>897030
FT                   /locus_tag="DEHA2E11374g"
FT                   /old_locus_tag="DEHA0E11968g"
FT                   /old_locus_tag="DEHA-IPF11962"
FT                   /old_locus_tag="DEHA-CDS1732.1"
FT   CDS_pept        895282..897030
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11374g"
FT                   /old_locus_tag="DEHA0E11968g"
FT                   /old_locus_tag="DEHA-IPF11962"
FT                   /old_locus_tag="DEHA-CDS1732.1"
FT                   /product="DEHA2E11374p"
FT                   /note="similar to uniprot|Q12362 Saccharomyces cerevisiae
FT                   YOL066c DRAP deaminase catalyzes the third step of the
FT                   riboflavin biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88042"
FT                   /db_xref="GOA:Q6BPR7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR7"
FT                   /protein_id="CAG88042.2"
FT                   /translation="MSKEEAKGVKRSPSPAEINPLLTPKLRDSLGFRMKRQTIDKRTLT
FT                   AYQQLGGEESNDDTNTLSKTKTIHEEEAEGASYTIDGRLRRVNPYFFTYLTYCKMRWRD
FT                   RKLLDIFVKEFRDRDADFYKKTIAAGQVTLNKKPADLDSIVRNGDLISHRCHRHEPSVS
FT                   SRGIKIVHEDENIIAIDKPSGIAVHPTGRYRYNTITKIFQHEFGKVVHPCNRLDRLTSG
FT                   LMFLGKNAKGADAFVQQIRDRTVKKEYIARVVGKFDIGDVEVDKPLKTVSPKHGLNRVD
FT                   FDEGKEAKTVFRRISYDPESDTSIVKCFPFTGRTHQIRVHLQYIGHAIANDPMYSNATV
FT                   WGKNLGKHGEGENADIISKLDRIGKDKASSTWIHPQEDGEILSGHLCDICSAELYTDPG
FT                   PNDLDLWLHAYKYEAADKTWSYKTEYPEWATSPHRKYMELALEMANKCGETQTQFNVGA
FT                   VLVNNGEVLATGHSRELPGNTHAEQCALEKYFEQTGKREVPAGTEIYTTMEPCSLRLSG
FT                   NLPCVDRILETNIKTCFVGVVEPDIFVKNNSGYTKLTERDVEYIHIPGYEELCLKIAKK
FT                   GHEKIE"
FT   gene            complement(<897067..>898680)
FT                   /locus_tag="DEHA2E11396g"
FT                   /old_locus_tag="DEHA0E11990g"
FT                   /old_locus_tag="DEHA-IPF11961"
FT                   /old_locus_tag="DEHA-CDS2055.1"
FT   CDS_pept        complement(897067..898680)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11396g"
FT                   /old_locus_tag="DEHA0E11990g"
FT                   /old_locus_tag="DEHA-IPF11961"
FT                   /old_locus_tag="DEHA-CDS2055.1"
FT                   /product="DEHA2E11396p"
FT                   /note="similar to ca|CA2530|IPF12782 Candida albicans
FT                   IPF12782 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88043"
FT                   /db_xref="GOA:Q6BPR6"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BPR6"
FT                   /protein_id="CAG88043.2"
FT                   /translation="MYWRSDEWQEEIYPACEQLSLPEGLLISQNTSFGSQFISRSIFQQ
FT                   KCYKHSVPMLNTNNGLMLNKFAGLLPIAEQTWHDFTGNSSKGSFAYSVVPVLYSISISA
FT                   VITWFLNIFVITNYTIKPSILLRASTTLSSIYLLITVIMAIIELHKQQKQGFLHGTKLF
FT                   DCINSSLALNIIDLIVVFLLQINQVQIIMRIFSRQKDKRLTFFVGIFASITSQVLWAIT
FT                   RFHSFSDDSEAGDILPAFQYLVRIAMGVCYAALVSVFVLMKINYIIANKKIWLITLLTV
FT                   ILIYGPVAFFIADVSNAWVFELSEIFSVVTYDICVVIPWEWCNKYNSIMKAKEKEGVLG
FT                   RKFYEDELYELDRFELFVDEEDEDHENNNNENDDESGNENDNERGNNDHNNRHGLSRNG
FT                   ENTHKGYRPVNFDGNDKGFGSIFETYRRTKETFLNITDHVIAKGLAIPRSASVFTGTPV
FT                   SAHNDEVFRMDNLNHKRDDPADMTLENQEDHRNTNRNNTIRFASNSDIHRTNNSTAQNR
FT                   RDVFVYSTREVIIDASDTET"
FT   gene            <898935..>900644
FT                   /locus_tag="DEHA2E11418g"
FT                   /old_locus_tag="DEHA0E12012g"
FT                   /old_locus_tag="DEHA-IPF11959"
FT                   /old_locus_tag="DEHA-CDS1816.1"
FT   CDS_pept        898935..900644
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11418g"
FT                   /old_locus_tag="DEHA0E12012g"
FT                   /old_locus_tag="DEHA-IPF11959"
FT                   /old_locus_tag="DEHA-CDS1816.1"
FT                   /product="DEHA2E11418p"
FT                   /note="similar to uniprot|P48566 Saccharomyces cerevisiae
FT                   YNL293W MSB3 GTPase-activating protein for Sec4p and
FT                   several other Rab GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88044"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR5"
FT                   /protein_id="CAG88044.2"
FT                   /translation="MVSAGENGRKYVSTLDPSVKVQGTNDLLSTPKANHQRSDSSYSNN
FT                   YSLLDIYEMESPHIGSPEVKDDGFIDRTMVNSNGDETMESVNDDTIEIQDDDIGCRESY
FT                   VKPTINANVEDLLHSQFDRYGFKKASTHHNITKEAYDQWFRDYSQYTLKRKKKWHFLMK
FT                   SNGLGLDSDEACPTRFPPKSDKVKKMVRKGIPAEWRGNAWFFYAGGHERLNKHIGVYEQ
FT                   IVRDTKDIHNKDIEVVERDLNRTFPDNIYFNDVIRNRPSSTSVNNTSTETHMIKSLRRV
FT                   LVAFAHYQPQIGYCQSLNFLAGLLLLFMEEERAFWLLVILTERIIPKVHSANLEGVHTD
FT                   QGVLMLCIKEYIPQLWSILGKNFEGETLSEDKILSRLPPVTLVTSSWFMSVFVGILPIE
FT                   STLRVWDILWYEGSKTIFRMSLTICKMCLDNPHFQNTKIEGGGGSEMEQIELFQFMQNF
FT                   PKTILDSNILIDNCFKKIGGYGFGSLSQDEINKCREFVSKQRAKLNSKKSSVTAEMSEE
FT                   ERKVLISTGTPFDYGDNDIHDVYGFNRSIMSGVTWNKNISNKMKKKFSRKSK"
FT   gene            <900783..>900950
FT                   /locus_tag="DEHA2E11440g"
FT                   /old_locus_tag="DEHA0E12034g"
FT                   /old_locus_tag="DEHA-IPF11958"
FT                   /old_locus_tag="DEHA-CDS8667.1"
FT   CDS_pept        900783..900950
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11440g"
FT                   /old_locus_tag="DEHA0E12034g"
FT                   /old_locus_tag="DEHA-IPF11958"
FT                   /old_locus_tag="DEHA-CDS8667.1"
FT                   /product="DEHA2E11440p"
FT                   /note="similar to uniprot|Q02820 Saccharomyces cerevisiae
FT                   YJL205C NCEO1 involved in non-classical protein export
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88045"
FT                   /db_xref="GOA:Q6BPR4"
FT                   /db_xref="InterPro:IPR024242"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR4"
FT                   /protein_id="CAG88045.1"
FT                   /translation="MQYPYLISRALDPVFAVSIGVASYYLYEQRTGRPDGHHLNELVVR
FT                   KYNSWVKPEK"
FT   gene            complement(<901159..>901809)
FT                   /locus_tag="DEHA2E11462g"
FT                   /old_locus_tag="DEHA0E12056g"
FT                   /old_locus_tag="DEHA-IPF11957"
FT                   /old_locus_tag="DEHA-CDS5191.1"
FT   CDS_pept        complement(901159..901809)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11462g"
FT                   /old_locus_tag="DEHA0E12056g"
FT                   /old_locus_tag="DEHA-IPF11957"
FT                   /old_locus_tag="DEHA-CDS5191.1"
FT                   /product="DEHA2E11462p"
FT                   /note="similar to ca|CA2536|IPF20107 Candida albicans
FT                   IPF20107 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88046"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR3"
FT                   /protein_id="CAG88046.2"
FT                   /translation="MSVATQNEREFASKFLQLLGLSADSKSDQFYSTADYHKLSSLGPT
FT                   LPKVQVALPKGESSQANTTENTAEVSLKSIKPPFKFSTQLTNVPVSHTVYKVKSDLIDS
FT                   LPLLKDANIKPTHLKLLVKGKVIPDTSSLTSLVNEDKTISFMCMVSQPTTESDVTADPT
FT                   DDKIDEVTPSSVKSDTLIVSESTWSKIYGVLIEDLGSEESANQALTKLKSGFN"
FT   gene            <901992..>902636
FT                   /locus_tag="DEHA2E11484g"
FT                   /old_locus_tag="DEHA0E12078g"
FT                   /old_locus_tag="DEHA-IPF11956"
FT                   /old_locus_tag="DEHA-CDS5201.1"
FT   CDS_pept        901992..902636
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11484g"
FT                   /old_locus_tag="DEHA0E12078g"
FT                   /old_locus_tag="DEHA-IPF11956"
FT                   /old_locus_tag="DEHA-CDS5201.1"
FT                   /product="DEHA2E11484p"
FT                   /note="some similarities with uniprot|P38166 Saccharomyces
FT                   cerevisiae YBL102W SFT2 and highly similar to
FT                   ca|CA2537|IPF20108 Candida albicans IPF20108"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88047"
FT                   /db_xref="GOA:Q6BPR2"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR2"
FT                   /protein_id="CAG88047.2"
FT                   /translation="MSFFKSFKKNQSNYSPLSQNDDGAPLPAPATNSNNSTPNSFKTRL
FT                   GKLNPFRNNSVYLEDDENYVTSEPGYFELSRWDRMLIFGLTFAGSVSCYLICIFLFPIL
FT                   SLKPRKFALLWSLGSIFFLVSFGVLQGFKAYMQHLFSSTRIIFTIVFVTSIILTLVSCL
FT                   SLRSTLLSIIFAVIQLISAIWYTVSYFPMGQQTLNLAGSVARSQVDGWIRS"
FT   gene            complement(<902676..>905090)
FT                   /locus_tag="DEHA2E11506g"
FT                   /old_locus_tag="DEHA0E12100g"
FT                   /old_locus_tag="DEHA-IPF11955"
FT                   /old_locus_tag="DEHA-CDS0821.1"
FT   CDS_pept        complement(902676..905090)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11506g"
FT                   /old_locus_tag="DEHA0E12100g"
FT                   /old_locus_tag="DEHA-IPF11955"
FT                   /old_locus_tag="DEHA-CDS0821.1"
FT                   /product="DEHA2E11506p"
FT                   /note="similar to uniprot|P12945 Saccharomyces cerevisiae
FT                   YDL040C NAT1 Subunit of the N-terminal acetyltransferase
FT                   NatA (Nat1p Ard1p Nat5p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88048"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR1"
FT                   /protein_id="CAG88048.1"
FT                   /translation="MFKPMSTLCPEYQVSLQQESEVEDMVVKRGPILANKEDSNFNEAL
FT                   KLYESKQYKKALKLVEQTLKKNSNHAESLGLKGCIYHFNGNKTEAEQYIVKAVSKAPEN
FT                   YLVDHLAGIYYRAVDNHREAAKWFKAAIDNGSPNKQILRDLSVMQVQIRDFKNLKESRQ
FT                   AYLESQPGYRANWTGVAVALHLNKNYAGAVSTLSKIEGIIKEHLQESDMYEHSECVLYK
FT                   NSIIGESGNFEKALEILDKDENEIKDKLSFMEYRAKYLVLLNRKKEASVIYRQLLQRNP
FT                   DNVEYYILLETALGTSGQSPDIRLKLYEKLAKFYPRSDPPKFLPLTFLPASHPSFVVKA
FT                   KEYILTQLQRGVPATFVNVKPLYKNKEKLAVIQEFVLDFFQNEAPKLIPTITVWTMYFL
FT                   AQHYLYLNDLLSAEKYIDQALVHSPTLVELYIVKGRVLKHLRRFEEASDVMEEGRKLDL
FT                   QDRFINSKATKYLLRANKVDEAISCISLFTKLDEDAVNGCKDLHLMQVNWVLTESAEAY
FT                   SRLYHQYEAQLAKIDKSDTDEETLAAESELIDKIELYKGLALKRYRAVIRIFKIFYADQ
FT                   FDFHSYCLRRGTPRDYIETLKWEDNIHSTPIYSRVLKGLSQIYFELYQQQQDQKLQNGQ
FT                   DSNEDIKFKKNNKKQKKAKAQNMKKKEDLISRVESEKNDRDPLGSQLLHELLTDSNGKL
FT                   LDNLFEMVKPLTEEAKNNRLTWELAFDLYCKEGKYILAMQAIKNLNKILDPYNEKKLRQ
FT                   IGEMVVNLSHASTVDSTANAAIAKVVGKGLSSAFPEFSELDKEGFLKVYSN"
FT   gene            <905315..>907711
FT                   /locus_tag="DEHA2E11528g"
FT                   /old_locus_tag="DEHA0E12122g"
FT                   /old_locus_tag="DEHA-IPF11953"
FT                   /old_locus_tag="DEHA-CDS0835.1"
FT   CDS_pept        905315..907711
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11528g"
FT                   /old_locus_tag="DEHA0E12122g"
FT                   /old_locus_tag="DEHA-IPF11953"
FT                   /old_locus_tag="DEHA-CDS0835.1"
FT                   /product="DEHA2E11528p"
FT                   /note="similar to ca|CA2539|IPF9188 Candida albicans
FT                   IPF9188 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88049"
FT                   /db_xref="GOA:Q6BPR0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPR0"
FT                   /protein_id="CAG88049.2"
FT                   /translation="MNNSLDEFRKEECGQTKGISKGRTKVACEFCRRRKIKCNGVKPCS
FT                   NCVNGGRENCTYPKRVEEKKTSTKNISNAKTVQSLYKRVASIESLLAKIASKFEETRNE
FT                   GVGNSEGKEEEMNKGFGVSNGRRSEENGSFSSETSSVNETGRSSCTEAAKSTLTQCFKS
FT                   YSIFCIFSKASISWMEQALGNKDEELVTLIRNMPMVFGDVLNSSTEMWLNANQGHQMSH
FT                   TPIPDSPVVFQLLEAYYENIHFATYICDLSYIREIFVRYYNQSFESSDKLKFSELLIMN
FT                   VSLALCLIDVQNHKDVDPEGLEADSFSEGHLYDLKTMFFNNAVFFYDKISVINEGIESV
FT                   QAIFLLVLYMELSHISDFRIIYMLSSVAIRYAQEMGLHRCESFQDCPEKEVALRRRLWN
FT                   FCHYSDIEFSYRCGKPPLINNYSVSTLTENDSYIFSVPMDPFMNTISNECMVSECQSKG
FT                   LQAYYGYFFLILNRIRVRSYESLFSVKAQKDILCSKEKVFQTLQSINDDMFRMASMMEP
FT                   EVRPTLHYDRRSDSRKNAKFQSLYDGECNIYKEHTLYLQLSFFSHLVTINRIPFLIDSY
FT                   ENDSVGFSLGNLGLDAARTVLKIILPLDKTSSSPSFFNGLLLHPFLSFSSLVIHCLSFP
FT                   ADSKTHNDCLLLIKASRKFFSHKSNSSAKEWANRRKHDSKATAADFIIRILLRLVVNVV
FT                   SFESGRNYFAEDDGLAEHFEQCKLIYPELFNENADHILDENNQILKLTQFFDPLVYSFN
FT                   DSCAKQNNDFVKSHSSKSNCPKTSNYRRSSLDNILNHSESCCGRP"
FT   gene            <907990..>910638
FT                   /locus_tag="DEHA2E11550g"
FT                   /old_locus_tag="DEHA0E12144g"
FT                   /old_locus_tag="DEHA-IPF11950"
FT                   /old_locus_tag="DEHA-CDS0638.1"
FT   CDS_pept        907990..910638
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11550g"
FT                   /old_locus_tag="DEHA0E12144g"
FT                   /old_locus_tag="DEHA-IPF11950"
FT                   /old_locus_tag="DEHA-CDS0638.1"
FT                   /product="DEHA2E11550p"
FT                   /note="similar to ca|CA2541|IPF9191.3f Candida albicans
FT                   IPF9191.3f unknown function 3-prime end"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88050"
FT                   /db_xref="GOA:Q6BPQ9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ9"
FT                   /protein_id="CAG88050.2"
FT                   /translation="MYSNSSKGEKPKKRIRVACDSCRRKKIKCDGQYPCGNCQQSNGSG
FT                   CNYKERQEKRAKSPRISKNASNSKTIEILNTRLSKLENVILNLAEKLEPGSGNITSPHE
FT                   KRISHSGETEGRQDDDDEKDEEDEEDEADEEDSTSIEDGNEEMATEGDEEEQGRNSDNT
FT                   DRDKSNKKWKYTPQRLEQFFGTHSVICLFSDKSLGWIESALGPEDSRLINPIRNLPFVF
FT                   YMKTKSFISKWVDPPLIDAAKKKKLLEAPFPKDYRLVFDLLDNYYDLYAATNFICDIDW
FT                   VRSLFEIYYGIDGKKRRKFKCSELIIMSMVICLCISRKIDEDTSDPNMSPASSCSANTP
FT                   ISIQSMNNDQLTVLQEELFDNCVFYYHRISVINDGIETIQAIILLVTYIESSYIISHVS
FT                   YMLISVAIRFAQEIGLHREESYANLSAQEAKTRKMIWWCCYCFDMEICFRSGKPPLING
FT                   LDISINLEKDFLFANARTYNSRNDQKLNDFDQAEKFNALFYYNFLLLTRIRAKSYNSLF
FT                   VASAETESFESLSLTLDALNMETFKLAESMDPILKPRFYNDPEFRNVYHSSDARHTKNI
FT                   LCMHFTYFSHLMVINRIPFLIGMPDSEQNNERSLSFRNLFLDSARTILAITTNMPREST
FT                   GLSFYNWVVFFPSAAFMSLSAACINHPTEPGTYDDIKLLADSCMNFFSHKKTWPVEGFS
FT                   RFKVYQSKDAIADLIIKVLLKIVIRVFETKTGISVLANNASLREHLESTERQFPDIFKG
FT                   TGDFISQFASSLKSSSFGTQGIVAFCGTSPFPSKKKYDNSHTVASHNSGESFDNQNSTG
FT                   KERNNGQNYGVSNNMSPDLSNLLHPSVNTNDFFMNDDLISDYLNDDGLTSIINSQMNNL
FT                   PNFFFDNNLGL"
FT   gene            <911296..>914025
FT                   /locus_tag="DEHA2E11572g"
FT                   /old_locus_tag="DEHA0E12166g"
FT                   /old_locus_tag="DEHA-IPF11948"
FT                   /old_locus_tag="DEHA-CDS0592.1"
FT   CDS_pept        911296..914025
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11572g"
FT                   /old_locus_tag="DEHA0E12166g"
FT                   /old_locus_tag="DEHA-IPF11948"
FT                   /old_locus_tag="DEHA-CDS0592.1"
FT                   /product="DEHA2E11572p"
FT                   /note="similar to ca|CA2541|IPF9191.3f Candida albicans
FT                   IPF9191.3f unknown function 3-prime end"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88051"
FT                   /db_xref="GOA:Q6BPQ8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ8"
FT                   /protein_id="CAG88051.2"
FT                   /translation="MYLNNSNNVTSKKRIRVACDTCRRKKIKCDGQYPCGNCQQLNGSG
FT                   CNYKEKQEKIVKPSSIPNRISNAKTIEILDTRLSKLENVILNLAERLEPRGDRNQNKKQ
FT                   NSRLVKRFEPRGDRNQNKKQNSRLVKENGRQSNDEESDDGDSISIDYGDEYEAEQDEEG
FT                   EEAGYDKERLNEKERNRESEPEEDRDKSNKKWNYTPQRLEQFFGTHSILCLFSDKSLGW
FT                   IESALGPEDSRLINPIRNLPFVFYMKTKSFISKWVDPPLIDAAKKKKLLEAPLPKDYRL
FT                   VFDLLDNYYDPYGATSFICDIDWVRSLFEIYYGIDGKKRRKFKCSELIIMSMVICLCIF
FT                   SKIDEDTSGSNMSPASSCSANTPVNIQSMNNDQLTVLQEELFDNCVFYYHRISVINDGI
FT                   ETIQAIILLVIYIESSYIISHVSYMLISVAIRFAQEIGLHREESYANLSAQECETRKMI
FT                   WWCCYCFDMEICFRSGKPPLINGLDISINLEKDFLFANAVGIESSNLSKNEKLNYLNHK
FT                   KRSNAQMQYYYLLLTRIRAKSYNSLFVASAQTESFEKLSFTLESLNREISKLGDSMGSL
FT                   MRPRFYNDPEFHNIYRQFEAPNLKDILILNFIYFSHLMIINRIPFLIGIPDCDETFEKG
FT                   LSFRNRFLDSARTILVIAKNMPRENIGISLYNWLVFFPSAAFMSLSAACINHPTAPGTY
FT                   DDVNLLIDSSMNFFSIKKAWPVEGFSRFKVYQSKEALVHLISKILLKIVIRVFETKTGI
FT                   QILANNELLREHLESTERQFPDIFKENRDFSSQFASVLKGSSFGTQGFIKIGGSSPFTS
FT                   VKSFNRSPNSSSSQEGNSSFGHQNNRGIGRNGNQSYEFSNNVSPNLSNPLNLNSSTNGN
FT                   LMNDESLPDYINDDGLSSIINFQMNSLPNFFFDNNLGL"
FT   gene            complement(<914238..>915953)
FT                   /locus_tag="DEHA2E11594g"
FT                   /old_locus_tag="DEHA0E12188g"
FT                   /old_locus_tag="DEHA-IPF11946"
FT                   /old_locus_tag="DEHA-CDS1804.1"
FT   CDS_pept        complement(914238..915953)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11594g"
FT                   /old_locus_tag="DEHA0E12188g"
FT                   /old_locus_tag="DEHA-IPF11946"
FT                   /old_locus_tag="DEHA-CDS1804.1"
FT                   /product="DEHA2E11594p"
FT                   /note="similar to uniprot|P15705 Saccharomyces cerevisiae
FT                   YOR027W STI1 Heat shock protein also induced by canavanine
FT                   and entry into stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88052"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ7"
FT                   /protein_id="CAG88052.2"
FT                   /translation="MSAEEFKAQGNQYFAAKDFTKAIEYFTKAIEASPTPNHVLYSNRS
FT                   ASYASLKNFKKALEDAEECVKVNDSWAKGYNRVASAQHGLGNLDEAKTSYKKALELDSN
FT                   NAMAKDGLKSVEDSERSRNSQPDMGLGAMFSDPNLITNLKNNPKTSELMKDPELVQKVV
FT                   NMQTNPQANATQFLSDPRLMTIMATLMGIDMDAPEPPQQQQPSQSAPKSETKQEPKSEP
FT                   KKESAPEPKDVEMEDVSSSSKADADAAKAEGNKLYKSKKFDEAIEQYNKAWESHNDITY
FT                   LNNRAAAEYEKGDYDTAIKTCETAIEQGREVRADYKLIAKSFARLGNTYLKKNDLQSAV
FT                   KYFDKSLTEHRTPDILNKLRATQRDIKIQEALSYVDPEKAEEARLQGKEYFTKGDWPNA
FT                   VKAYTEMVKRAPEDARGYSNRAAALAKLMSFPDAVQDCNKAIEKDPSFIRAYIRKANAQ
FT                   LAMREYSQVMETLNIAREKDLEVGEGKNVSEIDQLFNKASSQRFQALEGETPEQTMERV
FT                   SRDPEIVGILQDPVMQGILGQARENPAALQDHMRNPEVSKKINMLIAAGVIRTR"
FT   gene            complement(<916230..>917156)
FT                   /locus_tag="DEHA2E11616g"
FT                   /old_locus_tag="DEHA0E12210g"
FT                   /old_locus_tag="DEHA-IPF11945"
FT                   /old_locus_tag="DEHA-CDS4242.1"
FT   CDS_pept        complement(916230..917156)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11616g"
FT                   /old_locus_tag="DEHA0E12210g"
FT                   /old_locus_tag="DEHA-IPF11945"
FT                   /old_locus_tag="DEHA-CDS4242.1"
FT                   /product="DEHA2E11616p"
FT                   /note="similar to uniprot|P38749 Saccharomyces cerevisiae
FT                   YHL009C YAP3 bZIP transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88053"
FT                   /db_xref="GOA:Q6BPQ6"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ6"
FT                   /protein_id="CAG88053.2"
FT                   /translation="MEYNKASPLMDASYWDQELNNNNYLGEGMRLELNQQNVDIFNNAQ
FT                   YPSSNEDMLDDRPYKYANNESISTSSSPSGIVNSHLNSKANGIFSPVSVSEDKKKPKSK
FT                   KQFLNEQDAMLIAKDDSELNEEELQMKRKAQNRAAQRAFRERKETKLKELECKLAESEE
FT                   EKRRLLSQLNLAKQQNISISTENEYLKNKSSSEQNLVNKSDDTMNVVFPKNQRDFIYGL
FT                   AGNHEVNNYTINKVYENPEVPGRKLLAVGAVWDYLQLKSQESEKYENLDILEIMGRLKG
FT                   NERCHGYGPAYPLELVEQVVNECSVLR"
FT   gene            <918182..>918272
FT                   /locus_tag="DEHA2E11638r"
FT                   /old_locus_tag="Deha0E.11"
FT   tRNA            join(918182..918219,918236..918272)
FT                   /locus_tag="DEHA2E11638r"
FT                   /old_locus_tag="Deha0E.11"
FT                   /note="tRNA Phe (GAA) cove"
FT   gene            <918379..>919374
FT                   /locus_tag="DEHA2E11660g"
FT                   /old_locus_tag="DEHA0E12276g"
FT                   /old_locus_tag="DEHA-IPF11944"
FT                   /old_locus_tag="DEHA-CDS3897.1"
FT   CDS_pept        918379..919374
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11660g"
FT                   /old_locus_tag="DEHA0E12276g"
FT                   /old_locus_tag="DEHA-IPF11944"
FT                   /old_locus_tag="DEHA-CDS3897.1"
FT                   /product="DEHA2E11660p"
FT                   /note="similar to uniprot|Q9UUE4 Schizosaccharomyces pombe
FT                   Spbc17g9.05 putative peptidyl prolyl cis-trans isomerase
FT                   with RNA binding region"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88054"
FT                   /db_xref="GOA:Q6BPQ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR035538"
FT                   /db_xref="InterPro:IPR035542"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ5"
FT                   /protein_id="CAG88054.2"
FT                   /translation="MSVLLETTEGNIVIDLFIDQQPLACYNFLKLCKLNYYFFTPFYNL
FT                   HKDLIVSSGDPDYPENTDGDAINSFGDVNVNNTTVKQNKYLPVPNSQHEYVDNSIGLVS
FT                   FVTKKDTNGKDLVIGSQFTISLTENTENLKSFSQVYFGKVVEGFQVLEKINLSVVENLE
FT                   TRRLLKDIRITHTHNIYDPFPDPNFMHKKKSTEMPSDIQIANMRIPDLVSEESLEDSST
FT                   YSALALELMDDLPHYQIKPSPRTLFVAKLNPITTSESLNIIFNRFGKVINCNVVADHKT
FT                   NKSLCYGFVEFEDKQQADQAYSKLKDGCIIDGRNVVIDFSQSVKNMKLQR"
FT   gene            complement(<919570..>920088)
FT                   /locus_tag="DEHA2E11682g"
FT                   /old_locus_tag="DEHA0E12298g"
FT                   /old_locus_tag="DEHA-IPF11942"
FT                   /old_locus_tag="DEHA-CDS5700.1"
FT   CDS_pept        complement(919570..920088)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11682g"
FT                   /old_locus_tag="DEHA0E12298g"
FT                   /old_locus_tag="DEHA-IPF11942"
FT                   /old_locus_tag="DEHA-CDS5700.1"
FT                   /product="DEHA2E11682p"
FT                   /note="similar to uniprot|P53849 Saccharomyces cerevisiae
FT                   YNL255C GIS2 Putative zinc finger protein proposed to be
FT                   involved in the RAS/cAMP signaling pathway and highly
FT                   similar to ca|CA2534|IPF12793 Candida albicans IPF12793"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88055"
FT                   /db_xref="GOA:Q6BPQ4"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ4"
FT                   /protein_id="CAG88055.1"
FT                   /translation="MAAVFPRSCYKCGEAGHLADNCQQEQRLCYNCRQPGHESNDCPAP
FT                   KQATQKQCYSCGDLGHVQSDCPTQSQGAKCYNCGQFGHISKNCTEAGNESAKKPASSKL
FT                   QKPATTCYKCGGPNHYARDCQAGVVKCYACGKTGHISKDCNSASGGEFTSKTCYNCGKS
FT                   GHISKECDE"
FT   gene            complement(<920223..>922595)
FT                   /locus_tag="DEHA2E11704g"
FT                   /old_locus_tag="DEHA0E12320g"
FT                   /old_locus_tag="DEHA-IPF11941"
FT                   /old_locus_tag="DEHA-CDS0863.1"
FT   CDS_pept        complement(920223..922595)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11704g"
FT                   /old_locus_tag="DEHA0E12320g"
FT                   /old_locus_tag="DEHA-IPF11941"
FT                   /old_locus_tag="DEHA-CDS0863.1"
FT                   /product="DEHA2E11704p"
FT                   /note="similar to uniprot|P53848 Saccharomyces cerevisiae
FT                   YNL256W FOL1 Multifunctional enzyme of the folic acid
FT                   biosynthesis pathway has dihydropteroate synthetase
FT                   dihydro-6-hydroxymethylpterin pyrophosphokinase and
FT                   dihydroneopterin aldolase activities"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88056"
FT                   /db_xref="GOA:Q6BPQ3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ3"
FT                   /protein_id="CAG88056.2"
FT                   /translation="MLQDTVFINNLASIAITGKDAWNRPTPQPITISVSLNTDFHQASV
FT                   TDNLKYSLNYAVISRNIAEYMKANEHRNFKSLGSIAESVGEIVLDDKKGGGHQAVVSIK
FT                   SNKSEIRTDSIEYKICRSRIEDIESPDEINVYGLKLLTVIGVFTFERLQKQIVDINISI
FT                   KLERNANISIHKIIDELTLYVESSNFKTVEALVMKIGQLVMQNHGDGIQNVSATVTKPN
FT                   AITFTDGVGVSSNMSKASFKDVDPITDIGINVNSVPNFNLPISVEDSTFNKYEEHIAYI
FT                   AIGSNQENQLSNINNALQLLSSYDIKLLATSSLYISKPMYFKDQPDFYNGAIKVSFKDK
FT                   TPHELLKALKQIEYDHVKRVKEFENGPRTIDLDILLIDDIILNTDDLIVPHKSMLERTF
FT                   VLQPLCELFGPDVLHPLSAEPLHNHSRQLFTSETNESIQESSNLLQIVPIPRLPDASNP
FT                   LKFDHVENKRKTLIMGILNMTPDSFSDGGKNYHKSINEILENANQLIEQGADILDIGGV
FT                   STRPGSVEPSVQEELDRLLPVVRAIRESSNNALSQCVISIDTYRAKIAEECLLAGADVI
FT                   NDISMGLYDDCMFDVVAKYGCPYIMNHTRGTPQTMSKLTTYESNTNEDIIEYLTDPVTG
FT                   HHISLPKPDVENLINGVSRELGLQIFKAFSKGVKKWQVVLDPGIGFAKNVSQNISVIKH
FT                   ASAFKNYSMLLNKRDDDNHINHSYVSFNGLCTLLGPSRKKFLGTICNEPVASERVISTA
FT                   ASVMACIQQNTDIIRVHDVSEMKKTCLTGDAIYKGIY"
FT   gene            complement(<922913..>924295)
FT                   /locus_tag="DEHA2E11726g"
FT                   /old_locus_tag="DEHA0E12342g"
FT                   /old_locus_tag="DEHA-IPF11939"
FT                   /old_locus_tag="DEHA-CDS2494.1"
FT   CDS_pept        complement(922913..924295)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11726g"
FT                   /old_locus_tag="DEHA0E12342g"
FT                   /old_locus_tag="DEHA-IPF11939"
FT                   /old_locus_tag="DEHA-CDS2494.1"
FT                   /product="DEHA2E11726p"
FT                   /note="weakly similar to ca|CA0312|IPF6396 Candida albicans
FT                   IPF6396 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88057"
FT                   /db_xref="InterPro:IPR028094"
FT                   /db_xref="InterPro:IPR039024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ2"
FT                   /protein_id="CAG88057.2"
FT                   /translation="MAASKQYLSLSNSKSRSPESKSITLPNLKKDESIVHLHDRSDLFS
FT                   NSRRTGPSNGRKRKSQPIIVNNLVKKKPRKQKKPRVSFSSSPIKISRQQSNDDMKDIDF
FT                   NILDTFNKKRYQYDPDYNSPNSNIDTHNINNSDSETETQLINLKQLSSSPAKSQEHNNE
FT                   KDVQILDKLIEANSNKYEDYMEKVRKNEGEFASSDDDFAVEMMKGNILSTMENRKQASM
FT                   EAVRLKFKDKDYPKPISSKKSLLTRTEAHLYIIPQILKGKLETSIFYDMAKSISESSSH
FT                   ETMTHKEKWKINWQEFFGGYYGFKRQSFIASIILSRHKKDLQNAANRNKTVSYWTISGF
FT                   STFVLANEIVIRFVMHDFDCTISEAEKIIKESSEYGTVISDSTELIDDLNIGELLNDES
FT                   KEFMKGITLDDTKSSEVDENSDDESKTKTMEYESQPDFNDTKQSKTDILDQFLGTSSDE
FT                   DD"
FT   gene            complement(<924449..>926416)
FT                   /locus_tag="DEHA2E11748g"
FT                   /old_locus_tag="DEHA0E12364g"
FT                   /old_locus_tag="DEHA-IPF11937"
FT                   /old_locus_tag="DEHA-CDS1318.1"
FT   CDS_pept        complement(924449..926416)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11748g"
FT                   /old_locus_tag="DEHA0E12364g"
FT                   /old_locus_tag="DEHA-IPF11937"
FT                   /old_locus_tag="DEHA-CDS1318.1"
FT                   /product="DEHA2E11748p"
FT                   /note="similar to uniprot|P53617 Saccharomyces cerevisiae
FT                   YNL251C NRD1 RNA-binding protein that interacts with the
FT                   C-terminal domain of the RNA polymerase II large subunit
FT                   (Rpo21p) required for transcription termination and 3' end
FT                   maturation of nonpolyadenylated RNAs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88058"
FT                   /db_xref="GOA:Q6BPQ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ1"
FT                   /protein_id="CAG88058.2"
FT                   /translation="MSAVEQFETILKELPTLKAPGVSGSRIKKLTDLAVKNVSEESKLI
FT                   TILYSNCKAAPSSHKLGTLYVVDSIVRIFIEEAKKQNQEITSSAPEGTYASAIYKISEL
FT                   VEPLIDDAMELSVSKSQSIKIGKLVDIWERAETFKPEIINKIRSKHFSSTTPPGSPPGN
FT                   NSEPAKQPESNSNDSGSILSALASLAKKSNSNSSTPTTASAVPAQQPPQPQQPSGNNAN
FT                   DILSQLSAMAGSNGAAPQQNNAPQPAQSAPNEQYIFNMLQQMQNGSASLPPIPQQQPRQ
FT                   TGQPDYGTGRRGRNDDNVTSYSRRNRSRSPNRFGQNNRRDRSPPRQQFQQPFQQQIPQQ
FT                   FPTQQSPMPQIPGGPPDFNAPNEMNGEMNLPGTPHYRPRNVGFDQSLPQGSFKVLSRTL
FT                   FIGGVPRNMDEKELASVLRPYAEVQSVILNSERKHAFVKVYSRREAEQVITSFNKDNAL
FT                   PLRTRWGVGFGPRDCCNYQHGISIIPIQRLTDADRAWVVQAQWGGTGGQPLSSGMVIDE
FT                   PDIEIGTGISSKAMSKKMPTNSARNGPKSNKPGEPDEDYVKTTLIPQQNASMSHGAQPD
FT                   FTTLTQSSVNPLSGLFGNSNSPNPGFSMPSQPAQPAQPAQGNFPQANDFMNTLNQGGGN
FT                   PNLSAQLANFFQNGGMNQPQ"
FT   gene            <927014..>927835
FT                   /locus_tag="DEHA2E11770g"
FT                   /old_locus_tag="DEHA0E12386g"
FT                   /old_locus_tag="DEHA-IPF11935"
FT                   /old_locus_tag="DEHA-CDS4534.1"
FT   CDS_pept        927014..927835
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11770g"
FT                   /old_locus_tag="DEHA0E12386g"
FT                   /old_locus_tag="DEHA-IPF11935"
FT                   /old_locus_tag="DEHA-CDS4534.1"
FT                   /product="DEHA2E11770p"
FT                   /note="similar to uniprot|P36528 Saccharomyces cerevisiae
FT                   YNL252c MRPL17 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88059"
FT                   /db_xref="GOA:Q6BPQ0"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="InterPro:IPR040008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPQ0"
FT                   /protein_id="CAG88059.2"
FT                   /translation="MLSRSIIRAYSTQASSSLISSTLLLSRQPVLTADLPEFENQYYKY
FT                   QNELWKRLMWTFPKWFYYREGTLSEQNYRELNKNPTFNNPNIEFPRGRPEIRHQRDRRF
FT                   KQEIELPKTYKEAKEGEEDDFEVTPADDLSRKIVPNSRVTDADKSGDLTSLERKLSRTL
FT                   YLVINKEDKWILPNFSEGASEKLTPLHKLAEEGLYKIGGDKINYFNVSNKPCHLYKNDD
FT                   TREYFIKSHILSGKFEPQEPALKYMWLTKGELNSYLNKDYYKDIKHLLNDV"
FT   gene            complement(<927930..>929138)
FT                   /locus_tag="DEHA2E11792g"
FT                   /old_locus_tag="DEHA0E12408g"
FT                   /old_locus_tag="DEHA-IPF11933"
FT                   /old_locus_tag="DEHA-CDS3157.1"
FT   CDS_pept        complement(927930..929138)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11792g"
FT                   /old_locus_tag="DEHA0E12408g"
FT                   /old_locus_tag="DEHA-IPF11933"
FT                   /old_locus_tag="DEHA-CDS3157.1"
FT                   /product="DEHA2E11792p"
FT                   /note="similar to uniprot|P39727 Saccharomyces cerevisiae
FT                   YAL042W ERV46 Protein localized to COPII-coated vesicles
FT                   involved in the membrane fusion stage of transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88060"
FT                   /db_xref="GOA:Q6BPP9"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPP9"
FT                   /protein_id="CAG88060.2"
FT                   /translation="MSSRPKLISIDVFAKTVEDAKIKTASGGIITLVCIFIVMFLIRNE
FT                   YKDYTSIITRPELVVDRDINTKLDINLDVSFPNMPCDVLTLDILDISGDLQLDILKSGF
FT                   QKYRILKESNHEILDEAPVLSNDLSLEEMAKGVGANGKCGPCYGALPQDNNEYCCNSCE
FT                   TVKLAYAEKMWAFYDGKDIEQCENEGYVSRLTERINNNEGCRVKGTAQINRISGNLHFA
FT                   PGSSSTAPGRHIHDLSLFEKYEDKFNFDHVINHFSFGSDPHDNNLQQSTHPLDNHQLVF
FT                   DEKYHVASYYLKVVATRFEFIDTSLPLDTNQFSVISHHRPLRGGKDEDHKHTLHARGGL
FT                   PGVFFHFEISPMKIINKEQYAKTWSGFILGVISSVAGVLMVGTVLDRSVWAAEKAIKGK
FT                   KDM"
FT   gene            <929285..>930352
FT                   /locus_tag="DEHA2E11814g"
FT                   /old_locus_tag="DEHA0E12430g"
FT                   /old_locus_tag="DEHA-IPF11931"
FT                   /old_locus_tag="DEHA-CDS3615.1"
FT   CDS_pept        929285..930352
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11814g"
FT                   /old_locus_tag="DEHA0E12430g"
FT                   /old_locus_tag="DEHA-IPF11931"
FT                   /old_locus_tag="DEHA-CDS3615.1"
FT                   /product="DEHA2E11814p"
FT                   /note="similar to ca|CA3430|IPF6382 Candida albicans
FT                   IPF6382 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88061"
FT                   /db_xref="GOA:Q6BPP8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPP8"
FT                   /protein_id="CAG88061.2"
FT                   /translation="MSLTNNRTFFKNFIPVVIKDSAIAGGSSSEIIHISINLTGTRLVN
FT                   SRTDRSIRIWKCTPERLIDPVIIEHPHLKAVERVAWNPKTEFSFATVGRDDLVKIWRCT
FT                   GSLEKELTIVKNGNTNGSGTETICQVVAYSNDGEILTVVDRDATVLLYSVSNNYAKLQE
FT                   FQLNDHIYDISWFHHGHSFFMCALHDGSVPIYKITDVLSDANGSSQVNGSADTDNSNSI
FT                   TIDLKHKLSGHRSSATCVVVDPRGKYFAVGSNEGVVSLWNTSSMLISKVLTNTDEAIAN
FT                   IDISRDGTYVAVAYDSGENIKIFDYDTTEQVYEVPNSNSGNLALSHVAWFPSKTAFVHT
FT                   SDNGRTMTLMKKPGK"
FT   gene            <930916..>933381
FT                   /locus_tag="DEHA2E11836g"
FT                   /old_locus_tag="DEHA0E12452g"
FT                   /old_locus_tag="DEHA-IPF11929"
FT                   /old_locus_tag="DEHA-CDS0639.1"
FT   CDS_pept        930916..933381
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11836g"
FT                   /old_locus_tag="DEHA0E12452g"
FT                   /old_locus_tag="DEHA-IPF11929"
FT                   /old_locus_tag="DEHA-CDS0639.1"
FT                   /product="DEHA2E11836p"
FT                   /note="similar to uniprot|P11433 Saccharomyces cerevisiae
FT                   YAL041W CDC24 Guanine nucleotide exchange factor (GEF or
FT                   GDP-release factor) required for polarity establishment and
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88062"
FT                   /db_xref="GOA:Q6BPP7"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010481"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033511"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPP7"
FT                   /protein_id="CAG88062.2"
FT                   /translation="MMDANTQAPRPQFRSISTTSNLSLSSSSSSITRVASAPIQAMGNS
FT                   FNRAANSEDSLYYQSSRLKQRLESIEEMKPFLAAAFEVAEQSAEQQALALSQQLQEEAI
FT                   SSGDNEFRASMGSGGFSIHSDTSSMTSVGTNSSPGNANNNIFTFTAGVLPANIGVDPAT
FT                   HLWKMFQQGSSLCALFNCVVSDYSIPIVGSDDLRVCKKSVYDFLIAVKMHLNFEDDSMF
FT                   TISDVFSDNTHDLLKVLKVVNKLVSLKTSKNPVNFEVGQLAIGELAISDDRSKVLKEMI
FT                   ETERKYVQDLELLLAYRNDLQNAELVSSESIHILFPNLNEIIDFQRRFLNGLECNVNIP
FT                   HRYQRIGSIFIHAAGGPFRAYEPWTIGQISAIDLINKESINLKKSSTLLDPGFELQSYI
FT                   IKPIQRLCKYPLLLKELIKNSPESISDSNNSHSAAYNELILANSAVKEVANQVNEAQRR
FT                   SENVGYLQSLIERVNNWRGFNLKDQGELLHHGVVGVKDAENEKEYFAYLFEKIIFFFID
FT                   GSNTSKDKEGKKKRDILSSRKKSQSSSTTNLLDTLNHAKDKYLLELKGRVYISEIYNIS
FT                   ISNSQGYTLVISWSGKKESGSFTLRYRTEELRNQWEKCLRTLKTNEMNNQIHRKLRDSH
FT                   GSLLTNDSSGYDGSYGHNSHDGYSSRSSNGSTYQRHHSSSSTFSMMRQSRSKSSSDHQN
FT                   TRTSSSSLSNSANNAFSDKNEHSFSSASSGSSMVAIKLVYNKIEIQGILLVSTSIQFTD
FT                   LHSKISSKIAASNEVNDDILVNKLKYKDEDGDFVVMDSNDDWTLAIDTLDELNENNESD
FT                   ERIVTIWAS"
FT   gene            <933736..>935691
FT                   /locus_tag="DEHA2E11858g"
FT                   /old_locus_tag="DEHA0E12474g"
FT                   /old_locus_tag="DEHA-IPF11928"
FT                   /old_locus_tag="DEHA-CDS1348.1"
FT   CDS_pept        933736..935691
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11858g"
FT                   /old_locus_tag="DEHA0E12474g"
FT                   /old_locus_tag="DEHA-IPF11928"
FT                   /old_locus_tag="DEHA-CDS1348.1"
FT                   /product="DEHA2E11858p"
FT                   /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
FT                   YOR356W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88063"
FT                   /db_xref="GOA:Q6BPP6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPP6"
FT                   /protein_id="CAG88063.2"
FT                   /translation="MLKTKNCLALRHFVKKNNIVKHLSTRSLLVPLKPTTHRLQTIRKF
FT                   ASTTRIRNETEEQLNHNNEIPFERLSEEEQATLKDERAADSVDVCIVGGGPAGLVTAIK
FT                   LKLLDNEQGTGELRVVVLEKAGDFGAHIVSGAVIEPKALKELFPDSEFLNEDGSGIPLP
FT                   DDLVTMVESDTMKYLTNEYAYPMPEPPQLVNHGKNYIVSLNNVVKFLAEKAEELGVELY
FT                   PGISVSEVIYNEKGDAIKGVATKDMGISKTGAPKDSFERGMEFHARMTVLGEGCHGSLT
FT                   KEVISRYNLRENSEPQTYGLGIKEVWEVKPENFEKGAVAHTMGYPLSSDVYGGGFMYHF
FT                   GDGLVTVGLVVGLDYANPYISPYQEFQKMKLHPFYSNVLEGGKCLSYAARALNEGGFQS
FT                   VPQLYFPGGILVGCSAGFVNVPKIKGTHTAMKSGILAAETIFNEVKSLDPVEEGTLDDA
FT                   EPIVLKSYEEAYEKSWIYDELNEVRNVRPSFNGPLGFLGGLIHSGLSTMFTRGHEPWTL
FT                   SHHSTDAAATKDASNYEPIEYPKPDGKITFDLLTSVSRTGTYHDDDEQCHLRIPDQDYR
FT                   KHASISYPKFKGVEQRFCPAGVYEYTEDENEPLGVKFQINSQNCIHCKTCDIKVPTQDI
FT                   NWTVPEGGGGPKYYMT"
FT   gene            complement(<936183..>937727)
FT                   /locus_tag="DEHA2E11880g"
FT                   /old_locus_tag="DEHA0E12496g"
FT                   /old_locus_tag="DEHA-IPF11926"
FT                   /old_locus_tag="DEHA-CDS2232.1"
FT   CDS_pept        complement(936183..937727)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11880g"
FT                   /old_locus_tag="DEHA0E12496g"
FT                   /old_locus_tag="DEHA-IPF11926"
FT                   /old_locus_tag="DEHA-CDS2232.1"
FT                   /product="DEHA2E11880p"
FT                   /note="similar to uniprot|P41913 Saccharomyces cerevisiae
FT                   YOR355W GDS1 Protein of unknown function required for
FT                   growth on glycerol as a carbon source"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BPP5"
FT                   /protein_id="CAG88064.2"
FT                   /translation="MALADRRPLGFPVTSTPASPAFNPKTLSLNSSASTSSSDNDMTQG
FT                   FKSSMDDLKGKLSESDIKPLTPEKSLSPVELSPTSRSISPDSLMNSDSYRKLNATTIAP
FT                   SSTTSITSNSSRGSSPSINSSGSNVNALKKPKNTSRAPIATGISTTIPVTGEKPKPSQK
FT                   DDPSLEDDVLYAIFVILYEKDPEGSGMTVKQICDILVEQHPDMANLSTKTSNLVSAKLN
FT                   AYVKRVEKGDSSLKYALSRDWADASPKRMVYVYRGLLTEDFHLHVKNVMEVQKQQHNQI
FT                   ESPSSSKIDEPSSLEADKQANLLKPRRQTMFDLGVTKNTFLESALDKSNLVVPYFSAPV
FT                   TASLTETNSESKKITSNNQQESDLEFEEFEVFNDIEDDDEENDINLDMNDMYIDSFRKN
FT                   GKRSKSLSYLSSNKKPKILTAAAAAPRAPRTPSSHNANAAAAAAALHAAAFKAISAPSS
FT                   QSSESLLKSNASSSVNTNVGCPSNKKWLNVVRSGFLTQDIGTPEEISLSDLDKFFT"
FT   gene            <938737..>939018
FT                   /locus_tag="DEHA2E11902g"
FT                   /old_locus_tag="IPF_43058"
FT   CDS_pept        938737..939018
FT                   /transl_table=12
FT                   /locus_tag="DEHA2E11902g"
FT                   /old_locus_tag="IPF_43058"
FT                   /product="DEHA2E11902p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2E11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR65806"
FT                   /db_xref="UniProtKB/TrEMBL:B5RTZ4"
FT                   /protein_id