(data stored in ACNUC22857 zone)

EMBL: CR382138

ID   CR382138; SV 2; linear; genomic DNA; STD; FUN; 2305761 BP.
XX
AC   CR382138;
XX
PR   Project:PRJNA13832;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 11)
XX
DE   Debaryomyces hansenii CBS767 chromosome F complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Debaryomyces hansenii CBS767
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Debaryomycetaceae; Debaryomyces.
XX
RN   [1]
RP   1-2305761
RA   Genoscope - CEA;
RT   ;
RL   Submitted (15-SEP-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-2305761
RX   DOI; 10.1038/nature02579.
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine I.,
RA   de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N., Frangeul L.,
RA   Aigle M., Anthouard V., Babour A., Barbe V., Barnay S., Blanchin S.,
RA   Beckerich J.M., Beyne E., Bleykasten C., Boisrame A., Boyer J.,
RA   Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.M., Nikolski M., Oztas S.,
RA   Ozier-Kalogeropoulos O., Pellenz S., Potier S., Richard G.F., Straub M.L.,
RA   Suleau A., Swennene D., Tekaia F., Wesolowski-Louvel M., Westhof E.,
RA   Wirth B., Zeniou-Meyer M., Zivanovic I., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.L.;
RT   "Genome evolution in yeasts";
RL   Nature 430(6995):35-44(2004).
XX
RN   [3]
RP   1-2305761
RA   Casaregola S., Val M.E., Neuveglise C., Talla E., Martin T., Durrens P.,
RA   Barbe V., Bleykasten C., Bon E., Despons L., Fritsch E., Groppi A.,
RA   Iragne F., Jauniaux N., Leh V., de Montigny J., Pottier S., Straub M.L.,
RA   Wirth B., Wincker P., Sherman D.J., Gaillardin C., Souciet J.L.;
RT   "The second release of the complete genome of Debaryomyces hansenii type
RT   strain CBS767";
RL   Unpublished.
XX
DR   MD5; 4c87699bb5a4a340c953413afca64c97.
DR   BioSample; SAMEA3138183.
DR   CABRI; CBS 767.
DR   EnsemblGenomes-Gn; DEHA2F02310r.
DR   EnsemblGenomes-Gn; DEHA2F02332r.
DR   EnsemblGenomes-Gn; DEHA2F04730r.
DR   EnsemblGenomes-Gn; DEHA2F04950r.
DR   EnsemblGenomes-Gn; DEHA2F05214r.
DR   EnsemblGenomes-Gn; DEHA2F05500r.
DR   EnsemblGenomes-Gn; DEHA2F05940r.
DR   EnsemblGenomes-Gn; DEHA2F06336r.
DR   EnsemblGenomes-Gn; DEHA2F06358r.
DR   EnsemblGenomes-Gn; DEHA2F06952r.
DR   EnsemblGenomes-Gn; DEHA2F06974r.
DR   EnsemblGenomes-Gn; DEHA2F07216r.
DR   EnsemblGenomes-Gn; DEHA2F09042r.
DR   EnsemblGenomes-Gn; DEHA2F09218r.
DR   EnsemblGenomes-Gn; DEHA2F10186r.
DR   EnsemblGenomes-Gn; DEHA2F11264r.
DR   EnsemblGenomes-Gn; DEHA2F12056r.
DR   EnsemblGenomes-Gn; DEHA2F12254r.
DR   EnsemblGenomes-Gn; DEHA2F13662r.
DR   EnsemblGenomes-Gn; DEHA2F14388r.
DR   EnsemblGenomes-Gn; DEHA2F17974r.
DR   EnsemblGenomes-Gn; DEHA2F18084r.
DR   EnsemblGenomes-Gn; DEHA2F21296r.
DR   EnsemblGenomes-Gn; DEHA2F21714r.
DR   EnsemblGenomes-Gn; DEHA2F21780r.
DR   EnsemblGenomes-Gn; DEHA2F23034r.
DR   EnsemblGenomes-Gn; DEHA2F23056r.
DR   EnsemblGenomes-Gn; DEHA2F23936r.
DR   EnsemblGenomes-Gn; DEHA2F24376r.
DR   EnsemblGenomes-Gn; DEHA2F24684r.
DR   EnsemblGenomes-Gn; ENSRNA049506652.
DR   EnsemblGenomes-Gn; ENSRNA049506658.
DR   EnsemblGenomes-Gn; ENSRNA049506683.
DR   EnsemblGenomes-Gn; ENSRNA049506703.
DR   EnsemblGenomes-Gn; ENSRNA049506730.
DR   EnsemblGenomes-Gn; ENSRNA049506755.
DR   EnsemblGenomes-Gn; ENSRNA049506776.
DR   EnsemblGenomes-Gn; ENSRNA049506785.
DR   EnsemblGenomes-Gn; ENSRNA049506803.
DR   EnsemblGenomes-Gn; ENSRNA049559088.
DR   EnsemblGenomes-Gn; ENSRNA049559161.
DR   EnsemblGenomes-Gn; ENSRNA049559205.
DR   EnsemblGenomes-Gn; ENSRNA049559253.
DR   EnsemblGenomes-Gn; ENSRNA049559282.
DR   EnsemblGenomes-Gn; ENSRNA049559321.
DR   EnsemblGenomes-Gn; ENSRNA049559359.
DR   EnsemblGenomes-Gn; ENSRNA049559420.
DR   EnsemblGenomes-Gn; ENSRNA049559460.
DR   EnsemblGenomes-Gn; ENSRNA049559513.
DR   EnsemblGenomes-Gn; ENSRNA049559566.
DR   EnsemblGenomes-Gn; ENSRNA049559601.
DR   EnsemblGenomes-Gn; ENSRNA049559641.
DR   EnsemblGenomes-Gn; ENSRNA049559696.
DR   EnsemblGenomes-Gn; ENSRNA049559750.
DR   EnsemblGenomes-Gn; ENSRNA049559789.
DR   EnsemblGenomes-Gn; ENSRNA049559834.
DR   EnsemblGenomes-Gn; ENSRNA049559861.
DR   EnsemblGenomes-Gn; ENSRNA049559911.
DR   EnsemblGenomes-Gn; ENSRNA049559954.
DR   EnsemblGenomes-Gn; ENSRNA049560005.
DR   EnsemblGenomes-Gn; ENSRNA049560027.
DR   EnsemblGenomes-Gn; ENSRNA049560059.
DR   EnsemblGenomes-Gn; ENSRNA049560123.
DR   EnsemblGenomes-Gn; ENSRNA049560168.
DR   EnsemblGenomes-Gn; ENSRNA049560206.
DR   EnsemblGenomes-Gn; ENSRNA049560246.
DR   EnsemblGenomes-Gn; ENSRNA049560289.
DR   EnsemblGenomes-Gn; ENSRNA049560317.
DR   EnsemblGenomes-Tr; DEHA2F02310r-1.
DR   EnsemblGenomes-Tr; DEHA2F02332r-1.
DR   EnsemblGenomes-Tr; DEHA2F04730r-1.
DR   EnsemblGenomes-Tr; DEHA2F04950r-1.
DR   EnsemblGenomes-Tr; DEHA2F05214r-1.
DR   EnsemblGenomes-Tr; DEHA2F05500r-1.
DR   EnsemblGenomes-Tr; DEHA2F05940r-1.
DR   EnsemblGenomes-Tr; DEHA2F06336r-1.
DR   EnsemblGenomes-Tr; DEHA2F06358r-1.
DR   EnsemblGenomes-Tr; DEHA2F06952r-1.
DR   EnsemblGenomes-Tr; DEHA2F06974r-1.
DR   EnsemblGenomes-Tr; DEHA2F07216r-1.
DR   EnsemblGenomes-Tr; DEHA2F09042r-1.
DR   EnsemblGenomes-Tr; DEHA2F09218r-1.
DR   EnsemblGenomes-Tr; DEHA2F10186r-1.
DR   EnsemblGenomes-Tr; DEHA2F11264r-1.
DR   EnsemblGenomes-Tr; DEHA2F12056r-1.
DR   EnsemblGenomes-Tr; DEHA2F12254r-1.
DR   EnsemblGenomes-Tr; DEHA2F13662r-1.
DR   EnsemblGenomes-Tr; DEHA2F14388r-1.
DR   EnsemblGenomes-Tr; DEHA2F17974r-1.
DR   EnsemblGenomes-Tr; DEHA2F18084r-1.
DR   EnsemblGenomes-Tr; DEHA2F21296r-1.
DR   EnsemblGenomes-Tr; DEHA2F21714r-1.
DR   EnsemblGenomes-Tr; DEHA2F21780r-1.
DR   EnsemblGenomes-Tr; DEHA2F23034r-1.
DR   EnsemblGenomes-Tr; DEHA2F23056r-1.
DR   EnsemblGenomes-Tr; DEHA2F23936r-1.
DR   EnsemblGenomes-Tr; DEHA2F24376r-1.
DR   EnsemblGenomes-Tr; DEHA2F24684r-1.
DR   EnsemblGenomes-Tr; EFT00001977323.
DR   EnsemblGenomes-Tr; EFT00001977324.
DR   EnsemblGenomes-Tr; EFT00001977325.
DR   EnsemblGenomes-Tr; EFT00001977326.
DR   EnsemblGenomes-Tr; EFT00001977327.
DR   EnsemblGenomes-Tr; EFT00001977328.
DR   EnsemblGenomes-Tr; EFT00001977329.
DR   EnsemblGenomes-Tr; EFT00001977330.
DR   EnsemblGenomes-Tr; EFT00001977331.
DR   EnsemblGenomes-Tr; EFT00001977332.
DR   EnsemblGenomes-Tr; EFT00001977333.
DR   EnsemblGenomes-Tr; EFT00001977334.
DR   EnsemblGenomes-Tr; EFT00001977336.
DR   EnsemblGenomes-Tr; EFT00001977338.
DR   EnsemblGenomes-Tr; EFT00001977340.
DR   EnsemblGenomes-Tr; EFT00001977342.
DR   EnsemblGenomes-Tr; EFT00001977343.
DR   EnsemblGenomes-Tr; EFT00001977345.
DR   EnsemblGenomes-Tr; EFT00001977347.
DR   EnsemblGenomes-Tr; EFT00001977348.
DR   EnsemblGenomes-Tr; EFT00001977350.
DR   EnsemblGenomes-Tr; EFT00001977352.
DR   EnsemblGenomes-Tr; EFT00001977354.
DR   EnsemblGenomes-Tr; EFT00001977356.
DR   EnsemblGenomes-Tr; EFT00001977357.
DR   EnsemblGenomes-Tr; EFT00001977359.
DR   EnsemblGenomes-Tr; EFT00001977360.
DR   EnsemblGenomes-Tr; EFT00001977361.
DR   EnsemblGenomes-Tr; EFT00001977362.
DR   EnsemblGenomes-Tr; EFT00001977363.
DR   EnsemblGenomes-Tr; EFT00001977364.
DR   EnsemblGenomes-Tr; EFT00001977365.
DR   EnsemblGenomes-Tr; EFT00001977366.
DR   EnsemblGenomes-Tr; EFT00001977367.
DR   EnsemblGenomes-Tr; EFT00001977369.
DR   EnsemblGenomes-Tr; EFT00001977370.
DR   EnsemblGenomes-Tr; EFT00001977372.
DR   EnsemblGenomes-Tr; EFT00001977374.
DR   EnsemblGenomes-Tr; EFT00001977376.
DR   GOA; Q6BLT3.
DR   InterPro; IPR009057; Homeobox-like_sf.
DR   InterPro; IPR017930; Myb_dom.
DR   InterPro; IPR021786; Cdc5p/Cef1.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00049; SNORD36.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00472; snosnR55.
DR   RFAM; RF00473; snosnR54.
DR   RFAM; RF00474; snosnR57.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF01177; snR67.
DR   RFAM; RF01203; snR47.
DR   RFAM; RF01239; snR49.
DR   RFAM; RF01244; snR4.
DR   RFAM; RF01247; snR32.
DR   RFAM; RF01248; snR8.
DR   RFAM; RF01253; snR46.
DR   RFAM; RF01502; Fungi_SRP.
DR   StrainInfo; 120222; 0.
DR   UniProtKB/Swiss-Prot; Q6BLT3; CEF1_DEBHA.
XX
CC   This is an updated version of the complete genome sequence. The
CC   Debaryomyces hansenii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium.
CC   For more information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2305761
FT                   /organism="Debaryomyces hansenii CBS767"
FT                   /chromosome="F"
FT                   /strain="CBS767"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Deha2F"
FT                   /db_xref="taxon:284592"
FT   gene            complement(<807..>4961)
FT                   /locus_tag="DEHA2F00110g"
FT                   /old_locus_tag="IPF_42715"
FT   CDS_pept        complement(807..4961)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00110g"
FT                   /old_locus_tag="IPF_42715"
FT                   /product="DEHA2F00110p"
FT                   /note="some similarities with CA1884|IPF5486 Candida
FT                   albicans IPF5486 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66250"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU73"
FT                   /protein_id="CAR66250.1"
FT                   /translation="MSVLDDANFPSMEKFFERYGDDGVQEPRDEHYMSHEEYEETYAAQ
FT                   FSYEFGSTKDTKLRDVSETPINYDVSDYYFDPQLGLGIHKEIGLVVVFHRDPRKNYIIR
FT                   SLLFERYAQAIMCKMTSFRGALQLSRAKDELSSKLVLSCEMGEPGLEHARGKLSPQCMP
FT                   LQAVPIHFGFGCGCGIIRRRYGELSRHSCIQRDSIRPMAFQKFPQRYGLRPANFEVYCP
FT                   TDDGYVEARARDGPASSSSSSSSSSLSGTATTVQNHSRTTTVPDSQHHPLVKKILQEVD
FT                   REIVDIQVKGMKEANFVSKIAQLLVGAMTLFSANINHVNLAGLEVVRLFKGAANNTGGA
FT                   SNNFNRRPSTYFRAVQTYSTCVQYSKYMAELVYMVLMYGPKPAASLALTEMLDKYRDDE
FT                   VVLEVNSRDYHNLTGYSQFITAEERTRILDQTFTESSLRDIDQLVHWIMDHCIRKEFDE
FT                   NLSVAGDEQRQQQQQQPDIDIESDAIAAGILDEDGDDNNETPEVYLEAMNTTMSSSQQQ
FT                   TAAESLASLYYPVYGVNNNAEEEEEQNTSNENAFVVYLGYLGAKYPTKQYCRSLSGICY
FT                   VAKTCVLLDIIKRARTRRVSLRDAEDPSVVDTGSYRILAQVRTHYTYLGLSLARSEGNL
FT                   FRLNFSTGDIFNSDNVVVGHTNMISKIFGRLYDLAQETIQDLSNGEELDYSVDNARLSD
FT                   GMVSFTECVRVPSYSRYKHRLLSIHNNNIDSFRKAHTNLSLILITLLHISCLPARSTEI
FT                   DRLSVEGTSKEYRGVYFLGPTFGFCYNYNKSANSKDPIIREIGPELSSLFLWYVLVFRR
FT                   MYVESSRVESSEKLYQFDAMSPDKIRRGVSYWFTYGMDNQREYKFCEVRQILKRCIEFH
FT                   YTKSVTADLDMYRSVYETIARTSGHSVATSTEHYGTIANYPPSVNAADVLRSRHLGQVW
FT                   HRSGLRRKFIGFEGEVVEPEGEPGDVDEVVASDVSIDPASPVNEEIEEVEPLRDDIGGN
FT                   PVYEDDEVEEVEPLRDDIGGNPVYADDEVDSISDMLMEIPRIDYNRAVGSDPTPVPPLE
FT                   PSAVPPSEPPAPDAPPVSVSWNDSSLSPNHASSPYVHQLPGYRPPFSPPYHAPIAPYHA
FT                   PASSGFALPPQDAYLGAPLYDAHVSREVLSGARKRHSREKKERKERKMERKRKEKERIS
FT                   KREEDIRKREEKIRKREEKEKIRKREKREKRERKRAEEKREKESAALASPVTPVRTLKV
FT                   KDVHLYSSATSGRLFRSESPSGPSGPSSPRAMPSGPPTPNSSARRVHPLIYQSSTQSSA
FT                   VPGSSHPTRVQKQSKQPKQPPSARSLGSPPSFPETPRRSLLSPQHLRQRITESLQASPL
FT                   GRFFAPSDSPKSVARKGPKIPKNDPVVDDSDYSESDYSDED"
FT   gene            complement(<5249..>6253)
FT                   /locus_tag="DEHA2F00132g"
FT                   /old_locus_tag="DEHA0F00132g"
FT                   /old_locus_tag="DEHA-IPF9110"
FT                   /old_locus_tag="DEHA-CDS3869.1"
FT   CDS_pept        complement(5249..6253)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00132g"
FT                   /old_locus_tag="DEHA0F00132g"
FT                   /old_locus_tag="DEHA-IPF9110"
FT                   /old_locus_tag="DEHA-CDS3869.1"
FT                   /product="DEHA2F00132p"
FT                   /note="similar to CA3328|IPF10564 Candida albicans IPF10564
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88659"
FT                   /db_xref="GOA:Q6BN53"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN53"
FT                   /protein_id="CAG88659.2"
FT                   /translation="MSSLVANHSKSINAKDISFTNILVVGGSYAGISFLKGIVNQVRKE
FT                   NKRKLDSKLNNKKLLITMVEPRCGLLNIIGLPRSILDVEFAKSQFLSFRKINLMFDNIY
FT                   NKYGCYMNNQKPVDSFKHQESSLTLNHIQGKVIHLDNKSAEYVLDENGPKKKIYFDYVV
FT                   LATGRDRNSPITPKANTGPMFVKEMSDFNKTIEKYNIISIIGGGAVGVEIAANIKKYFP
FT                   KKNVNIIHPHYSLPPEPLSCEFKDSAYRSLVDAGINVILGTRILRECDNGNLETNNGEI
FT                   ITSEFNFWSYIVNTGTLFGVSCRVSRVYGFMGVYCRFGKCLGCRKSWIWLSLD"
FT   gene            <6898..>10197
FT                   /locus_tag="DEHA2F00154g"
FT                   /old_locus_tag="DEHA0F00154g"
FT                   /old_locus_tag="DEHA-IPF9108"
FT                   /old_locus_tag="DEHA-CDS0238.1"
FT   CDS_pept        6898..10197
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00154g"
FT                   /old_locus_tag="DEHA0F00154g"
FT                   /old_locus_tag="DEHA-IPF9108"
FT                   /old_locus_tag="DEHA-CDS0238.1"
FT                   /product="DEHA2F00154p"
FT                   /note="similar to uniprot|P33302 Saccharomyces cerevisiae
FT                   YOR153W PDR5 Short-lived membrane ABC (ATP-binding
FT                   cassette) transporter actively exports various drugs
FT                   expression regulated by Pdr1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88660"
FT                   /db_xref="GOA:Q6BN52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN52"
FT                   /protein_id="CAG88660.2"
FT                   /translation="MGWDCPKRQTTADFLTSLTNPAERVPRPGYEDKLPYTPVEFEEYW
FT                   KKSPQYKKLIEDIEEYLKQKEGSDRDLYHQAHVARQSNHISQKSSFTVSFFMQTRYIMS
FT                   RNILRTKGDPSIALQSIALQVVMGLIIGSTYYNLETTTGSLFYREAVLFFAILFNSFSS
FT                   ILEIMSLFEARPIVEKHKQYALYRPSADALAGIITELPTKFFMSMGFNFFVYFLSNMRR
FT                   DAGRFFFYWLMNALCTLVMSHFFRSLGAVSTSFPGAMTPATVVLLAMVIFSGYCIPPPN
FT                   MLGWSRWIGYINPVSYVFEALMINEFNDREFTCSAFVPAGPSYMDISSDQSICSVTGSR
FT                   PGLSFVNGSDHIAVTYEYYNSHKWGCFGIIVGFIVFFLVLYVILSEFNKGSMQKGEVTL
FT                   FLKSSLKEHKKQAAKGAATTKDIENSNISNEKISHKDQLDANKEENNNNNNALPSSKDI
FT                   FHWRDLTYQVKIKSEDRVILNHVDGWVKPGQLTALMGSSGAGKTTLLNCLSERVTSGII
FT                   SDGTRMINGQELGSSFQRSIGYVQQQDLHLPTSTVREALRFSAQLRQPNSVSIQEKNEY
FT                   VEYIIHLLDMNLYADALVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQ
FT                   TAWSICKLMRKLADHGQAILCTIHQPSAILLQEFDRLLFLQKGGKTVYFGDLGENCHTL
FT                   IDYFEKYGAHHCPEEANPSEWMLEVVGAAPGSHANQDYHEVWKNSAEYQMVKDHLTEME
FT                   TELVKIPRDESQEAKRSFAAPIWKQYLIVTKRIFEQNWRSPSYIYSKLILVISSSLFNG
FT                   FAFFKADRSLQGLQNQMISIIQFLVPFMTLVQQMMPYYIKQRDIYEVREAPSKTFSWFA
FT                   FITAQITSEIPYQVVIGTLGFFCWYYPVGLYDNAVPTDSVDSRGVLMWLYITAFYVYTS
FT                   TMGQLCISFIEVPENAANLAVNLFTVCLIFCGVLAPYDFLPGFWTFMYRCSPMTYFVQG
FT                   MGSTGLSNVEAVCSESELLRFEPRSGQTCGSYMADYIKQTGGYLVDGNATSKCEYCTTK
FT                   STNDYLASVDSLFSERWRNWGIVICFIAFNIIFTVFFYWIARVPKSNRQKK"
FT   gene            <14009..>14590
FT                   /locus_tag="DEHA2F00176g"
FT   CDS_pept        14009..14590
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00176g"
FT                   /product="DEHA2F00176p"
FT                   /note="similar to uniprot|Q6F9D3 Acinetobacter sp
FT                   ACIAD2568"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88663"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN51"
FT                   /protein_id="CAG88663.1"
FT                   /translation="MLNNFRIFDSSWSKRVLVALLIASILLIPVHTKKEEMPVVEKIEL
FT                   DKYLGKWYEIARKPFLFQKKCYSNVSAKYSLNDNANINVDNSCYSKDGKLRQAIGEAFT
FT                   QNPPFNSKLKVSFLPKAIRFLPIGRGDYWILKIDDNYQTVLVGGPSRKYMWILSRSQNH
FT                   DEIVVQDYLDYAKEIGFDVSDIIMTKQTNE"
FT   gene            <16091..>17515
FT                   /locus_tag="DEHA2F00198g"
FT   CDS_pept        16091..17515
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00198g"
FT                   /product="DEHA2F00198p"
FT                   /note="weakly similar to uniprot|P53388 Saccharomyces
FT                   cerevisiae YPL265W DIP5 Dicarboxylic amino acid permease
FT                   mediates high-affinity and high-capacity transport of L-
FT                   glutamate and L-aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66251"
FT                   /db_xref="GOA:B5RU74"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU74"
FT                   /protein_id="CAR66251.1"
FT                   /translation="MRWIGVYGSIFPNELSATGVVMTYWTDKSPSIFINTFSVIVIAVN
FT                   CYNVACFGEVEFWFEMSKLSLVIALVLSGIILDLGGIKDQERLGFRYWIYPRPFAAYFA
FT                   TGSLVRFIDFWKAITTVVYSFGGVQTMFIVFAGEALYPRRTTYRAAKRIFFRAFIMYSS
FT                   PVFVLTLIVPYNNPSIASSTGSAAGSPFVAMKRVGVKGFPHIINGVVLTSALSAQNNAI
FT                   GEGSRYLYVLAAKGQALQSFLKVNKNKLPYVATIAIGMFLPLAYMSVSSGADNVLGWFT
FT                   SLISAYLLLKWITIAVNHILLSRAMRNKSILEIYYLIDSKSQVSHLSSPFFWSVIFLLT
FT                   SDFANFLHGNFVISSFISAYLIIPISLVLYFGYKFIKKMKIKNSSKIKLKQLFQHVVNN
FT                   PEPPFPKKRPWEYIAAIWDRSLCYLEVGDGRVSNLSTIILDVLLNLYLKHVIILFIASL
FT                   YIQILRYKLIHYQIQI"
FT   gene            <18642..>19418
FT                   /locus_tag="DEHA2F00220g"
FT                   /old_locus_tag="DEHA0F00253g"
FT                   /old_locus_tag="DEHA-IPF9095"
FT                   /old_locus_tag="DEHA-CDS4712.1"
FT   CDS_pept        18642..19418
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00220g"
FT                   /old_locus_tag="DEHA0F00253g"
FT                   /old_locus_tag="DEHA-IPF9095"
FT                   /old_locus_tag="DEHA-CDS4712.1"
FT                   /product="DEHA2F00220p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88665"
FT                   /db_xref="InterPro:IPR022167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN49"
FT                   /protein_id="CAG88665.2"
FT                   /translation="MYFSGVDIDIITYYDPENRCITISIDLFIRVLNNYEQNTRVFLDT
FT                   HLLKIRGNEDEQERRAEKLVSKGNASVDLGNMPFIPIVVYTSRALITAEFREMSSDDFK
FT                   EAYLGPLDSVIRESCIRSLPLVRQYKYPSGDAMRMEQTIQEYFNEIAIPIRQLYRDVGD
FT                   VNNYFGSPSIVRPALDQRRIIQPDIIHMRSESDSDMQYPEIVFGIGDYKTGVYKMMEGF
FT                   EEFKTAISNRRRLRSHSIGKFFPDREWSPRVLLRWF"
FT   gene            <19523..>19849
FT                   /locus_tag="DEHA2F00242g"
FT                   /old_locus_tag="DEHA0F00264g"
FT                   /old_locus_tag="DEHA-IPF9094"
FT                   /old_locus_tag="DEHA-CDS7087.1"
FT   CDS_pept        19523..19849
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00242g"
FT                   /old_locus_tag="DEHA0F00264g"
FT                   /old_locus_tag="DEHA-IPF9094"
FT                   /old_locus_tag="DEHA-CDS7087.1"
FT                   /product="DEHA2F00242p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88666"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYS9"
FT                   /protein_id="CAG88666.4"
FT                   /translation="MIIDYHIIHDPETVEDGITLRSAIAGFFYKSVGDAADTKARLMEI
FT                   FSVASSTDVKSIKESDPFFNVHPRDPSGSSGKLDRPGFSGNLDSVKENDSSDNFDAIDG
FT                   NTYC"
FT   gene            complement(<22493..>23629)
FT                   /pseudo
FT                   /locus_tag="DEHA2F00253g"
FT   gene            complement(<23680..>25641)
FT                   /locus_tag="DEHA2F00264g"
FT                   /old_locus_tag="DEHA0F00385g"
FT                   /old_locus_tag="DEHA-IPF9085"
FT                   /old_locus_tag="DEHA-CDS1335.1"
FT   CDS_pept        complement(23680..25641)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00264g"
FT                   /old_locus_tag="DEHA0F00385g"
FT                   /old_locus_tag="DEHA-IPF9085"
FT                   /old_locus_tag="DEHA-CDS1335.1"
FT                   /product="DEHA2F00264p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88672"
FT                   /db_xref="GOA:Q6BN48"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN48"
FT                   /protein_id="CAG88672.1"
FT                   /translation="MNNNTFPNSIRRYILEGGGEDKDMDIDVDADIDLFEITKFNYRTL
FT                   FDKSTHQNISHTEMVYKFFGIENISDVDLEPQSQKWYFKNHPDEWRELFIFLCVMPFTE
FT                   YEFQGKDGKLLNPDSLRAIGSSHGTDNVLIETFSELEFKSFNKIIPEGRLAFNLENILK
FT                   TEIFSSNFNQDEPKRILTKLLGVCFKEDYMLVTDISSTDEDTYKENFKKYLFNPICEYV
FT                   AALLYFEINVRTKNTAGRTGVNTKVPHQSNDIFHSHPDVVAYDKWKHRRSLAIVEVKKL
FT                   PILKGEKVVDFTEPRMVSFMIQVVAEMFSDHTNKGMLTDSYTTILIEIDIERSMEIVHQ
FT                   KLTGPGNCKFIALNYRILDCQSSGLTLRGGLISFIYEAFSANEYQLNDVKRGLDAIYDY
FT                   VRKSDEEYLTYLDGLGEKADQIYKNNYSAFMRKLHVIEPKITLGEFKRIDVQSGVTFNS
FT                   QLFKVNSKDVKMYLKEDFDETVELVVKVFDPAKAKRDHSKYVIKKHDMFDNCRRAYLCE
FT                   KRAYERLLPNFKFNSVYIAQEPVYGRFFIGNHYHALGPFIVLKYLAKETLPRDEETYEK
FT                   AKEQLNIIHLYNIIHGDISPRNILYSQGKVYFIDFGYSEYTEDKLGSNPVSANPERIKS
FT                   EHQQLCGIFGQPTPNEYE"
FT   gene            complement(<27509..>27799)
FT                   /locus_tag="DEHA2F00286g"
FT                   /old_locus_tag="DEHA0F00429g"
FT                   /old_locus_tag="DEHA-IPF9080"
FT                   /old_locus_tag="DEHA-CDS6715.1"
FT   CDS_pept        complement(27509..27799)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00286g"
FT                   /old_locus_tag="DEHA0F00429g"
FT                   /old_locus_tag="DEHA-IPF9080"
FT                   /old_locus_tag="DEHA-CDS6715.1"
FT                   /product="DEHA2F00286p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88674"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN46"
FT                   /protein_id="CAG88674.2"
FT                   /translation="MSAMKILKPKYLYQTRVLYAKLAGRFCTFAKYSRNATIEEVIHRP
FT                   KPLSVAQAMHVMMQTYVLVARDPTPSLRTVHHRFSMAIPGFKTIPCNWVEA"
FT   gene            <27919..>29847
FT                   /locus_tag="DEHA2F00308g"
FT                   /old_locus_tag="IPF_9079"
FT   CDS_pept        27919..29847
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00308g"
FT                   /old_locus_tag="IPF_9079"
FT                   /product="DEHA2F00308p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66252"
FT                   /db_xref="GOA:B5RU75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022167"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU75"
FT                   /protein_id="CAR66252.1"
FT                   /translation="MPRMYFSGVDSDTITIDDPSNRCITINPELFIRVLNNRELNTRVF
FT                   LDTHLLKIGGNEDGQERRAEKLVSKGNASVGLGNMPSIPIVVYTSRALITAEFREMSSD
FT                   DFKETYLAPLDNALRESSIRSRPLAQEYKYPRGDAMHIEQAIQEYFDREIARTIDHLYR
FT                   DIGDITNHFCSPSFVKSPLDGKRAVQPDIIHMLTKSDLNTQYPEIVFGIGDYKTGVYKM
FT                   TQGFEEFKTAISNRRRLRSHSIGNFFPDREWSPRVLFALVLSKYIYQAFLCGTDRILIS
FT                   DHQTFSGFFKYEIVDGEMIIDYHIIHDPETVEDGITLRSAIAGFFYKSVGDAADTKARL
FT                   MKSFDIANNTGIKKLEESDPFFNVRPRDPSGSSGKLARREFSGNLDSVKENDASDNFDA
FT                   IDGNTYCRVIYDSAEFYPDLKLPSPVFVKLYYYSSRLWEENSLMCLEIPEKEGYYGMFF
FT                   NELLINERIAKSEFASNFPKLLVSGYWNGLSDHPMHIFEYLGKEVPEEKWNNKEVYEVI
FT                   KSRLEELHSIGISHNDIRLANIHVSVSGKISLIDFGLSDYTNNEEHKKNDFETLDYILR
FT                   ANGSNENYKHANRVNGEAISADRADEDDKYGNDSNSSSEEVFDEGSSGTFGTQITIEDI
FT                   ASKSSQR"
FT   gene            <33041..>34786
FT                   /locus_tag="DEHA2F00330g"
FT                   /old_locus_tag="DEHA0F00484g"
FT                   /old_locus_tag="DEHA-IPF9075"
FT                   /old_locus_tag="DEHA-CDS1741.1"
FT   CDS_pept        33041..34786
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00330g"
FT                   /old_locus_tag="DEHA0F00484g"
FT                   /old_locus_tag="DEHA-IPF9075"
FT                   /old_locus_tag="DEHA-CDS1741.1"
FT                   /product="DEHA2F00330p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88677"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN45"
FT                   /protein_id="CAG88677.2"
FT                   /translation="MKKVPKRKEVNSKRQFSTVITSIGIPLIFVPLRSITTTIGSPLLQ
FT                   EDTKVVNAWNHDTIAGHSISLFDFLLSSKRVDLVKADACNDEKELERSIINAIDHLPKN
FT                   IISKNREGRKYSIAKASRVSGILLDDVNLEVNTTSLRNVLYVAEASISREIKHTKFVNL
FT                   PESISGKFSEYLFNHYRVVSCGNQKFEDSKISILRVCLPLIIGNITVLKCVLVLSFYDL
FT                   LNGDSPELLEKENEMHALHVQVLEELKDRLNYYSSVCCDHSLLCVLLLLTIELINGANG
FT                   PLWRKLQKLSLSMIALRGGVKRISSNITGLCLLKLLTMSLSTGISIQSLDSNNGDALSF
FT                   KDFSSSMSTNNQFQFFDNFNYKSSLTLNELKEVIEIYGHISSLQSLMSVSLDANRNKHF
FT                   WTPEHFMKYKSVSSANLIRVLQNAEKLEKHISIRCKETHLNNTSRCHEIQMTFALNVSK
FT                   LYIYQMVYHQASGSPKTILLVKELLIKAESVFDVFKSIHEHEVNSMTVMILPLFCLGVD
FT                   LISKDVRDWYIDKLNQLLVKTKRKMIKTSIELLQKVWNLNRDGTLFLDWISLSAANCSY
FT                   ISLTC"
FT   gene            complement(<34941..>36455)
FT                   /locus_tag="DEHA2F00352g"
FT                   /old_locus_tag="DEHA0F00506g"
FT                   /old_locus_tag="DEHA-IPF9074"
FT                   /old_locus_tag="DEHA-CDS2311.1"
FT   CDS_pept        complement(34941..36455)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00352g"
FT                   /old_locus_tag="DEHA0F00506g"
FT                   /old_locus_tag="DEHA-IPF9074"
FT                   /old_locus_tag="DEHA-CDS2311.1"
FT                   /product="DEHA2F00352p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88678"
FT                   /db_xref="GOA:Q6BN44"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN44"
FT                   /protein_id="CAG88678.2"
FT                   /translation="MSMDTTEKLNTYVQVTHFSSKEELKNIDEAFKFSLETECMDLDPS
FT                   KEKKLVKKIDMFILPIMCILMSCQLMDKSTNSYASIVGLRTDLNMTSQEYSWVGSSFYL
FT                   GYLFSEYPANMLLQRFPLSKTLALAVVCWGIIICCHGACQSSASFLLCRTLLGIFEAFM
FT                   DPAYMLMTSQWYRKEEQYIRCGIWLGLQGFGTMLGSGLAYGVYKHETLFHFAPWRLLFV
FT                   VTGVITIVFGLVSFIHVPDIPTKAWFLNEEEKKYAVERIRKNKTGFGSKVYKPTQFKEA
FT                   LTDPCIYLFFFYMCGYGITNGSIGNFGSILLNEEFEFPTGQALLLNMVGSGVDIVFPLF
FT                   FAYVNKILIPSRLATSFLINSIIYIGICLIAFAPQKGAKLTGYFVSFLTTASWACMSSV
FT                   VSSNVAGHTKKITANTTFLIGFCVGNIIGPQAFIGSEAPIYITAKRVMAGTYVLTVVSA
FT                   GSLLVIYYLRNKKKDQLQGTSNSEDNAHLSFGDLTDQENPSFRYVL"
FT   gene            <36777..>38237
FT                   /locus_tag="DEHA2F00374g"
FT                   /old_locus_tag="DEHA0F00528g"
FT                   /old_locus_tag="DEHA-IPF9073"
FT                   /old_locus_tag="DEHA-CDS2440.1"
FT   CDS_pept        36777..38237
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00374g"
FT                   /old_locus_tag="DEHA0F00528g"
FT                   /old_locus_tag="DEHA-IPF9073"
FT                   /old_locus_tag="DEHA-CDS2440.1"
FT                   /product="DEHA2F00374p"
FT                   /note="weakly similar to uniprot|P78573 Aspergillus
FT                   fumigatus Fructosyl amine: oxygen oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88679"
FT                   /db_xref="GOA:Q6BN43"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN43"
FT                   /protein_id="CAG88679.1"
FT                   /translation="MTLNKDSKIILVGAGVFGLSNALHLAKSGYKNVTVFDRLDFGANH
FT                   YTLLEGADTASADINKIFRAQYAEKKHYQELAFRAFEIWQEWDRKIQLLPESEVKEFTG
FT                   LRLLDLCGMLRLDDQVGWEELASRDNFAREGLGPLRFDINDKNDLKRAKAQGYGPKVQF
FT                   ALDLQSKIPDLEGVFDSTSGMLYASRCLQYAAYLCKSMGVRFIMGGDKGTFKEYVMISN
FT                   KIVGGIVTRDGKKHEAELVVINCGPWSTSLVPELDGINEGTGGNILICKIPDSRKDLKV
FT                   KYSSKNFPIIGWKSGHSREHDYLAGMFIFPVIEPEGILKIIVRQTKYTNPEKLANGRVV
FT                   SIPKTSNSNPPFEALPRHIVYQVREWLQTFFPDLIDLKWESRILWYTDTINNDYIYDYV
FT                   PNKKGLFVACGGSGHAFKMLPVLGQFLVDKIEGRENFYTKLFAWRNAKDYEKDPNGLRE
FT                   GLNGARVYKRQLMSSPEDYIFNKMAPHL"
FT   gene            <38847..>40187
FT                   /locus_tag="DEHA2F00396g"
FT                   /old_locus_tag="DEHA0F00550g"
FT                   /old_locus_tag="DEHA-IPF9071"
FT                   /old_locus_tag="DEHA-CDS2768.1"
FT   CDS_pept        38847..40187
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00396g"
FT                   /old_locus_tag="DEHA0F00550g"
FT                   /old_locus_tag="DEHA-IPF9071"
FT                   /old_locus_tag="DEHA-CDS2768.1"
FT                   /product="DEHA2F00396p"
FT                   /note="similar to uniprot|Q7S638 Neurospora crassa
FT                   NCU04771"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88680"
FT                   /db_xref="GOA:Q6BN42"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN42"
FT                   /protein_id="CAG88680.1"
FT                   /translation="MESTKDIIIVGAGIFGLSTAIALAERYANRTIHVVDRFEPPVPDG
FT                   SSVDTTRCIRFDYKDETYCRLAHESMNLIKADPMISKLFHQQGMTFVYDGNHDTWEDIF
FT                   LSSKSSAEKVNEREEGKMDYYDSAEDVFRSIHNRSPNSVETTELGGPKKWNKGYTNRVN
FT                   GFIDARASIKVYYERARNFPNVNFRFQEVEKIDYFKNTKKVKGVLLKNGDKISADLVIV
FT                   AAGAWSCKLVNLDNISKSSAIEVVWFKVTPSMEKEWKQMSITTNLSTGINIFPPYNGEI
FT                   KVLRRSAGYKNTVAIESPSPFSRVKQEISVPRTIIDSPKDWIPEEAEIEIRGNLKEIMP
FT                   SLCELPFDRTKLCWLTQTTTSNFIIDYYPEAENVLVATGGSAHAWKFVPIIGDKVVDFI
FT                   EGRLETELIRKWSWKEKLTSTVENENAPRMKGDPKEMKECIRNVYDL"
FT   gene            <42433..>42792
FT                   /locus_tag="DEHA2F00418g"
FT                   /old_locus_tag="DEHA0F00572g"
FT                   /old_locus_tag="DEHA-IPF9068"
FT                   /old_locus_tag="DEHA-CDS6768.1"
FT   CDS_pept        42433..42792
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00418g"
FT                   /old_locus_tag="DEHA0F00572g"
FT                   /old_locus_tag="DEHA-IPF9068"
FT                   /old_locus_tag="DEHA-CDS6768.1"
FT                   /product="DEHA2F00418p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88681"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN41"
FT                   /protein_id="CAG88681.2"
FT                   /translation="MWFGSAENLLLPSVTDLQNDGLIYFEQENVVASIVALASVIGSGR
FT                   LLSPENNGQISGRSFLCSKLFNDGSGCINVEVSVTAQLLPDVSDAEFSIGSDQTIYLSS
FT                   VTSRLSFLTGGLLEN"
FT   gene            <42796..>43008
FT                   /locus_tag="DEHA2F00440g"
FT                   /old_locus_tag="DEHA0F00594g"
FT                   /old_locus_tag="DEHA-IPF9067"
FT                   /old_locus_tag="DEHA-CDS8120.1"
FT   CDS_pept        42796..43008
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00440g"
FT                   /old_locus_tag="DEHA0F00594g"
FT                   /old_locus_tag="DEHA-IPF9067"
FT                   /old_locus_tag="DEHA-CDS8120.1"
FT                   /product="DEHA2F00440p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88682"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN40"
FT                   /protein_id="CAG88682.2"
FT                   /translation="MLVLVAGFGNGSRIIIDFTFIRYLYDGDTESLREAFLGSTNVVFE
FT                   IELGYSSDQFNDNVVIVALQDFFSI"
FT   gene            <43589..>45070
FT                   /locus_tag="DEHA2F00462g"
FT                   /old_locus_tag="DEHA0F00616g"
FT                   /old_locus_tag="DEHA-IPF40226"
FT   CDS_pept        43589..45070
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00462g"
FT                   /old_locus_tag="DEHA0F00616g"
FT                   /old_locus_tag="DEHA-IPF40226"
FT                   /product="DEHA2F00462p"
FT                   /note="similar to uniprot|P11491 Saccharomyces cerevisiae
FT                   YDR481c PHO8 alkaline phosphatase a glycoprotein localized
FT                   to the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88683"
FT                   /db_xref="GOA:Q6BN39"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN39"
FT                   /protein_id="CAG88683.2"
FT                   /translation="MKISNFATYIATLSMFFTANAAPVEPNKKQNIILMVSDGMGVATL
FT                   DLARQYNAVVNGLELPSLLNLDDYLIGSLRTRSNSSFITDSAAAGTALACGKKSYNKAI
FT                   GVDPDRNPIGNVGEALKIEGYTVGIVVTTKITDATPGVFYAHSDSRSYEDLIAEQLVGE
FT                   HPLGRIPDLVMGGGRTYFYPNTSEGGSRADSRNLIEEIQNNGTWSYAGNRQEFDELDGG
FT                   NNVTLPLLGLFADKDIPYKIDRNESVYPSLNEQVQVALTALTEATKDSEKGFFLMIEGS
FT                   RIDHAGHANDAAASVRETIEYDSAWKEVLDFADASEVETLVVSISDHETGGISLNAEKA
FT                   EDYQPLINATHSGEYLSKEINNFSDIDDDALFTKFIKSEIIEKGLGIYNYTNEEIERVK
FT                   NTKNNEEPEYTEVLANLTSSRAKIRFSSYEHTAVDVGVYAHSNSDRLQYKVLDRINGLA
FT                   GAHENTDYPKFLQGIVGFDMDDVTELIQDIQHTLD"
FT   gene            complement(<45352..>46918)
FT                   /pseudo
FT                   /locus_tag="DEHA2F00495g"
FT   gene            <47628..>49208
FT                   /locus_tag="DEHA2F00528g"
FT                   /old_locus_tag="DEHA0F00671g"
FT                   /old_locus_tag="DEHA-IPF9062"
FT                   /old_locus_tag="DEHA-CDS2140.1"
FT   CDS_pept        47628..49208
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00528g"
FT                   /old_locus_tag="DEHA0F00671g"
FT                   /old_locus_tag="DEHA-IPF9062"
FT                   /old_locus_tag="DEHA-CDS2140.1"
FT                   /product="DEHA2F00528p"
FT                   /note="weakly similar to uniprot|P39709 Saccharomyces
FT                   cerevisiae YAL067C SEO1 Putative permease member of the
FT                   allantoate transporter subfamily of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88686"
FT                   /db_xref="GOA:Q6BN38"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN38"
FT                   /protein_id="CAG88686.2"
FT                   /translation="MSVENNFQSNVEKVKVDSEISSKQGGLGYENAILDTSSDISENRA
FT                   GNVDAEERRIVKHWYDGFVRLFLWYPSYLDGKEKKLLLKLDFCILTYVCCSYFTKSLDK
FT                   SNITNAYVSGMRNDIEFTGDDLSYAKSLYSAGYIVSMCFGMLFVTRPWARYMLPTLELI
FT                   WGVLTFCGAAVRNSSDMFALRFLIGLAEGPIFCTVVHILGSWYKRDEIYRRVMVFSISS
FT                   SLGGMFSGYLQSAAYETLSGKGGLAGWKWGFIIDGIFTVPIALFGFFIFPGAPYQVKKL
FT                   WWLSAEDLTLAKERTQTSGIATPGALNFSLVKRVFLRWHVHYFTAFWVFLNVLALPDGT
FT                   AFPLWLSANSPERFSISQVNNYPTIQSAVGIIAQFLLAGLADTFSIYPFLTITQCLFII
FT                   SYSSLAAWNIPDGWRWVCFLIIGFDGVNQAIISGWANRSCRHDNEERAFVLGFSDAVSQ
FT                   AINVWTNIVFYPTSDAPKFRKGFIVSLVGAIVMLFLPILGYMGDRFDRKQLENSHESDG
FT                   VESRVEEIK"
FT   gene            <50934..>52661
FT                   /locus_tag="DEHA2F00550g"
FT                   /old_locus_tag="DEHA0F00693g"
FT                   /old_locus_tag="DEHA-IPF9061"
FT                   /old_locus_tag="DEHA-CDS1778.1"
FT   CDS_pept        50934..52661
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00550g"
FT                   /old_locus_tag="DEHA0F00693g"
FT                   /old_locus_tag="DEHA-IPF9061"
FT                   /old_locus_tag="DEHA-CDS1778.1"
FT                   /product="DEHA2F00550p"
FT                   /note="weakly similar to uniprot|P38767 Saccharomyces
FT                   cerevisiae YHR032w and similar to CA4294|CaERC1 Candida
FT                   albicans CaERC1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88687"
FT                   /db_xref="GOA:Q6BN37"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN37"
FT                   /protein_id="CAG88687.2"
FT                   /translation="MSNERMDKYILSNTDGQSSYGSSVNNGLSIPSDIDRFDSSNQGDF
FT                   SGDERGIRCSSVNDTSPLLKASYDSHSKSVAQELIEQERGFLKYHNRIPNKGNENQAIK
FT                   RFEETISSKKITDTTALIELKSLFVASVPLSMTFLLQCSFSTVSVFTAGHLGSVELASV
FT                   SIGSMTASISGYAIIQGISSALDTLCPQAFGAKEYYLVGTYLQKCVAMNFTIMVPILFI
FT                   WTFFGYEVITGFLPDNDTAKYAAVYLRYTAPGIPAYILFECGKKFLEAQGIYHISTIVL
FT                   LFAAPSNLVMNLLFVKTFGYIGIPMAISINYWLMTFGLFVSIVYFIKPHSTPSGKHPLT
FT                   CWNGLHIKQAFQSWNEIVYLAVPGLVMLEAKFFALETLTLIASYLGTLSLAAQSVGTAI
FT                   ASLSYQVSIAIGIASSTRIANFLGAGSNSAAKKTTQVSLCFVLVFSIINVLFLYCFQTR
FT                   IAPLFTKDEKVIKIVESIMWLIALLQICDAINAGSAGCLRGQGQTKIGGIVSLLSYYLI
FT                   GIPLSIYITVYSKFKGTIDGLWIGNCAALIIIGVVQSYYALFADFIRLCTDAQKRASN"
FT   gene            complement(<53845..>55479)
FT                   /locus_tag="DEHA2F00572g"
FT                   /old_locus_tag="DEHA0F00715g"
FT                   /old_locus_tag="DEHA-IPF9060"
FT                   /old_locus_tag="DEHA-CDS2009.1"
FT   CDS_pept        complement(53845..55479)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00572g"
FT                   /old_locus_tag="DEHA0F00715g"
FT                   /old_locus_tag="DEHA-IPF9060"
FT                   /old_locus_tag="DEHA-CDS2009.1"
FT                   /product="DEHA2F00572p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536w STL1 Glycerol proton symporter of the plasma
FT                   membrane subject to glucose-induced inactivation strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88688"
FT                   /db_xref="GOA:Q6BN36"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN36"
FT                   /protein_id="CAG88688.2"
FT                   /translation="MGLRGRALRVAITFTAVSGFSFFGYDQGLMSGIITGDQFNKEFPP
FT                   TAGKSHDAVVNQGGVVSCYEIGCFFGALFALFQGDKYGRRPMLIIGSLLIILGTVISVA
FT                   SFGPHWGLGQFIIGRVITGLGNGMDTATIPVWQSEISRAENRGKLVNLEGSMIAIGTFV
FT                   AYWVVFGLSYVDTSVQWRFPVAFQAIFGIVLFGAIINMPESPRWLIAHDKKDEANYVLA
FT                   ALSDVDITDDIVIAESGVITDGVNRFSRSEVGFKELFSGGRSQHFSRMIIGASTQFFQQ
FT                   FTGCNASIYYSTVLFENLGMGEDFEKLPLIMGGVFATVYALATIPSFFLIDRLGRRALF
FT                   LIGATGQAIAFTITFACLIPDDGQNKETAKGAAVGIFLFIAFFAFTLLPLPWIYPPEIN
FT                   PLRTRTVASAISTCTNWLSNFTVVMFTPLFMNESQFGCYLFFAIFNYILIPTTIWFYPE
FT                   TAGRSLEEIDIIFAKAYVDKRPPWRVAATMPRLSLQEQDEEAIKLGLFDEFEKEGFEHS
FT                   ENLSSHSSRKTPEDRSHDESLVRPEGV"
FT   gene            complement(<56616..>57611)
FT                   /locus_tag="DEHA2F00594g"
FT   CDS_pept        complement(56616..57611)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00594g"
FT                   /product="DEHA2F00594p"
FT                   /note="weakly similar to uniprot|Q7S675 Neurospora crassa
FT                   NCU07100 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66253"
FT                   /db_xref="GOA:B5RU76"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU76"
FT                   /protein_id="CAR66253.1"
FT                   /translation="MGHACGHNLIATGAIAAAIASSEAMRKFNFAGTIKLFGTPAEEGG
FT                   DGKGKMLKAGAYNDVDVSLMHHGNSESPGQAFVRTAASFRFNIEYFGKSAHAGACPWQG
FT                   VNALDAASIFMHSSSLLRQQFEATDRIHFVVTDGGAAANIIPDYTRIKGIIRAINRGKM
FT                   AELKEKLVGCIKAGALGSGCAYKINYENEYNDMVSNIPLTDSFREFFNGFCDNDNEPKL
FT                   KDLDHERILVSSASTDQGNVSWEIPSLHSFFCIKADKEPHTIEFCEAAGKKSSHDSCLK
FT                   SAKCMSLTGLKVLYDEEFYTKIYSSWKADVESLKPKSVDLNALDNEFTYS"
FT   gene            <59465..>59632
FT                   /locus_tag="DEHA2F00616g"
FT                   /old_locus_tag="IPF_9056"
FT   CDS_pept        59465..59632
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00616g"
FT                   /old_locus_tag="IPF_9056"
FT                   /product="DEHA2F00616p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66254"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU77"
FT                   /protein_id="CAR66254.1"
FT                   /translation="MVHLSTVDSDNESIASEISDSASVSTQYTSTLASPESKLHKHLSI
FT                   EEVEDEECLY"
FT   gene            <60636..>62249
FT                   /locus_tag="DEHA2F00638g"
FT                   /old_locus_tag="DEHA0F00781g"
FT                   /old_locus_tag="DEHA-IPF9054"
FT                   /old_locus_tag="DEHA-CDS2061.1"
FT   CDS_pept        60636..62249
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00638g"
FT                   /old_locus_tag="DEHA0F00781g"
FT                   /old_locus_tag="DEHA-IPF9054"
FT                   /old_locus_tag="DEHA-CDS2061.1"
FT                   /product="DEHA2F00638p"
FT                   /note="weakly similar to uniprot|P32467 Saccharomyces
FT                   cerevisiae YHR092C HXT4 High-affinity glucose transporter
FT                   of the major facilitator superfamily expression is induced
FT                   by low levels of glucose and repressed by high levels of
FT                   glucose and similar to CA0480|IPF8610 Candida albicans
FT                   IPF8610"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88691"
FT                   /db_xref="GOA:Q6BN33"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN33"
FT                   /protein_id="CAG88691.2"
FT                   /translation="MLIKIYNPFKKEEDRPTPSSVYNWRIYFVGLISSFAALEIGYDSG
FT                   FIGGTLALNSFRKEFGFDRMSESHSSFIISNIVSLFHAGCFFGSILSYPITFYKGRKVV
FT                   LISSALFMALGAVLMLISNKDRGLGPIYAGRILAGIGVGQSTSIVPTFLSEISPPPIRG
FT                   RVSAMYEIGWRTGDLIGFWVSYAVDENMSTGYVQWILPFAIQIIPAALYLALVWWVKES
FT                   PRWLFSVGKDSEAIENSKFYRKLDDGNDYLLSEISSIKESVNEAKKKVGTGIAGPFLIL
FT                   LREPKLQKRLLVTASLYVFQNLLGVQSINYYSPIIFGKIGVDGTNATLFSTGMFGVVKY
FT                   IATIIWLMFIVEQIGRRNTLLYVSPICAVCFFYIGAYLKVEGGAAAGRAALGLMYVWCF
FT                   FFIIGWSGTPYIVGAEVFDNSLRASFQAINSMFLWLSVFFMTRFTTDMIEGMDYGIFFF
FT                   FASMALISIPWVYFLLPETKGIPLENMEELFDYPAPRAHILVFNSLKCGSDILQDKADE
FT                   SSLTSNGNLKQETIHVEKVV"
FT   gene            complement(<62898..>64151)
FT                   /locus_tag="DEHA2F00660g"
FT                   /old_locus_tag="DEHA0F00803g"
FT                   /old_locus_tag="DEHA-IPF9053"
FT                   /old_locus_tag="DEHA-CDS3021.1"
FT   CDS_pept        complement(62898..64151)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00660g"
FT                   /old_locus_tag="DEHA0F00803g"
FT                   /old_locus_tag="DEHA-IPF9053"
FT                   /old_locus_tag="DEHA-CDS3021.1"
FT                   /product="DEHA2F00660p"
FT                   /note="some similarities with uniprot|P08678 Saccharomyces
FT                   cerevisiae YJL005W CYR1 Adenylate cyclase required for cAMP
FT                   production and cAMP-dependent protein kinase signaling"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88692"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN32"
FT                   /protein_id="CAG88692.2"
FT                   /translation="MNILFRLPIELMGETLSHLSPDELTYKFDLEGLIYDTTFNSYSKV
FT                   RQMAFFVKYKGKHVTISNTNINDTHQLSNFQLQYLNITQMVIKPKVISFVLFDCNNRSS
FT                   YNFISFMLSHHFKLLKSFTNKFSFQLSIHDDNLIDINLLNGILYHFSYNNYIVNWFSIH
FT                   YKTVKQITGVQQTSFEENSHDLNHGSIENLKLHLFNSSRLMEHFMYFRNHNCLCGNLKT
FT                   LDLSYNNINDENLAKLYFPDSIQDLNLSNNNLHTISNNFNINNLANLRNLNLSNNNLIR
FT                   ISISINISFNLEVLVLSGNNLNNCNFLCKPFFQNLSKLNISRNLISNLINLPTSLERLD
FT                   LSGNYLSSFFNEQTSNVFPASLVELNLSWCKILFKARLNVIEAKRTLHIENLHKLKSLI
FT                   LSGNYYYNIDSEILQVCK"
FT   gene            <65202..>66521
FT                   /locus_tag="DEHA2F00682g"
FT                   /old_locus_tag="IPF_9050"
FT   CDS_pept        65202..66521
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00682g"
FT                   /old_locus_tag="IPF_9050"
FT                   /product="DEHA2F00682p"
FT                   /note="weakly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse)
FT                   catalyzes the second step of arginine degradation
FT                   expression is dually-regulated by allophanate induction and
FT                   a specific arginine induction process"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88694"
FT                   /db_xref="GOA:Q6BN30"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN30"
FT                   /protein_id="CAG88694.1"
FT                   /translation="MSLYSSIDEKEFWLKSKSLLPYGGVFTPAIITKAKGVYIYTHDGK
FT                   RILDFTSGQMSCLLGHGHPEISKTITEHAFNLDHLFSGMICPPVVNLAHMLTGILPDGL
FT                   DKAMFLSTGGEANEAAIKLAKICTGNFEVVGLSLSWHGMTGASNATTYQSGRSGQGPMI
FT                   PGNLVLPAPNGYRSIFRKPDGSYDWETELDYGWSLIDSASVGSLAAVIVEPILSSGGML
FT                   VLPDGYLRAMKKHCEKRGMLLIVDEAQTALGRCGSMFAFGDSGVIPDILSLSKTLGNGI
FT                   PLSAIVTSEQLSERGNKKGFLFYTTHVNDPLPAAVGLKVLEVIIRDNLVDKARIMGNIF
FT                   KSELDKFKQEYNFIGDIRGKGLMVGIEIVKNRQTKESDPDLAKVLADKMMELGLSANLI
FT                   AVASFGGIFRIAPPITITEEELRHGLSIMNDAFRAIRNQL"
FT   repeat_region   complement(67161..67306)
FT                   /locus_tag="DEHA2F00704t"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="solo LTR of Debaryomyces hansenii Tdh2
FT                   retrotransposon"
FT   gene            complement(<67391..>68701)
FT                   /locus_tag="DEHA2F00726g"
FT                   /old_locus_tag="DEHA0F00891g"
FT                   /old_locus_tag="DEHA-IPF9048"
FT                   /old_locus_tag="DEHA-CDS2859.1"
FT   CDS_pept        complement(67391..68701)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00726g"
FT                   /old_locus_tag="DEHA0F00891g"
FT                   /old_locus_tag="DEHA-IPF9048"
FT                   /old_locus_tag="DEHA-CDS2859.1"
FT                   /product="DEHA2F00726p"
FT                   /note="similar to uniprot|Q96W94 Saccharomyces kluyveri
FT                   PYD3 Beta-alanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88695"
FT                   /db_xref="GOA:Q6BN29"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN29"
FT                   /protein_id="CAG88695.2"
FT                   /translation="MTYETLIIKKDRLINTIHETASKFGAKGVWGPGLTQTGVCRLALS
FT                   DEDKNVRDWFVKETQFLGCEVKVDAIGNIFAIYPGKNPGPPTGIGSHLDTQPNGGRYDG
FT                   IYGVLSGLEVLRTLKENGIIPNYPIALVNWTNEEGARFPRSLIASSLWAEIVSEEEALG
FT                   LESISDKVPVSIGDELKRIGYNGPIMSSYKSNPLAAHFELHIEQGPILENENKKIGIVT
FT                   GVQAYTWYTVTVRGKSSHAGTTPMNTRSDAMQIASKLILKGIDIAQKHDGLATIGTIDL
FT                   EPASINVIPDTVRFSFDARHVNDDKLTELMDNVKLEFKSIAEKGNCSKYSQSLEVEFDH
FT                   IYTSGAVSFDETNIDTVKKSALELFSTDDVKEIVSGAGHDSCATSIRVPTSMIFIPSKN
FT                   GISHNPEEYSSPEEIDNGFRVLLNTILRYDELRRKNP"
FT   gene            <69404..>70984
FT                   /locus_tag="DEHA2F00748g"
FT                   /old_locus_tag="DEHA0F00913g"
FT                   /old_locus_tag="DEHA-IPF9046"
FT                   /old_locus_tag="DEHA-CDS2139.1"
FT   CDS_pept        69404..70984
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00748g"
FT                   /old_locus_tag="DEHA0F00913g"
FT                   /old_locus_tag="DEHA-IPF9046"
FT                   /old_locus_tag="DEHA-CDS2139.1"
FT                   /product="DEHA2F00748p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88696"
FT                   /db_xref="GOA:Q6BN28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN28"
FT                   /protein_id="CAG88696.1"
FT                   /translation="MSLYEEKNSVETNLHQYRLSKDPEKSIHPIISVKSTIREDVENGA
FT                   IGLDLYEQAQELSKDEIESEYLKIRRKIDRRLLPILCITYTLQFLDKLSLNYASAYSLK
FT                   EDLGLTGQRYSWVAAIFNFGYLFWALPSNYIIQRAPVAKYTGVMLFVWAIILIAHIGCQ
FT                   NYGGMLVVRFILGMFEAGISPACMTICSMFYTREEQPFRMCTFLSCNGIATIVGALLGY
FT                   GLGHSTNASIKSWKLIFLVIGLLNLVWSVVFIWLCPDSPATATFINEREKAIVVDKISK
FT                   NNMGIKDKKIRRYQIIEAVSDPAVWLISFIGLSCGIVNGGVSNFSSALMKGYGFSGLNA
FT                   TALQLPTGAIEFVVVFIAGIIAISVKNTRCIIFVLLCVPGLAGLIGIHLINLDHKWALV
FT                   GCTWLQFIIGGPVILSWIFLTGNIGGHTKKTISNGFWFTLYAAGNIIGANIFYANEAPK
FT                   YTSAIVGLITCYSGMMVIGIGYRFLLIHRNKKRTYEQGEYNDEIAKQAVIDGFNDLTDF
FT                   ENRGFRYAI"
FT   gene            <72231..>73133
FT                   /locus_tag="DEHA2F00770g"
FT                   /old_locus_tag="DEHA0F00935g"
FT                   /old_locus_tag="DEHA-IPF9042"
FT                   /old_locus_tag="DEHA-CDS4240.1"
FT   CDS_pept        72231..73133
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00770g"
FT                   /old_locus_tag="DEHA0F00935g"
FT                   /old_locus_tag="DEHA-IPF9042"
FT                   /old_locus_tag="DEHA-CDS4240.1"
FT                   /product="DEHA2F00770p"
FT                   /note="weakly similar to uniprot|Q03529 Saccharomyces
FT                   cerevisiae YMR272C SCS7 Required for the hydroxylation of
FT                   the very long chain fatty acid (VLCFA) located in the
FT                   endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88697"
FT                   /db_xref="GOA:Q6BN27"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN27"
FT                   /protein_id="CAG88697.2"
FT                   /translation="MFVGILVNASEQERLDDGDEDLASSFRNELPTFDLMTKDTDAKKD
FT                   FERYRFLDIAEPLMPQIMSAHWTKDFYLDQVHRPRHCSKGARVYPNSIVDILCSRVPWW
FT                   AILIYSPIGIASFIVGKRSLAELGASNDIYKWLLIGCLFWTFAEYILHRFIFHMDRYLP
FT                   DYNQTLFALHFAIHGVHHFLPMDPERIAAPPPMVLLLNFLLWYVSYATMGPAYGNIFYA
FT                   GGFASFLWYEEFHISLHTNPEFYQFWTGWWSHHTEMKRYHLQHHYKNYDWGYGVTSKLW
FT                   DFPFGTVLDSADANQVHSK"
FT   gene            <74487..>76001
FT                   /locus_tag="DEHA2F00792g"
FT                   /old_locus_tag="DEHA0F00979g"
FT                   /old_locus_tag="DEHA-IPF9039"
FT                   /old_locus_tag="DEHA-CDS2310.1"
FT   CDS_pept        74487..76001
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00792g"
FT                   /old_locus_tag="DEHA0F00979g"
FT                   /old_locus_tag="DEHA-IPF9039"
FT                   /old_locus_tag="DEHA-CDS2310.1"
FT                   /product="DEHA2F00792p"
FT                   /note="similar to uniprot|P46367 Saccharomyces cerevisiae
FT                   YOR374W ALD4 Mitochondrial aldehyde dehydrogenase that
FT                   utilizes NADP+ or NAD+ equally as coenzymes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88699"
FT                   /db_xref="GOA:Q6BN25"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN25"
FT                   /protein_id="CAG88699.2"
FT                   /translation="MVSTNLPLEIPITLPNGIKYTQPTGLFINNEFVRSKQGNKFEVLS
FT                   PSTEEVVTSVYEAREDDVDIAVQHASRAFEESSWAKADPCQRGAALYKLANLIEENFET
FT                   IASIEAMDNGKAIGNAKGDVTLAISVLRSTAGFSDKMLGSVIESGDSHFNFTRREPLGV
FT                   CGQIIPWNFPLLMFTWKIAPALVTGNCVVIKSSETTPLSALYVSNLIKEANLFPPGVLN
FT                   VISGFGKYTGNAITEHPLIKKVAFTGSTATGKTIMRKCAESNLKKVTLELGGKSPHIIF
FT                   NDADMDTTLKSVVTGIFYNSGEVCSAGSRLYIQEGIYDAFVEKFVQTTKSDVKVGDPFL
FT                   PDTIQGAQNSVDQLDKILKYIQIGTDEGAKILAGGERLQGKGYFIKPTIFGDVKEDMRI
FT                   VQEEIFGPVITISKFKTTDDVVRMANNTDYGLAAGIQTSNVNRAIDVSRRLKAGTVWVN
FT                   TYNDFHPMVPFGGYNSSGMGREMGVEVLQNYTQTKAVRMSIIKPKD"
FT   gene            complement(<76156..>77049)
FT                   /locus_tag="DEHA2F00814g"
FT                   /old_locus_tag="DEHA0F01001g"
FT                   /old_locus_tag="DEHA-IPF9037"
FT                   /old_locus_tag="DEHA-CDS4362.1"
FT   CDS_pept        complement(76156..77049)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00814g"
FT                   /old_locus_tag="DEHA0F01001g"
FT                   /old_locus_tag="DEHA-IPF9037"
FT                   /old_locus_tag="DEHA-CDS4362.1"
FT                   /product="DEHA2F00814p"
FT                   /note="some similarities with CA3202|IPF3444.5f Candida
FT                   albicans IPF3444.5f unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88700"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN24"
FT                   /protein_id="CAG88700.2"
FT                   /translation="MDGTRLDIVKEILSGNGISLKEEKGNIEDSAKIQTTYIRRLENDI
FT                   HLVSSFINQANVSIEKLILKTKNTSHEDSISLKKDIIALSDTYGRLPYLSDKSDVIGIA
FT                   SASSIIDSLIQQQTEASIHLNKKNEIDSYEITSKQALVEEYKRLLQLIDQKHITEQEKL
FT                   EEIDQKTSAMESDPISKGSQIGALNIKLDEARQSENLLSTYLKRIIIKYLALSDWESQQ
FT                   VITEEKLQENVNVCIELIDKLVVSSINSTAWVEIDPNEIESKFINHLLMNNTIISRDDS
FT                   TKEKLFLSLRTFGSEF"
FT   gene            <77245..>77517
FT                   /locus_tag="DEHA2F00836g"
FT                   /old_locus_tag="DEHA0F01023g"
FT                   /old_locus_tag="DEHA-IPF9036"
FT                   /old_locus_tag="DEHA-CDS7576.1"
FT   CDS_pept        77245..77517
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00836g"
FT                   /old_locus_tag="DEHA0F01023g"
FT                   /old_locus_tag="DEHA-IPF9036"
FT                   /old_locus_tag="DEHA-CDS7576.1"
FT                   /product="DEHA2F00836p"
FT                   /note="similar to uniprot|P57744 Saccharomyces cerevisiae
FT                   YJR135W-A TIM8 Mitochondrial intermembrane space protein
FT                   mediating import and insertion of polytopic inner membrane
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88701"
FT                   /db_xref="GOA:Q6BN23"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN23"
FT                   /protein_id="CAG88701.1"
FT                   /translation="MSQISQTALASLDESSRKDIMQFIESENSKSKVQMSIHNFTDMCF
FT                   KKCNANKPITSGTLDSSEEQCLTNCLNRFLDTNIKVVQALQGAQK"
FT   gene            complement(<77631..>79349)
FT                   /locus_tag="DEHA2F00858g"
FT                   /old_locus_tag="DEHA0F01045g"
FT                   /old_locus_tag="DEHA-IPF9035"
FT                   /old_locus_tag="DEHA-CDS1802.1"
FT   CDS_pept        complement(77631..79349)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00858g"
FT                   /old_locus_tag="DEHA0F01045g"
FT                   /old_locus_tag="DEHA-IPF9035"
FT                   /old_locus_tag="DEHA-CDS1802.1"
FT                   /product="DEHA2F00858p"
FT                   /note="some similarities with CA3204|IPF3446 Candida
FT                   albicans IPF3446 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88702"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN22"
FT                   /protein_id="CAG88702.2"
FT                   /translation="MSDSWLDNLDNLSGILDEGSIGENRLSSVQMDLIYINTIKPYNLT
FT                   SKMLSDQILHKKQSVKNTAFFVLEAAIFKESMETEKQQDFVELCSKVTSSLDIPNQNWN
FT                   WIVPANSHKSENYFYYRLRLLCALIYKACIKDSSVTDQSLILNLLAPLSYHMHPKLPWT
FT                   SELNSKTIENFIADNNKVRDMIHSVIPLYIDKKLKPELLNLSSTKGQYIRNSLSNPKTT
FT                   PAGYAIGNSGSTRLLQGGLRPKLGYGGTRTEVIAEDQRQAWKSSTKVKSISMIWFVIYT
FT                   ITSNEHLNQFWPLITSFILNLIDDHDPLMKAQSCELLNYFMLMIDHSKDYKQHILLKTG
FT                   LVDLLIESCKTCLTYLPNLTPSDQSFYLLSIAYPTVVKLCVLNCKKEANFLSLVELING
FT                   NILSSATHIHNSNGPNSNYPLLSLLFNQLDIIIKYYLKTNVLICLSRLNFTINQVMSNP
FT                   DIFEEGIEGVNCIKSALNVQSSILQSFKSLNDREGLKLILNYKYDFLAVWTILQKRLKH
FT                   NLVEHSNVDVSGLCDLNCKLLIQLSKNCQAIEFENLQTDLKQILKANPDVNFPLE"
FT   gene            <79499..>80539
FT                   /locus_tag="DEHA2F00880g"
FT                   /old_locus_tag="DEHA0F01067g"
FT                   /old_locus_tag="DEHA-IPF9034"
FT                   /old_locus_tag="DEHA-CDS3597.1"
FT   CDS_pept        79499..80539
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00880g"
FT                   /old_locus_tag="DEHA0F01067g"
FT                   /old_locus_tag="DEHA-IPF9034"
FT                   /old_locus_tag="DEHA-CDS3597.1"
FT                   /product="DEHA2F00880p"
FT                   /note="similar to CA3205|IPF3448 Candida albicans IPF3448
FT                   Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88703"
FT                   /db_xref="GOA:Q6BN21"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN21"
FT                   /protein_id="CAG88703.2"
FT                   /translation="MKQHKHYLSRCQFAITTKLRRNFVSIPLVISEEIQQTLNDKQKPI
FT                   VSLESTIITHGLPYPDNLSMATEVERIIRANGAVPATCAFIEGIPYVGLTSHQLEYLSE
FT                   QASKKEINKVSRRDIGYTMANKVNGGTTIASTMILSHLAGIKVFATGGLGGVHKDGHLT
FT                   MDVSADLTELGRTPVSVVCAGPKSILDIGLTMEYLETQGVFVGTYNDNNRTRIEIPGFY
FT                   CRDSGIQSPYSFNSFVQAASIIHSQNNLMSLKSGNVFCIPPPEDSALPSELINNIIEKA
FT                   NEEAKEKGIRGKNLTPFLLSKIANDTKGKSVECNINFVYNNAVSATKIAKELLLLENNS
FT                   EPNVCY"
FT   gene            <80773..>81987
FT                   /locus_tag="DEHA2F00902g"
FT                   /old_locus_tag="DEHA0F01089g"
FT                   /old_locus_tag="DEHA-IPF9033"
FT                   /old_locus_tag="DEHA-CDS3138.1"
FT   CDS_pept        80773..81987
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00902g"
FT                   /old_locus_tag="DEHA0F01089g"
FT                   /old_locus_tag="DEHA-IPF9033"
FT                   /old_locus_tag="DEHA-CDS3138.1"
FT                   /product="DEHA2F00902p"
FT                   /note="similar to CA3206|IPF3454 Candida albicans IPF3454
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88704"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN20"
FT                   /protein_id="CAG88704.2"
FT                   /translation="MNDSNPGQTRSSMGGVGYNVSLACKYGLESPSCSSENIDRSSYRF
FT                   VSVVANDFAGRSLLKHLDSNKVDTSGIKIIKDSKNSTAQYSSIHNTNGELLVACADMAI
FT                   IEEDFITEHTVTQLARAKPDCIVLDCNISSSAMSNILQYIRNNLEKTKVIIEPTSAPKA
FT                   ARLSHVNSKNLKVFPNNIISLVSPTVAELNTFHSSFSNRELFDDYDEWFPLLDTLGVDS
FT                   LFREKLNKQAQQYEVLREGLKRGFLQQSFQLLPYLPNILLKLGPSGLLYIGLSTSIGDY
FT                   SSIPTTSDYCPEFTITTNGKEFIDSDGKSKKMGIVIQYFPIPEVNKNLKVKNVTGAGDS
FT                   LLGYLTARLSLSSKNIVGKAWLEPEINRIEDEWFKWESIYKAQISSGLSLQSNEAISPE
FT                   IAKIK"
FT   gene            <82068..>82961
FT                   /locus_tag="DEHA2F00924g"
FT                   /old_locus_tag="DEHA0F01111g"
FT                   /old_locus_tag="DEHA-IPF9032"
FT                   /old_locus_tag="DEHA-CDS4279.1"
FT   CDS_pept        82068..82961
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00924g"
FT                   /old_locus_tag="DEHA0F01111g"
FT                   /old_locus_tag="DEHA-IPF9032"
FT                   /old_locus_tag="DEHA-CDS4279.1"
FT                   /product="DEHA2F00924p"
FT                   /note="weakly similar to uniprot|P38884 Saccharomyces
FT                   cerevisiae YHR198C FMP22 The authentic non-tagged protein
FT                   was localized to the mitochondria and similar to
FT                   CA3207|IPF3456 Candida albicans IPF3456 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88705"
FT                   /db_xref="GOA:Q6BN19"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR016089"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN19"
FT                   /protein_id="CAG88705.1"
FT                   /translation="MFRSGFIHNTRFNFSKVTTKRLFSSSARPIHSLRIKSLTLGVCGF
FT                   SAITGLALYNHRLIELDNKKQDISPNISIAVDSSISPFPTALISANQTNLNTDFQLLGY
FT                   GVRSVTFVNFKVYGIGLYIANDDVNKTKKILSPNYLSTFGTENHSLRELLSDPEFSAQL
FT                   ISKLLEENVRFAVRISPVRNTDFNHLKDGLIKSILAHPESKENKEIVSNGLEELRNVFS
FT                   GYRGSVPKNHVLWLEILKQGSLSISYENPVKNELTSMGQVKEPIISKLLFLQYLSGKKP
FT                   LSEPLRKSCNDGFIGL"
FT   gene            <83456..>85450
FT                   /locus_tag="DEHA2F00946g"
FT                   /old_locus_tag="DEHA0F01133g"
FT                   /old_locus_tag="DEHA-IPF9031"
FT                   /old_locus_tag="DEHA-CDS1266.1"
FT   CDS_pept        83456..85450
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00946g"
FT                   /old_locus_tag="DEHA0F01133g"
FT                   /old_locus_tag="DEHA-IPF9031"
FT                   /old_locus_tag="DEHA-CDS1266.1"
FT                   /product="DEHA2F00946p"
FT                   /note="weakly similar to uniprot|Q7Z7X5 Pichia angusta MPP1
FT                   ZnII/2cys6 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88706"
FT                   /db_xref="GOA:Q6BN18"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN18"
FT                   /protein_id="CAG88706.2"
FT                   /translation="MVRSKNGCISCRRKKKKCDEAQPICTLCSKTNSVCEYPVSHGMFL
FT                   QKNNKGIPDYQGTKRVKIRDKEPEDSFEDTSSEEHSLNDAYQPHKIVHLNSIAMEKSTL
FT                   PSYPLGSLSPELLKDGHGLDMNDLVETAPKDVDDPMLIQTNKKSPEYQELYDTFRDFMF
FT                   LNAASQGPQSPVQMPLGLKDVDIVNHFKSFLDYNTEVSLNEMQEILPQVVSGNSLLSFA
FT                   SVSPKIAGSSTEITSLKDTSSTREFSSTKPQTTNEQIRDEQPDPVVDEIKLNHRDFELF
FT                   TNFVEEIAGWLDMFDHKKHFTTIFVTLSKKSLPLYYSILAISSRHLDETKKLQKKNDHL
FT                   TYHLYQRSLYYLVPMVQGNSNIEVVASCIILCVFEMMNPSPSNWRKHLKGGATLLMAAN
FT                   IHGFSDSMEKSLFWCFSRMDICNALINDEPTLIPLRKWGDLSFIEDGDDDDDDDLIIAA
FT                   RYKEKFLSFSSQNSDMYSNYIVFLAARTVNLISDGNDFSSKTINSVNFETSFDALYQEL
FT                   LEWYINRPVTMKPIICHSDDEEFPRLLFSNGPGISGNQMYHMVMILMNSNKPRASKKCK
FT                   SGGIDNVYKNHLSNVWHAKRIVGISLVNKNDHGCLSNALQPVYFAGKVLTSKREHQIIL
FT                   DLLRNIEEITGLNCEWRIKDLETIWKDYF"
FT   gene            complement(<85718..>87829)
FT                   /locus_tag="DEHA2F00968g"
FT                   /old_locus_tag="DEHA0F01155g"
FT                   /old_locus_tag="DEHA-IPF9030"
FT                   /old_locus_tag="DEHA-CDS1133.1"
FT   CDS_pept        complement(85718..87829)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00968g"
FT                   /old_locus_tag="DEHA0F01155g"
FT                   /old_locus_tag="DEHA-IPF9030"
FT                   /old_locus_tag="DEHA-CDS1133.1"
FT                   /product="DEHA2F00968p"
FT                   /note="similar to uniprot|P23254 Saccharomyces cerevisiae
FT                   YPR074C TKL1 Transketolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88707"
FT                   /db_xref="GOA:Q6BN17"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN17"
FT                   /protein_id="CAG88707.2"
FT                   /translation="MNQIEDLSLKTIRCLVSDLVQQYNGGHPGGAMGMAAIGIALWKYI
FT                   LKYNPKNANWFNRDRFVLSNGHTCLFQYVFLHLVGYESFTMNQLKKYHAPEVSQCAGHP
FT                   EIEFEGIEVTTGPLGQGIANAVGLAIASKNLAANYNKPDLDLVDNKIYCMVGDACIQEG
FT                   VGLEAISLAGHLGLDNLIVIYDNNQITCDGSVDLANSEDINAKFMAQKWHVLTVDDGSF
FT                   DLRSILAAIEQAKSVKGSPILINIRTIIGVDTNVANNAKAHGAAYGVEEGRRLKALYGF
FT                   DPDQFIEVPKLVYDFFREGNEGAISKGVFHQEQWEKKLEAYSKKYPQLYEEVVSRINGK
FT                   LPTDWKESLPHSLPTDATASRKASGLVFTPLAAKYPQFLVGTADLSPSVNLLWPHKKDF
FT                   QNPEIKTDCGINGDYSGRYLHYGIREHAMCAISNGISAYSKGAFIPITSSFFMFYLYSA
FT                   PAVRMGALQNLQVIHVATHDSIGTGEDGPTHQPIALASFYRSLPNCLYVRPADNEEVAG
FT                   AWELAIETTNKPTIISLSRQNLKQYPGITDRNKVKFGAYVLKEFDSSSDSQKLQIISVG
FT                   AESQFAIDAAEILIESNINVKIISFPCQRLFECQSTEYKRSVLDPQIVTVAIEAYASNG
FT                   WERYANAGFHLNEFGISLPGKNAYEHFGFNGAYIASKIQKYLDDLQKDDIMKFEYQELN
FT                   ITKNHHSSS"
FT   gene            <88583..>89458
FT                   /locus_tag="DEHA2F00990g"
FT                   /old_locus_tag="DEHA0F01177g"
FT                   /old_locus_tag="DEHA-IPF9029"
FT                   /old_locus_tag="DEHA-CDS4673.1"
FT   CDS_pept        88583..89458
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F00990g"
FT                   /old_locus_tag="DEHA0F01177g"
FT                   /old_locus_tag="DEHA-IPF9029"
FT                   /old_locus_tag="DEHA-CDS4673.1"
FT                   /product="DEHA2F00990p"
FT                   /note="weakly similar to uniprot|P32573 Saccharomyces
FT                   cerevisiae YNL202W SPS19 late sporulation specific gene
FT                   which may function during spore wall formation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88708"
FT                   /db_xref="GOA:Q6BN16"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN16"
FT                   /protein_id="CAG88708.2"
FT                   /translation="MTVKAFDDNVSDTHYLLDTPRSLPTRDPQLNNHVIDLFNLKGKVA
FT                   VVTGGGQGIGYAICEAYAQAGAEVAIWDISDTSTVATKLEKLYGVKSRSYVCDVTDSKR
FT                   VEQTVNNIVEDFGDIDIFVANAGINIPVGTIINEENSNDKNWLKVMDINLNGVYYCAKN
FT                   VGKVFSRKPEGRKGSMIITGSMSGHIINTPVHQAAYNASKASVIHFAKSLAIEFVDFAR
FT                   VNSISPGYVNSGINDHLPSNTRKRWWSTIPMGREGLPRELVGAYLYLASDASTYTTAAD
FT                   IIVDGGWCAV"
FT   gene            complement(<89714..>91198)
FT                   /locus_tag="DEHA2F01012g"
FT                   /old_locus_tag="DEHA0F01199g"
FT                   /old_locus_tag="DEHA-IPF9028"
FT                   /old_locus_tag="DEHA-CDS2382.1"
FT   CDS_pept        complement(89714..91198)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01012g"
FT                   /old_locus_tag="DEHA0F01199g"
FT                   /old_locus_tag="DEHA-IPF9028"
FT                   /old_locus_tag="DEHA-CDS2382.1"
FT                   /product="DEHA2F01012p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane subject to glucose-induced inactivation strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88709"
FT                   /db_xref="GOA:Q6BN15"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN15"
FT                   /protein_id="CAG88709.2"
FT                   /translation="MVAFVASIAFMLFGYDQGVMSSLLTLPSFLETFPEINVFENKSNS
FT                   TLQGLVVAIYEIGCMCGALFAMVYGDNFGRRKMIWIGAATMTVGAVLQCSAFGLPHLIV
FT                   GRIVTGIGNGFSTATIPMWLSECAKPERRGALNMISAALNIFGVALSYWVDFGFYFVKG
FT                   SASWRFPIAFQIVFALFMMSVIFLMPESPRWLVKKNRIEEAKEVFAVFAEVETNHTFVL
FT                   AKIKEIKDLSMKEDAEFSLKRLISFGPNKHFHRTMLAAFCQIMQQICGINLITYYAGTI
FT                   YEDYLNMDPIPARILAACNGTEYFLAACLSYFLIERVGRRNLMLICAAGQSATMAILCG
FT                   SGWAADNGDTKAAISAAVFLFVFNSFFAVGWLGVSWLYPAEIAPLEIRAAVNGLSTACN
FT                   WAFTFLIVMITPICFAHIGAYTYAIFACVNFAMVPAVYIFYPETSGRSLEDIDIIFEHS
FT                   NPKTPWDVISLSRNYKKLDYKESDLYERKVLVESIE"
FT   gene            <91694..>93517
FT                   /locus_tag="DEHA2F01034g"
FT                   /old_locus_tag="DEHA0F01221g"
FT                   /old_locus_tag="DEHA-IPF9026"
FT                   /old_locus_tag="DEHA-CDS1591.1"
FT   CDS_pept        91694..93517
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01034g"
FT                   /old_locus_tag="DEHA0F01221g"
FT                   /old_locus_tag="DEHA-IPF9026"
FT                   /old_locus_tag="DEHA-CDS1591.1"
FT                   /product="DEHA2F01034p"
FT                   /note="similar to uniprot|P43550 Saccharomyces cerevisiae
FT                   YFL053W DAK2 Dihydroxyacetone kinase required for
FT                   detoxification of dihydroxyacetone (DHA)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88710"
FT                   /db_xref="GOA:Q6BN14"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN14"
FT                   /protein_id="CAG88710.1"
FT                   /translation="MSLAKHWGYSKDLVLENLKGLAAANPKISLIPAEKTVVYNDSLQS
FT                   KGNKNINRIMVISGGGSGHEPLHAGFVGVNALDAAVSGSIFASPSAKQIFAAIKSISSK
FT                   QNNSKGTLVIVKNYTGDVLHFGLAVERAKAHGYKIDMIIVGDDAAVGRSKGGMVGRRAL
FT                   AATALVHKIVGSAASEIEDLSRLKILGDSVANNTVTIGATLDHCSVPGRDIANFEPIGQ
FT                   NDAEIGLGIHNETSVKKVNPVPMIDSLVQDLLEFLLNENDKDRYFVPFDLSNDETVLLV
FT                   NNLGGTSTLEMYAITNCVIETLYQQYSLRPKKVIVGEFATSLNAPGFSITLLNVSCASK
FT                   QSQISISHIMSYLDLPTDAPGWKAHPCGFGLERDINIETSINGIDSFVKSQLKLSREQQ
FT                   TDFRSSLVNGLEKLLDKEPSITFYDTVAGDGDCGETLASGANGILESLRNNEICFEDPV
FT                   YSISQIANIVEDKMGGTSGGLYSIFLTSLIKHLQDCTTLNLCEMFASSLHNALYQGLYK
FT                   YTRARVGGRTLIDALEPFVNTFNDTLNFSKAAQAAIDGSESTRKLAAKFGRASYVNEQE
FT                   FKQFDEEGGLPDPGAIGLATLIAGFAGVDYN"
FT   gene            complement(<95058..>96146)
FT                   /locus_tag="DEHA2F01056g"
FT                   /old_locus_tag="DEHA0F01265g"
FT                   /old_locus_tag="DEHA-IPF9023"
FT                   /old_locus_tag="DEHA-CDS3552.1"
FT   CDS_pept        complement(95058..96146)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01056g"
FT                   /old_locus_tag="DEHA0F01265g"
FT                   /old_locus_tag="DEHA-IPF9023"
FT                   /old_locus_tag="DEHA-CDS3552.1"
FT                   /product="DEHA2F01056p"
FT                   /note="highly similar to uniprot|P41940 Saccharomyces
FT                   cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase
FT                   (mannose-1-phosphate guanyltransferase) synthesizes GDP-
FT                   mannose from GTP and mannose-1-phosphate in cell wall
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88712"
FT                   /db_xref="GOA:Q6BN12"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN12"
FT                   /protein_id="CAG88712.1"
FT                   /translation="MKGLILVGGYGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAKAG
FT                   VTDIVLAVNYRPEVMVSTLKKYEAEYGVTITFSVEEEPLGTAGPLKLAEKVLKKDDTPI
FT                   FVLNSDVICDYPFQELADFHKTSGGKATIVATKVDEPSKYGVIVHDRDTPNLIDRFVEK
FT                   PVEFVGNRINAGLYILNPSVIDLIEMKPTSIEKETFPILVENKELYSFDLEGYWMDVGQ
FT                   PKDFLSGTVLYLTALSKKEPKKLCNEKFIHGGNVLVDPSAKIHPSALIGPNVVIGPNVV
FT                   VGEGARIQRSVLLSNSEVKDHAWVKSTIVGWNSRIGKWARTDGITVLGDDVEIKNEVYV
FT                   NGAKVLPHKSISSNVEHEAIIM"
FT   gene            complement(<97098..>98558)
FT                   /locus_tag="DEHA2F01078g"
FT                   /old_locus_tag="DEHA0F01287g"
FT                   /old_locus_tag="DEHA-IPF9021"
FT                   /old_locus_tag="DEHA-CDS2279.1"
FT   CDS_pept        complement(97098..98558)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01078g"
FT                   /old_locus_tag="DEHA0F01287g"
FT                   /old_locus_tag="DEHA-IPF9021"
FT                   /old_locus_tag="DEHA-CDS2279.1"
FT                   /product="DEHA2F01078p"
FT                   /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
FT                   YDL054C MCH1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88713"
FT                   /db_xref="GOA:Q6BN11"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN11"
FT                   /protein_id="CAG88713.2"
FT                   /translation="MLKHKTFINRISHSIKHYLSFHVSIANLKKISFFISLFSCLTSGS
FT                   IMLFSLFSSSLHELYGINYLHINFIASLSAIGMYLCLPVLGYLADCYGPSLLSLISIWF
FT                   FVPSYFVNSQVIKSLEYNNVMKIHLYAFGICFFFIGLATSSLYFSSLLTCAKIYPEHKG
FT                   LAISLPVTCYGLSTLLGSQLMKLSYFKQYNGFLNLHKVFNFFGVLYLVMGILNFVSSSV
FT                   VSMESEIIFTNEDEMEEADEESPLMTSRSRHSHHSCEDDDNLIPERSIIEPLKHQERFI
FT                   NFLKDKSAWLLLASLILNIGPMESFQNNLGSIIINSNSESNLSDQVSIMAASSTVTRLA
FT                   MGGLSDYLSSSKRKFPICRVNLLIINLAIGIVGQFMVTRSTRFSIVSILNGSSYGGLFT
FT                   IYPTIVASIWGIDMMGSTWGSFMIAPAIGSIGFSIFYGNEVDNKCGVDYSSCLQHYFNL
FT                   TAVGLSVSLILIIIVWKGIWAKRGYRVF"
FT   gene            complement(<98790..>99815)
FT                   /locus_tag="DEHA2F01100g"
FT                   /old_locus_tag="DEHA0F01309g"
FT                   /old_locus_tag="DEHA-IPF9017"
FT                   /old_locus_tag="DEHA-CDS3912.1"
FT   CDS_pept        complement(98790..99815)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01100g"
FT                   /old_locus_tag="DEHA0F01309g"
FT                   /old_locus_tag="DEHA-IPF9017"
FT                   /old_locus_tag="DEHA-CDS3912.1"
FT                   /product="DEHA2F01100p"
FT                   /note="highly similar to uniprot|P09201 Saccharomyces
FT                   cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
FT                   regulatory enzyme in the gluconeogenesis pathway required
FT                   for glucose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88714"
FT                   /db_xref="GOA:Q6BN10"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN10"
FT                   /protein_id="CAG88714.2"
FT                   /translation="MSTQHNSVSEQMNVDTDIITLTRFILQEQQKEAPNATGELSLLLN
FT                   SLQFAFKFIAHNIRRAELVNLIGISGSANSTGDVQKKLDVIGDEIFINAMKSSNNVKVL
FT                   VSEEQEDLIVFEGGGRYAVCTDPIDGSSNIDAGVSVGTIFGIYRLKEDSQGSIKDVLRK
FT                   GTEMVAAGYTMYGASAHLMLTTGQGVNGFTLDTQLGEFILTQPHLTIPKTRAIYSVNEG
FT                   NSHYWADSAKQYIADLKKPQEDGKPYSARYIGSMVADIHRTILYGGIFAYPADSKSKNG
FT                   KLRILYECFPMAMLMEQAGGAAINDKGERILEILPKGIHDKSGIWLGSTGEVDRYLTYL
FT                   K"
FT   gene            complement(<100203..>100700)
FT                   /locus_tag="DEHA2F01122g"
FT                   /old_locus_tag="DEHA0F01331g"
FT                   /old_locus_tag="DEHA-IPF9015"
FT                   /old_locus_tag="DEHA-CDS5812.1"
FT   CDS_pept        complement(100203..100700)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01122g"
FT                   /old_locus_tag="DEHA0F01331g"
FT                   /old_locus_tag="DEHA-IPF9015"
FT                   /old_locus_tag="DEHA-CDS5812.1"
FT                   /product="DEHA2F01122p"
FT                   /note="weakly similar to uniprot|Q9P8Q5 Candida albicans
FT                   IPF3432 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88715"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN09"
FT                   /protein_id="CAG88715.2"
FT                   /translation="MSGGWAEKLTNASASNSSNVSNVSSKPVTTSPSSTSAAIKSKKPH
FT                   PVNADSLQPNTFNGKEILHYLSTSYNTHLQHAKEDKEGENIKVYRSLESSSQWKTKPSS
FT                   TKIAASSANTAGPNSKSKYNSKNVIRNQRDSTGKTNGNIDLLFELNRSIYQQQQHQSAH
FT                   KK"
FT   gene            <100920..>102359
FT                   /locus_tag="DEHA2F01144g"
FT                   /old_locus_tag="DEHA0F01353g"
FT                   /old_locus_tag="DEHA-IPF9013"
FT                   /old_locus_tag="DEHA-CDS2489.1"
FT   CDS_pept        100920..102359
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01144g"
FT                   /old_locus_tag="DEHA0F01353g"
FT                   /old_locus_tag="DEHA-IPF9013"
FT                   /old_locus_tag="DEHA-CDS2489.1"
FT                   /product="DEHA2F01144p"
FT                   /note="highly similar to uniprot|P32915 Saccharomyces
FT                   cerevisiae YLR378C SEC61 Essential subunit of Sec61 complex
FT                   (Sec61p Sbh1p and Sss1p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88716"
FT                   /db_xref="GOA:Q6BN08"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN08"
FT                   /protein_id="CAG88716.1"
FT                   /translation="MSGFRVLDLVKPFTPFMPEVIAPERKVAFQQRLMWTGVTLLIFLV
FT                   MSEIPLYGIASSDGSDPLYWLRMMLASNRGTLMELGISPIVSAGMVFQLLQGTKLITVD
FT                   MSNKNDRDQFQTAQKLFAILLAVGQATVYVLTGMYGPPSSLGTGVCLLLVLQLVFAGIV
FT                   VILLDELLQKGYGLGSGISLFTATNVCEQVFWKAFAPTTSNIGKGTEFEGAVVALFHLL
FT                   GSRKDKKRALLEAFYRSHLPNMFQLIATVFVFLLVVYLQGFRIELPIKSTRQRGPYGLY
FT                   PIRLFYTSNIPIMLQSALSSNIFIISQMLFVRWPNNIFVKILGSWDTRQGAAQLYAVSG
FT                   LAYYIQPPLSFTEALLDPIKTIIYIIFVLGSCAVFSTTWIEISGASPRDVAKQFKEQGL
FT                   VIAGHRDTSAYRELKKIIPTAAAFGGATIGALSVFCDLMGTLGSGTSILLSVTTIYGYY
FT                   ELAMKEGGFGKSVVSSFSDGI"
FT   gene            <103410..>105980
FT                   /locus_tag="DEHA2F01166g"
FT                   /old_locus_tag="DEHA0F01375g"
FT                   /old_locus_tag="DEHA-IPF9010"
FT                   /old_locus_tag="DEHA-CDS0690.1"
FT   CDS_pept        103410..105980
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01166g"
FT                   /old_locus_tag="DEHA0F01375g"
FT                   /old_locus_tag="DEHA-IPF9010"
FT                   /old_locus_tag="DEHA-CDS0690.1"
FT                   /product="DEHA2F01166p"
FT                   /note="weakly similar to uniprot|Q76I27 Pichia pastoris
FT                   PNO1 PNO1 protein and similar to CA4175|IPF4425.repeat2
FT                   Candida albicans IPF4425.repeat2 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88717"
FT                   /db_xref="GOA:Q6BN07"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN07"
FT                   /protein_id="CAG88717.2"
FT                   /translation="MPQPISGSNIGIGAKSRTLFRKVGNAKTIKFIIVLIAIVNILYIS
FT                   TLLVDERTSSTLTSKIKNHASYVLDNFYESDEEEAEDGTVFTDIPEANTVYSNNQNGQG
FT                   SESIHKYDKTLYNIPNRPYDQLSTSDKILFKLNEITSDSEKYWLGHTELTDYELEIQVD
FT                   DFVKSAWKEKQTIFYDPRFTLAIYINEIKNQYLKKNPDNEKHKSHEIVVPFAWSDWVDL
FT                   TMLNEELSKPESQRKNCEYMKATHHIPAKDADYCINNVAITNADLKEMNLPSTKFVPGF
FT                   AVKKSPTNKASNEVRMLEGKSHLLTYAPNPLAIIFLTNDGVYEAQIEGKQRIVDSNLFE
FT                   DFLTSTKNKDPKIIMNPVKEFNDLLARVKPNPLDPEDDEFGMVAKIKDKNPEKTKEVYL
FT                   PQKAFNYQQDKIDVQLEEYETKMKTLHDLTTNELIFDHHTINKLKLTRNEKIYYEGLKY
FT                   ANKFELAKEPTYFRMARLNFQTEENDHDAGWHYEWRFFNGALRYLKKGWNEEELLIREK
FT                   VLLDRILRNWFKFANEKGIISWIAHGPLLSWYWDGLLFPFDEDIDIQMPAEELTRFSKL
FT                   YNQTLVVEDISEGFGKYFIDCSTFIHHRGKSYKENHIDARFIDIDTGSYIDITGLGISK
FT                   EEAPDKYKDIVNQAAIFNQPKPVYNCRNLHFYSYDEISPLRYTMIGGVPCYIPNKVEDI
FT                   LKDEYTKGMSVYDFEGFYFIDPLNLWIHQQKLKFLFDQSHAHLFNDKEEVTNREEFTNL
FT                   VKGMNEEQILSLLEHNEDILLEYYLTKDVTDLHKQELTYMFNMPDGENTKIGNINGQKQ
FT                   QSEISENLEYHKLTSRFKFQKPFRRPLFNYEKIDKPKHAKPSTA"
FT   gene            <106989..>109346
FT                   /locus_tag="DEHA2F01188g"
FT                   /old_locus_tag="DEHA0F01397g"
FT                   /old_locus_tag="DEHA-IPF9008"
FT                   /old_locus_tag="DEHA-CDS0883.1"
FT   CDS_pept        106989..109346
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01188g"
FT                   /old_locus_tag="DEHA0F01397g"
FT                   /old_locus_tag="DEHA-IPF9008"
FT                   /old_locus_tag="DEHA-CDS0883.1"
FT                   /product="DEHA2F01188p"
FT                   /note="weakly similar to uniprot|Q76I27 Pichia pastoris
FT                   PNO1 PNO1 protein and similar to CA4176|IPF4425.repeat1
FT                   Candida albicans IPF4425.repeat1 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88718"
FT                   /db_xref="GOA:Q6BN06"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN06"
FT                   /protein_id="CAG88718.2"
FT                   /translation="MINTKFVKITFLIVLFINILFFTKYYSKQEAKLHEQAIQHVASIN
FT                   YHTDDEVKVPDDKVYSELEAKEKISHLLEQVKNDKEKYWLANTEISEPDLTINMKEFLT
FT                   PDEGESNFANKPTLFYDPRFTLSVYLNEIKNQLQTKNPKNEKTKDHLVTVPFAWSDWVD
FT                   LTMLNEELNKEESERLDCGWLQSEINKPTKYPNFCKNTRDLTSEELREIGLPSKAFLPG
FT                   FAVKSSPMNKAPPKQVMMQGKAHLLAYQENPLSIIFLTKNGTYEAQVSGKKRLVHTEMF
FT                   EHFLERKHINANHIDDMEDQTITLNPIDEFGDLQSAIKPRPLDMNDDMYRMFSITRQKD
FT                   KNASREIYLDTEAFNYNQEQVDAQIEEYESRLNILDDLMTNELRYDPRQIETNILNRHE
FT                   MNHYEGLKYSNSISAQDEPTYYKLATLKKDKENRDAGWHYEWRFFNGALRYLKEGYTMR
FT                   QLEIREQIILDRLLRNWFRFAEEKGIISWIAHGPLLSWYWDGLMFPFDIDIDIQMPSAE
FT                   LNRLSQNYNMTLVVEDVSEGYGKYLIDCATFLHHRDRAAKDNVIDARFIDIDSGTYIDI
FT                   TGLGKNNEKPPAEYDTYIRSRQSKGEEVQLYMDRRKHWLNFEKINPLRYSMISGVPAYV
FT                   PNDIMVMLNYEYDKGTTSYHYDGYYYVPQVRLWLKEEQLTFLFEESAYKDGDKINPDKL
FT                   TGLIKKMNIDHKVRLLESSDDILIEYYLTQKYTSYHEIEKKFMLNPSLQHSILDLKEKT
FT                   EYHQLTSKFHMDKPLRKSLFDYEYLERVKHSE"
FT   gene            <109654..>110481
FT                   /locus_tag="DEHA2F01210g"
FT                   /old_locus_tag="DEHA0F01419g"
FT                   /old_locus_tag="DEHA-IPF9006"
FT                   /old_locus_tag="DEHA-CDS4293.1"
FT   CDS_pept        109654..110481
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01210g"
FT                   /old_locus_tag="DEHA0F01419g"
FT                   /old_locus_tag="DEHA-IPF9006"
FT                   /old_locus_tag="DEHA-CDS4293.1"
FT                   /product="DEHA2F01210p"
FT                   /note="similar to uniprot|P32787 Saccharomyces cerevisiae
FT                   YJR144W MGM101 Protein involved in mitochondrial genome
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88719"
FT                   /db_xref="GOA:Q6BN05"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN05"
FT                   /protein_id="CAG88719.2"
FT                   /translation="MIRGTSLSTSSRSIKVFIFNARYSSNYVKAPIKKMSYNSAFQKSY
FT                   YSNPASKNGMTNNSATTSSPKPISNNESESSSSSSTIKSFSDSPAIASSPEVGSPINWS
FT                   DSFHGLGTAPFPKEVSDILLASIDNDDIEIKPDGLLYLPEIKYRRILNRAFGPGGWGLA
FT                   PRTESLITPKQISREYALICHGRLVSVARGEQDYFGGDEKITTALEGCKSNALMRCCKD
FT                   LGIASELWDPSFIRKWKKDFCDEIFAEHVTTKKKKKLWKLKKNKTLDYPYKKI"
FT   gene            complement(<110699..>111298)
FT                   /locus_tag="DEHA2F01232g"
FT                   /old_locus_tag="DEHA0F01441g"
FT                   /old_locus_tag="DEHA-IPF9004"
FT                   /old_locus_tag="DEHA-CDS5371.1"
FT   CDS_pept        complement(110699..111298)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01232g"
FT                   /old_locus_tag="DEHA0F01441g"
FT                   /old_locus_tag="DEHA-IPF9004"
FT                   /old_locus_tag="DEHA-CDS5371.1"
FT                   /product="DEHA2F01232p"
FT                   /note="similar to CA4178|IPF4421 Candida albicans IPF4421
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88720"
FT                   /db_xref="GOA:Q6BN04"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN04"
FT                   /protein_id="CAG88720.1"
FT                   /translation="MSEQSDAEQRIVPDSRFKWPRPFGNLTSASAYPPWKPVDTKKETS
FT                   QIFRFTFYTTVGAYAWLYLWKRTTFKIGLPMTVVTFATVATASKGMITNLREKNDGWNT
FT                   FWGVGLGNLACLTAGFKNMPVKHKVLTGISGAAIAAVLDHWSWSQSASFAGRDTKHVMA
FT                   NTDEELPKQQFWDVWRRRPLSQTVEEMGSGRGIFKA"
FT   gene            <111567..>112103
FT                   /locus_tag="DEHA2F01254g"
FT                   /old_locus_tag="DEHA0F01463g"
FT                   /old_locus_tag="DEHA-IPF9003"
FT                   /old_locus_tag="DEHA-CDS5625.1"
FT   CDS_pept        111567..112103
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01254g"
FT                   /old_locus_tag="DEHA0F01463g"
FT                   /old_locus_tag="DEHA-IPF9003"
FT                   /old_locus_tag="DEHA-CDS5625.1"
FT                   /product="DEHA2F01254p"
FT                   /note="weakly similar to uniprot|P35180 Saccharomyces
FT                   cerevisiae YGR082W TOM20 Translocase of Outer Mitochondrial
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88721"
FT                   /db_xref="GOA:Q6BN03"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="InterPro:IPR023392"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN03"
FT                   /protein_id="CAG88721.1"
FT                   /translation="MSKALTFTAVAGSALVAYAVYFDYKRRSSPDFRKTLKKKSVKQQK
FT                   LAAKEHENTKKSKLDAIKKALTADLEANPVPTDLSEKENFFMQQVALGEQLATVPDKKI
FT                   EAALCFYKALAVYPNPTDILGIYQRSVPEEVYEIVVMMIAVQPPAAVTNILGAGGAAGA
FT                   GAGEPEIKPSEEDLD"
FT   gene            <112580..>114040
FT                   /locus_tag="DEHA2F01276g"
FT                   /old_locus_tag="DEHA0F01485g"
FT                   /old_locus_tag="DEHA-IPF9002"
FT                   /old_locus_tag="DEHA-CDS2421.1"
FT   CDS_pept        112580..114040
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01276g"
FT                   /old_locus_tag="DEHA0F01485g"
FT                   /old_locus_tag="DEHA-IPF9002"
FT                   /old_locus_tag="DEHA-CDS2421.1"
FT                   /product="DEHA2F01276p"
FT                   /note="similar to uniprot|P23776 Saccharomyces cerevisiae
FT                   YLR300W EXG1 Major exo-1 3-beta-glucanase of the cell wall
FT                   involved in cell wall beta-glucan assembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88722"
FT                   /db_xref="GOA:Q6BN02"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN02"
FT                   /protein_id="CAG88722.2"
FT                   /translation="MTCIYSLLLTFWFAQLTLGLNSTSPSGNSSSLIQSQYNSRNFHYK
FT                   GVALGGWLILEPYITPSLFLEFNKTSGKDSDIPIDEHAYCKKLGYKEAKNRLTKHWDTF
FT                   YNESDFAQIKEYGLNMVRIPIGYWAFEKLENDSYVPGAEKYLDQAIEWAYKYNLKVWVD
FT                   LHGLPGSQNGFDNSGLRSLDYPGWFNRTEHVDLSHRVLNKIYSKYGGHNMSTEYKDTIL
FT                   GIEVVNEPLGPKLSMKKVKKFYEDSYGNARKIQAVNNTIVFHDAFQSMGYWNKFLSYSG
FT                   NKTNSTIDNYNILVDHHHYEVFSSGALNSTIDGHLSSIKSLSSSIKDENKHHPAVVGEW
FT                   SAALTDCTPWLNGVGIGTRFEGTSPYTNDKIGTCDDINTWGKWSKEQKKNYRKFVEMQL
FT                   DQYSSKMNGWIFWCFKTETSIEWDFKRLVHFDLMPQPLDDRKYIVNGTDTDEGDDKKSI
FT                   ASTTRHRNIWLLLVTFGLQLVNVLSDQY"
FT   gene            <114400..>115482
FT                   /locus_tag="DEHA2F01298g"
FT                   /old_locus_tag="DEHA0F01507g"
FT                   /old_locus_tag="DEHA-IPF9001"
FT                   /old_locus_tag="DEHA-CDS3578.1"
FT   CDS_pept        114400..115482
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01298g"
FT                   /old_locus_tag="DEHA0F01507g"
FT                   /old_locus_tag="DEHA-IPF9001"
FT                   /old_locus_tag="DEHA-CDS3578.1"
FT                   /product="DEHA2F01298p"
FT                   /note="similar to uniprot|P31116 Saccharomyces cerevisiae
FT                   YJR139C HOM6 Homoserine dehydrogenase (L-homoserine:NADP
FT                   oxidoreductase) dimeric enzyme that catalyzes the third
FT                   step in the common pathway for methionine and threonine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88723"
FT                   /db_xref="GOA:Q6BN01"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN01"
FT                   /protein_id="CAG88723.1"
FT                   /translation="MVKSVNVAIIGSGVVGSAFVNQLKNLKTAINFNVVYFARSSKEAL
FT                   FSSDYKPVDLASYKNASAQAVLSLDELTKFLKGASKPTILIDNTSNSTIADYYPTFVKE
FT                   GISIATPNKKAFSSDLSVWNEIFKNSEAPSGGLVYHEATVGAGLPIIGPLRDLITTGDK
FT                   VEKIEGIFSGTLSYIFNEFSTTDPSTKVKFSDVVKVAKDLGYTEPDPRDDLNGLDVARK
FT                   VTILARISGFDVESPTSFPVESLIPKELESVQTADEFLSKLPDFDADIQKVKEEALAEN
FT                   KVLRFVGQVDFKANKVSVEIGKYGFDHPFASLKGSDNVVSIKTERYSNPLIIQGAGAGA
FT                   EVTAHGVLADAIKIAERIAI"
FT   gene            complement(<115548..>120230)
FT                   /locus_tag="DEHA2F01320g"
FT                   /old_locus_tag="DEHA0F01529g"
FT                   /old_locus_tag="DEHA-IPF9000"
FT                   /old_locus_tag="DEHA-CDS0094.1"
FT   CDS_pept        complement(115548..120230)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01320g"
FT                   /old_locus_tag="DEHA0F01529g"
FT                   /old_locus_tag="DEHA-IPF9000"
FT                   /old_locus_tag="DEHA-CDS0094.1"
FT                   /product="DEHA2F01320p"
FT                   /note="similar to uniprot|Q75DV2 Ashbya gossypii ABL079C
FT                   ABL079Cp"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88724"
FT                   /db_xref="GOA:Q6BN00"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR027244"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN00"
FT                   /protein_id="CAG88724.2"
FT                   /translation="MHDARIFNSSSNKTMNQNDEAGKSKIKPLRTNQRRVIGASKSSSH
FT                   MGSHVGTTLIIGKNSHSTSHGVRNNSPENTIVIGRRNFSDGQIEYTKPASHSNKFKKDS
FT                   ILRDPNIDSNVEASKKLSEQIQLTVWFHEPRTSTEDVIIDASVIPGLKEGDICELVPLN
FT                   TFKPHKKPKRLIFIIKNQSLLSKSSSLHTSNNNNNAGATTSTLSANNNNTTKTKTNFQI
FT                   SLISNPLQNLMDLPPRSLVQLKTILDVESIEADTIEIFIKDINLSRDLMWTFSSSLVGT
FT                   CVYSEKRLTFLSNRTGVVKKIYKNGNELFSALICEKTKVVFRSKSAKLVFLVQLSREMW
FT                   HFEETGEIMFHKLVNTLFPKIFKKWRDKNTHHAITIVLFTSVDLTNIPWTSLGQGERPN
FT                   NRRDYFRVVVDQVSIFHWDRIMANLRLEFANFKRDIMLNCQPENNGKFTMAGQSLPSVK
FT                   GNVLEAINVGIHLVNDRFKNTDLKHSLNHFILVTPGTGLFDVDYSLMHETSKKMLSIDC
FT                   ALDIVCLSQPPLHIVPLFRYRDPSKDGQISHCVPHWCDISFYKDSTANSTQWIPHCKIY
FT                   ELQMMGVMENEINDVKIERYRVPNEAKSMVEAMDKYDSDVFKPVNKDSDSKVTRELSSS
FT                   PEQSTINSKTGTPKENSKPLSLIWNNRTSLLPNSSTARIDVSTTNSSVLGTVANSGKDV
FT                   SALSSLYTLNKTSADKSVVHAPSIRADSRKGVKENVSRDRKEFNEITRTKLRPRLQKTE
FT                   EFYKSDDSVSNTSKSRDILDSKSRNKQSSTKVEEEFETLTNLLWTEIRNPSKESHSDML
FT                   SFLRLSRWNDIFPSNIKRRLVKWRSFESPAALPVTTSIFPSTKQLETDYSFQIYSVFLN
FT                   SENDLEIESTHDLMREMIQLRLLLGFQICYSDQVKKFESSRKPGGNAESLIKYFPKGSC
FT                   YGSRIYMSLDDEIHRISCDYNGNLYVQMYRKIEELKHSRLLGSKDYRQQSYVPLIRTRY
FT                   VDEYAPAKFDFINTKPLKYNWNQFDQLIAGYDDAIPPEKRQFHKMKFVVLPANIPKNAY
FT                   FISNENLTDEEIRVEGLRKLIGLIERGKFVKSDDKESKRKEEILPEISFYTGNLYEFLS
FT                   DQAETYDATGNEPSNSLMLGENMRFTKSIKLSQLAQELQSPTGVRLVDRTWHFKRHLHC
FT                   FLGNELVSWFIECFEDIDNRNDATSYGQSLMDRGMIKHVESRHGFLDGYYFYTFEGEYI
FT                   DKNYKPERLNSGWFNRKKNSSEKGSAVTSPTYTRNNSDTESAKSPVFPVQDNLDLRKIT
FT                   SNSIGQHMYDSETSSMAGSSTKTKQKKKFILSRSVKFNADPLKKSFRPEIVTVHYDRVH
FT                   NPEHCYHIRLQWLNTTKKFIDDAILNWSRLCERHGLKLVETPWLELCTIPQVNPFHSFV
FT                   DLKLVINPWTDPEFSDPNILKDNKFYYHLYLMKKSDFLLDNRSTVFFSKDHIEISYSWG
FT                   KPIFQYAQYIHKTGAYIVELRDNGDLFLAPNNIHITRLNTSLSSVPEQDYLKSYKMDSQ
FT                   KVMLKFRSACTNEKILRGIFKEAKENWREKCSEVVLPAIN"
FT   gene            complement(<120362..>121066)
FT                   /locus_tag="DEHA2F01342g"
FT                   /old_locus_tag="DEHA0F01551g"
FT                   /old_locus_tag="DEHA-IPF8998"
FT                   /old_locus_tag="DEHA-CDS4992.1"
FT   CDS_pept        complement(120362..121066)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01342g"
FT                   /old_locus_tag="DEHA0F01551g"
FT                   /old_locus_tag="DEHA-IPF8998"
FT                   /old_locus_tag="DEHA-CDS4992.1"
FT                   /product="DEHA2F01342p"
FT                   /note="similar to uniprot|Q03144 Saccharomyces cerevisiae
FT                   YMR095c SNO1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88725"
FT                   /db_xref="GOA:Q6BMZ9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ9"
FT                   /protein_id="CAG88725.2"
FT                   /translation="MTITKKLTVGVLALQGAFIEHIKHFEGATKNGYSDFEFDFIEVRT
FT                   EEQLDRCHGLVIPGGESTSISLIAQRTDLLGPLMHYVKSERPIWGTCAGLIFLSTQVEN
FT                   GRPGQQLLGGMNIQVKRNAFGRQLQSFQSDLDFSSFIPSVSDFPTIFIRAPVITSVLSD
FT                   INGSENVDNEIIHSKNDYENKAPVQILHQLDNGLIVAVRQGTKLGTSFHPELSDDYRFH
FT                   KWFIDEFITKAV"
FT   gene            <121660..>122544
FT                   /locus_tag="DEHA2F01364g"
FT                   /old_locus_tag="DEHA0F01573g"
FT                   /old_locus_tag="DEHA-IPF8997"
FT                   /old_locus_tag="DEHA-CDS4298.1"
FT   CDS_pept        121660..122544
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01364g"
FT                   /old_locus_tag="DEHA0F01573g"
FT                   /old_locus_tag="DEHA-IPF8997"
FT                   /old_locus_tag="DEHA-CDS4298.1"
FT                   /product="DEHA2F01364p"
FT                   /note="highly similar to uniprot|Q03148 Saccharomyces
FT                   cerevisiae YMR096W SNZ1 Protein involved in vitamin B6
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88726"
FT                   /db_xref="GOA:Q6BMZ8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ8"
FT                   /protein_id="CAG88726.1"
FT                   /translation="MTQEFKVKAGLAQMLKGGVIMDVVTPEQAKIAEKAGACAVMALER
FT                   IPADMRASGQVCRMSDPKMIKEIMATVSIPVMAKCRIGHFVEAQILEALEVDYIDESEV
FT                   LTPADKLYHIKKDQFKVPFVCGARNLGEALRRVSEGAAMLRTKGEAGTGDISEAVSHIN
FT                   LIKQQIDHALSLKSEAEVAAYAEELRVPLITLQELIANKGKFPVVNFAAGGVATPADAA
FT                   LCMQLGCDGVFVGSGIFKSKNPELLAKAIVNAVTHYDDPKKVMEYSTDLGELMFGVSVD
FT                   SLKASEKVSTRGW"
FT   gene            complement(<122661..>123251)
FT                   /locus_tag="DEHA2F01386g"
FT                   /old_locus_tag="DEHA0F01595g"
FT                   /old_locus_tag="DEHA-IPF8996"
FT                   /old_locus_tag="DEHA-CDS5406.1"
FT   CDS_pept        complement(122661..123251)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01386g"
FT                   /old_locus_tag="DEHA0F01595g"
FT                   /old_locus_tag="DEHA-IPF8996"
FT                   /old_locus_tag="DEHA-CDS5406.1"
FT                   /product="DEHA2F01386p"
FT                   /note="similar to CA0416|IPF17492 Candida albicans IPF17492
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88727"
FT                   /db_xref="GOA:Q6BMZ7"
FT                   /db_xref="InterPro:IPR024359"
FT                   /db_xref="InterPro:IPR038613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMZ7"
FT                   /protein_id="CAG88727.1"
FT                   /translation="MPQAQIRKTQRNPKLWIAALVAASIVTISYKVYSSYIAEENIEDK
FT                   KTEGDGGVEEKLRIAKRYTKKSIALTLSHSVLSSQLPLNEILLNSENVTFILPPNLSMD
FT                   DLVCNIGNADEVERYNLPKTLLNNYKLLHCSNIDGYFNILKNLKPDTLLVCSEDLGIAN
FT                   NVPRDLHRFVKEIINIDQNKDDIYKKLSSIFIK"
FT   gene            complement(<123638..>127951)
FT                   /locus_tag="DEHA2F01408g"
FT                   /old_locus_tag="IPF_8995"
FT   CDS_pept        complement(123638..127951)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01408g"
FT                   /old_locus_tag="IPF_8995"
FT                   /product="DEHA2F01408p"
FT                   /note="some similarities with uniprot|P07866 Saccharomyces
FT                   cerevisiae YAL024C LTE1 Putative GDP/GTP exchange factor
FT                   required for mitotic exit at low temperatures"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66255"
FT                   /db_xref="GOA:B5RU78"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU78"
FT                   /protein_id="CAR66255.1"
FT                   /translation="MPMENSILETSDDGSGMMDNRDQRSINEENVFYEANTEENKEMDI
FT                   QEVEPGMIHPEFMYNEHDESIFDDENVFPSLNPKADDIVKFDHNNPELINHGTLKALIV
FT                   QLTSPEIIDYNLICDFFLTYRIFVDSEKVMNMLLIRLIWSLQYINSNNEASVKIGKLVL
FT                   LRTFVVLRHWMLNYFVDDFDSNNHLCDIFTYNMNQITNESNLVTDDMFFEQKVLKDLKI
FT                   HWISLLNEFWNVDIDLGIISDDVLQYKLPMIFEISNVKKLSKSNTEMSIHTNASYRRSA
FT                   MLSLYDPKIQHKCLIFGTNGNDENPQLSVNNLLLHHRSSRLSVNTKLQELKDKKLKDVT
FT                   VERKPLSSNTKHNHMNLQDSSLGLKKTSQNKQQIPEETQHGMVTPIKNKENINSNYKLS
FT                   PIKMENIGFSTNGNVKLPSSKVSSILPPTPAKKMDYVIKQSNVDDPFHKPNHYIKDGKS
FT                   TDDASNDFGRKKSLKKFVDGWKKSFNHSSSNAPHQSHTKDNSQGSKDMNNLIKDAMNVM
FT                   SENDEENIGDRVDILCARAVDELEYLIRCYVGNDSPCTIIEGDIDGIDEHNKTDPIDEF
FT                   VEVTVDDYREDNKVDLYDDESIDIMASPAKKARVKSTTHSSPVQGKIENIEDNEDSSAI
FT                   DINDLSELNLKKIDNLINTDELTNGEQCHDKENYNQRSRTPVDQIFGRSFDASNQSSFQ
FT                   RPASINWNDEGNLDLEYSENKTTGSVDDFDDEPKSPITQDQSFGLGSQLPPDPQYLFNN
FT                   QFNKSFESSISTPSNITQYNAEVADLGIALSPQSIKKNSVRRISFNEANLTKNNSNRKR
FT                   MSTLSKNSSGSIFRKDSRNSAKSYVSYDSAFSISNGSVSYKNKEPDNGELRKKMAHADL
FT                   RTIAGINDQRPALDSRISMESMSMSSYLSRSSSLRKSVRFSTLCALTELPFGEYNASST
FT                   SADRRVPSTRKEIRQSDISDSSFFSVAARSKTNSVMVCNEQNTQNSHNSSNNSVAIPGI
FT                   SNFVLKELADIPDESYQLHSPLDHALYKLEGKKSNSSDSKHEIKHEELPRGASNVEQQA
FT                   NESNITPDNTQDILNEINNANTQDIDDYPSDIVDMTQERPLTPVKNIMVVRSPQKKTAR
FT                   GSLKKNESVFFVSNGPSPRQFPSPKTILNGYYISTDILSIEKVMEADSHISFLLSYDSK
FT                   SLADHFTIIEKDILQEIDWKELIELKWNKELVPVNSWLEIIVNDDYFHKNRGVNLVIAR
FT                   FNLMVNWIISEILMSKTQLERISIISRLIHIAHNCYVLQNFSTLMQIILGLMSEKVSKL
FT                   KETWKNLPPGDILILKNLEELSSPLKNFVNIRLCINRIKPSNGCIPFVGLYLSDLIFNA
FT                   ERPAFIKTQIPHAAKNNDTTGGDSTLNTQNIAAKMINFSRFRTSVHIVKSLSQCIEWSS
FT                   NYDLSIQKDLLSKCLYIKSLDEEEMNFCLSNIVDP"
FT   gene            complement(<128421..>129048)
FT                   /locus_tag="DEHA2F01430g"
FT                   /old_locus_tag="DEHA0F01694g"
FT   CDS_pept        complement(join(128421..128984,129046..129048))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01430g"
FT                   /old_locus_tag="DEHA0F01694g"
FT                   /product="DEHA2F01430p"
FT                   /note="similar to uniprot|P53251 Saccharomyces cerevisiae
FT                   YGR081c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88732"
FT                   /db_xref="GOA:Q6BMZ5"
FT                   /db_xref="InterPro:IPR028160"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMZ5"
FT                   /protein_id="CAG88732.2"
FT                   /translation="MAVKKRTTLRDKHAKSNTKSNLSGKIAELKEENNGQESDYHENPF
FT                   LKLSKVTKKDKQLNKSQNFSQKFDSSTLNTSSNISKSALRRRKRNARNELKPKMDELLQ
FT                   NLPETTNVIDPSAAAHKPNDHKSTKFIKSTKASANLPNATKQTGHAKIMTQESKNFTNV
FT                   LKNPQFRSSPFSALKDAIAQNIQNQ"
FT   gene            complement(<129333..>130829)
FT                   /locus_tag="DEHA2F01452g"
FT                   /old_locus_tag="DEHA0F01716g"
FT                   /old_locus_tag="DEHA-IPF8987"
FT                   /old_locus_tag="DEHA-CDS2355.1"
FT   CDS_pept        complement(129333..130829)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01452g"
FT                   /old_locus_tag="DEHA0F01716g"
FT                   /old_locus_tag="DEHA-IPF8987"
FT                   /old_locus_tag="DEHA-CDS2355.1"
FT                   /product="DEHA2F01452p"
FT                   /note="similar to uniprot|P23776 Saccharomyces cerevisiae
FT                   YLR300W EXG1 Major exo-1 3-beta-glucanase of the cell wall
FT                   involved in cell wall beta-glucan assembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88733"
FT                   /db_xref="GOA:Q6BMZ4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ4"
FT                   /protein_id="CAG88733.2"
FT                   /translation="MFRSIKIIILLLNGLTTVLGQFQGTYDLDSDYSHVRKEPKIRTKN
FT                   GSKYQLDYCQKTFGVSLGGWLVLEPWIVPSLFEEVYEKMGEMPVDEYTYTKLLGKREAE
FT                   KALEEHWSSFYTEDDFQDIVDHGINLVRIPIGYWAFGLLADDPYVQGQEYYLDQAIEWA
FT                   DKYDLQVQIDIHGMPGSQNGFDNSGKRTDPTWLNGGENMDLTYDVMDYFFNKYGGEEYE
FT                   DIVTSIEVVNEPFAFILDKDDLREFYEYAYQCARDNSVKANLYFHDGFLPIGSWDRFMN
FT                   DSSVYPNITIDHHLYEIFSEHQIALNIDQHIKNVEDQGAAMALQPHHRIVGEFSGAFTD
FT                   CTKYINGVGIGARYDGTFSNTKPVGSCKNHSDFDSWSEEFKNNTKEFIKAQFETFEKNG
FT                   DGWIFWCFKTEDSIEWDFKRLASLDMLPESFLNRKKCHNLKTTQRLNDTEKNETTIEKT
FT                   SDGSSSIDSTILKFHQSFQLPKIIYIGVISSILLILAAIP"
FT   gene            <131151..>135242
FT                   /locus_tag="DEHA2F01474g"
FT                   /old_locus_tag="DEHA0F01738g"
FT                   /old_locus_tag="DEHA-IPF8986"
FT                   /old_locus_tag="DEHA-CDS0150.1"
FT   CDS_pept        131151..135242
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01474g"
FT                   /old_locus_tag="DEHA0F01738g"
FT                   /old_locus_tag="DEHA-IPF8986"
FT                   /old_locus_tag="DEHA-CDS0150.1"
FT                   /product="DEHA2F01474p"
FT                   /note="some similarities with uniprot|P39521 Saccharomyces
FT                   cerevisiae YPR104C FHL1 and similar to CA0765|IPF9040.3eoc
FT                   Candida albicans IPF9040.3eoc"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88734"
FT                   /db_xref="GOA:Q6BMZ3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ3"
FT                   /protein_id="CAG88734.2"
FT                   /translation="MMSSLSLGDDSLTSSKKEQDSLEDKNLKGNLGKQEDNNKIGGVDI
FT                   EREADAQSLDLDDEINSILNDNEENHKAHRKQGAETKNDEDIATQMSLPDLQDLDIGPL
FT                   DKIQNPMNKIVLDFDDTSKTVSNSQSPNPVDEETYDRYKNSTSQVDIRRNSSLVPITSE
FT                   AALGSSNHEDDKDSSKISAYARLDFENFTFFVQTLQVILGRKSNDELLQSSHHAVDVHL
FT                   SSTKAISRRHAKIFYNFGTQRFELSVLGRNGAFVDDAFTEKGITVPLADGTKIQIGDIP
FT                   FAFVLPSIDSNTNDNSAGTAKQFNPSDAINLRSNLYKVSESPSKNDQKPKQSKEADKPR
FT                   EESKSNISQSPSNSNSDNSSHTSRRTSQSKSNTSRRLSGARKKSVTNDEIDDILNELET
FT                   NSINAIDEEESELLDSEIQSILNDPDSHGQDEEMDLDEENLLKLTQFNEASNEEDEIDK
FT                   LVQQHNLEQGVTWDEDELDREDENDDDMHDIDLDLSVLDQEIATLAPLIDAHHQDLMKE
FT                   KEEKRKQLEQEKRKKESQQLRKMAGKKLPFNKPKVKPSTGSVSQPPTRSTPLMGKPAVP
FT                   RMGRPASIQPPASRLYGRQAPINGLSKAQLVDNRLTTMSSPLAGLPTHLVAQGSANSGL
FT                   PLKIAQGTHHSMAHLVNSQMSKPLMPPKPPAPKLDVQLQTITSSTSSTIRIPIRAITID
FT                   SKVELPPVCVPKNLTEQKDTPKVPKRRKDINQIKKAAKSIYTIDEIPEHYRIKPTLSYP
FT                   LMITNVLKSKGGDIGLTLSEINESIKEIYPYYKYCPDGWQASVSHNVTLNKIFKRISKK
FT                   EYDANWTWGIDDAYIAEREKVKQKQQEMAAAKAKAAAIKAEELKQKQRLEAQQGTTHNI
FT                   VGRNFASPYGLSPLNAGLRMPQSQFISQLQQKQMGSANTNGQKPKTIAELASEIRRDGL
FT                   IGSKAPLYFKPQSTLQVNSSGELVKRNDIPATVSSPAASTVSQQPQVTTNTIKAQLAAN
FT                   RSQSPSSLSPTSQGTHTSSEAKPKMNQDTKKSLAYLQKELFTLYKARKLSYNTATTTEV
FT                   ITKALATTIAQVNIIGVKAGCGDNALSFLVEKAPQQVSKILDIALTKSIKEKQGTLSSR
FT                   PASRGNTPGPTSHSLASSPEKQISSMVNTPQLAGSPKPSSSAASPIEKLGEQLTTSSHK
FT                   SESVAYSNSKENTPNASGELANDMPKPNQSSGIKSESPSASPSLTRPPVYKSGLSKPPT
FT                   FFGKSESSSPSQSAFASASYSSGAGLPKPQSFSKPSALSNPPRFLSNKPARPSFHGNKD
FT                   ETAVPRPPSFTSGSFPSTKGQNNSTTATNSPNIRETPTGDSVAEQATVANAPGTKRSAS
FT                   DEGNVEEKLEDNSRKIIKIE"
FT   gene            <135638..>136486
FT                   /locus_tag="DEHA2F01496g"
FT                   /old_locus_tag="DEHA0F01760g"
FT                   /old_locus_tag="DEHA-IPF8984"
FT                   /old_locus_tag="DEHA-CDS4442.1"
FT   CDS_pept        135638..136486
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01496g"
FT                   /old_locus_tag="DEHA0F01760g"
FT                   /old_locus_tag="DEHA-IPF8984"
FT                   /old_locus_tag="DEHA-CDS4442.1"
FT                   /product="DEHA2F01496p"
FT                   /note="highly similar to uniprot|P30656 Saccharomyces
FT                   cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
FT                   responsible for the chymotryptic activity of the
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88735"
FT                   /db_xref="GOA:Q6BMZ2"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ2"
FT                   /protein_id="CAG88735.1"
FT                   /translation="MNAIAQKFTHSNTNSVLKEINEAKSEFAENAQLDLAPSIQLPPIS
FT                   QPTDFLRAHTDDASNPDCKIKIAHGTTTMAFRFQGGIVVAVDSRATQGNWIASQTVNKV
FT                   IRINPDLLGTMAGGAADCQYWETWLGTQCRLHELREKERISVAAASKILSNLVYEYKGM
FT                   GLSMGTMICGYTKKEGPTIYYVDSDGSRLKGEMFCVGSGQTFAYGVLDSEYRWDLSVEE
FT                   ALYLGKRSILAATHRDAYSGGSVNLYHVTEAGWVYHGNHNVGDIFWDIKEKEKSFNNVD
FT                   G"
FT   gene            <137005..>137862
FT                   /locus_tag="DEHA2F01518g"
FT                   /old_locus_tag="DEHA0F01782g"
FT   CDS_pept        join(137005..137007,137341..137862)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01518g"
FT                   /old_locus_tag="DEHA0F01782g"
FT                   /product="DEHA2F01518p"
FT                   /note="highly similar to uniprot|P0C0W9 Saccharomyces
FT                   cerevisiae YPR102C RPL11A Protein component of the large
FT                   (60S) ribosomal subunit and highly similar to
FT                   uniprot|Q3E757 Saccharomyces cerevisiae YGR085C RPL11B
FT                   Protein component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88736"
FT                   /db_xref="GOA:Q6BMZ1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ1"
FT                   /protein_id="CAG88736.2"
FT                   /translation="MSAKAQNPMREMHIEKLVLNICVGESGDRLTRASKVLEQLSGQTP
FT                   VQSKARYTVRTFGIRRNEKISVHVTIRGPKAEEILERGLKVKEYQLRNKNFSATGNFGF
FT                   GVDEHIDLGIKYDPGIGIYGMDFYVVLGRAGARVTRRKRCRGTIGNNHKTNKEDSIQWF
FT                   KQRYDADVLNK"
FT   gene            <138362..>138874
FT                   /locus_tag="DEHA2F01540g"
FT   CDS_pept        138362..138874
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01540g"
FT                   /product="DEHA2F01540p"
FT                   /note="similar to CA0422|IPF9046 Candida albicans IPF9046
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88737"
FT                   /db_xref="GOA:Q6BMZ0"
FT                   /db_xref="InterPro:IPR008409"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMZ0"
FT                   /protein_id="CAG88737.1"
FT                   /translation="MLPLRDNPEKHLPRPLLMQEIERYEQEQDDEDIDENNARIIQDGI
FT                   DMSKYSEFTSANKSGGEDIRYDNLYATLSYSSLQNRNLSLLSQNEEQLEGLHEHHLNDL
FT                   ATIEEEYRQDLSKKRQRIEELNVYRKRRQVVDFKPVNDYLNDRWKDGLKSVVELGIEAK
FT                   RMDMDMH"
FT   gene            complement(<139137..>139496)
FT                   /locus_tag="DEHA2F01562g"
FT                   /old_locus_tag="DEHA0F01826g"
FT                   /old_locus_tag="DEHA-IPF8981"
FT                   /old_locus_tag="DEHA-CDS6767.1"
FT   CDS_pept        complement(139137..139496)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01562g"
FT                   /old_locus_tag="DEHA0F01826g"
FT                   /old_locus_tag="DEHA-IPF8981"
FT                   /old_locus_tag="DEHA-CDS6767.1"
FT                   /product="DEHA2F01562p"
FT                   /note="similar to uniprot|Q06835 Saccharomyces cerevisiae
FT                   YPR094w RDS3 Well-conserved 12-kDa protein with five CxxC
FT                   zinc fingers that has been implicated in the activation of
FT                   certain drug transport genes and in the pre-mRNA splicing
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88738"
FT                   /db_xref="GOA:Q6BMY9"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY9"
FT                   /protein_id="CAG88738.2"
FT                   /translation="MSRHQYDLIQCMKQPGTHMGMLCQSCDGKCPICDSFVKPTTKVRI
FT                   CDECSFGHLGNKCILCGNNLGVNKELGSAAYYCLECVRLEKDREGCPRIVNVGSSKADM
FT                   IQNKKKANATGGLLQ"
FT   gene            <139662..>141353
FT                   /locus_tag="DEHA2F01584g"
FT                   /old_locus_tag="DEHA0F01848g"
FT                   /old_locus_tag="DEHA-IPF8980"
FT                   /old_locus_tag="DEHA-CDS1864.1"
FT   CDS_pept        139662..141353
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01584g"
FT                   /old_locus_tag="DEHA0F01848g"
FT                   /old_locus_tag="DEHA-IPF8980"
FT                   /old_locus_tag="DEHA-CDS1864.1"
FT                   /product="DEHA2F01584p"
FT                   /note="weakly similar to uniprot|Q06834 Saccharomyces
FT                   cerevisiae YPR093C ASR1 Protein involved in a putative
FT                   alcohol-responsive signaling pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88739"
FT                   /db_xref="GOA:Q6BMY8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY8"
FT                   /protein_id="CAG88739.2"
FT                   /translation="MSLAIKEEECTICLEVITFASTIGTIKNCHHYYHEDCILQWSSHS
FT                   NSCPTCRKLFYKIDVSRHDEPNKIRKSISIRDKLLPNDAIDQIPQEYIIPMNSPSTDRE
FT                   NSHSTLDQITEHYSSNNKLCSICSSSDYRSSLSRNLIYCNNCPSAFHLNCLGVNAYEEF
FT                   DDLTWCCPMCDSLQDLSAMPTYQSGVSNRSRSSRGAGNIRPRANRIRTPRTTTSTSSLN
FT                   SHITDAIFRNASVPINVVPRVDNLNVTSERISRENSKRRPGLIIHNENGELDDDFLYDN
FT                   SNPEDETNIRAENNRVYSPPIINGGVILRKELKEKQKLSKEEARSWDVFDEARKCKVDS
FT                   ESSNAVKSIAQKTEEPRARRRRKKLSDLPHPNPNPELIEGTSANLQNVSEKKQEKTRIS
FT                   SLISQLRSQQTGCKYERNVITTSTTPEISTGISLNPTESISGDSGASSDSETKSQRKKA
FT                   CIDKPTSMELSLEQKVEIQKHIRNNLRPLYRPGDSNPSCSPMIRSEEIYIEINKSASRK
FT                   IYAHILSLITSETDESKCIEYFNDDETKLKSIVEKFVRDELRYYKW"
FT   gene            complement(<141436..>142521)
FT                   /locus_tag="DEHA2F01606g"
FT                   /old_locus_tag="DEHA0F01870g"
FT                   /old_locus_tag="DEHA-IPF8979"
FT                   /old_locus_tag="DEHA-CDS3560.1"
FT   CDS_pept        complement(141436..142521)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01606g"
FT                   /old_locus_tag="DEHA0F01870g"
FT                   /old_locus_tag="DEHA-IPF8979"
FT                   /old_locus_tag="DEHA-CDS3560.1"
FT                   /product="DEHA2F01606p"
FT                   /note="similar to uniprot|P53250 Saccharomyces cerevisiae
FT                   YGR080W TWF1 Twinfilin A member of a conserved family of
FT                   actin monomer sequestering proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88740"
FT                   /db_xref="GOA:Q6BMY7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR028458"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY7"
FT                   /protein_id="CAG88740.2"
FT                   /translation="MSTQSGIVSSEELLDAFKNFKSGALVIKVSSDNTQLIVDEEFQST
FT                   ETDTSKILIELNKYVSGIYPHPVYTIFSLSSPSNSNADYAFISFIPDVAPIREKMLYAS
FT                   TKNTLLTQLGSNNFSKSRTFAWTELDELSFDNFKRSSEVQEDGPLTHEEKTLKEVNSLQ
FT                   GLSLAESSARRNNDTAYKKKLASMHESSSSNGGVLMFSVDSKLESEFRALSQNHDNGKL
FT                   IIFGINLENEGMELISETTGVNSSSLVSNLNSAIETRSVHPLFALYNYSTNRFAFIYSC
FT                   PSGSKVKDRMVYASNKQGLINHLRGITDSDELSIDKILEIGDLDELEVKELESSQNEDK
FT                   DKASNTRNGLKFTKPKGPRRR"
FT   gene            <142885..>144138
FT                   /locus_tag="DEHA2F01628g"
FT                   /old_locus_tag="DEHA0F01892g"
FT                   /old_locus_tag="DEHA-IPF8978"
FT                   /old_locus_tag="DEHA-CDS3020.1"
FT   CDS_pept        142885..144138
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01628g"
FT                   /old_locus_tag="DEHA0F01892g"
FT                   /old_locus_tag="DEHA-IPF8978"
FT                   /old_locus_tag="DEHA-CDS3020.1"
FT                   /product="DEHA2F01628p"
FT                   /note="some similarities with CA0418|IPF9051.5eoc Candida
FT                   albicans IPF9051.5eoc unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88741"
FT                   /db_xref="InterPro:IPR035189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY6"
FT                   /protein_id="CAG88741.2"
FT                   /translation="MNFLSLFGTSANKTAKVPNFEQGENHDSVDLQVKSLLYVFKRLRL
FT                   NKLSSFLGKDGTTYSFKYVDGDKQLNSDSGVHNYFQKLDAMYNVKKFKQVMINDEYRVM
FT                   IDFTKNKFRSFCILSEYPSKGTLSSQGIGNGEFPNFKDYKDRDVKHFRFSIIPLQDTSI
FT                   AFIANTLSTSDIYVEHHNKIDFNCRYQYAMDSINKVLDMERSMSDIDSSISITDAEKAS
FT                   IIQYYLKRVAFFIQLNRIYVEYLKHHATKGSPTKVSAPISPSKSVSSLSQSYGSSNSKL
FT                   TNSMSNLSLAPSPPKLSPRKSMADLNKSRSPSPTRTLKSKPSVARMRMDELFNNPISTT
FT                   PTKAPKLTNKAIDSSKSDTSSTTFNDDIAIISSKKLPEVATEIKLDVWEKCKLAVKDKL
FT                   EQERKKLSSISSNNSLHE"
FT   gene            <144436..>145056
FT                   /locus_tag="DEHA2F01650g"
FT                   /old_locus_tag="DEHA0F01914g"
FT                   /old_locus_tag="DEHA-IPF8976"
FT                   /old_locus_tag="DEHA-CDS5578.1"
FT   CDS_pept        144436..145056
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01650g"
FT                   /old_locus_tag="DEHA0F01914g"
FT                   /old_locus_tag="DEHA-IPF8976"
FT                   /old_locus_tag="DEHA-CDS5578.1"
FT                   /product="DEHA2F01650p"
FT                   /note="some similarities with uniprot|Q7SBV1 Neurospora
FT                   crassa NCU07858 Hypothetical protein and similar to
FT                   CA0620|IPF17998 Candida albicans IPF17998 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88742"
FT                   /db_xref="GOA:Q6BMY5"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034095"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY5"
FT                   /protein_id="CAG88742.1"
FT                   /translation="MISRNILRQSCHRTQSRYFASSALMSNLFGGKKVINQTQLNAPTG
FT                   KGESTTNPADMIKRNDILMFSQKPINYIETVKSNGFHLANNLLITSPDKEGNIIGTLLL
FT                   ESETFEINMSKPNKGFDLINGFIIDFHEDVLQIFNKIHPKPEICVIGLGCKSRMLSDST
FT                   KKYFSNLGIQVDHSDSNNAAQMFDLLATERPNVIAALLLPPNI"
FT   gene            complement(<145270..>147450)
FT                   /locus_tag="DEHA2F01672g"
FT                   /old_locus_tag="DEHA0F01936g"
FT                   /old_locus_tag="DEHA-IPF8975"
FT                   /old_locus_tag="DEHA-CDS1049.1"
FT   CDS_pept        complement(145270..147450)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01672g"
FT                   /old_locus_tag="DEHA0F01936g"
FT                   /old_locus_tag="DEHA-IPF8975"
FT                   /old_locus_tag="DEHA-CDS1049.1"
FT                   /product="DEHA2F01672p"
FT                   /note="some similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019C MUC1 GPI-anchored cell surface
FT                   glycoprotein required for diploid pseudohyphal formation
FT                   and haploid invasive growth transcriptionally regulated by
FT                   the MAPK pathway (via Ste12p and Tec1p) and the cAMP
FT                   pathway (via Flo8p) and similar to CA0621|IPF17999 Candida
FT                   albicans IPF17999 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY4"
FT                   /protein_id="CAG88743.2"
FT                   /translation="MSNDFLQSSPSRHMIDPAIYNSFPDMQEDRNTSNSHTGNGNTSQH
FT                   QQPQQSQQQLSAGPPSAQKNHNQLPSNLTGWTPLISKTIFNDQLISYNSTPSGKFFNGV
FT                   LSGHVNNEIDYAQGLNLTPFLTHNLNIPNSNSHMNGISNITPFHDKTLHLTDFFMDSPI
FT                   KQTPIKNIDTITPSKFKIGSERKFLKQSVFQDPKSASKRSITQIDTPPRQPHKVSILNK
FT                   HEARYEKNNIIDDKVQSKDEDEDDQGDEENEKKSDGISINKSKLYGQNLLTPSKTVLKD
FT                   ISNINKNQGKSTPMPKDSKKTKESFETPSKQIPDSSPSTVIMSSAVNSPPSKPLTTNDI
FT                   DSSKNVTVKYSTTTQNLPPSPTPKKEIANNSDNVDVLKPTMGVFSEKKSKPLKTKPAVF
FT                   KNLSSDSTGASSSMNTKTKSNSKTQMQAGMNKFQIVFTDVHTLMNKKNKSKKLNNAPKP
FT                   KLKRSQSANRSKDQSFHINDNTKPRSLTRSATAPDSNQQSYQTTHRTGSSHDHNVSMNT
FT                   SSKEVSLISGNSNSMNTSNLNMSSTDHSSFELGGLSSTPNGKYFLDKMFDKPSPQSQQN
FT                   LNANQYYSMHQHSLSNMPPPNPNNSRPPPTVAQHNLSHAQQQQQHPMMMMMMMMSTPQH
FT                   QNVVNYGSNVYNPNNEISPTSDNQFASNSNISNFSYQPYPKSGTPSQSMMGPMVANQKE
FT                   SSQYSQLIPVSTSDEDEDILLKREEDEEEDNV"
FT   gene            complement(<148453..>149385)
FT                   /locus_tag="DEHA2F01694g"
FT                   /old_locus_tag="DEHA0F01958g"
FT                   /old_locus_tag="DEHA-IPF8973"
FT                   /old_locus_tag="DEHA-CDS4127.1"
FT   CDS_pept        complement(148453..149385)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01694g"
FT                   /old_locus_tag="DEHA0F01958g"
FT                   /old_locus_tag="DEHA-IPF8973"
FT                   /old_locus_tag="DEHA-CDS4127.1"
FT                   /product="DEHA2F01694p"
FT                   /note="highly similar to uniprot|P53252 Saccharomyces
FT                   cerevisiae YGR086C PIL1 Long chain base-responsive
FT                   inhibitor of protein kinases Phk1p and Phk2p acts along
FT                   with Lsp1p to down-regulate heat stress resistance via
FT                   regulation of the Pkc1p and Ypk1p pathways"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88744"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY3"
FT                   /protein_id="CAG88744.1"
FT                   /translation="MHRTYSLRSSRAPTAAQLQSPPPPTSSTKQKFFGKGSLSHTFRKQ
FT                   AAGSMGPELSRKLAVLVKMEKNLMRSIEITSRERKDVAKQLSIWGEANDEDVSDITDKL
FT                   GVLIYEVGELEDQFIDRYDQYRITIKSIRDIEGSVQPSRDRKQKITDQIAYLKYKDPQS
FT                   PKINVLEQELVRAEAESLVAEAQLSNITREKLKTAFNYQFDSTREHAEKIALIAGYGKA
FT                   LLELLDESPVTPGETRPAYDGYEASKQIIIDAENALASWTFDSAVVRPTLSLATHEHDD
FT                   EYDVDELAEDARNMQVTEKEWEDENRVTA"
FT   gene            <150565..>151131
FT                   /locus_tag="DEHA2F01716g"
FT                   /old_locus_tag="DEHA0F01980g"
FT                   /old_locus_tag="DEHA-IPF8972"
FT                   /old_locus_tag="DEHA-CDS5496.1"
FT   CDS_pept        150565..151131
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01716g"
FT                   /old_locus_tag="DEHA0F01980g"
FT                   /old_locus_tag="DEHA-IPF8972"
FT                   /old_locus_tag="DEHA-CDS5496.1"
FT                   /product="DEHA2F01716p"
FT                   /note="similar to uniprot|Q88KQ7 Pseudomonas putida
FT                   Hydrolase isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88745"
FT                   /db_xref="GOA:Q6BMY2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY2"
FT                   /protein_id="CAG88745.1"
FT                   /translation="MTKQAFIIIDLQNDYYKDGKFPLVGIEEATENAATLLKEVRKLKD
FT                   EYLIIHVRHEFPVDPKDAPFFGKGTEGSQINEAVKNEPNELVITKDEPNAFVRTNLQQV
FT                   LEDNKISELIIVGAMSHLCVQGTSRAASEKGYKVTVIQDAIATRDLEFGGVNVPAKQVA
FT                   ATVLVTLAFGYAKVITTKEQLQLLN"
FT   gene            <152133..>152822
FT                   /locus_tag="DEHA2F01738g"
FT                   /old_locus_tag="DEHA0F02002g"
FT                   /old_locus_tag="DEHA-IPF8970"
FT                   /old_locus_tag="DEHA-CDS4759.1"
FT   CDS_pept        152133..152822
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01738g"
FT                   /old_locus_tag="DEHA0F02002g"
FT                   /old_locus_tag="DEHA-IPF8970"
FT                   /old_locus_tag="DEHA-CDS4759.1"
FT                   /product="DEHA2F01738p"
FT                   /note="weakly similar to uniprot|Q06563 Saccharomyces
FT                   cerevisiae YLR251w SYM1 Protein and similar to
FT                   CA3605|IPF3865 Candida albicans IPF3865 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88746"
FT                   /db_xref="GOA:Q6BMY1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMY1"
FT                   /protein_id="CAG88746.2"
FT                   /translation="MSFFDKYNRLLKTHPFRVNMVTTGLLFGVGDGVAQKLFPSNHDHL
FT                   DEEKPKYNVYRTMRAMIYGSCFFAPCGVLWYGKRLPLIKNPFVSVKNRETWSKNRVHLY
FT                   DTLYRVAIDQIFIPGLFWIPMYNIVMSTLSGYENPLEVAFHKLQHNWWNVLTTNWMVWP
FT                   GFQLISFFYIPVHLRIVAANICSVGWNCFLSYLYNGKAHGDHQKEEILDHLVDPDEEIE
FT                   ETTMVVY"
FT   gene            <153307..>153927
FT                   /locus_tag="DEHA2F01760g"
FT                   /old_locus_tag="DEHA0F02024g"
FT                   /old_locus_tag="DEHA-IPF8967"
FT                   /old_locus_tag="DEHA-CDS4843.1"
FT   CDS_pept        153307..153927
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01760g"
FT                   /old_locus_tag="DEHA0F02024g"
FT                   /old_locus_tag="DEHA-IPF8967"
FT                   /old_locus_tag="DEHA-CDS4843.1"
FT                   /product="DEHA2F01760p"
FT                   /note="similar to uniprot|Q06563 Saccharomyces cerevisiae
FT                   YLR251w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88747"
FT                   /db_xref="GOA:Q6BMY0"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMY0"
FT                   /protein_id="CAG88747.1"
FT                   /translation="MASIYQKYSQLIAKRPLITNIITTGFLFGSGDYLAQTLYPSSSKY
FT                   DYKRTLRATFYGSIIFAPIGDKWYRLLHKINFPFPKTKVSPTVSKVLNTLTKVGVDQLV
FT                   FAPFIGIPLYYSVMSVLEFHDNPLQVAREKLHAHWFNTLKTNWVVWPTFQLFNFALIPV
FT                   QFRLLVVNIFSIGWNCYLSSVLNHKHDFLIENITDVDKDEILI"
FT   gene            <154574..>156829
FT                   /locus_tag="DEHA2F01782g"
FT   CDS_pept        154574..156829
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01782g"
FT                   /product="DEHA2F01782p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014w RTS1 B-type regulatory subunit of protein
FT                   phosphatase 2A (PP2A)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66256"
FT                   /db_xref="GOA:B5RU79"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU79"
FT                   /protein_id="CAR66256.1"
FT                   /translation="MMKGFKNRLSRNKGQSTGKKGEKKLDKDKDSKSDSSSRKASSSSS
FT                   IASKLSGSGSNAKSSSPSISRHNSGNSIKSSSSGGSATAMGQTSHSPQSPNQSQQDSPR
FT                   ILINDSENNDSPTMVTTAGSNTQPVTPTPTSPTTVTNTSPNASNSPFDQVQIKPGHVPH
FT                   SQTGSAIHPHGYPLNTNISSPTRDNFDIDLIVTPKRHSSSRFEPSTSDRYQEIVKLPNF
FT                   DEILPEEQISLFIQKIDQCNIMFDFSDPTYDGRGKEIKRITLQELIHFISNNRFTYTDE
FT                   MYKHVVGMFKKNLFRPIPPPVNPIGDIYDPDEDEPVSELAWPHMQAIYEFFLRFIESPD
FT                   FTHQIAKQYIDHEFILKILELFDSEDPRERDCLKTTLHRIYGKFLSLRSFIRKSINNVF
FT                   LQFVYETERFNGIGELLEILGSIINGFALPLKDEHKIFLVRILIPLHKVKSLSLYHPQL
FT                   AYCIVQFLEKDPMLTEDVIMGLLRFWPKINSPKEVMFLNEIEDIFEVMEPNEFLKIQIP
FT                   LFAQLSKCISSPHFQVSEKVLCYWTNEYFLTLITENAEVVLPIIFASLYELTNATQPGI
FT                   TNGTVQQRLLENPESPTDANGNLIDRGLILNDLNNHSIDHNTNVNDSLNPNMHDITDEE
FT                   YYDSFSSPQQVQGDLDEFGTPNQIPPHNSATSNWNRSIHSLAFGALKVFMDHNPILYDH
FT                   CTMLYHQSLEEQRAREVARKDGWKKVEEYVNSLRLQQSSSALSGKNSNDNGASVASH"
FT   gene            <157882..>159664
FT                   /locus_tag="DEHA2F01804g"
FT                   /old_locus_tag="DEHA0F02068g"
FT                   /old_locus_tag="DEHA-IPF8965"
FT                   /old_locus_tag="DEHA-CDS5742.1"
FT   CDS_pept        join(157882..158332,158550..159664)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01804g"
FT                   /old_locus_tag="DEHA0F02068g"
FT                   /old_locus_tag="DEHA-IPF8965"
FT                   /old_locus_tag="DEHA-CDS5742.1"
FT                   /product="DEHA2F01804p"
FT                   /note="highly similar to uniprot|P50094 Saccharomyces
FT                   cerevisiae YML056C IMD4 Inosine monophosphate dehydrogenase
FT                   catalyzes the first step of GMP biosynthesis member of a
FT                   four-gene family in S. cerevisiae constitutively expressed"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88749"
FT                   /db_xref="GOA:Q6BMX8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX8"
FT                   /protein_id="CAG88749.1"
FT                   /translation="MVLDASSATSHLQSYSKKDGLDVKTLIDSANFGGLTYNDFLVLPG
FT                   LIDFPSSKVGLDTKLTKKISLRSPFVSSPMDTVTEENMAIHMALLGGIGIIHHNCSPDE
FT                   QAEMVRKVKKYENGFINDPFVISPNETVGDVRNMKAELGFTSFPVTENGKIGGKLVGIV
FT                   TSRDVQFHDNNDSKVSEIMTTELITGEKGIDLSEGNELLRSSKKGKLPIVDASGNLVSL
FT                   ISLTDLQKNQSYPLASKSFDSKQLLCGAAIGTVPNDRERLEKLVAAGLDVVVVDSSNGS
FT                   SIFQLDMLKWIKSKFPELQVIAGNVVTREQAALLIEAGADGLRIGMGSGSICITQEVMA
FT                   CGRPQGTAVYNVTEFANQFGVPCIADGGIGNIGHITKALALGASCVMMGGLLAGTSETP
FT                   GSYFYSDGKRLKSYRGMGSVDAMQQTSTTANASTSRYFSESDKVFVAQGVSGAVVDKGS
FT                   ITKFVPYLYNGLQHSLQDIGTPSLDELRTRVDNGEVRFEFRTASAQFEGGVHGLHSYEK
FT                   RLHN"
FT   gene            <159815..>160360
FT                   /locus_tag="DEHA2F01826g"
FT                   /old_locus_tag="DEHA0F02090g"
FT                   /old_locus_tag="DEHA-IPF8963"
FT                   /old_locus_tag="DEHA-CDS5467.1"
FT   CDS_pept        159815..160360
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01826g"
FT                   /old_locus_tag="DEHA0F02090g"
FT                   /old_locus_tag="DEHA-IPF8963"
FT                   /old_locus_tag="DEHA-CDS5467.1"
FT                   /product="DEHA2F01826p"
FT                   /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
FT                   YOR367W SCP1 Component of yeast cortical actin cytoskeleton
FT                   binds and cross links actin filaments"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88750"
FT                   /db_xref="GOA:Q6BMX7"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX7"
FT                   /protein_id="CAG88750.2"
FT                   /translation="MNYLNYNRYEQKSEQNANTNLDQDLTNSRHQKYTKSEPEIKHWIF
FT                   SVLSTPQSTIDAYSNRSLDLIDILKDGELLCKLGKLLEIPNNPCSKYKSSKMPFVQMEN
FT                   ISFFLKACELIGISHDEIFQTIDLYERKDPYQIIITLISFSRRANEINSTNFPNVIGPK
FT                   IVKIKPPVPKKPINLSAK"
FT   gene            <160739..>161650
FT                   /locus_tag="DEHA2F01848g"
FT                   /old_locus_tag="IPF_8961"
FT   CDS_pept        160739..161650
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01848g"
FT                   /old_locus_tag="IPF_8961"
FT                   /product="DEHA2F01848p"
FT                   /note="similar to uniprot|P10962 Saccharomyces cerevisiae
FT                   YAL025C MAK16 Essential nuclear protein required for normal
FT                   concentration of free 60S ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88751"
FT                   /db_xref="GOA:Q6BMX6"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX6"
FT                   /protein_id="CAG88751.1"
FT                   /translation="MSDEIVWQVINQQFCAFKIKTTKEQNFCRNEYNVSGLCSRQSCPL
FT                   ANSRYATVKNVDGKLYLYMKTAERTHMPSKWWERIRLSKNYNKALSQIDGHLEYWQKFL
FT                   IHKCKQRLTRLTQVAITERRLALREDERHYVGVKHKVKRREENRERKALAAAKIEKAIE
FT                   KELLERLKSGAYGDKPLNVDENIWKKVLGKVDNEEEEEEEDEDDVELESDDESDVGEVE
FT                   YVEDDGDDELVDLEDLEKWLDDSSEESASEESDDESDSEDKSSKRKAAADDKANKRRRR
FT                   PKVEIEYEQEEQEPSIQTNIAA"
FT   gene            <162317..>163720
FT                   /locus_tag="DEHA2F01870g"
FT                   /old_locus_tag="DEHA0F02134g"
FT                   /old_locus_tag="DEHA-IPF8958"
FT                   /old_locus_tag="DEHA-CDS2595.1"
FT   CDS_pept        162317..163720
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01870g"
FT                   /old_locus_tag="DEHA0F02134g"
FT                   /old_locus_tag="DEHA-IPF8958"
FT                   /old_locus_tag="DEHA-CDS2595.1"
FT                   /product="DEHA2F01870p"
FT                   /note="weakly similar to uniprot|Q08417 Saccharomyces
FT                   cerevisiae YOR049C RSB1 Suppressor of sphingoid long chain
FT                   base (LCB) sensitivity of an LCB-lyase mutation and similar
FT                   to CA3607|CaRTA2 Candida albicans CaRTA2 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88752"
FT                   /db_xref="GOA:Q6BMX5"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX5"
FT                   /protein_id="CAG88752.1"
FT                   /translation="MSSMNFESMNWSPSTIPTSTTLRSVAATKSSGLMETLTSATARIH
FT                   TATARPELISLSRNIRGAEASLSILQAEGEIATATDDSVKSMATQAIFNATLNLKDLEW
FT                   EENVYSMRSLSRPANIIYLAVFIITFLYFTLMIWKSRFHWFNVAFFCGIGLEFAGFIGR
FT                   VMSFSDMTDINYYILQLVCLTIAPAFIMGGIYYLFAQLVVVYGREYSILRPMWYSYIFI
FT                   TCDVLSLIIQAGGGGAASYASNNFEDARPGSYVMIAGIAFQVFAMSFFLLFWFHFISQT
FT                   FFKYRPSRNESTDGESKYDPAWKNASVGNFFKMLFNTKSAYAHRTTYLEPYYNPQFAKI
FT                   RTRRLFYWFPLAMTIAVVAVYIRCIYRVVELAQGFSGYLITHEVYIMVLDALMIAITAI
FT                   VFVPFHPVHVFGAKNRIRLAAIKKNLDEASDNPADIADDNTAYDNTAGDNTAYVSAKGS
FT                   IKEENSDSY"
FT   gene            <164192..>165613
FT                   /locus_tag="DEHA2F01892g"
FT                   /old_locus_tag="DEHA0F02156g"
FT                   /old_locus_tag="DEHA-IPF8955"
FT                   /old_locus_tag="DEHA-CDS2039.1"
FT   CDS_pept        164192..165613
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01892g"
FT                   /old_locus_tag="DEHA0F02156g"
FT                   /old_locus_tag="DEHA-IPF8955"
FT                   /old_locus_tag="DEHA-CDS2039.1"
FT                   /product="DEHA2F01892p"
FT                   /note="similar to CA2671|IPF5856 Candida albicans IPF5856"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88753"
FT                   /db_xref="GOA:Q6BMX4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX4"
FT                   /protein_id="CAG88753.1"
FT                   /translation="MAKYLELSMGFEEVAYRGLETNSRRLASHVVRNGNILFEIINTLE
FT                   SVAEHYPTVPMSKEEALSIKLDYSADEAHILKSLKEKIIKLTAEIVDENLDRYKYAMDI
FT                   KAAKENLERSIINSTNFTAAISTIRKSINECVETSKKAIQDNFESFLIQEFVKIHGEGV
FT                   MDISFNVLDVDSAFQKAIESGAYIIKLPQTMSDVHGSVKLATIAVPYTDIHHTLIQNKD
FT                   YSGPFLPNYTKSIIEKPETYMHQLESLPPIRLDCIDHCVENYSWNQMMEHARFYANIFG
FT                   FHKYWSVDEKDVFTGETALKSIVMASSNGKVKMPINEPAKGRKKSQIEEFYDFNGGPGV
FT                   QHIALKTNDIIATVTSLRKRGIEFNPASQKYYDTLKQRLINDDIILKEDFNSIQNLNIL
FT                   VDYDPETRNNASKTCNYILQIFTKPLHDRPTLFIEIIQRRHHNGFGKGTFKGLFETIEA
FT                   QQKLRGTLVSSDKAE"
FT   gene            complement(<165951..>167057)
FT                   /locus_tag="DEHA2F01914g"
FT                   /old_locus_tag="DEHA0F02178g"
FT                   /old_locus_tag="DEHA-IPF8954"
FT                   /old_locus_tag="DEHA-CDS3493.1"
FT   CDS_pept        complement(165951..167057)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01914g"
FT                   /old_locus_tag="DEHA0F02178g"
FT                   /old_locus_tag="DEHA-IPF8954"
FT                   /old_locus_tag="DEHA-CDS3493.1"
FT                   /product="DEHA2F01914p"
FT                   /note="some similarities with uniprot|P36093 Saccharomyces
FT                   cerevisiae YKL043W PHD1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88754"
FT                   /db_xref="GOA:Q6BMX3"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX3"
FT                   /protein_id="CAG88754.2"
FT                   /translation="MTGPGHQIYYNSNNANDSNSDQIVNPSSNSNSNNNMSNTQYANQQ
FT                   SGSPLEPLHSISYHAYPSSRLKNTFNEPNFTFQQMYQSSSQPQEYYNNEYPALINQSPL
FT                   PLSSTIPSSVEAQGQMIGLQQSQPSNYSGANVLFQSDGAVRNSQSQTARVSHSPQSSNS
FT                   THSRNSSASTKRPSFDNSEFVKPDKPRIATTFWEDEKTICYQVEAQGILVSRREDTNYV
FT                   NGTKLLNVAGMTRGKRDGILKTEKTKSVVKVGAMNLKGVWIPFERASEIARNEGIDGLL
FT                   YPLFVKDLKSFYHEKGSMLRHDSYLKSLNSENLSNITLSDVSSPTIQSAIIPSSNNDYH
FT                   DKDIKSIEHHEYFEEKSPSPKGLKAENA"
FT   gene            <168349..>169914
FT                   /locus_tag="DEHA2F01936g"
FT                   /old_locus_tag="DEHA0F02200g"
FT                   /old_locus_tag="DEHA-IPF8953"
FT                   /old_locus_tag="DEHA-CDS2160.1"
FT   CDS_pept        168349..169914
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01936g"
FT                   /old_locus_tag="DEHA0F02200g"
FT                   /old_locus_tag="DEHA-IPF8953"
FT                   /old_locus_tag="DEHA-CDS2160.1"
FT                   /product="DEHA2F01936p"
FT                   /note="similar to uniprot|P47082 Saccharomyces cerevisiae
FT                   YJR001W AVT1 Vacuolar transporter imports large neutral
FT                   amino acids into the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88755"
FT                   /db_xref="GOA:Q6BMX2"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX2"
FT                   /protein_id="CAG88755.2"
FT                   /translation="MSHFSDNDENDCCNHPKERRRSFLDLGGANSLNKFASSYTRAQSY
FT                   LGSSLVETSVVQGTEDDLSPCTSLDDVVTESAIDDSPRGNERALDQINAFSFERNEESS
FT                   LLSRRTSKADSERLITGDSTAPQTIFNCINTLMGIGMLSLPFGFRLSGWVLGTLMLLFS
FT                   SIVTNISAKMLGKILRKYPHLMSYGDIAHLYGGRGINIVVTLVFSFDLLGAMISLIILF
FT                   SDSFHILFPSLQRVLLKGIIVAVLFVLSFLPLSILSLCSLLGIICTSLLIVVIIICGLL
FT                   TSTSPGSLVTPAVTNLWPSEYKYLFLSLGLFMAPWGGHPVFPELYRDMRHRSKFSKCCN
FT                   IAFGITFNLDYLIAAIGFLMFGINCQDSLTKNLMTNKNYPDWVRPLICLFMGLLPVSKL
FT                   PLITRPIITVYESFFKLNQTNYAVIKNGIRQEVYGIKRVLSRVVFCVLLLLVSLIFNSF
FT                   GKVISFLGSAICFTICMTLPLIFYLKFYDDEITVMERLLIKFGILIGVVFSLIGTYGSI
FT                   VIDI"
FT   gene            complement(<170176..>173199)
FT                   /locus_tag="DEHA2F01958g"
FT                   /old_locus_tag="DEHA0F02222g"
FT                   /old_locus_tag="DEHA-IPF8950"
FT                   /old_locus_tag="DEHA-CDS0437.1"
FT   CDS_pept        complement(170176..173199)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01958g"
FT                   /old_locus_tag="DEHA0F02222g"
FT                   /old_locus_tag="DEHA-IPF8950"
FT                   /old_locus_tag="DEHA-CDS0437.1"
FT                   /product="DEHA2F01958p"
FT                   /note="weakly similar to uniprot|Q03735 Saccharomyces
FT                   cerevisiae YML117w and similar to CA2674|IPF5846 Candida
FT                   albicans IPF5846 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88756"
FT                   /db_xref="GOA:Q6BMX1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018835"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX1"
FT                   /protein_id="CAG88756.2"
FT                   /translation="MAPPVTPLDLSYSQSMLPSNLLVNSPYIQQTQNIVPMSPILPRQY
FT                   APPSLNLSHGNLAHHQQQLSQMHSHHQHQNQQHHSQHPHYVPNSPYLTPLSSNSNLEQL
FT                   NLSRTVILKNIDENVSLNELLNSIDFGPIEYCKMYSRPAPERLRDTENLKTCVISFVNS
FT                   KISINFHIKYSKNRYNLNKLKEKLRNSKYLKVSLNESTNASSNGSINNFNSHLNNQDYI
FT                   KLKTLNYILEFNATRCLLIRLHSSEFTSSNIEGIENDVTRQCSKFGEIEDLKISTNETK
FT                   SEVKCLIHFTSIDAAIKSYEFYLKKIQADKQDQIDFEGTDKSKDAIEYLQASFHRDRCD
FT                   RTVIDKPSSGSNTNSPIFSKRQTTTINHNNIIPEDLNEPTPDTEGEELETFGEESVLDD
FT                   QSILENHESIRSSLLSNAKDPQEPSYDQISSKSSSSQNIDQSYISNSSSYMLNTYPSIN
FT                   QSQVRMQIPQVPNNNSASSYQYNPDPFNVGNRTIYLGNLHPNTTVEEIANNVRAGGLVE
FT                   SIRYHPDKRVCFITFIDPTIALKFYLNHQVLHQLIIHGYDITVGWAKNHSGALNRDISL
FT                   AVTAGASRNVYIGIKLNKDENNGSSSTTKDNKIRLPNESVLRSDFSKFGELEQINFYHN
FT                   KDCGFLNFINIADAIKLVDSFESRNISKINKIVGDNGEFYDKYNVFKISFAKDRCGNPP
FT                   KFSFKKKFGKRKNKDLAKPEDDSVIGKLDHNEDGRDEVRDEAMNEEAAMVFGIMSTTES
FT                   KKEVSTSNEDEEPEETRKAFEQSDITISGKAEKENNKNEKYEKTQANIKDVKSEIPGAA
FT                   DEDDEDDEDEDDISIIIGSDETTYSARDELKKSRNSGDKFYNNKVNTSDTFIPFRKSSR
FT                   NSSNISLNSHNPNYMKYYNQDSKFPPSPYHHHQQQSQHQQLYYMQNSQRPMASRMNSFG
FT                   YGGYYPPPNPNPNQYTYTANPSKNPYSTSGSQVMSQYLAKSQHDNLVYAASILSNDVGM
FT                   DEDKEYHYKPNSRRNSKK"
FT   gene            <174737..>175381
FT                   /locus_tag="DEHA2F01980g"
FT                   /old_locus_tag="DEHA0F02244g"
FT                   /old_locus_tag="DEHA-IPF8945"
FT                   /old_locus_tag="DEHA-CDS5218.1"
FT   CDS_pept        174737..175381
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01980g"
FT                   /old_locus_tag="DEHA0F02244g"
FT                   /old_locus_tag="DEHA-IPF8945"
FT                   /old_locus_tag="DEHA-CDS5218.1"
FT                   /product="DEHA2F01980p"
FT                   /note="highly similar to uniprot|P32835 Saccharomyces
FT                   cerevisiae YLR293C GSP1 GTP binding protein (mammalian Ranp
FT                   homolog) involved in the maintenance of nuclear
FT                   organization RNA processing and transport"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88757"
FT                   /db_xref="GOA:Q6BMX0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002041"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMX0"
FT                   /protein_id="CAG88757.1"
FT                   /translation="MAQEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVH
FT                   PLGFHTNFGELKFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPNWHRD
FT                   LVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR
FT                   KLVGNPQLEFVASPALAPPEVQVDADLMQRYQQEMEQATALPLPDEDDADL"
FT   gene            complement(<175832..>176146)
FT                   /locus_tag="DEHA2F02002g"
FT                   /old_locus_tag="DEHA0F02266g"
FT                   /old_locus_tag="DEHA-IPF8944"
FT                   /old_locus_tag="DEHA-CDS7228.1"
FT   CDS_pept        complement(175832..176146)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02002g"
FT                   /old_locus_tag="DEHA0F02266g"
FT                   /old_locus_tag="DEHA-IPF8944"
FT                   /old_locus_tag="DEHA-CDS7228.1"
FT                   /product="DEHA2F02002p"
FT                   /note="similar to CA2676|CaYHC1 Candida albicans CaYHC1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88758"
FT                   /db_xref="GOA:Q6BMW9"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW9"
FT                   /protein_id="CAG88758.2"
FT                   /translation="MSVRKSHLMGKNHIRYYCNYYEMKAKETGIWDPLDSMYEINLSYL
FT                   NKGAPGASNEGNTSSSKGDFSLPPPPSLTNYPNPPPSAFRNTEEYQQSVTEHTQNQETY
FT                   "
FT   gene            <176436..>176882
FT                   /locus_tag="DEHA2F02024g"
FT   CDS_pept        join(176436..176453,176574..176882)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02024g"
FT                   /product="DEHA2F02024p"
FT                   /note="weakly similar to uniprot|Q12349 Saccharomyces
FT                   cerevisiae YLR295c ATP14 F1F0-ATPase complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88759"
FT                   /db_xref="GOA:Q6BMW8"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW8"
FT                   /protein_id="CAG88759.1"
FT                   /translation="MFRQSVRSLSARRLFSISPQRSNLVSDLYIQQIKAFKPTPLSNKD
FT                   AESSIKSFQLPNKPSVPESEISADALSQYESSDVETAATEPSSAAEPAAEEDWFVFEEE
FT                   EVHH"
FT   gene            <177614..>178867
FT                   /locus_tag="DEHA2F02046g"
FT                   /old_locus_tag="DEHA0F02310g"
FT                   /old_locus_tag="DEHA-IPF8942"
FT                   /old_locus_tag="DEHA-CDS3019.1"
FT   CDS_pept        177614..178867
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02046g"
FT                   /old_locus_tag="DEHA0F02310g"
FT                   /old_locus_tag="DEHA-IPF8942"
FT                   /old_locus_tag="DEHA-CDS3019.1"
FT                   /product="DEHA2F02046p"
FT                   /note="similar to uniprot|Q59P70 Candida albicans Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88760"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW7"
FT                   /protein_id="CAG88760.1"
FT                   /translation="MASESPYLDTESILNASDLINSTLISKGYITEKLNFNSINWKDLV
FT                   QDQIENNIQELAKLDELKVTETIYNNDKNIINIIYSLLQSIERNKAQNKSFNKVISKKD
FT                   STIRDLQKKIESLEHQVDQSESRLNRFVQIDQLQLSKRVQDLSHVNKLQTQDLNKLKNW
FT                   CTDIKTKYHVKLKKKNIEIDHLKNQLLDKKNLSTTTTFGIPLSYDSSRNNDTTSFDQDI
FT                   NSNIIYNHNPIIDNTNPNTHLNSSLQPVLNKQYEQIVIDLTQLIENLISENHKFSRFIK
FT                   LINNYYQSLNIQLSNINHKHLDVRSLPNPSDLIDLNEFTGDLDPANINSKDSLDEIESF
FT                   EYITKPLLNNVYKNYHYVSNLVELVDSNSAQINENENGFSSKKIDELKTELEIVTRNWQ
FT                   DAIKTLENWKNYQQTNDD"
FT   gene            complement(<178926..>180167)
FT                   /locus_tag="DEHA2F02068g"
FT                   /old_locus_tag="DEHA0F02332g"
FT                   /old_locus_tag="DEHA-IPF8941"
FT                   /old_locus_tag="DEHA-CDS3068.1"
FT   CDS_pept        complement(178926..180167)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02068g"
FT                   /old_locus_tag="DEHA0F02332g"
FT                   /old_locus_tag="DEHA-IPF8941"
FT                   /old_locus_tag="DEHA-CDS3068.1"
FT                   /product="DEHA2F02068p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88761"
FT                   /db_xref="GOA:Q6BMW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW6"
FT                   /protein_id="CAG88761.2"
FT                   /translation="MASNSVVIGSIIGAVIGTCFLLSFVMILYCYWCCVIYVKSPQDEY
FT                   NVSDLHFRDKQKTTHTLRHMFKAMSWIYGGSRSKDLEDQIDIDKPPSSVTNCDTNLNSN
FT                   STFSRLALKSYTLPSEDGETPQVCMGNVKDVNIIPCFNKDDTTSYSSVYKDAIDRFDLS
FT                   DGLASTNVDRRNSLKAKHLSNIRRMSSLTYRMDDSEPSNFVTTVAKPSESEQSYISDQY
FT                   DSFTRTLMLQNLIGNSVNAIKKNVIRELYDPYSENLISVGGIVVVVKPFDGVNDFEFNS
FT                   LQTGDLLRVVRFYVKGELDIDKSKMKHDEDSIDIAESRNNSSTDATIRSGICIGRSDPN
FT                   YNSVYCTGILLNTYLEYNKQTRDLSLRLKKDAEENEFELLKDFPLRIVSLETTVLKKVS
FT                   ESSVAKDKFENHFS"
FT   gene            complement(<180297..>180839)
FT                   /locus_tag="DEHA2F02090g"
FT                   /old_locus_tag="DEHA0F02354g"
FT                   /old_locus_tag="DEHA-IPF8939"
FT                   /old_locus_tag="DEHA-CDS4870.1"
FT   CDS_pept        complement(180297..180839)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02090g"
FT                   /old_locus_tag="DEHA0F02354g"
FT                   /old_locus_tag="DEHA-IPF8939"
FT                   /old_locus_tag="DEHA-CDS4870.1"
FT                   /product="DEHA2F02090p"
FT                   /note="weakly similar to uniprot|Q05863 Saccharomyces
FT                   cerevisiae YLR281c and similar to CA2325|IPF10977 Candida
FT                   albicans IPF10977 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88762"
FT                   /db_xref="GOA:Q6BMW5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW5"
FT                   /protein_id="CAG88762.2"
FT                   /translation="MPRNSSFRIPVRCFVSTSYVNYAIPKKNKMPPRPKWLIVEEEIDE
FT                   AFLKGGRGPGGQKINKSNSKVQLTHKPTGLVVTCQYSRSQEQNRKRAREILALKLDELQ
FT                   NPEGCRTAIVNERKTKTKQGKTKKANKKYKVLDEERMKTKEEEHEILSNFIDIDAEFDS
FT                   HVKSTLNSTTTGEKGPV"
FT   gene            <181112..>183310
FT                   /locus_tag="DEHA2F02112g"
FT                   /old_locus_tag="DEHA0F02376g"
FT                   /old_locus_tag="DEHA-IPF8937"
FT                   /old_locus_tag="DEHA-CDS1022.1"
FT   CDS_pept        181112..183310
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02112g"
FT                   /old_locus_tag="DEHA0F02376g"
FT                   /old_locus_tag="DEHA-IPF8937"
FT                   /old_locus_tag="DEHA-CDS1022.1"
FT                   /product="DEHA2F02112p"
FT                   /note="highly similar to uniprot|P29496 Saccharomyces
FT                   cerevisiae YLR274W CDC46 Component of the hexameric MCM
FT                   complex which is important for priming origins of DNA
FT                   replication in G1 and becomes an active ATP-dependent
FT                   helicase that promotes DNA melting and elongation when
FT                   activated by Cdc7p-Dbf4p in S-phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88763"
FT                   /db_xref="GOA:Q6BMW4"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008048"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW4"
FT                   /protein_id="CAG88763.2"
FT                   /translation="MSYERSEVYGAQVLPGEDPEDNSFNEITKAFRSFILEFRLNSQFI
FT                   YRDQLRENLLIKNYFLKVNSEHLIGFNEELNKKLTDDPAEMIPLFENAITDIGKRIAYL
FT                   SNEEVPTDFPNCQLILFSNASKTSIRDLDSDHISKIVRVSGIIISSSVLSSRATQVQLL
FT                   CRNCKHTMRQKISSGFGSLNLPNRCQGTHNFDDTSTQDKCPSDPYTIVHDKSTFIDQQV
FT                   LKLQESPDMVPVGEMPRHIILQADRYMTNQVVPGTRVTIVGIYSIYQAKQKSSSNVNTV
FT                   AIRNPYLKILGIQTDVDNSISGQGLTFTEEEEEEFLKISRLPNLYDVFSKSIAPSIYGN
FT                   EDIKKAITCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKISPISVYTS
FT                   GKGSSAAGLTASVQRDQVTRDFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQ
FT                   QTISIAKAGITTILNSRTSVLAAANPIFGRYDDLKSPGENIDFQTTILSRFDMIFIVKD
FT                   DHNEARDISIAQHVMNVHTGNANNNQDQNQEGEIPIDVMKRYIQYVKLKCAPRLSPEAS
FT                   ERLSSHFVSIRRRLQINEVEMNERSSIPITIRQLEAIIRITESLAKLRLSPIALEEHVE
FT                   EAIRLFTASTMDAVDQGVSSGGLITTGDMNKEINKVEQELRRRLPIGWSTAYKTLRREI
FT                   VDSGKASPGALDKALYILERHEVIRFRHQRQNILRCGV"
FT   gene            <183570..>186017
FT                   /locus_tag="DEHA2F02134g"
FT                   /old_locus_tag="DEHA0F02398g"
FT                   /old_locus_tag="DEHA-IPF8936"
FT                   /old_locus_tag="DEHA-CDS0793.1"
FT   CDS_pept        183570..186017
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02134g"
FT                   /old_locus_tag="DEHA0F02398g"
FT                   /old_locus_tag="DEHA-IPF8936"
FT                   /old_locus_tag="DEHA-CDS0793.1"
FT                   /product="DEHA2F02134p"
FT                   /note="similar to uniprot|Q06224 Saccharomyces cerevisiae
FT                   YLR277C YSH1 subunit of Polyadenylation factor I (PF I)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88764"
FT                   /db_xref="GOA:Q6BMW3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMW3"
FT                   /protein_id="CAG88764.2"
FT                   /translation="MTVDSQPADGTDDFKFFGLGGCNEVGRSCHIIEYKNKVIMLDAGV
FT                   HPGLQGLSSLPFYDEYDLSKVDILLVSHFHLDHAASLPYVMQHTNFNGRVFMTHATKAI
FT                   YRWLLSDFVKVTSIGGGSDARLNNSDPNANTGSSNLYTDDDLMRSFDRIETIDYHSTIE
FT                   LDGIRFTAYHAGHVLGACMYFIEIGGLKVLFTGDYSSEEDRHLQVAEVPPIKPDILITE
FT                   STFGTATHEPRLEKETRMTNIIHSTLLKGGRILMPVFALGRAQELLLILEEYWSLNDDL
FT                   QNINIYYASSLARKCMAVYQTYTNIMNDSIRLTTSATNSSKKQNPFQFKFIKSIKNLDK
FT                   FQDFGPCVVVASPGMLQNGVSRELLERWAPDPKNAVIMTGYSVEGTMAKDLLTEPHTIQ
FT                   SAMNSDMTIPRRLSIEEISFAAHVDFQQNASFIEKVNPSKIILVHGESNPMGRLKSALL
FT                   SKYASRKGTEQEVKVFNPRNCDEVTIGIKGLKVAKVLGTLAEEQLSYLKKEISTQIKKD
FT                   NVKIEELSDDNMDKETMPESDEKADKESEDTKNDIDKNNDENANEKNIISTGKALSGVL
FT                   VSKDFDLNLLQLQDLHEFTQLSTSIVKSKINLKINADISLMKWHLEQMFGFISILADDE
FT                   ETWECVIMDMIDISVEKNNSQSAGGLLINVEWVNDNLMADSLADSVIAILYSIDSSPAS
FT                   VKLTSKSCSHSHNKVKEEVDDDAMIESTPPPEKNAHANSEISSRIHRITSLLKAQFGDS
FT                   LKTAAGEEGKKATIVIGKNEAKIDYLNLTVDCNSRVLRDRIENIIKRGCGLAAPLSQYE
FT                   KTT"
FT   gene            <186181..>186589
FT                   /locus_tag="DEHA2F02156g"
FT   CDS_pept        join(186181..186185,186247..186589)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02156g"
FT                   /product="DEHA2F02156p"
FT                   /note="similar to uniprot|Q06217 Saccharomyces cerevisiae
FT                   YLR275w SMD2 U1 snRNP protein of the Sm class"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88765"
FT                   /db_xref="GOA:Q6BMW2"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW2"
FT                   /protein_id="CAG88765.1"
FT                   /translation="MAELIDRPRSELTELELQKLEEFEFTHGPMSLLQNAVNNGSPVVI
FT                   SCRNNHKLIAKVKAFDRHCNLILENVKELWTESVKNNKGKKIKSTSKERFVSKMFLRGD
FT                   SVVIVLKAQAS"
FT   gene            <187071..>188057
FT                   /locus_tag="DEHA2F02178g"
FT                   /old_locus_tag="DEHA0F02442g"
FT                   /old_locus_tag="DEHA-IPF8933"
FT                   /old_locus_tag="DEHA-CDS3938.1"
FT   CDS_pept        187071..188057
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02178g"
FT                   /old_locus_tag="DEHA0F02442g"
FT                   /old_locus_tag="DEHA-IPF8933"
FT                   /old_locus_tag="DEHA-CDS3938.1"
FT                   /product="DEHA2F02178p"
FT                   /note="weakly similar to uniprot|Q02574 Saccharomyces
FT                   cerevisiae YLR288C MEC3 Involved in checkpoint control and
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88766"
FT                   /db_xref="GOA:Q6BMW1"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="InterPro:IPR016580"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW1"
FT                   /protein_id="CAG88766.2"
FT                   /translation="MKLKLRTQNIEALKTTLSLISHIRKFVILRFTPTQLLIISVNGSS
FT                   ITQEPQVWCKLQINNMFDQIEIQSLRDNTISLEINIEQLLQTLHNFNRANSDGLNIRLQ
FT                   KKDTSGGQGINISNGRIASLALFYSNININSNAINHTFRLPVKILKNTDDIMLLKEPEL
FT                   TEVDLMMRLPKEFLSTYKRLEKFKKTSSNDLVNIKSSRRNGGFLGFVLEEDGKFKVTIS
FT                   WNDKLEVQKPNRSNFDGESLRLANLHNPGSVLSQDVDEDDIHEDKEILVRLKDWKMASK
FT                   IVATCKTVIFLLTHKEACVLHCLLDDTDDVEIIYYISGVKIRDILDN"
FT   gene            <188271..>189452
FT                   /locus_tag="DEHA2F02200g"
FT                   /old_locus_tag="IPF_8931"
FT   CDS_pept        188271..189452
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02200g"
FT                   /old_locus_tag="IPF_8931"
FT                   /product="DEHA2F02200p"
FT                   /note="similar to uniprot|P33330 Saccharomyces cerevisiae
FT                   YOR184w SER1 phosphoserine transaminase and highly similar
FT                   to CA2320|CaSER1 Candida albicans CaSER1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88767"
FT                   /db_xref="GOA:Q6BMW0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMW0"
FT                   /protein_id="CAG88767.1"
FT                   /translation="MAQERTLNREEPHYFGAGPALLPTSVLQEAAYDLITYGDENIGVG
FT                   EISHRSKPAIGIIDSTKEKLSELMNIPDTHEVFFMQGGGTTGFSSIVYNLMANYTKRTG
FT                   KKGKAAYAITGSWSAKAAEESKRLGFETDIVVNTKNRKYGDIPPYSEWKSIDKESTAYL
FT                   YVCDNETVNGNEFQDTPGPNYLPEGVELVSDMSSNILSKEIDVSKYGLIMAGAQKNIGL
FT                   AGLTIYIIKKSLLEQASDEELNSKNIPLTPIAFHYPTVVKNNSAYNTIPIFTCHMINLV
FT                   LKKLQDAGGVSAMEKTNEQKAKTLYGALENYPNFYKMPVTNRSVRSRMNVVFNLPNADL
FT                   EAKFVSEAAERKLTGLKGHRSVGGIRASIYNAVSLESVELLVKFVNDFAEANK"
FT   gene            <189685..>191595
FT                   /locus_tag="DEHA2F02222g"
FT                   /old_locus_tag="DEHA0F02508g"
FT                   /old_locus_tag="DEHA-IPF8929"
FT                   /old_locus_tag="DEHA-CDS1563.1"
FT   CDS_pept        189685..191595
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02222g"
FT                   /old_locus_tag="DEHA0F02508g"
FT                   /old_locus_tag="DEHA-IPF8929"
FT                   /old_locus_tag="DEHA-CDS1563.1"
FT                   /product="DEHA2F02222p"
FT                   /note="similar to uniprot|P46943 Saccharomyces cerevisiae
FT                   YLR289w GUF1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88769"
FT                   /db_xref="GOA:Q6BMV8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV8"
FT                   /protein_id="CAG88769.2"
FT                   /translation="MSMKKTAAVEDKKISLDKESYIKSVQERIAKIPISNYRNFSIVAH
FT                   VDHGKSTLSDRLLELTGVIQPGDANKQVLDKLDVERERGITVKAQTCSMFYVDPKSKEE
FT                   YLLHLVDTPGHVDFRAEVSRSYASCGGALLLIDASQGVQAQTVANFYLAYSMGLKLIPV
FT                   INKIDLDAADIPRAMDQVETTFELPREDCIPVSAKTGLNIENIIPAIIRDIPGPRGSVD
FT                   KPLKALLVDSWHDPYVGVVMLIHVVDGVVKKGMKLLSAHSEKRYDVKEVGIMYPDKMPM
FT                   DCVKAGQVAYIIPGMRNPREAMIGDTFYQYGKHEGLEPLPGFEEPKPMVFVGAFPADGG
FT                   EFKVMNDHMENLVLNDRSVTLEKETSNALGLGWRLGFLGSLHASVFKERLENEYGAKII
FT                   LTAPTVPYKLIFKDGEESIVTNPDEFPGADFRNHNIEMLMEPYVNALMTIPDEYIGTVM
FT                   SLCENNRGIQKELEYLTTGQVLLKYEIPLAQLVEDFFGKLKGCTKGYASLDYEDAGYKK
FT                   SDIVKMELCVNGEPQDALTQVMHRSQVLSRGKEYVTRFKEYLKFQLFEVAIQAKVNNKV
FT                   VARETIKAKRKDVTQKLHAADISRRKKLLSRQKEGKKQMKATGKISINQEAYQAFLRRA
FT                   D"
FT   gene            complement(<191719..>193437)
FT                   /locus_tag="DEHA2F02244g"
FT                   /old_locus_tag="DEHA0F02530g"
FT                   /old_locus_tag="DEHA-IPF8928"
FT                   /old_locus_tag="DEHA-CDS2127.1"
FT   CDS_pept        complement(191719..193437)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02244g"
FT                   /old_locus_tag="DEHA0F02530g"
FT                   /old_locus_tag="DEHA-IPF8928"
FT                   /old_locus_tag="DEHA-CDS2127.1"
FT                   /product="DEHA2F02244p"
FT                   /note="similar to uniprot|P00927 Saccharomyces cerevisiae
FT                   YER086W ILV1 Threonine deaminase catalyzes the first step
FT                   in isoleucine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88770"
FT                   /db_xref="GOA:Q6BMV7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMV7"
FT                   /protein_id="CAG88770.2"
FT                   /translation="MMIARNLLKGIHKPVNRRVCIPKIGSLTSAKFYSTQSTVQQFPEL
FT                   QEADFTPEGEPDYIKLILTSRVYDVVDEGGSPLTHAVNLSQKCNTNIFLKREDLLPVFS
FT                   FKLRGAYNMIAHLHSNSKSPVSGVIACSAGNHAQGVAFSASKLKIQSTIVMPTATPSIK
FT                   YKNVSRLGSQVVLYGDDFDSAKKECDRLSSLNGLTNIPPFNHPYVIAGQGTIALEITRQ
FT                   LRLDKLDALFVPVGGGGLIAGIAVYLKKIAPHVKIIGVETFDADALYQSLQNHQSKTLD
FT                   QVGVFADGTAVKVLGDETWKLCHKYVDEVVRVSTDELCAAIKDIFEDTRSIVEPSGALS
FT                   VAGLKRYLSDNSEIDHRNKNYVPILSGANMNFDRLRFVSERAVLGEGKEVSLAVTIPER
FT                   PGEFAILQNIIDPRAITEFSYRFNNSGPANIFVSFNVTNKDKELAPIVESMKSNDYEVI
FT                   DISENELAKTHGRYLVGGKSTTANCNKISKERLFRFEFPERPGALTKFLQTLKYDWDIT
FT                   LFHYRNHGHDVGKILCGFVLPEGTSDEDFQDFLKKIGYNFVDETDNVVYKKFLQS"
FT   gene            <194046..>195059
FT                   /locus_tag="DEHA2F02266g"
FT                   /old_locus_tag="DEHA0F02552g"
FT                   /old_locus_tag="DEHA-IPF8927"
FT                   /old_locus_tag="DEHA-CDS3831.1"
FT   CDS_pept        194046..195059
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02266g"
FT                   /old_locus_tag="DEHA0F02552g"
FT                   /old_locus_tag="DEHA-IPF8927"
FT                   /old_locus_tag="DEHA-CDS3831.1"
FT                   /product="DEHA2F02266p"
FT                   /note="some similarities with CA2317|IPF13586 Candida
FT                   albicans IPF13586 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88771"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMV6"
FT                   /protein_id="CAG88771.1"
FT                   /translation="MDSQLQYNISELVQFMDQCNDSNVVTSYSGLNHVNSPTAFNYTAQ
FT                   YELESKSGNEQQKSVRQESNAQHFSAMSFFPLHTSPKIQVLNLRDQEYKEIQKNCRFSK
FT                   VVEDVHATAPTDLRETLNYDELFDTFINSEVDIQTLKDSVGVLRTHSPLPLPLPLTPKP
FT                   TPNINMKDSMSRSYVFENENSKDRSYFDVADERDVGRIFRYPDNSNQIFNIGTLKLASN
FT                   SYKEAKVVSASVNKTIDDEFELKSKYFRSFDNSLKRRQKSQSEEIRSKIRKRNNPTTDE
FT                   VEWKPLSIFTVYTNFKPEAIDDTDYFENIPQTSCFGRLNMRVKRAWTRGPNKAKLK"
FT   gene            complement(<195632..>195940)
FT                   /locus_tag="DEHA2F02288g"
FT                   /old_locus_tag="DEHA0F02574g"
FT                   /old_locus_tag="DEHA-IPF8926"
FT                   /old_locus_tag="DEHA-CDS6941.1"
FT   CDS_pept        complement(195632..195940)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02288g"
FT                   /old_locus_tag="DEHA0F02574g"
FT                   /old_locus_tag="DEHA-IPF8926"
FT                   /old_locus_tag="DEHA-CDS6941.1"
FT                   /product="DEHA2F02288p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88772"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMV5"
FT                   /protein_id="CAG88772.2"
FT                   /translation="MRMITRDQGPLSESIHVLRNESEAARIEHKEKRKLQDKKQLTEKL
FT                   ECFLCWPSLSLTQVIKILRVSEDLTLTQLIIIVGRNMTGRAETWYLELKENYMNISL"
FT   gene            <196481..>196554
FT                   /locus_tag="DEHA2F02310r"
FT                   /old_locus_tag="Deha0F.1"
FT   tRNA            196481..196554
FT                   /locus_tag="DEHA2F02310r"
FT                   /old_locus_tag="Deha0F.1"
FT                   /note="tRNA Ile (AAT) cove score=72.18"
FT   gene            <196573..>196645
FT                   /locus_tag="DEHA2F02332r"
FT                   /old_locus_tag="Deha0F.2"
FT   tRNA            196573..196645
FT                   /locus_tag="DEHA2F02332r"
FT                   /old_locus_tag="Deha0F.2"
FT                   /note="tRNA Ala (AGC) cove score=72.43"
FT   gene            <196917..>198716
FT                   /locus_tag="DEHA2F02354g"
FT                   /old_locus_tag="DEHA0F02640g"
FT                   /old_locus_tag="DEHA-IPF8925"
FT                   /old_locus_tag="DEHA-CDS1708.1"
FT   CDS_pept        196917..198716
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02354g"
FT                   /old_locus_tag="DEHA0F02640g"
FT                   /old_locus_tag="DEHA-IPF8925"
FT                   /old_locus_tag="DEHA-CDS1708.1"
FT                   /product="DEHA2F02354p"
FT                   /note="weakly similar to uniprot|P38687 Saccharomyces
FT                   cerevisiae YPL243W SRP68 Component of the signal
FT                   recognition particle (SRP) ribonucleoprotein (RNP) complex
FT                   that functions in protein targeting to the endoplasmic
FT                   reticulum (ER) membrane and similar to CA5902|CaSRP68
FT                   Candida albicans CaSRP68"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88773"
FT                   /db_xref="GOA:Q6BMV4"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV4"
FT                   /protein_id="CAG88773.2"
FT                   /translation="MEYPLIVTLGARMSAYLSSSEDYHKQRKRLNKRLLKLRHELDLIT
FT                   PDTKDYKKKEKISKISSSDYDQDEKYGLLLLLTAERDSLYSSEIKSLLEISNDNASSYR
FT                   NLMISRIKKSLSSSKKLLEITVNEKDEYKRIEYYTYAALIQGNLSVNKKQWSKALNAFS
FT                   IAKCALDFLYSQEDSKMDIEEEQEESTQFKKTLISEITETLVDPSLALAISQDDTAYST
FT                   TTDLKTVSRQHCRDNKLSYLQPVIEIIARIDPEAVSEVSSSTELIKSVQWRDHEATLYN
FT                   DELAYKIMKLTNDNETNWKNFNDANQFDVLLSGWSELLEIHTNDMDKNKDEDDLEKVQD
FT                   RAIVLTYINFNLLFTRLKRDLLIIDQLSSQGDNVFALKKLEFNKDIIRLYGTIITTTQE
FT                   IKDLPGVYNDEDLHESLDNLEKFFVAKKSAVLARSFALNNKFPEALKIFDHVDNTLSSS
FT                   DNKFYKIDEFPYNVSSNVEFEKFKKELPSQVLQAQILAQFSVDLSKNLNQSNFVIENMN
FT                   KYPVSNETLDNIANFNKNLSIAPVLSKPVLFDIGFNYINYGMGRSSSYNNSNSATSTTS
FT                   DSTTDQNDPNKKKSGFFGIFGRS"
FT   gene            <198879..>199943
FT                   /locus_tag="DEHA2F02376g"
FT                   /old_locus_tag="IPF_8924"
FT   CDS_pept        198879..199943
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02376g"
FT                   /old_locus_tag="IPF_8924"
FT                   /product="DEHA2F02376p"
FT                   /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
FT                   YPL244C HUT1 Protein with a role in UDP-galactose transport
FT                   to the Golgi lumen has similarity to human UDP- galactose
FT                   transporter UGTrel1 exhibits a genetic interaction with S.
FT                   cerevisiae ERO1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66257"
FT                   /db_xref="GOA:Q6BMV3"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV3"
FT                   /protein_id="CAR66257.1"
FT                   /translation="MKKEGGGSIITLAACILGLYASFLTWSVLQERISTKPYGSNPDTG
FT                   SPDFFKAPLVINIIQAFFASIVGLIYSVVSSRSNPLSIFTQNEKPVALKFFKSFVIISL
FT                   TSSLSSPLGYESLKHVDYLAYLLAKSCKLIPVMLVHFVLYRTKFPLYKCMVAGSVTVGV
FT                   IIFTLSHSSTKSKADISDGKTALGMAQLIGSMLLDGLTNSTQDQLFKLRGTSPSNKHTK
FT                   LTGAYLMCILNAFIFINTLAYALIFKYQSEITYTVNFVHHYPQVMMNILEFAILGSVGQ
FT                   VFVFIILEKFDSLILITSTVTRKMISMILSVVLFGHQLNGLQWGGVGLVFGGIGYEALV
FT                   KMSMNKAPTTKKNQ"
FT   gene            <200078..>201295
FT                   /locus_tag="DEHA2F02398g"
FT                   /old_locus_tag="IPF_8922"
FT   CDS_pept        200078..201295
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02398g"
FT                   /old_locus_tag="IPF_8922"
FT                   /product="DEHA2F02398p"
FT                   /note="weakly similar to uniprot|P42836 Saccharomyces
FT                   cerevisiae YNL326c PFA3 Palmitoyltransferase for Vac8p one
FT                   of three yeast DHHC-cysteine rich domain proteins (Pfa3p
FT                   Erf2p Akr1p) with palmitoyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66258"
FT                   /db_xref="GOA:Q6BMV2"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMV2"
FT                   /protein_id="CAR66258.1"
FT                   /translation="MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVYA
FT                   LIVHGCYDTLMTTQETSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRIRN
FT                   ILSLSKPKYNSANPYDTNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLKSNN
FT                   SSYRYCTKCSVWKPDRCHHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMYLTAY
FT                   SGFDFVVSLSILWKFFADEKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYLVFRNK
FT                   TTIEFQENRWNFKNDKNGKSFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPSWYYWLL
FT                   PVTVTNKSIDARLENGINFEIDQDVYDRWCYNAQLQDQLNQQLADYKNRIRMEREANQT
FT                   TDTNPF"
FT   gene            <201635..>203128
FT                   /locus_tag="DEHA2F02420g"
FT                   /old_locus_tag="DEHA0F02706g"
FT                   /old_locus_tag="DEHA-IPF8921"
FT                   /old_locus_tag="DEHA-CDS2328.1"
FT   CDS_pept        201635..203128
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02420g"
FT                   /old_locus_tag="DEHA0F02706g"
FT                   /old_locus_tag="DEHA-IPF8921"
FT                   /old_locus_tag="DEHA-CDS2328.1"
FT                   /product="DEHA2F02420p"
FT                   /note="similar to uniprot|P32561 Saccharomyces cerevisiae
FT                   YNL330C RPD3 Histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88776"
FT                   /db_xref="GOA:Q6BMV1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMV1"
FT                   /protein_id="CAG88776.1"
FT                   /translation="MYVQLPFDDLKVDPTQKKRVAYFYDADVGNYAYGAGHPMKPHRIR
FT                   MAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVSPDNLDMFAKEQIKFN
FT                   VGDDCPVFDGLFEYCGISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLN
FT                   DIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRD
FT                   IGVGKGKYHAINVPLRDGIDDATYKSIFEPVISKVMEWYQPSAIVLQCGGDSLSGDRLG
FT                   CFNLSMSGHANCINFVKSFNVPMMVVGGGGYTMRNVARTWSFEAGLLNNVVLPSELPYN
FT                   EYYEYYGPDYKLDVRPSNMYNANSPEFLNKILTNILTNLENTKHAPSVQMNYVPNDAED
FT                   LGDIDEDTQEAIDTKGGSQQARDEITQPDNEFYEDDDKDAGSRDIQNFSKSASASESKP
FT                   AELETTAQPETLEEPEDEKMLTDEELKEINELNSNENNA"
FT   gene            <203514..>204929
FT                   /locus_tag="DEHA2F02442g"
FT                   /old_locus_tag="DEHA0F02728g"
FT                   /old_locus_tag="DEHA-IPF8920"
FT                   /old_locus_tag="DEHA-CDS2557.1"
FT   CDS_pept        203514..204929
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02442g"
FT                   /old_locus_tag="DEHA0F02728g"
FT                   /old_locus_tag="DEHA-IPF8920"
FT                   /old_locus_tag="DEHA-CDS2557.1"
FT                   /product="DEHA2F02442p"
FT                   /note="similar to uniprot|Q06892 Saccharomyces cerevisiae
FT                   YPL188w POS5 Mitochondrial NADH kinase phosphorylates NADH"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88777"
FT                   /db_xref="GOA:Q6BMV0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMV0"
FT                   /protein_id="CAG88777.2"
FT                   /translation="MMLKTWKIPQYSYISNGIRMTHIGQLRFTRNISSSLMRKSDILMS
FT                   NDLLTIKSCKHLRNSTFPEFVRSPNSQLSNIIWNSPLENIYVVKKPWDQDVRDATVRFI
FT                   THIHDNYPSVNVVVSEDVADEIIHETNTGGSVTSILKKQSPKFSSNSKYVIYTGELSQI
FT                   VNKTDLIVTLGGDGTILRAVSTFSNANVPPVLSFALGTLGFLLPFDFSTFSESFRMVYE
FT                   SRGKALHRHRLECHVVRKSLNESTQTPITDATPIKNIRQSESGISPQENVTTMLHAMND
FT                   ISLHRGSQPNLISLDIYIDNEFLTTTTGDGLVFSTPTGSTAYSLSAGGSITHPLVPCII
FT                   LTPICPRSLSFRPLILPASSHIVIKLSDKNRNASIKLNIDGISQQDLQPGDQIHVAGEN
FT                   DSALATSSRSEKVSGSTSENEQTDSTDSTPSSKQDLCQKGIWCVARSENDWTKDINELL
FT                   GFNSSFKASKSKL"
FT   gene            <205824..>207950
FT                   /locus_tag="DEHA2F02464g"
FT                   /old_locus_tag="DEHA0F02750g"
FT                   /old_locus_tag="DEHA-IPF8916"
FT                   /old_locus_tag="DEHA-CDS1111.1"
FT   CDS_pept        205824..207950
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02464g"
FT                   /old_locus_tag="DEHA0F02750g"
FT                   /old_locus_tag="DEHA-IPF8916"
FT                   /old_locus_tag="DEHA-CDS1111.1"
FT                   /product="DEHA2F02464p"
FT                   /note="similar to uniprot|P14922 Saccharomyces cerevisiae
FT                   YBR112C CYC8 General transcriptional co-repressor acts
FT                   together with Tup1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88778"
FT                   /db_xref="GOA:Q6BMU9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU9"
FT                   /protein_id="CAG88778.1"
FT                   /translation="MATSIPVQMTMGNNGHKQANGSIPVPSPQPVAPPTNPSNILMETT
FT                   AGTWLAIGSLAESLGDVEKALASYDSALRHSPNNPEILTKLANMYRSKDVFFKAAELYE
FT                   QALNFHPENGETWGLLGHCYLMLDDLQRAYAAYQRALYYLDNPNVPKLWHGIGILYDRY
FT                   GSLEYAEEAFVRVLELDPNFDKSNEIYFRLGIIYKHQGKLQSALECFQYILTNPPHPLT
FT                   QPDVWFQIGSVLEQQKDWNGAKEAYEKVLQVNPQHAKVLQQLGCLYSQAEPAPSGNSNQ
FT                   QPFQQDLNIALKYLLQSLEIDQSDAHSWYYLGRVHMIRGDFNAAYEAFQQAVNRDSRNP
FT                   TFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQISDALDAYR
FT                   QAERLDPSNPHIKARLDQLIKYQQDGNTQPPQPPPVSQQPKLPQGMILESTQMQQQGPQ
FT                   QPQLLPGHPPPPPSAQQQSQLHQQPPLLQPHQQGPPPPHSLPQPHQISQPNQPAVSPIP
FT                   PVHQPPPLAQSNPQTSYLPSIPQPSSQIQSSTHTPNQASVKPPSPPPQSSLPPPQNSPP
FT                   QKSTSIPSIQQNNGTKRDLEDKKDTKVTKKQSKKSAKSQQNSSLNSLANAANNASSAKS
FT                   ETPKTDEREPKSTKQSPKADKESSKSKTEVPQFSSNVTGKKEDEEEETEEKKSSEPVEP
FT                   PLRRVDEDENYDDD"
FT   gene            complement(<208043..>209896)
FT                   /locus_tag="DEHA2F02486g"
FT                   /old_locus_tag="DEHA0F02772g"
FT                   /old_locus_tag="DEHA-IPF8914"
FT                   /old_locus_tag="DEHA-CDS1531.1"
FT   CDS_pept        complement(208043..209896)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02486g"
FT                   /old_locus_tag="DEHA0F02772g"
FT                   /old_locus_tag="DEHA-IPF8914"
FT                   /old_locus_tag="DEHA-CDS1531.1"
FT                   /product="DEHA2F02486p"
FT                   /note="similar to ca|CA5908|IPF5960 Candida albicans
FT                   IPF5960 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88779"
FT                   /db_xref="GOA:Q6BMU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU8"
FT                   /protein_id="CAG88779.2"
FT                   /translation="MSTDIDVCSFCLGGETDIPPFGSLRDAEDLVHPCSTCSLTAHRKC
FT                   LLDWFNSLSSDKLQVVNASTLTEGSVRRPHSHSHDESIGVGQPQHETRIHINISSQQLN
FT                   NWITNIAASLSGNVTAENLSSNSDSQYSSNGFVVLLLAPCPQCKDDIVFSMRRSSFLTF
FT                   TTATRTLITRSITYGGLFIGITSAVTGVVSMGYIGLTSLGLKMMDSLIPTPILLKMLTK
FT                   NSSPNAALSNSSLSQVLFGNVNNYAIDNLEQALSKGLVDPLKFSRIPVLPIVLYRMRST
FT                   SIMNCLLGSSKENSFNNWLTEFMISGYISSLGNHELFRSVTTNFQHSVSRIFQNPRSIS
FT                   EGLGLLNGINLWKANNMISMLVPLRWVYDLFFRMTLNRLHFNIAMSIRPRDIANSLDAS
FT                   ELDELEEIGANIGKLEFKFKSFRDAVDDQVEKEFKSKSSYPLITTLFKFIKKKLLYYER
FT                   CFNSNLQLSYSRLKVLSWIHETKACINNDYSSAFLYKSITMRFVTTVLWPIASSKLGNM
FT                   IFKLLQTKKFSDIPQNQLVLLGNIIGMVAVVFVKDCINLYLSKKKAEQISQMSVLCIDV
FT                   DRHQTTNDQQSDDNDNANDDSNWITEDEDEFAQRFPGRYVE"
FT   gene            complement(<210112..>210747)
FT                   /locus_tag="DEHA2F02508g"
FT                   /old_locus_tag="DEHA0F02794g"
FT                   /old_locus_tag="DEHA-IPF8912"
FT                   /old_locus_tag="DEHA-CDS5243.1"
FT   CDS_pept        complement(210112..210747)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02508g"
FT                   /old_locus_tag="DEHA0F02794g"
FT                   /old_locus_tag="DEHA-IPF8912"
FT                   /old_locus_tag="DEHA-CDS5243.1"
FT                   /product="DEHA2F02508p"
FT                   /note="similar to uniprot|Q01976 Saccharomyces cerevisiae
FT                   YBR111c YSA1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88780"
FT                   /db_xref="GOA:Q6BMU7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU7"
FT                   /protein_id="CAG88780.2"
FT                   /translation="MPKNTKGSPYDAKLVSVEPLEQGKWIQTRKLNYKDPRGNDRVWEM
FT                   AIRTTRSETTDIDGVAIVALLNHPNKKKEIVLTKQFRPPVGAVVIELPAGLVDPKESVE
FT                   STAVRELIEETGYHSTFNHSTDSMADLVSDPGLTNANMAIAYVDVDLTKPENVTPKPQL
FT                   EEGEFIDSFSVPLEDLVKELHRLVKEEGCVVDARLYHLAVGIELAKSL"
FT   gene            <210977..>211282
FT                   /locus_tag="DEHA2F02530g"
FT                   /old_locus_tag="DEHA0F02816g"
FT                   /old_locus_tag="DEHA-IPF8911"
FT                   /old_locus_tag="DEHA-CDS7318.1"
FT   CDS_pept        210977..211282
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02530g"
FT                   /old_locus_tag="DEHA0F02816g"
FT                   /old_locus_tag="DEHA-IPF8911"
FT                   /old_locus_tag="DEHA-CDS7318.1"
FT                   /product="DEHA2F02530p"
FT                   /note="similar to uniprot|Q6WNK7 Saccharomyces cerevisiae
FT                   YBR111W-A SUS1 Protein involved in mRNA export coupled
FT                   transcription activation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88781"
FT                   /db_xref="GOA:Q6BMU6"
FT                   /db_xref="InterPro:IPR018783"
FT                   /db_xref="InterPro:IPR038212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMU6"
FT                   /protein_id="CAG88781.2"
FT                   /translation="MTQQQDELDQIKSQIQEHLISSGNYDIINKQLKLQLYESGWFDKV
FT                   TQLANRELQENSAHDTAVSFDQLFSFVKPKAEEMVPSNIKEDVLERLKDYLDDVIQ"
FT   gene            <211743..>212369
FT                   /locus_tag="DEHA2F02552g"
FT                   /old_locus_tag="DEHA0F02838g"
FT                   /old_locus_tag="DEHA-IPF8910"
FT                   /old_locus_tag="DEHA-CDS5272.1"
FT   CDS_pept        211743..212369
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02552g"
FT                   /old_locus_tag="DEHA0F02838g"
FT                   /old_locus_tag="DEHA-IPF8910"
FT                   /old_locus_tag="DEHA-CDS5272.1"
FT                   /product="DEHA2F02552p"
FT                   /note="highly similar to uniprot|Q9UUT7 Yarrowia lipolytica
FT                   nukm Subunit NUKM of protein NADH:Ubiquinone Oxidoreductase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88782"
FT                   /db_xref="GOA:Q6BMU5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU5"
FT                   /protein_id="CAG88782.1"
FT                   /translation="MYSLARRSILSVGRHQSMKMIPYGAVRSISSKDLTPKPLATDFPL
FT                   MSQKTASAPVDYALTSLDAIANWARKSSFWPVTFGLACCAVEMMHVSTPRYDQDRLGII
FT                   FRASPRQSDIMIVAGTVTNKMAPALRQVYDQMADPRWVISMGSCANGGGYYHYSYSVVR
FT                   GCDRLIPVDVYVPGCPPTAEALMYGVFQLQKKMMKTRITRLWYRS"
FT   gene            <212953..>213363
FT                   /locus_tag="DEHA2F02574g"
FT                   /old_locus_tag="DEHA0F02860g"
FT                   /old_locus_tag="DEHA-IPF8908"
FT                   /old_locus_tag="DEHA-CDS6378.1"
FT   CDS_pept        212953..213363
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02574g"
FT                   /old_locus_tag="DEHA0F02860g"
FT                   /old_locus_tag="DEHA-IPF8908"
FT                   /old_locus_tag="DEHA-CDS6378.1"
FT                   /product="DEHA2F02574p"
FT                   /note="highly similar to uniprot|P02303 Saccharomyces
FT                   cerevisiae YNL031C HHT2 One of two identical histone H3
FT                   proteins (see also HHT1)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88783"
FT                   /db_xref="GOA:Q6BMU4"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMU4"
FT                   /protein_id="CAG88783.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPVSGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQEAVEAYLVSL
FT                   FEDTNLCAIHAKRVTIQKKDIQLARRLRGERS"
FT   gene            complement(<213771..>216014)
FT                   /locus_tag="DEHA2F02596g"
FT                   /old_locus_tag="IPF_8907"
FT   CDS_pept        complement(213771..216014)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02596g"
FT                   /old_locus_tag="IPF_8907"
FT                   /product="DEHA2F02596p"
FT                   /note="some similarities with uniprot|P32831 Saccharomyces
FT                   cerevisiae YBR212W NGR1 negative growth regulatory protein
FT                   and similar to CA5915|IPF10735 Candida albicans IPF10735"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66259"
FT                   /db_xref="GOA:B5RU82"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU82"
FT                   /protein_id="CAR66259.1"
FT                   /translation="MSFLQSNKGEYVSNNAETGSDTPVGVDSENTGIKPSSVANPSVSS
FT                   NLHGAVAPLEQPALTSSTASHQHQQEQEMLSGFTIPRPPVSTQQSSVAAEKEQGSNTGQ
FT                   PDSPRTLWMGDLDPWLDEGAISDLWWQILHKKVTVKIIKPKTPKPENNAQGLSHSGYCF
FT                   VEFESFDDAQQALGLNGQLLPDIAMPSQQQFPNNPDNQKKYFRLNWASGATLSAPIVQT
FT                   PEYSLFVGDLSASTTEAHLLAFFQKSFPTSIKTVRVMTDPVSGKSRCFGFVRFTDESER
FT                   QRALVEMHGAWFGGRPLRVALATPRNVGGKLRYPNIPSPNFYNPDQGRQMFIPPNAMPM
FT                   GGSPFGFFGNPQMPPPPHHPHQVPPRQSYPSHMSPMDMQPTKEYSDDRDQNVSSNGQPN
FT                   VEQLRSPNLQGGQHGQPFTDPNNTTVFVGGLSSEVTEQTLFTLFKPFGIIQQVKIPPGK
FT                   NCGFIKYSSREEAEEAIAAMQGFIIGGNRVRLSWGRVSMNNKKYQQQQQQVAQAAQMQA
FT                   ATALSMGMDPASAIAAAAAAAAAGGYPPPIPGAHGHSQNAGMPMMGGMPPMGLPPHISM
FT                   QSRGNLRSPNPSNIQNYSTSSEDNDASFDKSDVDSNERPSNESQGRGHGIAPPPFYMGG
FT                   LPTDYHIPPPGSQQGQDELADSMAHMNLNGENHDSNANSENFMAYQGDHRFMMPPMFNG
FT                   GFPMHDLQYQQFIPSQQLDPQAMYPPQDDRAANDDSIDNAKADDNDSKNDNDD"
FT   gene            <221708..>222040
FT                   /locus_tag="DEHA2F02618g"
FT                   /old_locus_tag="DEHA0F02937g"
FT                   /old_locus_tag="DEHA-IPF8900"
FT                   /old_locus_tag="DEHA-CDS7040.1"
FT   CDS_pept        221708..222040
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02618g"
FT                   /old_locus_tag="DEHA0F02937g"
FT                   /old_locus_tag="DEHA-IPF8900"
FT                   /old_locus_tag="DEHA-CDS7040.1"
FT                   /product="DEHA2F02618p"
FT                   /note="highly similar to uniprot|P53173 Saccharomyces
FT                   cerevisiae YGL054C ERV14 Protein localized to COPII-coated
FT                   vesicles involved in vesicle formation and incorporation of
FT                   specific secretory cargo"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88787"
FT                   /db_xref="GOA:Q6BMU1"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMU1"
FT                   /protein_id="CAG88787.1"
FT                   /translation="MYSDLECDYINPIELCNKLNPWFIPEGGLHAFITALFLVNGYWFV
FT                   FLLNLPLLAFNVNKFLNKNHLLDATEIFRTLSKHKKESFIKLGFHLLMFFFFLYRMIMA
FT                   LIADDS"
FT   gene            complement(<222288..>223523)
FT                   /locus_tag="DEHA2F02640g"
FT                   /old_locus_tag="DEHA0F02981g"
FT                   /old_locus_tag="DEHA-IPF8896"
FT                   /old_locus_tag="DEHA-CDS2665.1"
FT   CDS_pept        complement(222288..223523)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02640g"
FT                   /old_locus_tag="DEHA0F02981g"
FT                   /old_locus_tag="DEHA-IPF8896"
FT                   /old_locus_tag="DEHA-CDS2665.1"
FT                   /product="DEHA2F02640p"
FT                   /note="weakly similar to CA5919|IPF8926.3 Candida albicans
FT                   IPF8926.3 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT9"
FT                   /protein_id="CAG88789.2"
FT                   /translation="MTINSEGVNDMNSDNLSPDGTQNTHKEAIDESDSSPVHNNGKTFV
FT                   NGVKTEMDEDSKRMKDSTQTENDDTPDDIQFGDEFDDDFHEDSTSNTNPVQELNQEDAK
FT                   KPEKRGRGRPRKITKPEEIAATPKIKRKRGRPRKGTETTSSIENMATDTPRRSARILRK
FT                   ETPSYRIEKDYDEKTSSKPIQPKRKSLRPNIYENKKPVSLAKTRPNETQKPMYINTERI
FT                   ITSQNRDKRLRINTLDVIKHLIENFNPVNSNSQILNEPLIHNEFKNHVLHHLGYLFDAH
FT                   ANINDISQEINEIQKKKTQLRNKIFELKKSHTDIGSELNKMRGNYQNERSKFKNFNKMT
FT                   NKLQSLSSTVDGYKAGNRNSSEIPEQNNKSTGEAIDKDIFTLSKVINPNSGMFKKLILI
FT                   NKKLSKIENELS"
FT   gene            complement(<224039..>224473)
FT                   /locus_tag="DEHA2F02662g"
FT                   /old_locus_tag="DEHA0F03003g"
FT                   /old_locus_tag="DEHA-IPF8895"
FT                   /old_locus_tag="DEHA-CDS6217.1"
FT   CDS_pept        complement(224039..224473)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02662g"
FT                   /old_locus_tag="DEHA0F03003g"
FT                   /old_locus_tag="DEHA-IPF8895"
FT                   /old_locus_tag="DEHA-CDS6217.1"
FT                   /product="DEHA2F02662p"
FT                   /note="similar to p|P48589 uniprot|Q02545 Saccharomyces
FT                   cerevisiae YOR369C RPS12 Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88790"
FT                   /db_xref="GOA:Q6BMT8"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT8"
FT                   /protein_id="CAG88790.1"
FT                   /translation="MSDIEEQPVVEEVAVEQQESGSISIEDALKVVLRTSLVHDGLARG
FT                   LREASKALSRGEAQLCVLCDSVTEESIIKLVEALCNEPEEKIPLIKVSDAKLLGEWAGL
FT                   CQLDREGNARKVVGASCVVVKNWGNDSDERNILLEHFSQQ"
FT   gene            complement(<225048..>226931)
FT                   /locus_tag="DEHA2F02684g"
FT                   /old_locus_tag="DEHA0F03025g"
FT                   /old_locus_tag="DEHA-IPF8894"
FT                   /old_locus_tag="DEHA-CDS1482.1"
FT   CDS_pept        complement(225048..226931)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02684g"
FT                   /old_locus_tag="DEHA0F03025g"
FT                   /old_locus_tag="DEHA-IPF8894"
FT                   /old_locus_tag="DEHA-CDS1482.1"
FT                   /product="DEHA2F02684p"
FT                   /note="similar to uniprot|P32864 Saccharomyces cerevisiae
FT                   YOR370C MRS6 Rab escort protein forms a complex with the
FT                   Ras-like small GTPase Ypt1p that is required for the
FT                   prenylation of Ypt1p by protein geranylgeranyltransferase
FT                   type II (Bet2p-Bet4p) and highly similar to CA5922|CaMRS6
FT                   Candida albicans CaMRS6 geranylgeranyltransferase
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88791"
FT                   /db_xref="GOA:Q6BMT7"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT7"
FT                   /protein_id="CAG88791.2"
FT                   /translation="MSSFNRSERRKSVAERRPSVPYIAPVIPHLAGLEKPQEHSLKMDH
FT                   CDVLIMGTGLVESILAAALSWQGVEILHIDNKQYYGDSTSTLTIDQLKKWCMEVNQGKV
FT                   QHFHDAQFYMPGGKLKDQFHSKDYGIDLTPKIMFAQSDLLSLLIKSRVYKYLEFQSLSN
FT                   FHVFENDNFNKKLSNTTKEDIFTDQSLSLVTKRYLMKFLKFVLQDNNDQNKKSMLQDNA
FT                   NVPIGEFLTKNFNLETPQINELVYSIGLCAKTTTKTPEALTRIKRFLVSFDVYGNFPVM
FT                   VSKYGGPGEISQGFCRSAAVAGTTYKLNTTLVDYDPQSKIARFNDGSNIKINEKVVVSP
FT                   TQMPKFLQQSYNEITEDLKPYNVTRLVTIVKNDCKEWMSEQETSAIVVFPPNSLPTSNQ
FT                   QSVQVIIQNGGSGVCPEGQAVWFSHSSEQDLNKAKQDLECAHEKMESAILRESSNNLDE
FT                   VLDDKDFVLSAQGTPVLVNSIKLGESLQSFVPEEKLEIVCKLGYVQKTFVKPDLSNVIA
FT                   PTPENNVSSATISDAEDIIFSNMPSSEISYDGIIGECKSIFSRITGSDEDFFDVDFEDE
FT                   DDDYNNHQAPSTNSKTTSDSTTTNNIGSPILDSVLDDEGHHEPFGADEMEL"
FT   gene            <227902..>228777
FT                   /locus_tag="DEHA2F02706g"
FT                   /old_locus_tag="DEHA0F03047g"
FT                   /old_locus_tag="DEHA-IPF8893"
FT                   /old_locus_tag="DEHA-CDS4336.1"
FT   CDS_pept        227902..228777
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02706g"
FT                   /old_locus_tag="DEHA0F03047g"
FT                   /old_locus_tag="DEHA-IPF8893"
FT                   /old_locus_tag="DEHA-CDS4336.1"
FT                   /product="DEHA2F02706p"
FT                   /note="weakly similar to uniprot|P15807 Saccharomyces
FT                   cerevisiae YBR213W MET8 Bifunctional dehydrogenase and
FT                   ferrochelatase involved in the biosynthesis of siroheme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88792"
FT                   /db_xref="GOA:Q6BMT6"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT6"
FT                   /protein_id="CAG88792.2"
FT                   /translation="MGPGIQTKPSGSLLLAWQVKDKHCLVIGGGDVALSRIHHLIRAQA
FT                   KITVIGGTSEKGINAEILQLNKEGYIYKLVERDYESSDLTMYEKTKLDLGGEDCYVYDL
FT                   ISSDHYEEIDRQVKNEVFANVCCCIDDYKLSTKIYYQCKFLRLPVNIADKPPLCDFYFG
FT                   SMFNQDNLQIMISTNGKSPRLSKLIKDNIAKQFEGIDLNKAVENLGLIRSRLRETIVLD
FT                   DDLVSIDTRMAWIKKLTDFFTLKQWSNLDLISGDQDRFERVDRIIKYFPEYPPREFDNF
FT                   KLAIYNQCLE"
FT   gene            complement(<228806..>230134)
FT                   /locus_tag="DEHA2F02728g"
FT                   /old_locus_tag="DEHA0F03069g"
FT                   /old_locus_tag="DEHA-IPF8890"
FT                   /old_locus_tag="DEHA-CDS2807.1"
FT   CDS_pept        complement(228806..230134)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02728g"
FT                   /old_locus_tag="DEHA0F03069g"
FT                   /old_locus_tag="DEHA-IPF8890"
FT                   /old_locus_tag="DEHA-CDS2807.1"
FT                   /product="DEHA2F02728p"
FT                   /note="similar to uniprot|P54885 Saccharomyces cerevisiae
FT                   YOR323C PRO2 Gamma-glutamyl phosphate reductase catalyzes
FT                   the second step in proline biosynthesis and highly similar
FT                   to CA5926|CaPRO2 Candida albicans CaPRO2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88793"
FT                   /db_xref="GOA:Q3V7I2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7I2"
FT                   /protein_id="CAG88793.2"
FT                   /translation="MAESIAKDANNAFSLLKTLSNDQRSSALQKIHDALQKNKGQIIEA
FT                   NKIDMDNAVKGNLSSSLVKRLDLSNSGKFDTMLQGILDVANLPDPVGKCTLAKKIDEGL
FT                   NLYRVSAPIGVLLIIFESRPEVIANITALAVKSGNAAILKGGKESYQTFKIMSDIVNTT
FT                   LDKETDVPGPAVQLIQSREEVGDLLSQDKYIDLVIPRGSNELVRNIKSNTKIPVLGHAD
FT                   GICSIYIDKEADLDKATRVLVDSKTNYPAGCNAVEQLLIHQDIANDDEKLSKIINSLIN
FT                   AKVTSHVVPEIKSKLTNFNQEFIKDAADDAFDKEYLSFDISVKPVASAADAISHINTHS
FT                   SKHTESIITENKATAETFMKAIDSAGVYWNCSTRFADGFRYGFGTEVGISTNKIHARGP
FT                   VGLEGLMSYQYQLRGDGHIVADYVGGGGKKVFVHEDLDTNVNV"
FT   gene            <230417..>234355
FT                   /locus_tag="DEHA2F02750g"
FT                   /old_locus_tag="IPF_8888"
FT   CDS_pept        230417..234355
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02750g"
FT                   /old_locus_tag="IPF_8888"
FT                   /product="DEHA2F02750p"
FT                   /note="similar to uniprot|P39524 Saccharomyces cerevisiae
FT                   YAL026C DRS2 Integral membrane Ca(2+)-ATPase potential
FT                   aminophospholipid translocase required to form a specific
FT                   class of secretory vesicles that accumulate upon actin
FT                   cytoskeleton disruption"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66260"
FT                   /db_xref="GOA:B5RU83"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU83"
FT                   /protein_id="CAR66260.1"
FT                   /translation="MSYSNHRNKDENGMNNLNNHTNPFSEPENLIDLDLDTRNSFNANV
FT                   ENSPYSHVTSQNQHAQPANPFEDNFIISDDEIERDDTIESLGHGSSSQRKVPLLSTAND
FT                   KSQQRSGLFGGLLANRNDEYIGMENGPEERQFKDNNLNDGSSDFDIRKIYRKTKAKFSR
FT                   SNAEAEDAAAVNKGPRQIYIMNQMLNSSFKYYGNHISTTKYNFATFIPKFLFEQFSKYA
FT                   NLFFLFTSIIQQVPNVSPTNRYTTIGTLTIVLLVSAIKEIMEDLKRAGADKELNNTKVL
FT                   VLDASSGVFHSKKWIQVKVGDVVKINNEEPFPADLLLVSSSEPEGLCYIETANLDGETN
FT                   LKIKQAKSETSYLVNPRDLLSDLSRSEILSEQPNSSLYTYEGNLKNFGSVGDIPLSPDQ
FT                   LLLRGATLRNTQWIHGVVVFTGHETKLMRNATAAPIKSTDVERIINLQIIALFSILIFL
FT                   SFVSSIGNVIKISVDSNELGYLMLGGTNKASLFFRNLLTYCILFSNLVPISMFVTVEII
FT                   KFYQAYMIGSDLDMYYAETDTPTGVRTSSLVEELGQIDYIFSDKTGTLTRNIMEFKCCS
FT                   IGGKCYTEEITEDNQVQSHDGIEVGFYSFDNLHEHLKDTSSQQSAIINEFFTLLSACHT
FT                   VIPETNDVDDTIKYQAASPDEGALVQGAADLGYKFRVRKPKGISIRNTLTGVDSEYELL
FT                   NICEFNSTRKRMSAIFRCPDGVIRLFCKGADTVILERLSDDGRPFVDATLSHLESFAAE
FT                   GLRTLCIASKIISEEQYESWSTKYYEASTSLENRSEKLDEIAEVIENDLFLLGATAIED
FT                   KLQDGVPETIHTLQSAGIKIWVLTGDRQETAINIGMSCKLLSEDMNLLIINEETKNDTR
FT                   LNLQEKISAIQEHQYDIEDDTLESSLALVIDGHSLTFALEPDLEDMFIQLGSLCKAVIC
FT                   CRVSPLQKALVVKMVKRKKKDSLLLAIGDGANDVSMIQAAHVGVGISGQEGMQAARSAD
FT                   VSIGQFKYLKKLLLVHGAWSYQRISNAILYSFYKNVTLYMTQFWFVFANCFSGQSIIES
FT                   WTLTFYNVFFTVFPPFVMGVFDQFVNARLLDRYPQLYQLGQKKKFFNVPIFWGWIANGF
FT                   YHSAIIFLCSIFIYQHGDQLSNGLVANNWTWGTAVFTTCTLTALGKAALVVTMWTKYTL
FT                   LAIPGSFLLWIGIFPAYATVAPMINVSQEYRGVLKATYPSLTFWSMIFGVSVLCLLRDF
FT                   AWKFFKRSYSPESYHYVQEIQKYNIQDYRPRMEQFQKAIRKVRQVQRIKKQRGFAFSQV
FT                   DNQDQEKIVRLYDTTKKRGVFGELSEGN"
FT   gene            <234553..>236145
FT                   /locus_tag="DEHA2F02772g"
FT                   /old_locus_tag="DEHA0F03113g"
FT                   /old_locus_tag="DEHA-IPF8883"
FT                   /old_locus_tag="DEHA-CDS2114.1"
FT   CDS_pept        234553..236145
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02772g"
FT                   /old_locus_tag="DEHA0F03113g"
FT                   /old_locus_tag="DEHA-IPF8883"
FT                   /old_locus_tag="DEHA-CDS2114.1"
FT                   /product="DEHA2F02772p"
FT                   /note="weakly similar to uniprot|P12754 Saccharomyces
FT                   cerevisiae YGR083C GCD2 Delta subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88796"
FT                   /db_xref="GOA:Q6BMT5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT5"
FT                   /protein_id="CAG88796.2"
FT                   /translation="MSEQSVSDKTPSAENAVTEASAAVVAGEKELSNKELKELKKKEKA
FT                   AKRAAQKEASGITPEQQDQLAQQKMERKKQQQTATNTNLKKQLNQTLIKDASAKKKIPA
FT                   LFSHLETREQRNASSPSISHIVHPAILSLTLKYSNYKIVGSISRLRNMLETFKIVISDY
FT                   QTPPNTTLTRHLTGHLSHQIEYLKTARPLSVSMGNAIRLLKQEISHISIDTTEQQAKEI
FT                   LNQRIDDLIKEKIDLSDMLIIENASKHVTNGSTILTFGHSHVLENLFKYCVNQQDKKFN
FT                   LIIVDSRPLFEGKNLLTNLVNTNYSPGTEEDDNSDAESATRKIFKSKPITQDHLKVQYV
FT                   LINSLSSTILEDVDCVFLGAHAMLSNGRLFSRVGTGLIAMMCHTRNIPVLAFCESIKFS
FT                   DKVQLDSVTTNELADSGDLIQDIGSKRPPQKKSFALEQFIKQCDEEKAKVTNNLNNKNK
FT                   QQKQKNNNTDEEISGKDANESLLKNWQDIDNLNILNIMYDLTPPEYIKKVVTELGALPP
FT                   SSVPVILREYKSA"
FT   gene            <236350..>241857
FT                   /locus_tag="DEHA2F02794g"
FT                   /old_locus_tag="DEHA0F03135g"
FT                   /old_locus_tag="DEHA-IPF8881"
FT                   /old_locus_tag="DEHA-CDS0044.1"
FT   CDS_pept        236350..241857
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02794g"
FT                   /old_locus_tag="DEHA0F03135g"
FT                   /old_locus_tag="DEHA-IPF8881"
FT                   /old_locus_tag="DEHA-CDS0044.1"
FT                   /product="DEHA2F02794p"
FT                   /note="similar to uniprot|P38737 Saccharomyces cerevisiae
FT                   YHL030W ECM29 Major component of the proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88797"
FT                   /db_xref="GOA:Q6BMT4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024372"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT4"
FT                   /protein_id="CAG88797.2"
FT                   /translation="MAEIELALINKVELRIALAEDDKKFEETLNLYLAPLLLKLSSPYT
FT                   EVRQAILKIIQYLIPRISAARAIKLPVNALLDQVKNPKLPAGEGPPLVRLYSLLLISRS
FT                   IERLSPEEKMNLVPKVIEHISTYPTSVSSRLFNVFCKLLESWKVPERDSNEFNDMNRFL
FT                   QFDKYPQDEQFLAKAIGKFLLLQPNSTANPLQSPGLSIKDTSFFTQDAGVSYKSSQEIY
FT                   LIKIRLLEFLKSGFQPKNIAIPLLIASCDSSSSISDPSEILFRKLDLNLEDSSIIDSLI
FT                   ELFLGSTETFIPPARPVLQEKILSILVKSKLAAQHSDISKLSSVALASDYSKLKRTAVH
FT                   FIKWVSKNNGENHSLQAVKEFNIDMASQLRSNLMGEGWPRIDMAGVRNYSSAISQRSLQ
FT                   YEALGNILKSNPELIVQDFTYFEFLFQSLEGEESDLRSAIQDALSGLTTHLPNISLTSK
FT                   NKLKNLAKRYLSFDKSESKENLQSCRYIAIKYINCAFPFSDSEARVICILGTSKDNRPD
FT                   TIEEAQKGLHPHWFNILQSSNTLEFKATADLLGSNSKVEFPSFSDIVFTLKNELNTMKD
FT                   QENARLLGCMGCSIQFILHTLVMQSIAGKSTVVVPDEEWLTRIEKAIEVDRTVINCLIK
FT                   EISLVSQEDAIMDETSKSHESSFSVFLSIIFDCFVGQYRNNNKILSNITYGTTFTKLIS
FT                   LSPPKVIEKLSSFLNDLLSICNDKSLNESSSTQIAKSIGIIASHPINDNSVVNELLKKL
FT                   VIEELQGSLSKSKLLSAGYLFSRLALRKRINFIDSELPSIFCEKLVGALKNLNTYNVAL
FT                   DCISQLAMFGVLGPELEVDIRIKACVSKLIEEIKIRVKKCDEKSVLTLSYLAMACNDTT
FT                   NTEQLDQYEKLVYDTHVSKQIEYVFTSGEAFTILAAGWDSKVLERQMDIQDEAIEYIPK
FT                   NTSRLPFILKMTLQSCKNTKPSLRKAGCIWLLSLVQYCGHLSDVKDRATEIHLMFMRFL
FT                   ADRDELVQESASRGLSIVYEMGDYDLKDTLVRGLLKSFTDSNSSALASGSVGHETELFE
FT                   PELLKTNDGSVSTYKDVLNLASDVGDPSLVYKFMSLAKSSALWSSRKGMAFGLGSILSK
FT                   SSLDELISSNKSLANKLIPKLYRYRYDPNSSVSKSMNDIWNALIKDSSKTVNDNFDLIL
FT                   NELLKEMGNKEWRVRQASTAALNDLLQTVSLEAYEERLEQIWSMSFRAMDDIKESVRKE
FT                   GSGLTRSLATTLTRTADVKSGASTNKAKKVLSNLIPFLLGSKGLLSDAEDIKKFALETI
FT                   LKLCNVGGSAIKSFIPDLLDNFIGLMSSLEPEAVNYLVLNADKYNMKSNDIDAQRLQSL
FT                   GHSPMMDAIEKLLDSLDDSLMPKTVRILQQSIKKSIGLPSKVCGSRVLVSLVIKHLELI
FT                   KPYGDQLLKICINQLNDKNDTIASSYATAAGYLCRISSIDKIVEYSKVLSKLYFEGDDD
FT                   RSREIAGIGSESMSKYSGDKFELALSAFLPLSFIGKHDNVKSVKQPFEREWIENTSGNN
FT                   SIKLYMKEICDICETYLNSNQYGIRKTIGKAIVALCNSIEETSAFPQHVMNELFKILIE
FT                   ACKGKSWSGKELILESLISISIKSRMLINNDNDLFNKVNKVVLTEAKRRNKEYQKHSVK
FT                   LMGKYLKEFPSNELIESYVDLMTGLLSDDYYEDSDDEMEQVKSSISMVKLEEERLLFIK
FT                   NLFETISMPINDDLCNLMLKSSINLFKSKIDITWRSKVQINQNFLGFVKELIINDEVIN
FT                   TEEMELLFSIWKLLEDECLQSSTIENVKIQFIRFSKMLIVYLERVNEVKKAEIVTSSLT
FT                   EFQNVETSAIIQSELLKTYD"
FT   gene            complement(<242269..>243642)
FT                   /locus_tag="DEHA2F02816g"
FT                   /old_locus_tag="DEHA0F03157g"
FT                   /old_locus_tag="DEHA-IPF8876"
FT                   /old_locus_tag="DEHA-CDS2671.1"
FT   CDS_pept        complement(242269..243642)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02816g"
FT                   /old_locus_tag="DEHA0F03157g"
FT                   /old_locus_tag="DEHA-IPF8876"
FT                   /old_locus_tag="DEHA-CDS2671.1"
FT                   /product="DEHA2F02816p"
FT                   /note="highly similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YLL039C UBI4 Ubiquitin becomes conjugated to
FT                   proteins marking them for selective degradation via the
FT                   ubiquitin-26S proteasome system"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88798"
FT                   /db_xref="GOA:Q6BMT3"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT3"
FT                   /protein_id="CAG88798.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
FT                   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGQ"
FT   gene            complement(<244865..>246217)
FT                   /pseudo
FT                   /locus_tag="DEHA2F02827g"
FT                   /note="similar to gb|EAZ63308.2 Pichia stipitis putative
FT                   flavin-containing monooxygenase"
FT   gene            <247638..>249560
FT                   /locus_tag="DEHA2F02838g"
FT                   /old_locus_tag="DEHA0F03234g"
FT                   /old_locus_tag="DEHA-IPF8870"
FT                   /old_locus_tag="DEHA-CDS1412.1"
FT   CDS_pept        247638..249560
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02838g"
FT                   /old_locus_tag="DEHA0F03234g"
FT                   /old_locus_tag="DEHA-IPF8870"
FT                   /old_locus_tag="DEHA-CDS1412.1"
FT                   /product="DEHA2F02838p"
FT                   /note="weakly similar to uniprot|P38738 Saccharomyces
FT                   cerevisiae YHL029C Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts and similar to
FT                   CA5934|IPF2802 Candida albicans IPF2802 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88802"
FT                   /db_xref="GOA:Q6BMT2"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMT2"
FT                   /protein_id="CAG88802.2"
FT                   /translation="MSQDFINTDNHTSNLSSNNLYTNINAGNSIMSEELAVKDNSNSTV
FT                   ASDNTERTPCDAENGSIYTTGRSVVSDNAGNQDKGKNFPNGESSSASGKSENSHADDEN
FT                   DGSTENNSKLGQPSFSYDSEIFQLCQHYLTTKNHQGLALVARQKGLPPFLRFKIWPILL
FT                   KHHPFVVNPFIEPDNEVNNENDTNTEEDLKSDIKRDLLKYIHRLNYTNLIDLNNASPEE
FT                   QEVFKILESSILKFVKKWGKIMKYDHALTWIALGLAEWFPPIPNTSWVLVGRDFPSSKT
FT                   SCIKNLFHDYSNYINNVPNLNEYLEDLVNDKEIINMSFRDVYERLVLVLLHAPEEKIKN
FT                   KSKDLLGPKKINRKILPINGGTIEERVSFFIYCFRKLLPELSQYFQEEQILNKFGSHDD
FT                   EWLIWWLKWCGSKVWSRLDRGRIWDLIFGWRLQNFKKSNSYYVEKLNLSDNLINKLGPD
FT                   NFWSVSKDNDDSTIENYKKSSSFKDLINELNINESSNSNSPTSNSPSNSSINEDLLPPS
FT                   PLSSSSFSSSNIAPADEFNIPFSKLDPHVELLFVTLALLKSKENTLMELDQHEIRQFLS
FT                   RLPTKSINISNKYKHFKPQESDMNNNIISNDSRNNHKIDFMDNIINESGELWRKWLWSE
FT                   MIDDN"
FT   gene            <250047..>251210
FT                   /locus_tag="DEHA2F02860g"
FT                   /old_locus_tag="DEHA0F03256g"
FT                   /old_locus_tag="DEHA-IPF8867"
FT                   /old_locus_tag="DEHA-CDS3295.1"
FT   CDS_pept        250047..251210
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02860g"
FT                   /old_locus_tag="DEHA0F03256g"
FT                   /old_locus_tag="DEHA-IPF8867"
FT                   /old_locus_tag="DEHA-CDS3295.1"
FT                   /product="DEHA2F02860p"
FT                   /note="similar to uniprot|P53883 Saccharomyces cerevisiae
FT                   YNL175c NOP13 Protein of unknown function localizes to the
FT                   nucleolus and nucleoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88803"
FT                   /db_xref="GOA:Q6BMT1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034226"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT1"
FT                   /protein_id="CAG88803.1"
FT                   /translation="MSKEEVEIKKESKKDKKEKKERKKEKKEKKQKKAVDEDSDNENES
FT                   SGDSDDEEIAIDLNAGVPLSKKQKRLLKKGKLNLEKLAKKNPPPKPILTEEEQIKKDAQ
FT                   EPKKSEYGVWIGNLSFDTTKEDITRFIMGKTNAYDADSNDGLVKIEQSDFIRINIPKKE
FT                   NKIKGFAYVDLPSAKHVDTVISLSESHLNGRNLLIKNANSFEGRPQKDTNPLSKNPPSR
FT                   ILFVGNLSFDTTQDLLREHFRHCGDIVKIRMATFEDTGKCKGFAFIDFRDESGPTTALK
FT                   SKLAKSLINRPLRLEYGEDRSKLTPKKFARNRDNFEPSEQDSISQPPPQVSTTRERTKP
FT                   QATPFKRKYDKPENNSNKRQKSSIALATAQRASVAIVPSSGKKTTFD"
FT   gene            complement(<251516..>254773)
FT                   /locus_tag="DEHA2F02882g"
FT                   /old_locus_tag="DEHA0F03278g"
FT                   /old_locus_tag="DEHA-IPF8866"
FT                   /old_locus_tag="DEHA-CDS0334.1"
FT   CDS_pept        complement(251516..254773)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02882g"
FT                   /old_locus_tag="DEHA0F03278g"
FT                   /old_locus_tag="DEHA-IPF8866"
FT                   /old_locus_tag="DEHA-CDS0334.1"
FT                   /product="DEHA2F02882p"
FT                   /note="weakly similar to uniprot|Q02455 Saccharomyces
FT                   cerevisiae YKR095W MLP1 Myosin-like protein associated with
FT                   the nuclear envelope connects the nuclear pore complex with
FT                   the nuclear interior"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88804"
FT                   /db_xref="InterPro:IPR024527"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMT0"
FT                   /protein_id="CAG88804.2"
FT                   /translation="MSEVVEQRASNGDNASTKTSSTQNTRLKKLTSGSEWVSPFRESGH
FT                   SQKNLRQQLKEDNSIKNIHVPSKFTTHPTLDAQKKEKKEKEKAAKLEKKKKEKEAKEKE
FT                   AKEKEAKEKEAKEKEAEDKGDEEETKAVTLKNTEVDPLKAVTLKENGADPKSSKDASMR
FT                   SLKDEPIDTPKESVFGGNKETEDLEYGEDLYEDDVKADNESERPLSEAEQAEVEDEVNG
FT                   DTKKDEPATTDEATKEVSETAVKDKDASGSDEIENVVKEAPIELVTQPGSKYEPVPLPN
FT                   QEVLDKLKDKPKLLSRYQELNAAAVSSLSRSLDDPNKVVDLGSGLRMTQQQLLDIAAKR
FT                   VAPVITNINDEVSKTRNEDEIKRKKELDSKVASHEKKLQKDFDKHNKKLEKQKSKFTTD
FT                   IGNKLQDLKKKMKNSDLTAANFEKETRKEIDTANEDYKERETTAVEKHSKDKDTIIKNH
FT                   EELEGTKKQELEDAKANQETTTQEIEELHERKTELDNANSELSTRIEELTAELNERTIE
FT                   LDDLKAKHAAKQDGISKNLASKDELDNKITTTKKELETKKKQHDKLSAEVGVLGGVLST
FT                   YAAKLTDLKSEASSHGDRLTDAKKKYKDWEDEKDQLATEIAREHERKRATAQEEAETKR
FT                   VEDELEEKRLKNEAERKEAEERVAAKKEEERKLQESHEKAEADRLANDPEHQFMLATQK
FT                   RESDVKKLEDERAEKERVYNEHKDKEAEEAQKLQEEIEELKQQKAAHDESAREEADKLA
FT                   EAKLVQIEQLKKEHEERVKMFKEKLEFEELQKSRLLDEVDNLNKIKELRAEKARLTSEL
FT                   NKDVDVKDVNKLIEERELEVSKLSKQIELDNADLNNFNATQRSALAEGQKSTEPSKDIT
FT                   EADRPSKVSNAPIFANIGGSSKEQNIANKSDHSKPVKNEDNSNSSSQKKSGARATGLAT
FT                   AGLAGAAGAGTAVALDAKNNAKNVSNVNDSKSTGGSFSKLKSLTKRIRGESVSDANAEE
FT                   PAVSSKEKKPSTKSAAPVNISKQPDGKSTKTKAVPVTSSSKRADNAASFSDSSSAYETY
FT                   SVYEEVSEAEYQKNLKNPDYMEMTAEEFEKRRKAGDH"
FT   gene            <255711..>260384
FT                   /locus_tag="DEHA2F02904g"
FT                   /old_locus_tag="DEHA0F03300g"
FT                   /old_locus_tag="DEHA-IPF8861"
FT                   /old_locus_tag="DEHA-CDS0095.1"
FT   CDS_pept        255711..260384
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02904g"
FT                   /old_locus_tag="DEHA0F03300g"
FT                   /old_locus_tag="DEHA-IPF8861"
FT                   /old_locus_tag="DEHA-CDS0095.1"
FT                   /product="DEHA2F02904p"
FT                   /note="weakly similar to uniprot|P53094 Saccharomyces
FT                   cerevisiae YGL197W MDS3 Protein with an N-terminal kelch-
FT                   like domain putative negative regulator of early meiotic
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88805"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS9"
FT                   /protein_id="CAG88805.2"
FT                   /translation="MSTLVPSASSCYGLRLPPTEKDDRLNLNVRTGSASTLYKSLVFTY
FT                   GGLTIGLDIGDESVDELIRIFHSKISNLKSNSIDKYLSGEFFYLDLIEKYWTRVDIPSG
FT                   ERKPKPRVFHEITAVNNCIYVFGGLIVNEKYDSHTHEDTNERELVPCNDLWEFSLESRK
FT                   WNLLHDGSKYEYDAAVPRPRFSHKMTTLSSLSFANRKDHFGIFIAGGRDDESRPLYDNF
FT                   VFDLVTKEYVGSSPIELTLDTKKNSQKFRNVNSIVTSEDYKISVDYVNNVIISFIKEPT
FT                   HHHHHSRTRSTNKAISSDYTSTMEGDESLIVYSQVDSSKDQSINTLLSFKVGKSIKEGK
FT                   ILPVHNKVSTKENETKRITNHTIPYNLKFPTGGLFGQNIVITGFLPNDNDICVFIYNKP
FT                   TGKWSRLNFFCDHDYGSHRCWGGFAWQSHHKVVLLGNYLTSRTTSSIRYFTLMITVSLP
FT                   ITNILASLELEGGHYHCPDGTKVFYKDDNSSTDDNNRDRISEEDAYSSSDALSDGEKKM
FT                   LKRHHSVSASSDKAPQSISFSEYVHYVAPKTKFTTIRSVFPPAAITLGRNAMDRYGDLI
FT                   SDFELVSSKGDRIPVSLRILMERWGRYFVQLLAKGYVQAVDRFERDQQLDSESTRNASS
FT                   ASESMNSANKTQNKLRSSMSTCGGSSISSSNSEVSINQSKPSKKGHHQSSYHVSIPAPS
FT                   KYSKEPPQFRLPFQESSLTNNSVSEKANETINQHFEETKRGIETNNNEKLPDLPGSSHI
FT                   KDEQPDTSRKGSVSSFSSSNSLLNSHLQNIPPQLPLPNEPIPAVPASTSFRGSSRKNSA
FT                   DLNSPRASLMYTLTALRNIPATKSPRESPFSSPRASVSGGPAPMGNELSSLAIPNLKQS
FT                   SLSTDRNNHRLTRSLDSSPNGSTDALPIKTAAGECITDQNFRNKKVSNSSSMASSETFN
FT                   SDKKFSPLSSIQPNTNKIYAKDADDRQDYEETNTTEANNSLFSNPLLDFENAESGKFRM
FT                   EPSLIPRKLYMPFATSSIKAFCEYLYTGQVGNKWLLSPVTLDNLAISKFLDVPLLYDLI
FT                   SEVLFGVIGRKESFIIREGNKLKRRYHELLELTGSVKESGFKFPLDEYEGFMDTIDDGF
FT                   LDITLLKKSSASHKDSSASAMSSKRNKSSLNSASSFRYSISIDDINENAMSLREVPIDE
FT                   TLRSTNTESNQENIPTNNQEESTDDSIEKSTSNSEEDTDFELGYLDARDNSSLNVGPRA
FT                   KSIFDKSGTDMQFHSALDNDQKEKESEMEKSKSLNLTLEQLVSPQSPLPSDYTIDLIYE
FT                   TATLCRDIKLMLRAANVKNMGDVFNQSKLELNIAIEELENKYDEQQKQQDEEQKIEHPQ
FT                   FKGKIPSQPSGNESDTGLEHIRSNMSSSSLSTLGLRSVDLEKTKSNTGFRAIGGFGPFK
FT                   SKTDLKASKMTSFENNKELDRRITRSIKNDEKLKSKTAKDEKLKRLQDQKLERRQTDKP
FT                   KLMTRKSIFTKYKDEGSTSTLASEASTNKKKHGFLHHLSHKKKNEAPINQGDNSSLESS
FT                   NLSRTLSASGSISSANSKKSQGSRIKNSLFGKKRLSN"
FT   gene            <260637..>261521
FT                   /locus_tag="DEHA2F02926g"
FT                   /old_locus_tag="DEHA0F03322g"
FT                   /old_locus_tag="DEHA-IPF8859"
FT                   /old_locus_tag="DEHA-CDS4297.1"
FT   CDS_pept        260637..261521
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02926g"
FT                   /old_locus_tag="DEHA0F03322g"
FT                   /old_locus_tag="DEHA-IPF8859"
FT                   /old_locus_tag="DEHA-CDS4297.1"
FT                   /product="DEHA2F02926p"
FT                   /note="similar to uniprot|P14065 Saccharomyces cerevisiae
FT                   YOR120W GCY1 Putative NADP(+) coupled glycerol
FT                   dehydrogenase proposed to be involved in an alternative
FT                   pathway for glycerol catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88806"
FT                   /db_xref="GOA:Q6BMS8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS8"
FT                   /protein_id="CAG88806.1"
FT                   /translation="MAVTLKNNTDTVTLNNGDKIPAVGLGTWQATEKDAAYKSVKAALQ
FT                   NGYRHIDTAAIYGNEEEVGRGIKDSGVPREEIYVTTKLWNADHKKAEEALNTSLKKLGL
FT                   DYIDLYLIHWPYSVQPDTKQPYSDWDYLDTYKELQKLKATGNVKAIGVSNFTVKQLERL
FT                   LADKDITIKPAVNQIEAHPLLTQPELTEYLKKNDIVIEAYSPLGSSNSPLFKNETVVAI
FT                   AEKYQVEPAQVLVSWAIQRDTVVLPKSVTESRIISNLKTFKLSDEDFNTLNNLSQKDGV
FT                   VRTCNPEFNDFDD"
FT   gene            <261995..>262882
FT                   /locus_tag="DEHA2F02948g"
FT                   /old_locus_tag="DEHA0F03344g"
FT                   /old_locus_tag="DEHA-IPF8858"
FT                   /old_locus_tag="DEHA-CDS4292.1"
FT   CDS_pept        261995..262882
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02948g"
FT                   /old_locus_tag="DEHA0F03344g"
FT                   /old_locus_tag="DEHA-IPF8858"
FT                   /old_locus_tag="DEHA-CDS4292.1"
FT                   /product="DEHA2F02948p"
FT                   /note="similar to uniprot|Q12458 Saccharomyces cerevisiae
FT                   YDR368w YPR1 strong similarity to members of the aldo/keto
FT                   reductase family P6.5.f6.1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88807"
FT                   /db_xref="GOA:Q6BMS7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS7"
FT                   /protein_id="CAG88807.1"
FT                   /translation="MTTRTANNTDYYTLNNGEKIPAVGFGTWKATKKEGAHTAVKIALQ
FT                   TGYRHVDTAVMYDNEEEVGRGIKESGIPREEIFVTTKLWNTDHKQVSKAFDSSLQRLGL
FT                   DYVDLYIMHWPLPLDPKTEKPYEDWNYIDTYKEMQKLVESKKVKSIGISNCNIEQTKKI
FT                   LDDKDITIKPVVNQVEAHPLLPQLELFDFLKQNDIALEAYSPLGSDNSPLFKDDTIIGI
FT                   SQKYNVHLAQVLVSWAVQRGSIVLPKSVTESRIISNLKTFKLREDDFATLNNLSKEVGP
FT                   VRTNDPDWFDFGKD"
FT   gene            <263118..>263807
FT                   /locus_tag="DEHA2F02970g"
FT                   /old_locus_tag="DEHA0F03366g"
FT                   /old_locus_tag="DEHA-IPF8856"
FT                   /old_locus_tag="DEHA-CDS5045.1"
FT   CDS_pept        263118..263807
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02970g"
FT                   /old_locus_tag="DEHA0F03366g"
FT                   /old_locus_tag="DEHA-IPF8856"
FT                   /old_locus_tag="DEHA-CDS5045.1"
FT                   /product="DEHA2F02970p"
FT                   /note="similar to CA5728|IPF2471 Candida albicans IPF2471
FT                   maltose acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88808"
FT                   /db_xref="GOA:Q6BMS6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS6"
FT                   /protein_id="CAG88808.2"
FT                   /translation="MSEESIKQEVVDYAYKNLRGIPKGNKEYEKMISQLSYNCFDHELL
FT                   MSRNLAHERAIDYADIRMKDYDFDPEKHYKAREEYLRTIFGKLGDKSFIEAPFFVDYGF
FT                   NVSAGKNFYCNFNCTFLDCCLIVFGDNCMCGPNVTFCTPTHAIDPERRLAGEESAGPIT
FT                   VGDNVWFGANAVVLQDITIGDNSIIGAGAVVTKDVPANTVVVGSPARVVKHLTSEQDKI
FT                   ESANHLT"
FT   gene            <263919..>264962
FT                   /locus_tag="DEHA2F02992g"
FT                   /old_locus_tag="DEHA0F03388g"
FT                   /old_locus_tag="DEHA-IPF8854"
FT                   /old_locus_tag="DEHA-CDS3937.1"
FT   CDS_pept        263919..264962
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F02992g"
FT                   /old_locus_tag="DEHA0F03388g"
FT                   /old_locus_tag="DEHA-IPF8854"
FT                   /old_locus_tag="DEHA-CDS3937.1"
FT                   /product="DEHA2F02992p"
FT                   /note="weakly similar to uniprot|P53093 Saccharomyces
FT                   cerevisiae YGL198W YIP4 Protein that interacts with Rab
FT                   GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88809"
FT                   /db_xref="GOA:Q6BMS5"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS5"
FT                   /protein_id="CAG88809.2"
FT                   /translation="MNTLIVDILFHTIKTNITSMSSGTWNPPSYSAQDADEFIIADEDE
FT                   TSSQRIQPDVTEHTPMSTSSHNANANANTNSMFSSFSFGPKVDLSSTFAPFTQSKTFTD
FT                   SNTIKERQYSGGDTLDEPVWNTLKRDLSQIGRRLAIVVWPMQLASLAAKQQSRLIDFAS
FT                   NNGINLPQSIVNARRISVSENQNDDEDEDRETGVTGDELLSQTTLEWDLWGPLIFSLAY
FT                   SVTLGVSASKNETNSVFSGSFSFIWLFFIVIGLNIQLLGGNISFMSAISATGYSMFPIT
FT                   CGTLICTLVVKWKLIRIIIMSILGAWSIYSGVMSLKCSGVLPGRVLLAIYPVGLMYSVL
FT                   SWLCIIT"
FT   gene            complement(<265464..>266492)
FT                   /locus_tag="DEHA2F03014g"
FT   CDS_pept        complement(265464..266492)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03014g"
FT                   /product="DEHA2F03014p"
FT                   /note="similar to uniprot|P23642 Saccharomyces cerevisiae
FT                   YML115C VAN1 Mannosyltransferase with a role in protein N-
FT                   glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66261"
FT                   /db_xref="GOA:B5RU84"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU84"
FT                   /protein_id="CAR66261.1"
FT                   /translation="MPLRNAESVLPMAFHNLMNLTYDHSLIDIAFLVSDCSPDDRTLET
FT                   VFEYSVALQNGTLLNKLQLGERQRHANVIKGSSDLYQLYMDPDYMNNIKKSYNPETFHE
FT                   NYHKPFRSISIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTSNALKSYHSWV
FT                   YWRDVDIETCPGSVIQDLMKHDYDVMVPNVWRPLPTFLGNEQPYDLNSWVESEAAVELA
FT                   KSLDEEDVIVEGYAEYPTWRVHLAYIRDPNGDPNEIIDIDGVGGVSILARARIFRQGVH
FT                   FPAFTFLNHAETEAFGKMAKSMGFRVGGLPHYTIWHIYEPSEDDLREIAKMERKKRRQK
FT                   GK"
FT   gene            complement(<267088..>268992)
FT                   /locus_tag="DEHA2F03036g"
FT                   /old_locus_tag="DEHA0F03432g"
FT                   /old_locus_tag="DEHA-IPF8851"
FT                   /old_locus_tag="DEHA-CDS1444.1"
FT   CDS_pept        complement(267088..268992)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03036g"
FT                   /old_locus_tag="DEHA0F03432g"
FT                   /old_locus_tag="DEHA-IPF8851"
FT                   /old_locus_tag="DEHA-CDS1444.1"
FT                   /product="DEHA2F03036p"
FT                   /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
FT                   YMR278w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88811"
FT                   /db_xref="GOA:Q6BMS3"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS3"
FT                   /protein_id="CAG88811.2"
FT                   /translation="MEEYSEEQIKTLNTLVEQWISVDINPKSRKEIIELQQEGNYSKLN
FT                   EKLSKRIAFGTAGLRSTMTSGFAHMNDVTILQASQGLIKYLLEKNESNQNLSIVVGYDH
FT                   RFHSQRFAEITASVALTQGFKVYYLGSTTNLSRESIELSEAKFNELQEADRGYVHTPLV
FT                   PFAIDYFKASAGVMVTASHNPAQDNGYKVYYGNGCQIIPPNDSGIANSIERNLDPWLNQ
FT                   HVWDIVGNFKKNADKLLFGVKGKATEMYVNAVNELLIQNHKLSYDFTYTPMHGVGMEIF
FT                   DKIISLFETKSDIKPVTEQMNPDPEFSTVKFPNPEEKGALALSIKNANESGHKLVIAND
FT                   PDADRFSVAIKSYKTNEWVQLTGNEIGFLFAMYVIEELTPENKLDKTYLINSTVSSQVL
FT                   ASMAQHHGFKFIDTLTGFKWIGNKAIDLKKEGFNVPFGYEEAIGFMFSVANDKDGISAL
FT                   VIWLQLYETWFANKENYDPVDKLNEGYEKYGWYKEANGYYKLNDLSMTQKIFENTIRKS
FT                   YEGRPHPQTLGDTFLVDSWRDLTLGYDTSTPTHVPDLPVDPTSQMITATLKPKDAQSDN
FT                   ELVRFTCRGSGTEPKLKIYIEGKSDIGENRALSLAKLCWNTLKTEWFKPEENGLQEVI"
FT   gene            complement(<269170..>270761)
FT                   /locus_tag="DEHA2F03058g"
FT   CDS_pept        complement(join(269170..270683,270749..270761))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03058g"
FT                   /product="DEHA2F03058p"
FT                   /note="weakly similar to uniprot|P32523 Saccharomyces
FT                   cerevisiae YLL036C PRP19 Splicing factor associated with
FT                   the spliceosome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88812"
FT                   /db_xref="GOA:Q6BMS2"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS2"
FT                   /protein_id="CAG88812.2"
FT                   /translation="MICSISGETPKEPVISPKSGSIFERRLIENYISTSGKDPVNDEDL
FT                   TIEELVGINSVTSTIAPPKPPSFNSIPSLLSTFQNEWDSLALEVFALRKQLHKAREELS
FT                   AALYHHDAAVRVAAKAIKERDEARSALQQLAVSIGKDEPMDDVVIESTSNGDAKASTQL
FT                   PVEIINQARDELFQLHKSQKPTLPITPEQNITVEFIANHAQPFKKAENSFVNATNKILL
FT                   VGSSTGSVAVYNFNNPGKNNVTKITHKGLVTAVNQVIHKDEQVPILAYKEKVFVRDSKT
FT                   LFEHNHEGEIFQIVSHPTLTNLFILFSRDGTWSLNDLDEMAVLFRSSKVNNICCGDIHV
FT                   DGALLGTGTENGEVTIYNLTSGQSVFNIKSKYPNIKKLSFASNGYWLLVSSANGENASC
FT                   LDIIDLRKNAIIHSIEFSNELVDFAIDPSSSIIITYDSRNMLSLHRYIKKGKKWLDNLS
FT                   EKTIEESNSALLSLDILNTADDEEFKNTGEIKFAGVTQNSSILEFQLAYA"
FT   gene            complement(<271020..>272102)
FT                   /locus_tag="DEHA2F03080g"
FT                   /old_locus_tag="DEHA0F03476g"
FT                   /old_locus_tag="DEHA-IPF8848"
FT                   /old_locus_tag="DEHA-CDS4106.1"
FT   CDS_pept        complement(271020..272102)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03080g"
FT                   /old_locus_tag="DEHA0F03476g"
FT                   /old_locus_tag="DEHA-IPF8848"
FT                   /old_locus_tag="DEHA-CDS4106.1"
FT                   /product="DEHA2F03080p"
FT                   /note="weakly similar to uniprot|Q06991 Saccharomyces
FT                   cerevisiae YLR414C Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88813"
FT                   /db_xref="GOA:Q6BMS1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS1"
FT                   /protein_id="CAG88813.1"
FT                   /translation="MFRIVRLIIILLSIATTVLSIFALVGSYKNEAYLTKIYLLDFHLT
FT                   DLDVSQLIDFNGFSKRDTIHPDSKRDTILPGRTVVEKDLASSLSDIGSTISGIVNSITY
FT                   EDMGLAQVYSISLWGYCKGEVKGSSKTEKGFDNSDIDFKWCSDPKPAYFFDPLEIIKQE
FT                   LNNTINDKITGASGSIDISSDVRTVLEQIVDNITYETLNLPGNLNKQLTLLNNLTKAAF
FT                   ALILIMAILSAIGVFVQLIGCCVDPSNCCLSCINFLFQTLVFLTGIIGAGLATGAYIYV
FT                   RKQINENTGELGIKSFLSIAFYALIWSAVAAALLVLIFTIIGHCCGCLSNNRKKYKPLD
FT                   APAVPEKNGYEMGYNHHQNY"
FT   gene            complement(<272630..>275017)
FT                   /locus_tag="DEHA2F03102g"
FT                   /old_locus_tag="DEHA0F03498g"
FT                   /old_locus_tag="DEHA-IPF8845"
FT                   /old_locus_tag="DEHA-CDS0851.1"
FT   CDS_pept        complement(272630..275017)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03102g"
FT                   /old_locus_tag="DEHA0F03498g"
FT                   /old_locus_tag="DEHA-IPF8845"
FT                   /old_locus_tag="DEHA-CDS0851.1"
FT                   /product="DEHA2F03102p"
FT                   /note="similar to p|Q03254 uniprot|Q03254 Saccharomyces
FT                   cerevisiae YMR277W FCP1 Carboxy-terminal domain (CTD)
FT                   phosphatase essential for dephosphorylation of the repeated
FT                   C-terminal domain of the RNA polymerase II large subunit
FT                   (Rpo21p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88814"
FT                   /db_xref="GOA:Q6BMS0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMS0"
FT                   /protein_id="CAG88814.2"
FT                   /translation="MAELTSITLPQSVPFPVTISSILCRQGETVPKHQTLFKYKYWDYQ
FT                   DDPNSKEETPPKIRVERIGTYESPIEGEVNSINVCLSDEIAHSGVELCFIKEPCAHAVQ
FT                   YGGLCALCGKAVEDEKDYSGYNYEDRATISMSHDNTGLKISLDEATKIEHNTTDRLSRE
FT                   KKLILVVDLDQTVIHATVDPTVGEWQSDPSNPNYPAVKNVRSFCLEEDPIAPPGWTGPK
FT                   LPPSKCWYYVKLRPGLEEFLRSASDLYEMHIYTMATRNYALAIAKIIDPEGEYFGDRIL
FT                   SRDESGSLTHKNLKRLFPVDQSMVVIIDDRGDVWQWENNLIKVVPYDFFVGIGDINSSF
FT                   LPKKFGQLTGPTKKRKSIAKLEALENEKNSTDDEESEANENDKEASEEDDNPSQENDTP
FT                   SSSPVDRILEMGGGEDNASLLMEQSISRNMSLEQQQHDRPLAKLQHDLDKIHEHDSHSP
FT                   SGSSSPEESDGDKKEEEDEEEDNLLYDDDNELYSLKKALVRIHSEYYKILAANKIKSPH
FT                   LKPDLTHIIPFLKSKCLEGITILFSGILPLGINLDTADIVIWCKQFGVKVVNEVYPEVT
FT                   HVVCRDPNANSFKSGPTFKVRVAKKILPNVKIVNPDWLFACLSAWGKVDETDYLVESEE
FT                   DNWYLEDKDLKKYQKGLESQKQKQINTIESRPRFDSIGSVEEYDLDNANQEVDDFLAGI
FT                   SEDDNSEKDDDDNDNDDDNNDNEDTDNDKAEVSKPFDSFIKDAYKVNKKRSLEADEDII
FT                   LQQEVTSKKQKTQQAEPESEVDLDELEKELLDGFDDMEEANV"
FT   gene            complement(<275252..>277345)
FT                   /locus_tag="DEHA2F03124g"
FT                   /old_locus_tag="DEHA0F03520g"
FT                   /old_locus_tag="DEHA-IPF8841"
FT                   /old_locus_tag="DEHA-CDS1139.1"
FT   CDS_pept        complement(275252..277345)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03124g"
FT                   /old_locus_tag="DEHA0F03520g"
FT                   /old_locus_tag="DEHA-IPF8841"
FT                   /old_locus_tag="DEHA-CDS1139.1"
FT                   /product="DEHA2F03124p"
FT                   /note="weakly similar to uniprot|Q03750 Saccharomyces
FT                   cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved in
FT                   RNA polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88815"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR9"
FT                   /protein_id="CAG88815.2"
FT                   /translation="MVSEDKAADIKKEEQSNSTINSAQDDVQNKHHEADETKEDMIRSN
FT                   NNENEEKDINSDGQEEKKADISEKLNGHEVITIDNKSTQNESEASNADDTVMNTETINK
FT                   KGEEVPINISNNDKETHFNKPVLNLPDLEVPFSERRLAPETINLLNKPVDKKLAMSGIE
FT                   FQFSKIIGVILKSKGLDYSEEFLSQMNDLSITYFHDIIEMLRKFTEVQRRKKPSISDTE
FT                   LCFRMKGIKAGKLYKEYEETKLIAKKYKSEIDLVNSQTTELINEFKEDNKFDENDPSLP
FT                   FFTNEHYEITELIPKQSSKPIYIPFYLPELPPDYTYQKTPKYMNMITDLKQLRLKLVDE
FT                   SRLTEKSLYNLIDDDEKKWKEDFEKQIRDTLSEVDDDIDSENENSLMSEVEQKNQTDIE
FT                   TPIPDHQLEEHETKPRPTELNTKDGIPDEVDAASETLHNKTEEQIAKVDGEPRKLLQDV
FT                   KTFDFVAYAQKRRDLERSKELKIDRKRKLRESNIFFKTEKYYSPYATLPVTPEVDLFFA
FT                   NIVQEEFKSVIGSVRTAEKRKKRKVENILREKAEREQAKEKEREKMGLGFSFGPISHMS
FT                   DDDNDDSDRDEDMGFPTFDFGDSNGSQDKQETDANPNNNNNFPLDNNETEIGSVPKADG
FT                   TDAAHVNINTDEEMDSDSFEAELEDAIPADSAPKVTLLENNMKISNDLPSDSSDDEIEL
FT                   EDV"
FT   gene            complement(<277517..>278614)
FT                   /locus_tag="DEHA2F03146g"
FT                   /old_locus_tag="DEHA0F03542g"
FT                   /old_locus_tag="DEHA-IPF8839"
FT                   /old_locus_tag="DEHA-CDS3520.1"
FT   CDS_pept        complement(277517..278614)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03146g"
FT                   /old_locus_tag="DEHA0F03542g"
FT                   /old_locus_tag="DEHA-IPF8839"
FT                   /old_locus_tag="DEHA-CDS3520.1"
FT                   /product="DEHA2F03146p"
FT                   /note="similar to uniprot|P48510 Saccharomyces cerevisiae
FT                   YMR276W DSK2 Nuclear-enriched ubiquitin-like polyubiquitin-
FT                   binding protein required for spindle pole body (SPB)
FT                   duplication and for transit through the G2/M phase of the
FT                   cell cycle involved in proteolysis interacts with the
FT                   proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88816"
FT                   /db_xref="GOA:Q6BMR8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR8"
FT                   /protein_id="CAG88816.1"
FT                   /translation="MSDTISITIKSSGDTKYEVTVSPTITVLELKNEIADKSSVPADRQ
FT                   RLIYSGKVLKDTETVASYKVQTGHTIHLVKSAGPKTNNTDNRGAASTDAPRNESESSGN
FT                   NSGVPSNIAAGQGSFNPLADLTGARYAGYTQLPSASMFGPDGGMNSGMPDPEQMSEMMS
FT                   NPMFQESMNSMLSNPQMLDYMINQSPQLRAMGPQAREMLQSPLFRQMMSNPEMMRSMMQ
FT                   MGRGGAGGAGGFPGFGGQGGAGAFPAPGANPTVDSSDDNNATGAANENTNASTNAPANP
FT                   FASMFPGGMPPMDPFALLGGAGGAGGAGAGQAAPQDTRPPEERYEEQLRQLNDMGFFDF
FT                   DRNVAALRRSGGSVQGAVEYLLSSI"
FT   gene            complement(<278750..>279526)
FT                   /locus_tag="DEHA2F03168g"
FT                   /old_locus_tag="DEHA0F03564g"
FT                   /old_locus_tag="DEHA-IPF8837"
FT                   /old_locus_tag="DEHA-CDS4711.1"
FT   CDS_pept        complement(278750..279526)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03168g"
FT                   /old_locus_tag="DEHA0F03564g"
FT                   /old_locus_tag="DEHA-IPF8837"
FT                   /old_locus_tag="DEHA-CDS4711.1"
FT                   /product="DEHA2F03168p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR7"
FT                   /protein_id="CAG88817.1"
FT                   /translation="MRSVQYKAERKYRAAEYMKQERDTKWKWSDQKRVKFHPTIITEYI
FT                   ESVWQDKQELVNYRRDLDLLYPDIPYSERCQRRSENCNKTKQRLRNNKSYDRLYMDHPS
FT                   GLYNLPSYADCDCDLEYESYAIKKKIAWELSTAPPIFSHIHPFDDNLTLFFNSYLGRTI
FT                   DKRPIYQESHGDERIESPYYVEEDIFNMPYEIERRLWVYRIAKFREWKLSFSKKNVVLP
FT                   TNDSTTGICKYSSSFDCDAYPFKRIEDPMMYFKSSF"
FT   gene            complement(<280012..>281571)
FT                   /locus_tag="DEHA2F03190g"
FT                   /old_locus_tag="DEHA0F03586g"
FT                   /old_locus_tag="DEHA-IPF8835"
FT                   /old_locus_tag="DEHA-CDS2199.1"
FT   CDS_pept        complement(280012..281571)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03190g"
FT                   /old_locus_tag="DEHA0F03586g"
FT                   /old_locus_tag="DEHA-IPF8835"
FT                   /old_locus_tag="DEHA-CDS2199.1"
FT                   /product="DEHA2F03190p"
FT                   /note="weakly similar to uniprot|P34233 Saccharomyces
FT                   cerevisiae YKL185W ASH1 Zinc-finger inhibitor of HO
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88818"
FT                   /db_xref="GOA:Q6BMR6"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR6"
FT                   /protein_id="CAG88818.1"
FT                   /translation="MSVLNTTNMFNNQLNSFTSGHINSRSYNELSSKLKANIKTNKLSQ
FT                   PLQQYAENDVHYIKKRSYSDLLRESSAFGDRGSIKGQDTKRSRTAPPSPPSQPYDTNFQ
FT                   ANGVPQFKFKSIKTNSNVRSRSLSPNKKFVTCLSPCNSPSLPNTPHSSPSKKPTLPSIS
FT                   TVLQSTPMTPKAPLRLKPITPTVSLDYFDTYKPNDENWRYGLLDTINKGPNQFNLNQYD
FT                   YLNKHKISHTSSVPSPVFVKDRPSFNSRISSKIIQNSSPRVNTFDKSNYPPCIQEKVYS
FT                   ERKINFPYESNYTYLNKTYLNDVKKYPEYLELAHSLIQLSQPQSNTPDSHCQPMTPVNT
FT                   SNNNSVNDTIIEPIYQQNVSHSVYPPTSTPPSSTRLPNPQYNSFLGIISEGPTTPPAEN
FT                   DNKTKFIPVTPPSSKCKSRSELLKSSPRQQHQHAPRVCISCGSDQSPCWRPSWSIKEGQ
FT                   LCNSCGLRYKKTSARCLNDECKKIPAKGEWSLMQSKGKSVFEDGLEGYSCLDCGWRVEV
FT                   KK"
FT   gene            complement(<282429..>282614)
FT                   /locus_tag="DEHA2F03212g"
FT                   /old_locus_tag="IPF_8833"
FT   CDS_pept        complement(282429..282614)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03212g"
FT                   /old_locus_tag="IPF_8833"
FT                   /product="DEHA2F03212p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66262"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU85"
FT                   /protein_id="CAR66262.1"
FT                   /translation="MPDDKLNMAKSIGASIAGSVGGAKVADKLHLGNGGHMATSIAGSI
FT                   GANNVLHHFEDKDGKK"
FT   gene            complement(<283102..>283287)
FT                   /locus_tag="DEHA2F03234g"
FT                   /old_locus_tag="DEHA0F03608g"
FT                   /old_locus_tag="DEHA-IPF8831"
FT                   /old_locus_tag="DEHA-CDS8443.1"
FT   CDS_pept        complement(283102..283287)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03234g"
FT                   /old_locus_tag="DEHA0F03608g"
FT                   /old_locus_tag="DEHA-IPF8831"
FT                   /old_locus_tag="DEHA-CDS8443.1"
FT                   /product="DEHA2F03234p"
FT                   /note="some similarities with CA5650|IPF7109 Candida
FT                   albicans IPF7109 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88819"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR5"
FT                   /protein_id="CAG88819.1"
FT                   /translation="MGGDDHHKLDQAKDIATGVAGGVGGGAIANKLGLGQAGGIVGSVA
FT                   GSIGANKADHKAEEKK"
FT   gene            <283536..>284149
FT                   /locus_tag="DEHA2F03256g"
FT                   /old_locus_tag="DEHA0F03630g"
FT   CDS_pept        join(283536..283560,283638..284149)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03256g"
FT                   /old_locus_tag="DEHA0F03630g"
FT                   /product="DEHA2F03256p"
FT                   /note="weakly similar to uniprot|P34232 Saccharomyces
FT                   cerevisiae YKL186C MTR2 mRNA transport regulator essential
FT                   nuclear protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88820"
FT                   /db_xref="GOA:Q6BMR4"
FT                   /db_xref="InterPro:IPR019488"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR4"
FT                   /protein_id="CAG88820.1"
FT                   /translation="MSNIQRDPKPYLKKILSSLDIQYQGPSQQFPNVESYATQFGKQLK
FT                   PQCAIIMNGKPLIPTNNDAKLEFQKKWLLSPLTFHQLNSFDSHLIPGTGTFVINASGKV
FT                   KFDESGRNRLGETSDLIHPINNATVKGRPVWGSWFGFNLNLIVDESILNNPESEAINSY
FT                   NYRFTYKPDDSVIQI"
FT   gene            complement(<284191..>286110)
FT                   /locus_tag="DEHA2F03278g"
FT                   /old_locus_tag="DEHA0F03652g"
FT                   /old_locus_tag="DEHA-IPF8829"
FT                   /old_locus_tag="DEHA-CDS1418.1"
FT   CDS_pept        complement(284191..286110)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03278g"
FT                   /old_locus_tag="DEHA0F03652g"
FT                   /old_locus_tag="DEHA-IPF8829"
FT                   /old_locus_tag="DEHA-CDS1418.1"
FT                   /product="DEHA2F03278p"
FT                   /note="similar to uniprot|P38887 Saccharomyces cerevisiae
FT                   YHR202w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88821"
FT                   /db_xref="GOA:Q6BMR3"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041823"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR3"
FT                   /protein_id="CAG88821.2"
FT                   /translation="MNMIENKRKCQYGFIVLAFILGIFLFPVSWLQLSKQHKSDSSLIR
FT                   NIEWNDINFIHTTDTHGWYSGHINQKQYNADWGDFISFTIHLRDIAHSKKQDFLLVDTG
FT                   DRHDGNGLSDVTIPNGAKSLPIFMRQDYDLLTIGNHELYIWENSQQEYDLVRDHFKSNY
FT                   ISTNVEYKLQNGTYIPMGQRYKYFTTPIQSIRILSFAFLFDFARYNSETKVEPIMKVLD
FT                   EDWFKDILIDHPADEVDLLVIIGHIPVSHNDEELFQLHSFLRKYYPKTKIQYFGGHSHI
FT                   RDFSIYDEYSTGLQSGRFCETAGWVSINLESANNNLNGVDKVKNTFSRSYIDFNLNSFM
FT                   YHTNISSTEEFHTGVGLNVSRQISDTRKELNLEAIIGYVRNSNYFMDYVSITNPKNIFK
FT                   LLTDKVLPTLEIENPDIATSDQRLIIINTGSIRYDLYKGPYTLDSQYIISPFENDWVKL
FT                   TLPKNVAIKIAPKLNELQYIIRSASDNTFDNRRLLPEHQYSRLLKNDYASFNKRTEDWG
FT                   QHHFENRASERFQEIGKLKSASRKNRLSKGYVTYDDFGHDGDDTLHRPVVNHPIPNVVQ
FT                   SEELNYSDGGSSVDVVFYSFITPNILWALKEIGFEEDVSNQIEFYSKNYLGLLLNEYIR
FT                   NNDI"
FT   gene            complement(<286296..>287087)
FT                   /locus_tag="DEHA2F03300g"
FT                   /old_locus_tag="IPF_8828"
FT   CDS_pept        complement(286296..287087)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03300g"
FT                   /old_locus_tag="IPF_8828"
FT                   /product="DEHA2F03300p"
FT                   /note="highly similar to uniprot|P05753 Saccharomyces
FT                   cerevisiae YJR145C RPS4A Protein component of the small
FT                   (40S) ribosomal subunit and highly similar to
FT                   uniprot|P05753 Saccharomyces cerevisiae YHR203C RPS4B
FT                   Protein component of the small (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88822"
FT                   /db_xref="GOA:Q6BMR2"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR2"
FT                   /protein_id="CAG88822.1"
FT                   /translation="MGRGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPLV
FT                   IFLRNRLKYALNGREVKAILMQEHVKVDGKVRTDATFPAGFMDVITLEATNEHFRLIYD
FT                   VKGRFTVHRITAEEASYKLAKVKKVQLGKRGIPYVVTHDGRTIRYPDPLIRANDSVKVD
FT                   LATGKITDFISFDTGRLVMVTGGRNMGRVGVITHREKHEGGFDLVHIKDSLENTFVTRL
FT                   TNVFIVGTEAGKPHISLPKGKGIKLSISEERDRRRNQQLIN"
FT   gene            complement(<287332..>289563)
FT                   /locus_tag="DEHA2F03322g"
FT                   /old_locus_tag="IPF_8825"
FT   CDS_pept        complement(287332..289563)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03322g"
FT                   /old_locus_tag="IPF_8825"
FT                   /product="DEHA2F03322p"
FT                   /note="weakly similar to uniprot|Q12344 Saccharomyces
FT                   cerevisiae YPL249C GYP5 GTPase-activating protein (GAP) for
FT                   yeast Rab family members"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66263"
FT                   /db_xref="GOA:B5RU86"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR031214"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU86"
FT                   /protein_id="CAR66263.1"
FT                   /translation="MMPPSDDEFQDAASNSFPTGSEVDNGKESPPITNQSTKNKKKNKK
FT                   KNKKQQQTDTASVSSFTGESSNYENNNESNELVNTNEKIDLTNNDDPIDKRGNDDTITE
FT                   DTEDVNNPVEKQTEQLKVVLPNPVKVATPDTSFTGEPANDEQNSTLPNGKPSLPNRKPI
FT                   SECLRLDQPSAQILEGTTEASNDKMNTISNSYRKESNNFLLESKFNQLNREFESKDLKL
FT                   KESINSGTENIKKTFNDIKNTVGGFSDMFDYQIDWEFWTRIVNDYESVIQNESNELNNL
FT                   INKGIPKEFRGIIWQLIAKSKNFQLEEFYFNLKSESSVHEKSIKRDLTRTSFFTNVEQV
FT                   NKGEELFNVIKAYSLFDPDVGYTQGMIFITVPLIMNMSESECFCLLVTLMKDYNLRSLF
FT                   CPEMKGLHLLLYEFDRLLEINLPNLYNHLVKQGIKSSMYASQWFLTFFAYKFPLDIVLR
FT                   IYDILITQGIESILKFAVNLMIKNESNITSLKFDKLLDFLKNNLFNVYVNDEFINGINS
FT                   TNTSQSDLSGSGVSRRFSLLGGRRSSAGGARSKSHNYYKLNELVEDSMQINVIPLDLSK
FT                   FEAEFENIYLNEKSKTTEIENLRIENGKLRHDIKLLETDFSSLNSDHINIVQKMVDIKV
FT                   TLPDIANDNEDLQRSIAELKDKIEGLESKINAGSGDNNSSESSLGLQAPALPTNIENNI
FT                   QELLTINAQETERFANLEEELSNLQMEDERLNSELSNVKQSKWLFNRWK"
FT   gene            complement(<290147..>291370)
FT                   /locus_tag="DEHA2F03344g"
FT                   /old_locus_tag="DEHA0F03718g"
FT                   /old_locus_tag="DEHA-IPF8824"
FT                   /old_locus_tag="DEHA-CDS3035.1"
FT   CDS_pept        complement(290147..291370)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03344g"
FT                   /old_locus_tag="DEHA0F03718g"
FT                   /old_locus_tag="DEHA-IPF8824"
FT                   /old_locus_tag="DEHA-CDS3035.1"
FT                   /product="DEHA2F03344p"
FT                   /note="some similarities with uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88824"
FT                   /db_xref="GOA:Q6BMR0"
FT                   /db_xref="InterPro:IPR038816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMR0"
FT                   /protein_id="CAG88824.2"
FT                   /translation="MRSQTMKNLISLKKNITRRIKQTLEEIAENLGHPQQRPVPVPIPI
FT                   PVRSGRNASRLSKQFSRYYSTSSNFTGGHYKFRAFQFLNVKYQNGGKLGRIIQNNSNWI
FT                   RFNIQNSNFNQYRSFRTFHKSFLYNNFSQRYQSQFGNKMANMNFFRHPNGSSPIKNLNL
FT                   NIRAFMNSKKFDTSDPSTYKQDLVLHSRPQVKSNIRLNVSLTPKFSELTLSMARTVSSA
FT                   GCEETSHNTQTSNGCYVDFPMSSKFSIPAMTILNNEILDELMQDLKILESKIAELKSDL
FT                   QNLFELGELPMKYLHDQNIIRVYFANCDKARLESLLREKNIINGIIYEEAVYGCSSDCA
FT                   NVSEADILSSYYGSSSSLGSSTEYDDDVLSDSSHHPLSNDHIIRPESGNQSQNSQHVSF
FT                   CDEDICWV"
FT   gene            complement(<291746..>292789)
FT                   /locus_tag="DEHA2F03366g"
FT                   /old_locus_tag="DEHA0F03740g"
FT                   /old_locus_tag="DEHA-IPF8822"
FT                   /old_locus_tag="DEHA-CDS3708.1"
FT   CDS_pept        complement(291746..292789)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03366g"
FT                   /old_locus_tag="DEHA0F03740g"
FT                   /old_locus_tag="DEHA-IPF8822"
FT                   /old_locus_tag="DEHA-CDS3708.1"
FT                   /product="DEHA2F03366p"
FT                   /note="some similarities with uniprot|P04386 Saccharomyces
FT                   cerevisiae YPL248C GAL4 DNA-binding transcription factor
FT                   required for the activation of the GAL genes in response to
FT                   galactose"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88825"
FT                   /db_xref="GOA:Q6BMQ9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ9"
FT                   /protein_id="CAG88825.2"
FT                   /translation="MKIPTNLAAESHHDNNLIEQACDSCRKRKLKCSKESPKCSKCIQH
FT                   NWCCSYSPRTVRSPLTRAHLTQVENKVKSLENLITYLLPQEVNSRGIDQLLYQNTFKDV
FT                   LRPYKDMLQNGSTSDEGQDGRNRGSTPGGGSGTTTPPAFEEDLNQSSSVTPQGGSPGKG
FT                   EHSRLNTNGCNSLAQSPSYSIFSMDDSISNASIDHSDHHDHNRIDNDKIKQEIIDDFIL
FT                   NSIPTDNKRSQCQFITPSAIKHEYSPYPYQQHQPRPKNISNTTTSATSLTSPSSLLSLN
FT                   SYGDNINEDEEIPKKSYASPTRSSANKKFEDLDLLISSNGINNGINDSNYNLIFDEVMD
FT                   DSPMING"
FT   gene            complement(<294495..>298598)
FT                   /locus_tag="DEHA2F03388g"
FT                   /old_locus_tag="DEHA0F03762g"
FT                   /old_locus_tag="DEHA-IPF8817"
FT                   /old_locus_tag="DEHA-CDS0148.1"
FT   CDS_pept        complement(294495..298598)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03388g"
FT                   /old_locus_tag="DEHA0F03762g"
FT                   /old_locus_tag="DEHA-IPF8817"
FT                   /old_locus_tag="DEHA-CDS0148.1"
FT                   /product="DEHA2F03388p"
FT                   /note="similar to uniprot|P35187 Saccharomyces cerevisiae
FT                   YMR190C SGS1 Nucleolar DNA helicase of the RecQ family
FT                   involved in maintenance of genome integrity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88826"
FT                   /db_xref="GOA:Q6BMQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ8"
FT                   /protein_id="CAG88826.2"
FT                   /translation="MIGNNLAEHLKWVDLNKPQIPNAKIISILARHGSDSSINNGIRGS
FT                   TGSVFRATGHMGEMNSSVGSQQTIPKSGATSTRINIRPPSDQPLQQSTQTANNMETLSI
FT                   PETGSIASKDRASNVSDIDSTTKPAKHTNIQSESNGNIANNNNKTTNINNPKEEEDENV
FT                   IDLTMEAPRNQKKQKLNPDSQTSIQQAYIQICEQKIALLMERFTTIESTAISLDDKKNY
FT                   LNKTFGPKFKQINENQSSLRGKLLFLTDDLQHDDTSSLSELNEFPNFDSDRISDSPKNL
FT                   NTIDKIDFCSQFSEVNQSNIARAMNIRENLESTNPNSQKPSSASNEESEFHLVDETSSP
FT                   SRYADNLNEARELVMQSNLRNKSNPPKIINNSESEDDEDNFGDNTMDGLRTPSQDRNDE
FT                   YDLGSFIEFEKQNLDNESVDESYIESQRNKHESDNSDNYTELDSDNEIDNIRLSPDVAE
FT                   NFGIKYNDLPNSEIDLISNIDNNNDMNDDNGNDDDNGNDDDIEEIEDFTTQLNQERELN
FT                   NTEDIIEISSDDEGDANYDMFVKPSTIKNTLVETKPNPLIVSKSPLTENNLAMNVPSQH
FT                   LDSDIDFSDDEDELINILNNHKPNKENIPPNSEAFIKEVYSKLNSVFKLSNFRPNQLHA
FT                   ISSTLNGKDVFVLMPTGGGKSLCYQLPALVKSGKTRGTTIVVSPLISLMQDQVQHLLNK
FT                   NIKAGMVSSKGSASERKSTLDSFRNGQLDLVYLSPEMINASQHIQRIITKLYDMNELAR
FT                   VVVDEAHCVSSWGHDFRPDYKGMNYFKHNYPKVPVMALTATANEKVRMDIIHHLKMDNP
FT                   ILLKQSFNRLNLFYEIKWKTSNTLEWIKNYILTKQVNKTGIIYCHSKQSCEHTSEKLNE
FT                   WGVNASYYHAGLSPTDRFEIQNKWQQNELQIICATIAFGMGIDKPDVRYVIHLFIPRTL
FT                   EGYYQETGRAGRDGAYSECIMFYSYKDARSLQNMIQRDEELDREGKENHLAKLRQVVQY
FT                   CENTTDCRRKQVLHYFNEQFNPITCNKKCDNCINSSNITIVEKDVTGYAKDILKLVKSI
FT                   QDDRVTVLHCQDVFKGSNNSKIMKFGHNLNPYHGKGRALDKTDVERIFFYLLSEGCLCE
FT                   YQIMKGGFASNYVKLDKQAESVLHDRKFIKINFSSESKQRSTGNATISGSVNPTNGYQF
FT                   QSFVSASRIQIPSITNFTSAGVQNSDHIKHSCNELNNMRMQIMVDSSLNSAENVFNDDT
FT                   LKDMAHKLPTNKRDFGKLASITKEQLNYFPQFKKLLGSLSKERKNQVPDSTPSSTTSPY
FT                   FGNQQDSNDPSTWRSTYSQTENSTAYVNIKNKYSRGNRRSSQSSQRGYKSQRGRNQKTQ
FT                   RSQRSQRVSKPRSNQKNTPRGMPL"
FT   gene            <300008..>300871
FT                   /locus_tag="DEHA2F03410g"
FT                   /old_locus_tag="DEHA0F03784g"
FT                   /old_locus_tag="DEHA-IPF8816"
FT                   /old_locus_tag="DEHA-CDS4389.1"
FT   CDS_pept        300008..300871
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03410g"
FT                   /old_locus_tag="DEHA0F03784g"
FT                   /old_locus_tag="DEHA-IPF8816"
FT                   /old_locus_tag="DEHA-CDS4389.1"
FT                   /product="DEHA2F03410p"
FT                   /note="some similarities with uniprot|P47977 Saccharomyces
FT                   cerevisiae YLR136C TIS11 mRNA-binding protein expressed
FT                   during iron starvation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88827"
FT                   /db_xref="GOA:Q6BMQ7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ7"
FT                   /protein_id="CAG88827.2"
FT                   /translation="MTAYQQVPLQTLPLNDNMMGYRQVNNEQYQKLAGVGGFGSVESTG
FT                   VDVGAVKGDLLADLWSMPSSHECASSTSSTSSSSSPSHNNMWKSPASITPPLMSQGNGN
FT                   YGYLPGGGVGSAMQPNYGMRDSIEYKPLSSNMVFNDLPALTEENLMYGTDSNSFAYIGR
FT                   NSSLSDHSDEIFNFEQQQLHQQQQQQQQQVLLSQQAAQYPSIEQTQQQKNKQLNVNTQL
FT                   YKTELCASYIKMGICPYGNKCQFAHGENELKSVSRPPKWRSKPCANWSKFGSCRYGNRC
FT                   CFKHGE"
FT   gene            <301854..>310064
FT                   /locus_tag="DEHA2F03432g"
FT                   /old_locus_tag="DEHA0F03806g"
FT                   /old_locus_tag="DEHA-IPF8813"
FT                   /old_locus_tag="DEHA-CDS0007.1"
FT   CDS_pept        301854..310064
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03432g"
FT                   /old_locus_tag="DEHA0F03806g"
FT                   /old_locus_tag="DEHA-IPF8813"
FT                   /old_locus_tag="DEHA-CDS0007.1"
FT                   /product="DEHA2F03432p"
FT                   /note="similar to uniprot|P33892 Saccharomyces cerevisiae
FT                   YGL195W GCN1 Positive regulator of the Gcn2p kinase
FT                   activity forms a complex with Gcn20p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88828"
FT                   /db_xref="GOA:Q6BMQ6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="InterPro:IPR033173"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ6"
FT                   /protein_id="CAG88828.2"
FT                   /translation="MTSETDVTWDQLSDIYEKEIFDSLTSKRIPFLRKVQHLLDTNKIT
FT                   DDKQELLELCQTLLKTYNYYQDVNSRNELLKTLEKIVLFKNEFLPVFIKFTYDIAVKER
FT                   SMAVTDYLTLLSWINKFSIITSDLGVSNQELIDKVVLSQAYLFNNCVNTILNESNQSFQ
FT                   HRRRINDSVLSSTKYSITHTFVKSDGSTKVIDNYINALTSPSNKVPPTVVISYLGVISD
FT                   AIVDALPTYPGLLNHLNESGGNVKSSILNYYTNQVLLNKIPPHDYSLKLFGKYIESSIN
FT                   ENDFNTVIVPVLDKAILRSSEVSFGYLIPRLIEFLSKDIDLSNTLVNTKLLNNFLNAFK
FT                   SPKELTRNGAFTSMELLIHNHFEGAADDILAKLIDECLKSFKGTSNNESKYLIVKTLSM
FT                   LKFKNTGISLRILNGLLPLVSKDQNEISLNGLINAFINQYLDLIVNNEEISDEDNSKFV
FT                   DQFKLGLSDKKMPLRRIWFLELGAYVYNTMRIVHNVKFLQLIETLYPIFISSIEEAQQS
FT                   PLPTITTKGISCSYVLITLSSLVKKSLKLIDDKKVFINSLRNTEKPSILTSSKVFTKLT
FT                   NSTEIIWFLRALREASGYINSLDQNDKNAYGHAWIYMAISENIPYDLRLQCLKFMGDCL
FT                   NENAEEFSKLIIDSIYCVLIEADNQKDQEVYSYNFKFLSPVLSVITQSKNHHTSKISLQ
FT                   KLLVAANHDLIPIRNEWVGLCQRSNVNIGDLVGNNSDEIFASTLEFLKNNAFAGLIYKA
FT                   AIKSMSMISFIKPEVFGPKLSALMSSDLDIDKIVNIDNQSIQIWQGTDGVLVLDVLNNS
FT                   SDSKRNDDKNNRDYETRKWEEEMRKELANKNKGKITKKLTKEEHVLVNEQLNKESNTRK
FT                   EVQILVNDFHRGIDIINDLVSNATQVDNGSAHWYPVAISKILILTESKVIPQLLHDLPL
FT                   KSFLHLAELISSRLGSLKGFVGVAILRLNGVVGLKENLLEEPILSLTSRILFRIKFLSD
FT                   QNPLDSLSLSYILPLLTKVLENGKMVAMKNATKQKVTSEFVEEDPEEEQLLLAIEIISS
FT                   HAEVFEDDTIPRQKILEVILSLMRLPSKAKLSKECFLAMCQHISVSITKNDLKILFDNV
FT                   ISPEVFVRNAVLEGIDSEFDLTTEMNYSNELWIAIHDNDPNSAELARTIWEDNKFELSQ
FT                   EAPTQLLQYAGNKDSGLRLSIANAIYSSVLALLDSNKNIFEETLNELIDLYHVKKNPPP
FT                   PALDRFGLVIKSSSDQRDTWEERSTIALTIKLLSPFFEKQTIEKLFRFLVDEKALGDKE
FT                   DLVRQELQEAGVEVIKKHGFTNIETLIPIFEACLAAKDDGSKTQDNIRECVIILYGALA
FT                   RHLDESDSRLDLIVDRLIKTLDTPSEDVQYAISECIAPLVVSFTPKLQHYFDILFEKLF
FT                   EGKNMASRRGGAYGISGLVKGSGIKSLSTYDIIRNLTDAADDKKNSQRREGVSFAFECL
FT                   SQSLGKFFEPYVIEILPILLKSLGDQVPEVREATDSAAKQIMKNTTSFGVKKLIPVAIS
FT                   NLDEIAWRSKKGSVELLGSMAYLDPTQLSSSLSTIVPEIVGVLNDTHKEVRKAADQALK
FT                   RFGEVIRNPEIQAIVPDLINAIGDPTKYTESALDKLIQTQFVHYIDGPSLALIIHVIHR
FT                   GMKDRSAATKKKACQIVGNMAILVDSKDLRPYLSALVGELEVAMVDPVPGTRSTAARAL
FT                   GSLVEKLGEEQFPDLIPRLLDTLRDETRAGDRLGSAQALSEVISGLGINKLEELLPDIL
FT                   SSASSPRNYIRAGFMPLLLFLPVCFGSQFSPYLNRIIPPILSGLADTDEEIRDTALRAG
FT                   RLIVKNYAKKAVDLLLPELEIGLSDTNYRIRLSSVELTGDLLFQVTGISGKSELTEEVS
FT                   EFSGEVNKTLIEVLGQDRRDRILSLLFVCRSDVAGIVRSAAVDIWKALVANTPRTVKEI
FT                   LPSLTQIIVRRLASSDEEQRTIAAQTLGEMIRRVGANALAQLLPTLQSSLVSGDNDAKQ
FT                   GICIALSELIKSTSYDGLVEYQGVFISIIRDALIDPATKVREAAAEAFKALQEQLGKVV
FT                   IDAILPYLLNMLESDNTENALLALKDIMATRADVIFPILIPTLLSPPIDAFKARALSSL
FT                   ASVAGHALYKRLSLIINTLVSAVIDSKNESEASQDEIKSAFDKILLAIDDDEGVHPLMQ
FT                   QLLSLVKHEDAAKRAVIYERLGSFFAHTNLDYTVYIQDMVSQFILSLGDRSPEVVKGSF
FT                   DALSALVKRQSKESLERLIKPARQALSITGVRGEELAAFTLPRGPNCILPIFSHGLMYG
FT                   NSDQREMSAHGIADIIDKTPAANLKPFATTITGPLIRVIGERVSSDIKAGILYALTSLL
FT                   SKIPQFLRPFIPQLQRTFVRSLSDPQNDALRSRAVIALGTLIEHQPRVDSLVTELVTGA
FT                   RNASEQGVKTAMLKGMLEVVSKAGENMNEASKTSILSLVEDEITLVSDKSAVSYARLIG
FT                   SLSQILSTEEATSILKSKILEKQNDVSVDNHKFAILSINSFLKDAPHHIFQTGLLDEIV
FT                   TFIINCANSSNDYISANATVAIGKLCLLLSETKSPVTSSTIVNDKQFEIDDDNIHKLVE
FT                   QLATNMVKPNSNSPDTRRLSLVIVRTIARFKYQELVKPFYDLLVPSVFTCVRDTIIPIK
FT                   LAAEKAYIAIFNLVDDEQMNDFNQWFNSKQSNISGVVGISIIPRSIGDYTKRVATRLAG
FT                   VERERIEAGGDEETLFSDRIEDESEVWAIGGVDLSK"
FT   gene            complement(<310397..>311737)
FT                   /locus_tag="DEHA2F03454g"
FT                   /old_locus_tag="DEHA0F03828g"
FT                   /old_locus_tag="DEHA-IPF8806"
FT                   /old_locus_tag="DEHA-CDS2767.1"
FT   CDS_pept        complement(310397..311737)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03454g"
FT                   /old_locus_tag="DEHA0F03828g"
FT                   /old_locus_tag="DEHA-IPF8806"
FT                   /old_locus_tag="DEHA-CDS2767.1"
FT                   /product="DEHA2F03454p"
FT                   /note="some similarities with uniprot|P27705 Saccharomyces
FT                   cerevisiae YGL035C MIG1 Transcription factor involved in
FT                   glucose repression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88829"
FT                   /db_xref="GOA:Q6BMQ5"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ5"
FT                   /protein_id="CAG88829.2"
FT                   /translation="MTTKAQDKRKDPASRPYKCTMCDKAFHRLEHQTRHIRTHTGEKPH
FT                   SCSFPGCFKKFSRSDELTRHSRIHTNPNSRRNKNLSKSQQKIPVPPQTSRGDQSDQSKE
FT                   EIQIINEKPQSEHVKTEKGDIEDSVMQPSVTHHAHGVLGAPLKVSSSESSFSSNPLSKK
FT                   KSHNSDHLANKGHRSEISDDEMQSTPPSDDCASHPNGKKNIDVLASAASEELENLNSKS
FT                   LPSLTDYFNNGKNAPFSAPAPKPINSSNSTNNLQYLSNVAMMSSNKPQSKSSTTLASKG
FT                   LTNALSVLQRMTPLNPVPQNSHALQDSDFDYVKQRLKKSRPNSPVNGKHFTLPNSPVLG
FT                   LSSTTTPIISASNSSTNLAALMMAPSSNNVITDGGFIPRQNNSSPPPHNAFDRNNLKDE
FT                   NSLPPLRSLKLELPTNLPMQSINASFDMGSTLRNTPFPSNTGEGRQY"
FT   gene            <314173..>316068
FT                   /locus_tag="DEHA2F03476g"
FT                   /old_locus_tag="DEHA0F03850g"
FT                   /old_locus_tag="DEHA-IPF8803"
FT                   /old_locus_tag="DEHA-CDS1459.1"
FT   CDS_pept        314173..316068
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03476g"
FT                   /old_locus_tag="DEHA0F03850g"
FT                   /old_locus_tag="DEHA-IPF8803"
FT                   /old_locus_tag="DEHA-CDS1459.1"
FT                   /product="DEHA2F03476p"
FT                   /note="weakly similar to uniprot|P38741 Saccharomyces
FT                   cerevisiae YHL024w RIM4"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88830"
FT                   /db_xref="GOA:Q6BMQ4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034352"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ4"
FT                   /protein_id="CAG88830.1"
FT                   /translation="MQKKQYIEDQRSISPVLESGSYKQNDGYMKGDEKNTLAMFNQLFI
FT                   DSNKLAADDENDNTDGEAGESSNGEEYEEEIIHLGDGDHHDDTAMVDGEKKIVDSEEDC
FT                   NDYEAETNGNEDGNTDENKENCDPNHGDMKLTNEKPLARGRPSSCVFVASLCSSRSDDE
FT                   LCVSVTKHFGQWGKLSTVKVLRDPANRPYAFVQYTNDKDSRTAIYRGHNSILNGRNLRC
FT                   EAAKVNRTLFISSKFLKTEKGFKDALQEFGEIEQLIPSDEFGNVKSSKPHTKSSKHWFC
FT                   KYVYRDDAIRAFANLSENNLFHIEWAQNIETFSSNKNHNSYHNAVKQEENKMKFDKFSV
FT                   FVGQLNCSVTEEELIKRFKRHGKIEEVTIIKKTSNTFGFVKYKEESSAASAVERENHSM
FT                   FKDKTMHVQYRELHSNTLKHSPKAQGVALAPPPINLKKRTTLGAKKTSDLRKISPFNHH
FT                   LYPMPIPIPTKKNFNSYTTNHSKQRNITNPYNTNSIGRRRYSKFGDVYDKLKPEIKEDS
FT                   PTPPESVQTYDSHTITKSGYSPSSAVNSERSEGNKNLKSTNKTKNVPYFYYIPTNEVAS
FT                   GSNSGYYNPYQYFIPYEASPEFQSQNGYGVPFPMYYPPTNNDQEFNFEDSFETPN"
FT   gene            <316263..>317672
FT                   /locus_tag="DEHA2F03498g"
FT                   /old_locus_tag="DEHA0F03872g"
FT                   /old_locus_tag="DEHA-IPF8801"
FT                   /old_locus_tag="DEHA-CDS2573.1"
FT   CDS_pept        316263..317672
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03498g"
FT                   /old_locus_tag="DEHA0F03872g"
FT                   /old_locus_tag="DEHA-IPF8801"
FT                   /old_locus_tag="DEHA-CDS2573.1"
FT                   /product="DEHA2F03498p"
FT                   /note="weakly similar to uniprot|Q12468 Saccharomyces
FT                   cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88831"
FT                   /db_xref="GOA:Q6BMQ3"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMQ3"
FT                   /protein_id="CAG88831.2"
FT                   /translation="MRCIHELADVFINDSDERILTQSLDATEIDKHADYESFFSINSDE
FT                   SIMKARPWKSNAKYFKKTYISSLALCKMSVHAKSGGAIEVMGMMTGKIIKNSIIVMDVY
FT                   PLPVEGTETRVNAQAEGYEYMVQYLENSKQVGRDENIVGWYHSHPGYGCWLSGIDVATQ
FT                   SLNQNFQDPYLAIVIDPMKTEDQGKVEIGAFRTFPDNYKSPDSAAPTNNTRGVPPSKQK
FT                   DFGVHSDKYYSLDIQIFKSNLDTEILNIISNKSWIGKLIKSVNTANHQEQNMIENVFKL
FT                   INKLQKKEVNQLNRFEISFIKKFDLIFEDIISKKLMNDNRFYSTISQSSYDSFSGHGNS
FT                   SSNDEMDDESDLDDRDKSSAPLDISDTGNDDVMSMESSVNVYTDKRGDDNDDDDDNDGY
FT                   DKRPMYTNYRSRANLTKPRKSGSSPEEHVKLSNNVNKTITNISNHSKDIGLTELQDLIA
FT                   LKTKESIFLGK"
FT   gene            <318210..>320303
FT                   /locus_tag="DEHA2F03520g"
FT                   /old_locus_tag="DEHA0F03894g"
FT                   /old_locus_tag="DEHA-IPF8800"
FT                   /old_locus_tag="DEHA-CDS1161.1"
FT   CDS_pept        318210..320303
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03520g"
FT                   /old_locus_tag="DEHA0F03894g"
FT                   /old_locus_tag="DEHA-IPF8800"
FT                   /old_locus_tag="DEHA-CDS1161.1"
FT                   /product="DEHA2F03520p"
FT                   /note="similar to uniprot|P53874 Saccharomyces cerevisiae
FT                   YNL186W UBP10 Ubiquitin-specific protease that
FT                   deubiquitinates ubiquitin-protein moieties"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88832"
FT                   /db_xref="GOA:Q6BMQ2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ2"
FT                   /protein_id="CAG88832.2"
FT                   /translation="MSGQANVLSNSVTPLIDRILANPLTFISGKQIESDNFEKPASYIV
FT                   LSKSSKKGDSSESSKASTQEKEPKSPEMRKPRSMAEAVAVYTGKKFLTKAEKKAAKKRK
FT                   VTQPLVDSEEEDVGEVIGGDIKMAESDSDSISDSQYESASEFQSDSNVELPFAEFKSES
FT                   DVKSSSESRSDSELKTESESKSDSESTSESPAGGEEDDEGNDDDDDDDNKDYSLEDNES
FT                   FSESDSGSASDVEDSSNDEEDLEALKHDLKQELQHDPRDISSKDPSLSGSDDDDEEKEE
FT                   ENSDKNTTPPTSPEDEPEKPPATVNASDDLHVLPLNKFYSINEVSSDRGSNNSTRIYKN
FT                   WRELSKRKPVGLLNHGVTCYMNSAIQSLIHIPAVQHYLTDINSGKHNKTLKPRSVSHVL
FT                   AELSKRMWALDDNTSKAKQPKYVNPKRIIQRLDDINCMMSEWQQEDSHEYFMSLMSRLQ
FT                   EDSTPKGVKLNQSIIYDIFGGLLHQSVTCKNCNYVSDTKQEFYDLSLGLNRKKNKDVTE
FT                   NSGPQRYTIEKSIQEFFSSELIKLDRKDKSSGYDCENCKQKSNACKISTIDRSPETLTV
FT                   HLKRFKFNGNSSSKVKQSISYPNYLDLTKFTTLKTPTKYQLVSVIVHEGRSISSGHYIA
FT                   HCLQPDGTWSTYDDEYINKINEKEALSDPSAYVLVYTKLTPRLMKRSNEGNDNLVNAKK
FT                   LKR"
FT   gene            complement(<320662..>321300)
FT                   /locus_tag="DEHA2F03542g"
FT                   /old_locus_tag="DEHA0F03916g"
FT                   /old_locus_tag="DEHA-IPF8799"
FT                   /old_locus_tag="DEHA-CDS5236.1"
FT   CDS_pept        complement(320662..321300)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03542g"
FT                   /old_locus_tag="DEHA0F03916g"
FT                   /old_locus_tag="DEHA-IPF8799"
FT                   /old_locus_tag="DEHA-CDS5236.1"
FT                   /product="DEHA2F03542p"
FT                   /note="weakly similar to uniprot|P38191 Saccharomyces
FT                   cerevisiae YBL049W MOH1 Protein of unknown function has
FT                   homology to kinase Snf7p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88833"
FT                   /db_xref="GOA:Q6BMQ1"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="InterPro:IPR034751"
FT                   /db_xref="InterPro:IPR039058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ1"
FT                   /protein_id="CAG88833.2"
FT                   /translation="MGLKYTNFFENSSYESSDTQIVICKNCSSHLCLSNLILSDNFRGS
FT                   TGPAYLVDKLINYQSENGSQETRMLTGNYLINKVKCHQCSNQLGWTYKKAFSYSETYKE
FT                   GKFVIEKDYIKLIPNNFSTASLVEKAKLNNSRRRSSGSSSSSVDYNTTSDDLFKFNSVD
FT                   PTKEKMEESVGDSSINFRDNDGVSILGRLRFQGIDKEEFDEDQDVFVDV"
FT   gene            complement(<321897..>322763)
FT                   /locus_tag="DEHA2F03564g"
FT                   /old_locus_tag="DEHA0F03938g"
FT                   /old_locus_tag="DEHA-IPF8798"
FT                   /old_locus_tag="DEHA-CDS4376.1"
FT   CDS_pept        complement(321897..322763)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03564g"
FT                   /old_locus_tag="DEHA0F03938g"
FT                   /old_locus_tag="DEHA-IPF8798"
FT                   /old_locus_tag="DEHA-CDS4376.1"
FT                   /product="DEHA2F03564p"
FT                   /note="similar to uniprot|P53881 Saccharomyces cerevisiae
FT                   YNL177c MRPL22 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88834"
FT                   /db_xref="GOA:Q6BMQ0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMQ0"
FT                   /protein_id="CAG88834.1"
FT                   /translation="MFNRLGLLQRAVGVQPARIQTSLLRSVKQFHTTKYLQNGNVFGEL
FT                   TKGKESDEAEIEKQNNIDASQITPATDSTLQEYYLEEAKKSQLTSDKYITPLKRKLFQL
FT                   NVQQNGFFMNNEIFKDPETGKVYKLALTEEEIDILEPSIYLQSYRIKSSMKKATQVNRF
FT                   VRGYKVKNAINQLHFNPKKMSTELEKLLKKGLEQARESNYNEDELYIQALWVGSDGSWR
FT                   KRLDAKGRGRTGIIEHPHIHLKAILRTDQTANRLKWEKHQKQLNQKPRMFLNNEPLNFR
FT                   VHPFYRW"
FT   gene            complement(<323850..>324503)
FT                   /locus_tag="DEHA2F03586g"
FT                   /old_locus_tag="DEHA0F03982g"
FT                   /old_locus_tag="DEHA-IPF8796"
FT                   /old_locus_tag="DEHA-CDS5185.1"
FT   CDS_pept        complement(323850..324503)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03586g"
FT                   /old_locus_tag="DEHA0F03982g"
FT                   /old_locus_tag="DEHA-IPF8796"
FT                   /old_locus_tag="DEHA-CDS5185.1"
FT                   /product="DEHA2F03586p"
FT                   /note="weakly similar to uniprot|Q02774 Saccharomyces
FT                   cerevisiae YDL212W SHR3 Endoplasmic reticulum packaging
FT                   chaperone required for incorporation of amino acid
FT                   permeases into COPII coated vesicles for transport to the
FT                   cell surface and similar to CA0700|CaSHR3 Candida albicans
FT                   CaSHR3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88836"
FT                   /db_xref="GOA:Q6BMP9"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP9"
FT                   /protein_id="CAG88836.1"
FT                   /translation="MAYKDIVPVGSGLIIGATSFGLGVLYANLPYDVNTLWRQDETGTA
FT                   FITSLAHYSVWGNSPAYVHHIFHSVIGLGFIGAFIKLYKPSEDAKYFEYGSLFLYMVGV
FT                   IIYLTNLRIGVNSCLAGDWGEVDMPTGINVMAASQVMIGFALFGVLLLQGGLYYAEWYD
FT                   NRLKVKFFEEEERAALAAASAKTDNLAESEVVGSKGASASGASASSTKAKKKSK"
FT   gene            <325442..>326089
FT                   /locus_tag="DEHA2F03608g"
FT                   /old_locus_tag="DEHA0F04004g"
FT                   /old_locus_tag="DEHA-IPF8795"
FT                   /old_locus_tag="DEHA-CDS5210.1"
FT   CDS_pept        325442..326089
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03608g"
FT                   /old_locus_tag="DEHA0F04004g"
FT                   /old_locus_tag="DEHA-IPF8795"
FT                   /old_locus_tag="DEHA-CDS5210.1"
FT                   /product="DEHA2F03608p"
FT                   /note="similar to uniprot|P19073 Saccharomyces cerevisiae
FT                   YLR229C CDC42 Small rho-like GTPase essential for
FT                   establishment and maintenance of cell polarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88837"
FT                   /db_xref="GOA:Q6BMP8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP8"
FT                   /protein_id="CAG88837.2"
FT                   /translation="MRSIKSVVIGDGGVGKTCLLISYTTNTFPNDYIPTVFDNYSATAM
FT                   FNGEPIKLGLWDTAGQAEYDRLRPLSYPQTEIFLCCFSIVSPESLENVKAKWIPEILHH
FT                   SPKDILVLLVGTKADLRDDLSVLDKLDDGNQKPTTAAQGERLAKELGLVGYKECSAATQ
FT                   MGVKEVFDFAIKSVVSPPEGNQGRNGGTNNAATNMRNSQARKVKKAKKCTIL"
FT   gene            complement(<326445..>327053)
FT                   /locus_tag="DEHA2F03630g"
FT                   /old_locus_tag="DEHA0F04026g"
FT                   /old_locus_tag="DEHA-IPF8794"
FT                   /old_locus_tag="DEHA-CDS5337.1"
FT   CDS_pept        complement(326445..327053)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03630g"
FT                   /old_locus_tag="DEHA0F04026g"
FT                   /old_locus_tag="DEHA-IPF8794"
FT                   /old_locus_tag="DEHA-CDS5337.1"
FT                   /product="DEHA2F03630p"
FT                   /note="similar to uniprot|Q07623 Saccharomyces cerevisiae
FT                   YDL213c and highly similar to CA3006|IPF12152 Candida
FT                   albicans IPF12152 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88838"
FT                   /db_xref="GOA:Q6BMP7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP7"
FT                   /protein_id="CAG88838.1"
FT                   /translation="MSDTAKLTKKQKKALDFRQKKSKDSTEEDTSANTEKDNKKRAADA
FT                   EGTSETGEEPKKKRKTRRGKKGKGVNEGKGPRFILFVGNLPYNVTQPELVSHFKNSNPD
FT                   RIRLRQDKGIAFMEFDNDSREIQSKMELALRMHHSTLRNRKINVELTVGGGGNSDNRVN
FT                   KLKEKNEKLEDERRSRVTKDGKKGEVPEGVHPSRAALLS"
FT   gene            <327236..>327769
FT                   /locus_tag="DEHA2F03652g"
FT                   /old_locus_tag="DEHA0F04048g"
FT                   /old_locus_tag="DEHA-IPF8793"
FT                   /old_locus_tag="DEHA-CDS5646.1"
FT   CDS_pept        327236..327769
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03652g"
FT                   /old_locus_tag="DEHA0F04048g"
FT                   /old_locus_tag="DEHA-IPF8793"
FT                   /old_locus_tag="DEHA-CDS5646.1"
FT                   /product="DEHA2F03652p"
FT                   /note="some similarities with uniprot|Q871R2 Neurospora
FT                   crassa 7F4 Hypothetical protein 7F4.280"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88839"
FT                   /db_xref="GOA:Q6BMP6"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP6"
FT                   /protein_id="CAG88839.2"
FT                   /translation="MVLSNKNKIKINLKQTPKFDASRSRSRSPHISSESLTSNSQGSDQ
FT                   KDQNYRDRSQERSIDKMQKSDLYKKDNTSLQDLPLSNSSFNNKIKLPEHKQEQDSRGRQ
FT                   RERNDEDHINMESPVEAQDDDMISLMGFGGFGTTKGKHVKGTKGGNTKKEAKSEYRTYM
FT                   NRSKGFNRPLSPTR"
FT   gene            complement(<327815..>329362)
FT                   /locus_tag="DEHA2F03674g"
FT                   /old_locus_tag="DEHA0F04070g"
FT                   /old_locus_tag="DEHA-IPF8792"
FT                   /old_locus_tag="DEHA-CDS2228.1"
FT   CDS_pept        complement(327815..329362)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03674g"
FT                   /old_locus_tag="DEHA0F04070g"
FT                   /old_locus_tag="DEHA-IPF8792"
FT                   /old_locus_tag="DEHA-CDS2228.1"
FT                   /product="DEHA2F03674p"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182C IPI3 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88840"
FT                   /db_xref="GOA:Q6BMP5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMP5"
FT                   /protein_id="CAG88840.2"
FT                   /translation="MDESVFYISEGDPADKHSQESFGHSSSVHSSQQHAGFRQADCPQN
FT                   GACLSGVGTGERLFVASPNKALINVYSWGKESPDQRIPIPEQLSCLTLCKHPRIKVSEG
FT                   RQSDERNLPSFRTPWLLAGGSKTGKIYVWELASGNLLCVKEAHYQAITAIKFSQCGTFL
FT                   VSGSSDARCMVWRTSDLISVYNKDEESSINIKPFASFTDHSLPITDLAISEAGIISDLR
FT                   LYTVSRDSTLRIYDIMTKSLLTTFVLPSGIECVTKDPANRACYVGLSNGLIRTVPLYQI
FT                   NPNTSVLESIGGRGKIVTLDTDPNLLSTFVHHQQRLSTEPLHKTLNKKTTTEEKPILVT
FT                   RLSITMDGSNLISGDSAGRVYVSDIVSRQVVKTFAPCKSSISYIQVNACAAEKVSVSNT
FT                   SSNNNDKRHRLIPQFKRVLANPDPLEHQLYMEIPKQQEDEEDFESWLARKSQEELEFRN
FT                   LTHINSSVTVTGAAPTTNDSTVKELEEKLAKVSKAYTDLRGKHEELYEEHNRLLSDS"
FT   gene            <329553..>330968
FT                   /locus_tag="DEHA2F03696g"
FT                   /old_locus_tag="DEHA0F04092g"
FT                   /old_locus_tag="DEHA-IPF8790"
FT                   /old_locus_tag="DEHA-CDS2556.1"
FT   CDS_pept        329553..330968
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03696g"
FT                   /old_locus_tag="DEHA0F04092g"
FT                   /old_locus_tag="DEHA-IPF8790"
FT                   /old_locus_tag="DEHA-CDS2556.1"
FT                   /product="DEHA2F03696p"
FT                   /note="similar to uniprot|P53878 Saccharomyces cerevisiae
FT                   YNL181w protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88841"
FT                   /db_xref="GOA:Q6BMP4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP4"
FT                   /protein_id="CAG88841.2"
FT                   /translation="MPIDILGTAIYEGPEAIPGWEYIKTYTPAIMALAGIKYYFGGTSN
FT                   TWERDYHGKVYIMTGATSGLGANLAYELASKGAQLILLVRSTEDSWLVDYIEDLRERTD
FT                   NFMIYAEECDLNSLYSIRKFATKWLDNQPPRRLDGVICCAAESIPIGKARQVTVDGVEK
FT                   QMGINYLAHFHLLTLLSPALKIQLPDRDVRIVMATCVSQALGDLDMKDALWLNRRYPTR
FT                   EPWKLYGTSKLMLTMFAKEFQRRLNSFERKDKAPCNVRVNMVNPGIMRTPSTRRFLSMG
FT                   AIWGLLVYFVLFPIFWIFFKSTTQGAQSFLYALAAPVFKNLDGGNVIQECKILKPARKE
FT                   LSDEDLQKALYDETEKLLEALEKSSAIERKRQEKIQESKMPLADKLRAQNEESRKKADI
FT                   HTKPESPEELQAKLASLKRSIGIPSDANDELPLFPSQPNSSQSESRAENLSTTKSTPKS
FT                   KSKAKKSKSKKID"
FT   gene            <331402..>333918
FT                   /locus_tag="DEHA2F03718g"
FT                   /old_locus_tag="DEHA0F04114g"
FT                   /old_locus_tag="DEHA-IPF8789"
FT                   /old_locus_tag="DEHA-CDS0769.1"
FT   CDS_pept        331402..333918
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03718g"
FT                   /old_locus_tag="DEHA0F04114g"
FT                   /old_locus_tag="DEHA-IPF8789"
FT                   /old_locus_tag="DEHA-CDS0769.1"
FT                   /product="DEHA2F03718p"
FT                   /note="similar to uniprot|P22211 Saccharomyces cerevisiae
FT                   YNL183C NPR1 Protein kinase that stabilizes several plasma
FT                   membrane amino acid transporters by antagonizing their
FT                   ubiquitin-mediated degradation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88842"
FT                   /db_xref="GOA:Q6BMP3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP3"
FT                   /protein_id="CAG88842.2"
FT                   /translation="MNLETPNRKANGGKLPISSLTRLLNESSSNNTTPILSKNHSQTSL
FT                   DSTSETITPSHQNHDILEGNGHRPDLGSEDVDAITGGVGGFSMDENYDDGSLDVAQPQV
FT                   INGFDPSIDIVPEDSFLVPESPRTQGGRNSGNTAFQYRDVPIKPPTVASPRTKRTGSVS
FT                   HSSFLNTGGYGGESMSSSIPYSAPGGRSHLSSSFTNLNGLGTNSSANQSSSFSSEAPIT
FT                   HDNSHIPNLPNGQPISSIHIQSPQVNSSSIEPRFVISKQRVAQAQAQASLSTSNKSSSQ
FT                   SGLSYFFSSKNKGPNKKPSSSTDLGSFYNNAYQDYNNSVVLSSPSSISSNESISSNAFP
FT                   APSRHNSMANLKRFFKKSTPTNPAPASSLSSSLRSNGSDRNSIPVNSDFNTTMSSSFQP
FT                   GSYGQSLTESSSNASYSQSPNTGLTIGSSSVSRSSSVLQNKMNYQRERRGSVSVLINPQ
FT                   QQLPFSKRYGKLGDNLGAGAGGAVKLVNRLSDKQVFAVKEFRAKYQNETKRDYAKKITG
FT                   EYCIGSTLKHPNIIETIEICYENERILQVMEYCDFDLFAIVMSNKMSREEINCCFKQIL
FT                   SAINYLHSMGLAHRDLKLDNCVIDNRGIVKIIDFGSAVVFSYPFTKTLIEAQGIVGSDP
FT                   YLAPEVCVFNKYDPRPVDVWSAAIIYCCMILKKFPWKVPKLSDNSFKLFASRGEMIPLS
FT                   EMLKKTPEQSSNDLNERGDELDISEMNPISISKSESSNPQSLNSQGKPHTSSESGAGRL
FT                   LLALPEDCRPLIGKMVELPPACRISIEECFNDDWLTSIDMCYVEQTLTSDGSTNFEVVP
FT                   CDNHDHTQVDQSKAHIAAFDKTKKKQ"
FT   gene            complement(<334136..>334567)
FT                   /locus_tag="DEHA2F03740g"
FT                   /old_locus_tag="DEHA0F04136g"
FT                   /old_locus_tag="DEHA-IPF8786"
FT                   /old_locus_tag="DEHA-CDS6233.1"
FT   CDS_pept        complement(334136..334567)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03740g"
FT                   /old_locus_tag="DEHA0F04136g"
FT                   /old_locus_tag="DEHA-IPF8786"
FT                   /old_locus_tag="DEHA-CDS6233.1"
FT                   /product="DEHA2F03740p"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185c MRPL19 ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88843"
FT                   /db_xref="GOA:Q6BMP2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP2"
FT                   /protein_id="CAG88843.2"
FT                   /translation="MSAKNVMVKLIVGAGQAAPAPPVGPALGSKGVKAIDFCKEFNART
FT                   GNYQPGIPIPCLLTIKPDRSFTFEMKSPPTSWLLLKAAQAKKGSDKPTHNIVGEVSLKH
FT                   VYEIAKIKKTDDRHKEVDLQAICGAVISTAEAVGVKIVP"
FT   gene            complement(<334843..>336489)
FT                   /locus_tag="DEHA2F03762g"
FT                   /old_locus_tag="DEHA0F04158g"
FT                   /old_locus_tag="DEHA-IPF8785"
FT                   /old_locus_tag="DEHA-CDS2025.1"
FT   CDS_pept        complement(334843..336489)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03762g"
FT                   /old_locus_tag="DEHA0F04158g"
FT                   /old_locus_tag="DEHA-IPF8785"
FT                   /old_locus_tag="DEHA-CDS2025.1"
FT                   /product="DEHA2F03762p"
FT                   /note="some similarities with uniprot|P53214 Saccharomyces
FT                   cerevisiae YGR023w MTL1 and similar to CA0076|IPF8866
FT                   Candida albicans IPF8866 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88844"
FT                   /db_xref="GOA:Q6BMP1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP1"
FT                   /protein_id="CAG88844.2"
FT                   /translation="MTYVESMMGNVRDIFRRADEDTGNGGGLQDDGGFNATSSSSSSRG
FT                   PTSSSGDDGPTGGSSLTSDNSETIGPTSDGSETVSETSGPTSGPASATSSDITSESSSE
FT                   NSSSSSSSSDTSSSDTSSSETSRSSSSRSSSSSSVSSSSVRSSSSRSSSRSLSSSNNPS
FT                   SSSFISSSSSSSASPSSSFLTSSSIPFSSSESSSSHSSSQERSSSSVTLSSSSSSPSST
FT                   PSQASSTSHSESSTRASSSRSSSRSSSRSSSSHTQSSSSPSSSSDRTSSDRTSSDRTSS
FT                   SHVTPTSSSSFSSYYTTIEDSGTTITSLVTVPTSAANDQTDTPSSTSEKNAKLIGGLVG
FT                   SIGGTIVIGLLVALFLFLKKRKKVTNQSPDFNDNTSGDSDSYKDKSGFKKLFSSKNTNT
FT                   YGGVAGVTDIERQNNTPVIQADDESNEESDDFVYRGVTNNNNLDSIFRSTASNSSGQNT
FT                   AAGGSANQSANHTRMNSIGHALDIPYETRESEEHDPFASHTRINSDGTDNFSPSDYDID
FT                   QNDLVPADRSNIFGEESHSNNSRSRFHEEII"
FT   gene            complement(<337144..>338682)
FT                   /locus_tag="DEHA2F03784g"
FT                   /old_locus_tag="DEHA0F04180g"
FT                   /old_locus_tag="DEHA-IPF8781"
FT                   /old_locus_tag="DEHA-CDS2238.1"
FT   CDS_pept        complement(337144..338682)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03784g"
FT                   /old_locus_tag="DEHA0F04180g"
FT                   /old_locus_tag="DEHA-IPF8781"
FT                   /old_locus_tag="DEHA-CDS2238.1"
FT                   /product="DEHA2F03784p"
FT                   /note="weakly similar to uniprot|Q12523 Saccharomyces
FT                   cerevisiae YPL247c and similar to CA3884|IPF6367 Candida
FT                   albicans IPF6367 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88845"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMP0"
FT                   /protein_id="CAG88845.2"
FT                   /translation="MEWQNPTKYKRSSVSMGMPYSQGGYGLSYTSPQQQQRTQFYSGRH
FT                   ALLPPSSNGNNRGLANEGGSGVLDRHSYYFSPDPLYCSDWTYLNGGEMDCIALSSYKEG
FT                   FSNKISVVHGVGYGREATCAGNGDMDDDDVTMGSPTSSAYQDDAIEGFDFHKVAEVSVD
FT                   YPVTNLQWDPSMLRMGNGVSERLGASSEVLRLYKVDHEALDKNSDYKLTQTHILANNTA
FT                   TASSSTSSSAQSNTGASGSASEDMNTFPPVTSFDWNKVDPNLIITSSVDTTCTVWDLNR
FT                   SSLTADPSSDSGAATDTATVKTQLIAHDSEVFDVKFIHNSTNVFASVGNDGSMRVFDLR
FT                   SLEHSTIIYEPSHPPTSASTLTTPHHNSRALLKLSASNIDQNYLATIGVNSNQVIIIDM
FT                   RMPGLPVAALDGSLGGANTAAINSIQWHPSSNYLLTGGDDCQALVWDCNNIRHPGAPKT
FT                   PSSASSHPPEFTSLVESPVLAYSDDLEVNNVCWRRDQGDWMGVVSGKGFQAVSI"
FT   gene            complement(<338944..>342051)
FT                   /locus_tag="DEHA2F03806g"
FT                   /old_locus_tag="DEHA0F04202g"
FT                   /old_locus_tag="DEHA-IPF8779"
FT                   /old_locus_tag="DEHA-CDS0399.1"
FT   CDS_pept        complement(338944..342051)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03806g"
FT                   /old_locus_tag="DEHA0F04202g"
FT                   /old_locus_tag="DEHA-IPF8779"
FT                   /old_locus_tag="DEHA-CDS0399.1"
FT                   /product="DEHA2F03806p"
FT                   /note="similar to uniprot|P49095 Saccharomyces cerevisiae
FT                   YMR189W GCV2 P subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88846"
FT                   /db_xref="GOA:Q6BMN9"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN9"
FT                   /protein_id="CAG88846.2"
FT                   /translation="MISRVVARSARANRLSTLTRSVPRAYNLNLKLAASNRFLASKADT
FT                   SSADYEKVYDPSAKTVSLGNLDTFARRHLGPTPENVKTMLSALGYKDLDEFLSKAIPEH
FT                   VLYKRALQIQPQQGFTESEMLEHLHNLANKNKIVKSFIGKGYAGTKVPPVIQRNLLESP
FT                   EWYTSYTPYQPEISQGRLESLLNYQTMVTSLTGLNMANASLLDEGTAAGEAMSLSFHSL
FT                   KGKRGKYAVDTNLHPQTLDVMKSRAENIGVEIVELPLSTQEGLEELERIASDSCGALVQ
FT                   YPGTDGSLNNYTKVGEIVHAHKGLFAMATDLLALTLIKSPAEFNADIALGTSQRFGVPF
FT                   GYGGPHAAFFATNMKYSRKIPGRIVGLSKDRLGKPALRLALQTREQHIKREKATSNICT
FT                   AQALLANMAAMYAVYHGPKGLKDIASRVYGYTTVLANEISNNSQHEIVNDKWFDTLTVK
FT                   LGGGVKSDEILNKALNEYNINLFKAGEDKVSLCLDETVEEKDLIALVDVFTGNDSFSTS
FT                   SISELPKLPTELLRTDEILAHPVFNTHRSETSMLRYLHLLQSRDLSLANSMIPLGSCTM
FT                   KLNATVEMQTLSMPGFNQIHPFAPLNQAQGYKELVDEFEKDLNDITGFDATTNMPNSGA
FT                   QGEYTGLSLIRQYHKSKGEYEQRNICLIPVSAHGTNPASAAMCGLKVVPVKCLNNGSID
FT                   VDDLKVKAEKHAENLCSIMITYPSTYGLFEPGIKTAIDLVHNNGGLVYLDGANMNAQVG
FT                   LTSPGDLGADVCHLNIHKTFALSHGGGGPGQAPVCVKEHLKPFLPKHHFLDTPHSTNES
FT                   IQAVNSAPYGSASVIPVSYSYIKMLGAKALPHVSSIAMLNANYMLEKLKDDYQIMFVDH
FT                   SASTDEGLKHCAHEFILDLREFKAVGVEAIDVAKRLQDYGFHAPTMSFPVAGTLMIEPT
FT                   ESENLEELDRFINSLLSIRKEINAMANKEPLGQVLKNAPHSLNDIVSTSQADWEARGYT
FT                   REQAAYPLPFLKESKCWPSVSRVDDTYGDMNLMCTCPSVEEVAADQ"
FT   gene            complement(<342728..>344104)
FT                   /locus_tag="DEHA2F03828g"
FT                   /old_locus_tag="DEHA0F04224g"
FT                   /old_locus_tag="DEHA-IPF8778"
FT                   /old_locus_tag="DEHA-CDS2664.1"
FT   CDS_pept        complement(342728..344104)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03828g"
FT                   /old_locus_tag="DEHA0F04224g"
FT                   /old_locus_tag="DEHA-IPF8778"
FT                   /old_locus_tag="DEHA-CDS2664.1"
FT                   /product="DEHA2F03828p"
FT                   /note="highly similar to uniprot|P02994 Saccharomyces
FT                   cerevisiae YPR080w TEF1 translation elongation factor eEF1
FT                   alpha-A chain and highly similar to uniprot|P02994
FT                   Saccharomyces cerevisiae YBR118W TEF2 translation
FT                   elongation factor eEF1 alpha-A chain"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88847"
FT                   /db_xref="GOA:Q6BMN8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN8"
FT                   /protein_id="CAG88847.1"
FT                   /translation="MGKEKTHVNLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKFHVTIIDAPGHRDFIKNMIT
FT                   GTSQADCAILIIAGGIGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSVKWDKN
FT                   RYDEIVKECSNFVKKVGFNPKSVPFVPISGWNGDNMIEASPNCPWYKGWEKETKAGKSS
FT                   GKTLLEAIDAIEPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPA
FT                   GVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDTPKGCDSFAA
FT                   QVIVLNHPGQISSGYSPVLDCHTAHIACKFDTLIEKIDRRTGKKLEDNPKFIKSGDAAI
FT                   VKMVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVEKSDKAGKVTKAAQKAAKK
FT                   "
FT   gene            complement(<345117..>346769)
FT                   /locus_tag="DEHA2F03850g"
FT                   /old_locus_tag="DEHA0F04246g"
FT                   /old_locus_tag="DEHA-IPF8775"
FT                   /old_locus_tag="DEHA-CDS1959.1"
FT   CDS_pept        complement(345117..346769)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03850g"
FT                   /old_locus_tag="DEHA0F04246g"
FT                   /old_locus_tag="DEHA-IPF8775"
FT                   /old_locus_tag="DEHA-CDS1959.1"
FT                   /product="DEHA2F03850p"
FT                   /note="similar to uniprot|P53172 Saccharomyces cerevisiae
FT                   YGL056C SDS23 Spindle pole body protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88848"
FT                   /db_xref="GOA:Q6BMN7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMN7"
FT                   /protein_id="CAG88848.2"
FT                   /translation="MSNSFSFQRQNPGSPLQQHSPIHNINTGGNSNSVSNQSNNHPQTP
FT                   GHHVPSRKPSIVEMLSSPPPLPNTPDQEDIHSFSLSRNTSVSSRASSIYGNVNGGTSKG
FT                   SIVGVDWAEIPLVELTESNKLVSINSGFSVQKAFETLMEHNLTSVPVSLSKTDSTDLTN
FT                   CLTFDYSDVNTYLLLIMNKINLNDLSIYEGGDDVLSNQQKDSITKSINKAKKGEEVPVD
FT                   FIVKLHPKNPFVKFSEQDTLYKAMESLGNGVHRVAITNMNGTKITGILSQRRLIKYMWE
FT                   NARRFPSLDFYINSTLQDLKIGSNNPITIYEDQLLIEALLKMFTERVTSLAVVDKTMAL
FT                   IGNISIVDVKNVTSSKNSHLLFKSVLGFIGYNLTQKGIEEGQDQFPIFHVNNQSSLGRV
FT                   IAKLVATKSHRLWVVENRGSVHHGSVSSTSSSNSNSNSKSVTQSPKASPSTIESTLNQS
FT                   VSTPSNVQNIPPGSEPGGLPGKLVGVVTLTDILGLFASSKSNKKIDPQFARNQRRRSST
FT                   STTRSSFEGSSAGQDLFRKSYTTSAPAKTEGKR"
FT   gene            <348314..>349768
FT                   /locus_tag="DEHA2F03872g"
FT                   /old_locus_tag="DEHA0F04268g"
FT                   /old_locus_tag="DEHA-IPF8773"
FT                   /old_locus_tag="DEHA-CDS2451.1"
FT   CDS_pept        348314..349768
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03872g"
FT                   /old_locus_tag="DEHA0F04268g"
FT                   /old_locus_tag="DEHA-IPF8773"
FT                   /old_locus_tag="DEHA-CDS2451.1"
FT                   /product="DEHA2F03872p"
FT                   /note="similar to uniprot|P21147 Saccharomyces cerevisiae
FT                   YGL055W OLE1 Fatty acid desaturase required for
FT                   monounsaturated fatty acid synthesis and for normal
FT                   distribution of mitochondria and highly similar to
FT                   CA3921|CaOLE1 Candida albicans CaOLE1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88849"
FT                   /db_xref="GOA:Q6BMN6"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN6"
FT                   /protein_id="CAG88849.2"
FT                   /translation="MSDKVEVADVTSLNALAAGTNKKNPRVVAAGLGGRLMGTKSLVDV
FT                   TADEITKDSESSLAEKDRKDKEKWTKMTHISDQPWTWSNWSEHINWLNLILVVLVPTVG
FT                   FVCALRHPPQLKTAVMGVILYILSGLSITAGYHRLYSHKAYDAAVPVKIFFALFGAGAV
FT                   EGSIKWWGHSHRVHHRYTDTARDPYDARQGLWYSHMGWLLIKANPKNRARADISDLTGD
FT                   WVVNFQHRHYLVIMIFMALVLPTLIAGLGWGDYWGGFVYGGIIRSFFIQQATFAINSLA
FT                   HWIGSQPFDDRRTPRDNVITALVTFGEGYHNFHHEFPSDYRNALIWYQYDPTKITIWVL
FT                   SKLGLAWGLKTFSQNAIEQGLIQQQQKKLDRMKSKLEWGTMLNELPLMDKEEFTARAKK
FT                   DGLILISGIVHDVKQFIKQHPGGQALIRVSLGKDATKAFNGMVYAHSNAAHNMLANMRI
FT                   AILKDHAVNGNTFDLQQEFLDKEKVN"
FT   gene            <350988..>351571
FT                   /locus_tag="DEHA2F03894g"
FT                   /old_locus_tag="DEHA-IPF8769"
FT                   /old_locus_tag="DEHA-CDS7409.1"
FT   CDS_pept        join(350988..351098,351161..351223,351278..351571)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03894g"
FT                   /old_locus_tag="DEHA-IPF8769"
FT                   /old_locus_tag="DEHA-CDS7409.1"
FT                   /product="DEHA2F03894p"
FT                   /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
FT                   YOR357C GRD19 Sorting nexin required to maintain late-
FT                   Golgi resident enzymes in their proper location by
FT                   recycling molecules from the prevacuolar compartment"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66264"
FT                   /db_xref="GOA:B5RU87"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU87"
FT                   /protein_id="CAR66264.1"
FT                   /translation="MSKPFQSINDVINTTSKHKQQSFNELYGEPENFLEIEVRNPQTHY
FT                   GKELFTDYEIICRTNIPAFKKRNSRVRRRYSDFVIFRKLLEQETTRVIIPPLPGKILLN
FT                   SNKFNDLNIEKRRQGLEKFISIVSGHPLLQTGSKTLIEFIQSDKWEPRGYY"
FT   gene            <353110..>353343
FT                   /locus_tag="DEHA2F03916g"
FT                   /old_locus_tag="DEHA0F04334g"
FT                   /old_locus_tag="DEHA-IPF8766"
FT                   /old_locus_tag="DEHA-CDS7449.1"
FT   CDS_pept        353110..353343
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03916g"
FT                   /old_locus_tag="DEHA0F04334g"
FT                   /old_locus_tag="DEHA-IPF8766"
FT                   /old_locus_tag="DEHA-CDS7449.1"
FT                   /product="DEHA2F03916p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88852"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN5"
FT                   /protein_id="CAG88852.1"
FT                   /translation="MQCLHISLVICTSLRINTLLHYVREYMEPKSAILKFPNTLCSLKR
FT                   DFLSPKQIVGFQALARFSMTKHIDHFYFMVFM"
FT   gene            <353823..>354863
FT                   /locus_tag="DEHA2F03938g"
FT                   /old_locus_tag="DEHA0F04356g"
FT                   /old_locus_tag="DEHA-IPF8765"
FT                   /old_locus_tag="DEHA-CDS3726.1"
FT   CDS_pept        353823..354863
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03938g"
FT                   /old_locus_tag="DEHA0F04356g"
FT                   /old_locus_tag="DEHA-IPF8765"
FT                   /old_locus_tag="DEHA-CDS3726.1"
FT                   /product="DEHA2F03938p"
FT                   /note="similar to uniprot|P00331 Saccharomyces cerevisiae
FT                   YMR303C ADH2 Glucose-repressible alcohol dehydrogenase II
FT                   involved in the production of certain carboxylate esters"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88853"
FT                   /db_xref="GOA:Q6BMN4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN4"
FT                   /protein_id="CAG88853.2"
FT                   /translation="MSIPKTQKAIIFETSGGELKYADIAVPKPKPNEILINVKFSGVCH
FT                   TDLHAWKGDWPLPTKLPLVGGHEGAGEVVAIGENVQGWEIGDLAGIKWINGTCLNCEFC
FT                   QNSNESNCAKADMSGYTHDGTFQQYATADAVHAARIPKGTDLASVSPILCAGITVYKAL
FT                   KTSGAKPGQWVAISGAAGGLGSLALQYAKAMGFRVLAVDGGDKGEFVKSLGAESYVDFT
FT                   KSKDVVKEISETTGGGPHAVINVSVSVAAMNQSTEYVRSCGTVVLVGLPHAKLEAGIFN
FT                   TVVKCVSIKGSYVGNRADSAEAIDFFARGLIKCPIKVVGLSELASIYKLMEEGKILGRY
FT                   VVDTSK"
FT   gene            complement(<355158..>357194)
FT                   /locus_tag="DEHA2F03960g"
FT                   /old_locus_tag="DEHA0F04378g"
FT                   /old_locus_tag="DEHA-IPF8764"
FT                   /old_locus_tag="DEHA-CDS1234.1"
FT   CDS_pept        complement(355158..357194)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03960g"
FT                   /old_locus_tag="DEHA0F04378g"
FT                   /old_locus_tag="DEHA-IPF8764"
FT                   /old_locus_tag="DEHA-CDS1234.1"
FT                   /product="DEHA2F03960p"
FT                   /note="highly similar to uniprot|P23254 Saccharomyces
FT                   cerevisiae YPR074C TKL1 Transketolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88854"
FT                   /db_xref="GOA:Q6BMN3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN3"
FT                   /protein_id="CAG88854.1"
FT                   /translation="MSQDLDQLAISTIRLLSVDSVDKAQSGHPGAPLGLAPAAHAVWQK
FT                   MKFNPKDTNWINRDRFILSNGHACALLYSLLVLYGYDLTVEDLKQFRQLNSKTPGHPEA
FT                   LDVPGCEVTTGPLGQGISNAVGLAMAQKQFGATYNKPDHKISDSYTYAFLGDGCLMEGV
FT                   ASETCSLAGHLQLNNLIAFWDDNHISIDGNTNVAFTEDVMLRFKAYGWHLIEIAEGDTD
FT                   LDAIAKAIDEAKKVEDKPTLIRLTTTIGFGSLAQGTHGVHGAPLKADDIKQLKESMGFN
FT                   PEETFVIPKEVTDYLKKHVEENQKVQEDWKKLFESYKQKYPELGAELQRRLDGKLPENW
FT                   SDALPTYSPSDSAVATRKLSETVLTKILPVIPEIIGGSADLTGSNLTRAAGSVDFQPPA
FT                   TGLGDYSGRYIRYGVREHGMGAIMNGIAAFGANYKNYGGTFLNFVSYGAGAVRLSALSH
FT                   HPVIWVATHDSIGLGEDGPTHQPIETLAHLRAIPNLSVWRPADGNETSAAYLQAIESTS
FT                   TPSIIALTRQNLPQLEGSSIEKAAKGGYTLVKQDKPDVIIVSSGSEVSISADAAKKLES
FT                   EGFKAGVVSMPDFLTFDKQPLDYRLSVLPDGVPIMSVEVMSSFGWSKYSHEQFGLNRFG
FT                   ASGKGPEIYKFFEFTPEGVADRAAKTIQFYKGKPLLSPLNRAF"
FT   gene            complement(<357848..>359272)
FT                   /locus_tag="DEHA2F03982g"
FT                   /old_locus_tag="DEHA0F04400g"
FT                   /old_locus_tag="DEHA-IPF8763"
FT                   /old_locus_tag="DEHA-CDS2526.1"
FT   CDS_pept        complement(357848..359272)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F03982g"
FT                   /old_locus_tag="DEHA0F04400g"
FT                   /old_locus_tag="DEHA-IPF8763"
FT                   /old_locus_tag="DEHA-CDS2526.1"
FT                   /product="DEHA2F03982p"
FT                   /note="some similarities with uniprot|Q06810 Saccharomyces
FT                   cerevisiae YPR075C OPY2 Protein of unknown function
FT                   overproduction blocks cell cycle arrest in the presence of
FT                   mating pheromone and similar to CA3925|IPF13257 Candida
FT                   albicans IPF13257 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88855"
FT                   /db_xref="GOA:Q6BMN2"
FT                   /db_xref="InterPro:IPR018571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN2"
FT                   /protein_id="CAG88855.2"
FT                   /translation="MTVIPYSIFEKRTKCVDCPSKPKNSCPKCESGKECVLAHQTCDTC
FT                   AYYKCTRIDGDSTKSKPVGGIIGGSIGGFVLILMVVGILYYKFVYRKKHPVLLEDDDDI
FT                   LMSGIESESDRKSDYTISNLDSYQGDPNMAPLGGLTRNGSTQEKTGTRPAAANKRISSY
FT                   ESFTRPKTKYNKNTRRTGGRGGARARTRVGAYSDNNSSRHSVATTMSTTNASNILPIAY
FT                   IPGVTVRPTKNNTRSIYSYETESVFSDLNTIENASIIGDVMRANQLQDANAGQADANAN
FT                   GSTNKDSTMTAIKAHPKLINVDRIEEEDEDDITDEDDDTYADTYDDSSVAYEAQQDATN
FT                   TTNMRDSQTSIPQENPVDMSSEEHHYINVNADDDADSDSDVDSDIGEITRATSVKRPAE
FT                   SIPQSREVLLDVTGGPNSTSSITVDTHHEAVELSQLGRPTGPLHQYNETDSPTNTSAGS
FT                   FILDVEFEDSRPFSDP"
FT   gene            complement(<359634..>361454)
FT                   /locus_tag="DEHA2F04004g"
FT                   /old_locus_tag="DEHA0F04422g"
FT                   /old_locus_tag="DEHA-IPF8760"
FT                   /old_locus_tag="DEHA-CDS1599.1"
FT   CDS_pept        complement(359634..361454)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04004g"
FT                   /old_locus_tag="DEHA0F04422g"
FT                   /old_locus_tag="DEHA-IPF8760"
FT                   /old_locus_tag="DEHA-CDS1599.1"
FT                   /product="DEHA2F04004p"
FT                   /note="weakly similar to uniprot|Q12514 Saccharomyces
FT                   cerevisiae YPR072W NOT5 Subunit of the CCR4-NOT complex
FT                   which is a global transcriptional regulator with roles in
FT                   transcription initiation and elongation and in mRNA
FT                   degradation and similar to CA3926|IPF16198 Candida albicans
FT                   IPF16198"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88856"
FT                   /db_xref="GOA:Q6BMN1"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMN1"
FT                   /protein_id="CAG88856.2"
FT                   /translation="MSTRKLQQEFDKTNKKIAEGLTVFDDIYDKLMTTEISSQKEKLES
FT                   DLKKEIKKLQRSRDQLKTWISDTSIKLDKSLIQDNRTKIEHAMDQFKDLEKSSKIKQFS
FT                   NEGLELQSQKTKYNKFTDPEDAKKQEACNYIGDIIDQLNQQNESLESEIHSLATQLKKT
FT                   KSANSYSVQSSIDDCKYNVERNNNHLSKLEMILRNIENENLDPERVDDIKDDLEYYVET
FT                   NQEDDYVEYDDFYDQLEMSEENDILGSGQDANEDNEENKAEVKEGPKEEPKDGPKEEPK
FT                   PETKTETKPEAKTESKRETKPEIKSEAKSEPKSSNESTSAASTLARKGKTTVVPAANPP
FT                   PLNTAQSYSNIIKASMSSPAAAKVLPPGLNQAKSSTSSPQRTPQKLHQADDSKKRVVSQ
FT                   TQHIPSTQPETRSETQSPILNVNKPIFDTVNRLSTLPQSRLHNPLPFQSIVSLLESSLL
FT                   NCPDSFDAEKPRQYHPTSIHPSSVDYPQEPMYELNSSHIMKKFDNDTLFFCFYYSEGID
FT                   NLAKWNAAQELSKRGWIFNTDVKQWFLKDNKNGGKNRSMSIIQKEEDEQNKQDDSANNE
FT                   ENYKYFDYEKTWLTRRKENYKFSQDFRESF"
FT   gene            complement(<361642..>362204)
FT                   /locus_tag="DEHA2F04026g"
FT   CDS_pept        complement(join(361642..362080,362140..362204))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04026g"
FT                   /product="DEHA2F04026p"
FT                   /note="similar to uniprot|P40347 Saccharomyces cerevisiae
FT                   YPR073C LTP1 Protein phosphotyrosine phosphatase of unknown
FT                   cellular role"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66265"
FT                   /db_xref="GOA:B5RU72"
FT                   /db_xref="InterPro:IPR002115"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU72"
FT                   /protein_id="CAR66265.1"
FT                   /translation="MTATSRTVDKKISVAFVCLGNICRSPMAEAIFKHKVHELGYSEYF
FT                   KIIDSYGTGGYHIGDPPDSRSAKTCRKHGVPVDHSAQQITSKDFKKFDYVICMDQSNLS
FT                   DLLFMKPRESKARVALFGEWKADSKFNTVVQDPYYGGINGFETNFQQISHFSEEFLKRE
FT                   VGEL"
FT   gene            complement(<362409..>365648)
FT                   /locus_tag="DEHA2F04048g"
FT                   /old_locus_tag="DEHA0F04466g"
FT                   /old_locus_tag="DEHA-IPF8754"
FT                   /old_locus_tag="DEHA-CDS0341.1"
FT   CDS_pept        complement(362409..365648)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04048g"
FT                   /old_locus_tag="DEHA0F04466g"
FT                   /old_locus_tag="DEHA-IPF8754"
FT                   /old_locus_tag="DEHA-CDS0341.1"
FT                   /product="DEHA2F04048p"
FT                   /note="weakly similar to p|P19659 uniprot|Q08221
FT                   Saccharomyces cerevisiae YOL051W GAL11 Component of the
FT                   Mediator complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88858"
FT                   /db_xref="GOA:Q6BMM9"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR033789"
FT                   /db_xref="InterPro:IPR036546"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM9"
FT                   /protein_id="CAG88858.2"
FT                   /translation="MNNLQQQPGNTNSWHAMYSVSDRQKVVQILSGTLKELQNGNYDAQ
FT                   KAANMAQEFEKFTFMKSQSRDEYLRLIKQKVTQLRAGIRNPANGNNMGGNNPMVNQNMG
FT                   QNMGSGMGMQQQPNMNPQSNMRPQNMNFLQQQAQARQQSAAQIQAQLRNGNIANQTPSQ
FT                   TQPVHHIQQQQQQQPSQPPQPQQSQPPQQPQPQPNQQQLHQISNMIRNAPIPQALLSKI
FT                   PNLPPNVNTWTQIFDCFQKKIIPQAAMPVIKEIHNTHLQLTLRQHQQQKINQMQSQRMN
FT                   QQQHQQQHQQQPQLPQQQQQQQQPQAMNNMAGTVNNSNNNTPVMNSGNFNMNNLNPQQK
FT                   QQLLRRQMQQRNSLAGQNPLMQQQGQVPSQPPQPQPQQQPSQPQQQKPQMVQSSPQNPQ
FT                   QSKPPNFTITPDDILKYSSDAMRLLTRLQSNGSIQPNLDQSQKESFIRKYIHHQKTTMW
FT                   KQGQVTNNMTNVPNTANAGNTVNQAQVQRRLQQQTGVNSMPMQSQPQTQPSAPLSQQSP
FT                   MINNMQMGNQQPMPHTQMNNQNSPMMQQRAVNTPTMPMNNNDPSAATKKQAAMGSLSAL
FT                   LPPLTDEMKLQLRQLIEEVSRNNVALKDVTMLLSQQDKNAVRDTVVRISQQYANVDSII
FT                   SYFYIITRNVEGTKRLIQMKYMTKNIIENVQRGIYLAAPDLLEKLRSQYQKYFEYVKEQ
FT                   FAIRRQRMQSQQPQGQPPQQQFLNNQQRNGPIQNQIPQQQVQGMPQQQNGQTLMNIGPV
FT                   NSWPNVAPPMQQRNNIGSSPMIPNSVSPIIPKQMHPFQSPASNINTAPPKQGGRAQNKK
FT                   SVSGTTPGATGTSRKKSINKSISSVGGIPTPANNATTPAALANSIKTPNSIPTPQVPPT
FT                   QSNKNTPAEQQSPNSQMKRAPSNAGLKITEDTVGTIFNNSEVDPKLAKRRELSDTDPLK
FT                   FFYASLSNLLEIDDLAGDQQGLPTPAQSSSSTGSKIGIAKSPLSPVITSNEWTCEIKPM
FT                   AITSSFKQVGTIRELTASDIVQTCADLALTEVEEFSKKGVKRENDEMDDSDDIDNLFSD
FT                   KKPKVEDDDYKFMYEPVEFDEWQKFMVASMQ"
FT   gene            complement(<366261..>369188)
FT                   /locus_tag="DEHA2F04070g"
FT                   /old_locus_tag="DEHA0F04488g"
FT                   /old_locus_tag="DEHA-IPF8751"
FT                   /old_locus_tag="DEHA-CDS0485.1"
FT   CDS_pept        complement(366261..369188)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04070g"
FT                   /old_locus_tag="DEHA0F04488g"
FT                   /old_locus_tag="DEHA-IPF8751"
FT                   /old_locus_tag="DEHA-CDS0485.1"
FT                   /product="DEHA2F04070p"
FT                   /note="similar to uniprot|Q12220 Saccharomyces cerevisiae
FT                   YLR129W DIP2 Nucleolar protein specifically associated with
FT                   the U3 snoRNA part of the large ribonucleoprotein complex
FT                   known as the small subunit (SSU) processome required for
FT                   18S rRNA biogenesis part of the active pre- rRNA processing
FT                   complex and highly similar to CA3927|CaDIP2 Candida
FT                   albicans CaDIP2 beta transducin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88859"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM8"
FT                   /protein_id="CAG88859.2"
FT                   /translation="MVKSYDRYEQEKCFGVIASQSNIVYLPPTSNQSSKTIGRAISSGL
FT                   EEILVWDIKTGEVLNRLRDGLTPGASNAPTAQAPSPVSYLAYHEDTNIVAAGYLDGSIK
FT                   IWDLTSGSALISFQGHKSSISILKFDRSGTRLLSGSNDATIILWDLVGEEGLFKLKGHK
FT                   SQITGLNFLTENPESKGSDDLEDYLLSVSKDGLIKLWEVKTQQCVETHLAHSNECWSLG
FT                   MNTSNNVAITTGNKDQVKVWEIDLSQPDTQKLIEKGSFEKQSKARCADIQFQKLKTSSA
FT                   NITDLFYLQNADRTVEIFRVRSSDEIKKGITKRTKRLKEKGYDEDEILQSLKESEISMM
FT                   ITPFTTLRTISKVKSCTWVNNDKNSKKLDLLVSLTNNSIEYHNIPIPESIKKTQASDIY
FT                   SVKQHSVDLLGHRTDIRAMDIAADNKLLATASNGELKIWNIKTQNVIRTFALEGGYALC
FT                   CKFLPGGTLIAIGFKNGDLELYDLATSSVVDRIEKAHDSKSAVDDENGSAIWSLDLTPD
FT                   GKTLVTGGNDKSVKFWNFKVEQEMIPGSNSSVSKLKFVHNQTLELNEDVLCVRISPDSR
FT                   FLAVSLLNNNVQVVFLDSLKLFLTLYGHKLPVLSIDISDDSKLIITSSADKNIKIWGLD
FT                   FGDCHKSIFGHQDSIMNVKFIPDSHNFFSSGKDGLIKYWDGDKFECIQKLPAHQSEVWC
FT                   LAISSDGRFMISTSHDHSIRLWLATDDQVFLEEEREKEMDELYENTLLESLEEDPTHNN
FT                   NEEDDEKEDGEEVSKVTKQTMETLKAGEKLMEALDIGTEDVLATEDYESHLKNFQAKRI
FT                   AAPPVKPTPNPILLALGINGQEHVLNTVTKIRPAQLDDALLVLPFSYSLKLLKFIEIWT
FT                   NKQNVTNNVVNISLICKILFFVIRSNAKEFIHQKSPELKNQLATVKKQLREELSKTSNQ
FT                   LGYNIQGLKFTKQQWKLTHESEFIDEAEQREYEDKKAIKRSFTTI"
FT   gene            complement(<369807..>371987)
FT                   /locus_tag="DEHA2F04092g"
FT                   /old_locus_tag="DEHA0F04510g"
FT                   /old_locus_tag="DEHA-IPF8750"
FT                   /old_locus_tag="DEHA-CDS1048.1"
FT   CDS_pept        complement(369807..371987)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04092g"
FT                   /old_locus_tag="DEHA0F04510g"
FT                   /old_locus_tag="DEHA-IPF8750"
FT                   /old_locus_tag="DEHA-CDS1048.1"
FT                   /product="DEHA2F04092p"
FT                   /note="similar to uniprot|Q08108 Saccharomyces cerevisiae
FT                   YOL011W PLB3 Phospholipase B (lysophospholipase) involved
FT                   in phospholipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88860"
FT                   /db_xref="GOA:Q6BMM7"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM7"
FT                   /protein_id="CAG88860.1"
FT                   /translation="MQLLKPKGSSNLSWYSYFVVVLCLCTNVRAITWPWEDSSSSSSDS
FT                   SATSSSSDSSSTNGITWPWQDNSDSSSSASSESSSSSASSSSGGSSASSESSTRKNQYA
FT                   PYETSCPSGDISREAKNISSSERDYMSNRHETTNKNLIGFLSKRANLSDFDAKSFINDY
FT                   SDEHNISIGLAFSGGGYRAMLNGAGQILGLDDRYDEAKENGLGGLLQSSSYLAGLSGGN
FT                   WLVGSLVLNNWISVADIIEGDIDIWNLEDSIFNPSGINLVKTVRYYNNIRTSIEAKQDA
FT                   GFDTSLTDLWGRALSHQFFPDEDGGENVTWSSIRDLSKFSDYEMPFPIVIADGRTPGTF
FT                   IMDSNSSVFEINPFELGSWDPSVHSFVDVKYVGSSMKSNDPNTSKCAVNFDNGGFIMGT
FT                   SSTLFNQGLLRISNTGLNKAVKSIVSSILGKLSYAEDDIAAYEPNPFYENDFGTYNSIS
FT                   TNNTLFLVDGGEDQQNIPLYPLIQNARDVDIIFAYDNSADTDSNWPNGTSLVHTYRRQF
FT                   SKQGKGTPFPYVPSEETFVKDELNKQPVFFGCDAGNLTSLLDFHKNSDINETDVPLVVY
FT                   MPNYRTSYNSNTSTYKMSYDEDEKMGIIKNGFEVSTSNNLTDDSDWAKCVGCAIIRRSQ
FT                   ERLGQEQSSECKKCFDNYCWSDGEKAAASSSVSGSSSTSESSSTSKSSSKSSSTSQSSS
FT                   SDKPKDSNANALYISLPLAFFTSFIIALSLLV"
FT   gene            complement(<372259..>373254)
FT                   /locus_tag="DEHA2F04114g"
FT                   /old_locus_tag="DEHA0F04532g"
FT                   /old_locus_tag="DEHA-IPF8747"
FT                   /old_locus_tag="DEHA-CDS3905.1"
FT   CDS_pept        complement(372259..373254)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04114g"
FT                   /old_locus_tag="DEHA0F04532g"
FT                   /old_locus_tag="DEHA-IPF8747"
FT                   /old_locus_tag="DEHA-CDS3905.1"
FT                   /product="DEHA2F04114p"
FT                   /note="weakly similar to uniprot|P36069 Saccharomyces
FT                   cerevisiae YKL128C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88861"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM6"
FT                   /protein_id="CAG88861.2"
FT                   /translation="MSLLIPTVTDYEDAHGQESEEVTYQEKLTQLSDKKDSNGNLVYPW
FT                   TFETINGFFKQSDPSTDDLKFNYATEDFGRTKSWPEIIEELERLNKEAGENECYKLMFF
FT                   ARHGQGFHNVCVNKYGLDEWHRKWHALSTDGEIVWAPDPMLTDLGVDQAKENNQAWKAQ
FT                   IAQGAPIPAKFYVSPLQRSSYTLVYTWGDIKPEEKRPLVTDSIRETIGINLCDKRSTKS
FT                   VIRERFDKHGFIIDDSLTEEDELNERDTREQLHEQAIRVNGFLQGLFNEDWDSKASALD
FT                   EKKKLQNSVISTTSHAGTIRSFIMVLGHRHFTISTGGMIPILVKGTRKSD"
FT   gene            complement(<373608..>376103)
FT                   /locus_tag="DEHA2F04136g"
FT                   /old_locus_tag="DEHA0F04554g"
FT                   /old_locus_tag="DEHA-IPF8744"
FT                   /old_locus_tag="DEHA-CDS0754.1"
FT   CDS_pept        complement(373608..376103)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04136g"
FT                   /old_locus_tag="DEHA0F04554g"
FT                   /old_locus_tag="DEHA-IPF8744"
FT                   /old_locus_tag="DEHA-CDS0754.1"
FT                   /product="DEHA2F04136p"
FT                   /note="weakly similar to uniprot|P31384 Saccharomyces
FT                   cerevisiae YAL021C CCR4 Component of the CCR4-NOT
FT                   transcriptional complex which is involved in regulation of
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88862"
FT                   /db_xref="GOA:Q6BMM5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMM5"
FT                   /protein_id="CAG88862.2"
FT                   /translation="MNIPKYQQAQVQGQQPNLQAQQILLQQLQQGQSQQSQPSIGGSGS
FT                   AGQFSQQDIYNDNIAQQGLYQNSYQRPVQAQQPPQLQNIHQQQQFFPQQFSSQQQNQPQ
FT                   ASSLQQYQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQIHLPQQYQQSQGQQVPHQPPH
FT                   IQQQQFFNQQAAALQQQQQQQQQQQQQQQQPAQKLNSINIENPNSIYWQHQQQLCQLSR
FT                   NANIPHYYARQYAANSRKNKNPYSDVKTVSLIDATRSIVSALNEQENSKSNPGSATNSA
FT                   LLQNKKLAQDLDDDHLQEEQRMRQKTQGRQLWCQLDLSGQGLVNLSPKLFQYDFLESLY
FT                   LNNNKLTSVPPIVNKLRSLRTLDLSHNRINEVPSELGMCFNLRYLYLFDNNIKTLPNEF
FT                   GNLIELLFLGIEGNPIDLKIANLVAEKGTKELIAYLRDLKPSFSKPPPRQWLLLEDDGE
FT                   IIDPINNPDAYTNDNNNSDTNDTFTMMSYNTLCQHYATTKMYKYTPSWALEWGFRRAAL
FT                   QEEVLHFKSDLVCMQEVETRTFHEFWVPVMQGFGYKGVFFNKTRSKTMSESDSKKVDGC
FT                   ATFYKTDKFELLHKQNFEYNSVCMGSDKYKKTKDLFNRFMNKDNIALITYFNHIQTGEK
FT                   ILFVNTHLHWDPAFNDVKTLQVGILLEELRTIMKKYHHTNSIDEIKNASMVICGDFNST
FT                   KENAVYQLFSTGAVSNHEDLEGRDYGKFTDEGFRHSFKLKSAYDHVGELPFTTISPAFT
FT                   DAIDYIWYSTPTLQVKGLLGKIDEEYSSHCIGFPNAHFPSDHIPLVTKFQIKKSGGNKK
FT                   PDFKPDFKPDFKSGSSRKT"
FT   gene            complement(<376485..>377705)
FT                   /locus_tag="DEHA2F04158g"
FT                   /old_locus_tag="DEHA0F04576g"
FT                   /old_locus_tag="DEHA-IPF8741"
FT                   /old_locus_tag="DEHA-CDS3080.1"
FT   CDS_pept        complement(376485..377705)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04158g"
FT                   /old_locus_tag="DEHA0F04576g"
FT                   /old_locus_tag="DEHA-IPF8741"
FT                   /old_locus_tag="DEHA-CDS3080.1"
FT                   /product="DEHA2F04158p"
FT                   /note="some similarities with uniprot|P31384 Saccharomyces
FT                   cerevisiae YAL021C CCR4 Component of the CCR4-NOT
FT                   transcriptional complex which is involved in regulation of
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88863"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM4"
FT                   /protein_id="CAG88863.2"
FT                   /translation="MYFDSKSTKLDDITWSDMHKLISRNGKESILCIGQRLYSNMRIPL
FT                   NYDATKYRNWHHFDEPSTSKKQKISVMSFNLLSRHYMWKPVFGYLEQEYLSWSDYRFPL
FT                   INLMIRQFNCDIMCFQEMEHLIYEKFWSKGFPSPNYHSFYVRKSEPVYWGDRPSENIDG
FT                   VGIFVNGDKFDVLDSHAIHFGEYIMQHHVKFNVTKATVERVIPRNTVALLVKLRDKQNG
FT                   KILYVTNTHLYWSPKFNDVKIIQTKLLLNVLHDFIDHNCLCDPCIIMCGDFNSNPSSKV
FT                   FQLLNTGTIDAFKCNEFALHDYDHKANSELFHNGHIENPFHLACAYESLLTHSHINPRK
FT                   KLEFTSFTKGLIDVVDHIWYSKNHFKVTKLLGEVDQSYYTETGVVGFPNSQFPSDHIPL
FT                   VTELAYL"
FT   gene            complement(<377949..>379076)
FT                   /locus_tag="DEHA2F04180g"
FT                   /old_locus_tag="DEHA0F04598g"
FT                   /old_locus_tag="DEHA-IPF8739"
FT                   /old_locus_tag="DEHA-CDS3404.1"
FT   CDS_pept        complement(377949..379076)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04180g"
FT                   /old_locus_tag="DEHA0F04598g"
FT                   /old_locus_tag="DEHA-IPF8739"
FT                   /old_locus_tag="DEHA-CDS3404.1"
FT                   /product="DEHA2F04180p"
FT                   /note="weakly similar to uniprot|Q08214 Saccharomyces
FT                   cerevisiae YOL043C NTG2 DNA N-glycosylase and
FT                   apurinic/apyrimidinic (AP) lyase involved in base excision
FT                   repair localizes to the nucleus and similar to
FT                   CA2220|CaNTG1 Candida albicans CaNTG1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88864"
FT                   /db_xref="GOA:Q6BMM3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR030841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM3"
FT                   /protein_id="CAG88864.2"
FT                   /translation="MTVAKSKRLREVNGTDVLNKRVKTEETLSFESITIPNIKHESDLI
FT                   ITPSIKPESDSVIPSNKLEPDSISNTKKYLTVEIEDKKPNVFAKVTSDDVDSIPSTCKA
FT                   PPKWSELYNEVVAMRSKFLSPVDTMGCERIPEGISPNVAKTNPRVFRFQLLISLMLSSQ
FT                   TKDEVNFQAMRNLHSGLMALGHKDGLSLESIVTLSEGEIDAFISKVGFHRKKAAYIKKA
FT                   CAILQSNFDSDIPKNITDIVTLPGVGPKMGFLLLQRGWNINDGIGVDVHIHRLAQMWGW
FT                   VAKSEKPESTRTELESWLPKKFWGDINPLLVGFGQVICVPKASNCDICTLGINKLCKSS
FT                   NKKLLNASMTDARRAKLLKGRGNLTELITEIEDLV"
FT   gene            <379292..>382510
FT                   /locus_tag="DEHA2F04202g"
FT                   /old_locus_tag="DEHA0F04620g"
FT                   /old_locus_tag="DEHA-IPF8736"
FT                   /old_locus_tag="DEHA-CDS0346.1"
FT   CDS_pept        379292..382510
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04202g"
FT                   /old_locus_tag="DEHA0F04620g"
FT                   /old_locus_tag="DEHA-IPF8736"
FT                   /old_locus_tag="DEHA-CDS0346.1"
FT                   /product="DEHA2F04202p"
FT                   /note="weakly similar to uniprot|P39113 Saccharomyces
FT                   cerevisiae YMR280C CAT8 Zinc cluster transcriptional
FT                   activator necessary for derepression of a variety of genes
FT                   under non-fermentative growth conditions active after
FT                   diauxic shift binds carbon source responsive elements and
FT                   similar to CA2219|CaCAT8 Candida albicans CaCAT8"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88865"
FT                   /db_xref="GOA:Q6BMM2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM2"
FT                   /protein_id="CAG88865.2"
FT                   /translation="MSQVTNIETKSDISTQPENRVKAKVKSRSNGTTTNTKTIKTPGTR
FT                   VERVAQACDRCRAKKTKCDGKVPTCSSCAAVGFKCIVSDKLSRRAFPKGYTETLEERIR
FT                   QLEIENKKLVGILDLRDEQLDMLNTRMNGQDASFDDIRSSGSVKDNEMQPVTSSNLSLL
FT                   DKQHTERLHEHDDGCPCGCSNFPHSMHERPVSIAGSVYDTATGQASVPGSINLSDNDDN
FT                   ESLLSDNDLSSIYSSNNRALLNANISNLTKTGHVIGGETTPAPGAFAAATAIAQMQKNR
FT                   PLSQQQQLEHKEQNKKQMLTSLVAMSIPRSTEETLFIPTLLSKICQVHGYNSKPAILTA
FT                   NAIASLKENTNETMKNDSSSNKSRDDEMLLKIIMNRSNLQKLPEAEAIYFIRNLISLPN
FT                   SRIDLDHLITVYFQDWGNAFPIIDKNSFLKKYVKFTELLESGSTDSFSNEESSESIEKF
FT                   GVLMILILSLSLLSNKHSHMSSKGNIDSNEIAKKYVSYLNHYDYLIHQFINSNCIMTKH
FT                   CSIQSLQILTLSLQYCLVIGDITTCYELRCRVITMAQQLRLHRCPAAVLGVTGNNGGSV
FT                   NLQNFMQGERRILFWCIYCLDIYSSLNLGVPRLLKDFEIECALPFSGKNDDDNDDNENI
FT                   LIVNNTKLSIVGKVSKLALSVMLYCKVLGRILDSIFARFENTDGQNKAMDQERMLDCWR
FT                   RELPTDLKFDIDVNGFSLADNDSSNDAENSNWKNYSKQQLTLIFLYYHAKFLIYLPIIS
FT                   KYGNHYNVGLSQKEQLTKEKGNIAAIVSSVSMIQQSSTRILEVLKSLSKYSSSYVLPIP
FT                   INISRQQARFALLVAKGSLEYIKGGPLYQNSKTLLLDTVAYLTAETNHEIPGGLTKNSV
FT                   KLLELAILSIFGLSCNKTPQNMKKKPNPSGVPITKMAVAREPVSQLDSYNNNFIIRPNN
FT                   ISSKTPSPTVFDKNSVPQDNSINVEKNEDGISLQQQDYGGYLSSLGPEGSQNNSNNLFN
FT                   DDGLENIESILKFDPFKVTLNSQLMMNEFAADGSLGLVPFLDMSNPPSGDEASQMYDGS
FT                   SQVKIEDSDQRVSDGQYSSFFEWS"
FT   gene            <382705..>383661
FT                   /locus_tag="DEHA2F04224g"
FT                   /old_locus_tag="DEHA0F04642g"
FT                   /old_locus_tag="DEHA-IPF8734"
FT                   /old_locus_tag="DEHA-CDS4044.1"
FT   CDS_pept        382705..383661
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04224g"
FT                   /old_locus_tag="DEHA0F04642g"
FT                   /old_locus_tag="DEHA-IPF8734"
FT                   /old_locus_tag="DEHA-CDS4044.1"
FT                   /product="DEHA2F04224p"
FT                   /note="similar to uniprot|P32643 Saccharomyces cerevisiae
FT                   YER175c TMT1 Trans-aconitate methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88866"
FT                   /db_xref="GOA:Q6BMM1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM1"
FT                   /protein_id="CAG88866.2"
FT                   /translation="MATFSKVNFKTINYNSFRPHYPSSFYQILSKYATEGKESRLPLNK
FT                   SLDLGCGTGVATYSLLNFVDDVTGIDVSPPMIETAKSLIPERCEQMNVKDRSRIKFKTG
FT                   SAESFVSSGSREVEDNSIDLIVAAQCIHWFQDYNIFYKSCASLLKQGGTLAYWYYVDPI
FT                   VIDFQGPAKGEKMEILKKAFQIYSKYVYDDPKFIGPHWEQPGRNIIKNLCVEVNEAIPK
FT                   DLYSDIKIQTYVPDFDGNVKPTDDDLKLEKSNMSINDFIKYLNTYSGFHNYKDATGDKE
FT                   NLIELFLSECETELGWDREKTRIDIVWRTGYTFMKKK"
FT   gene            <383808..>384728
FT                   /locus_tag="DEHA2F04246g"
FT                   /old_locus_tag="DEHA0F04664g"
FT                   /old_locus_tag="DEHA-IPF8732"
FT                   /old_locus_tag="DEHA-CDS4291.1"
FT   CDS_pept        383808..384728
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04246g"
FT                   /old_locus_tag="DEHA0F04664g"
FT                   /old_locus_tag="DEHA-IPF8732"
FT                   /old_locus_tag="DEHA-CDS4291.1"
FT                   /product="DEHA2F04246p"
FT                   /note="weakly similar to uniprot|P23797 Saccharomyces
FT                   cerevisiae YMR281W GPI12 ER membrane protein involved in
FT                   the second step of glycosylphosphatidylinositol (GPI)
FT                   anchor assembly the de-N-acetylation of the N-
FT                   acetylglucosaminylphosphatidylinositol intermediate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88867"
FT                   /db_xref="GOA:Q6BMM0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR039516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMM0"
FT                   /protein_id="CAG88867.1"
FT                   /translation="MLVRIWRFVLRVIGLSFLLWLILSTTIPQIIAKYSHSNESENLAC
FT                   PYNSITSPSPLPIHNANVYFIIGHPDDEVMFFSPTLIELNKKEYNNRVKLICFSNGDAV
FT                   HESMGRVRTEELYKSGGILGLKENDIKVIDSFKDGMDEKWDVDDIQRTLEETVGKKSKE
FT                   TLVLITFDEDGVSKHPNHISLYYGTKKFFQTYYNNPERNGKLYVLKSLNFLEKYSFNIL
FT                   TNVELFVDHLSKLLISNILKIKVNVSFFNNKTNNQSIKIYSDLNMLSVSYAAMSYGHYS
FT                   QMVWFRYGWLILSRYLTFNHLIEIN"
FT   gene            complement(<384769..>385998)
FT                   /locus_tag="DEHA2F04268g"
FT                   /old_locus_tag="DEHA0F04686g"
FT                   /old_locus_tag="DEHA-IPF8731"
FT                   /old_locus_tag="DEHA-CDS3103.1"
FT   CDS_pept        complement(384769..385998)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04268g"
FT                   /old_locus_tag="DEHA0F04686g"
FT                   /old_locus_tag="DEHA-IPF8731"
FT                   /old_locus_tag="DEHA-CDS3103.1"
FT                   /product="DEHA2F04268p"
FT                   /note="weakly similar to uniprot|Q12509 Saccharomyces
FT                   cerevisiae YLR085C ARP6 Nuclear actin-related protein
FT                   involved in chromatin remodeling component of chromatin-
FT                   remodeling enzyme complexes and similar to CA0593|CaARP6
FT                   Candida albicans CaARP6"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88868"
FT                   /db_xref="GOA:Q6BML9"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR030054"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BML9"
FT                   /protein_id="CAG88868.2"
FT                   /translation="MSQQYFVIDNGSYNIKAGFSNQDAPIKHQNALSKARDGLIYVGNE
FT                   YLVQTNNYSGMIFKRPYDHGHLISWETEKAVWDYTFNKASPNQELDASITHLTLTETPF
FT                   QLPQLSMNTDQIVFEEYGFNEYYRCAPASLVPWSNLGSSESKNNDFTLVVDSGYSGTWI
FT                   VPIIYQNVYWKGVKKLPIGGAALNGLLREIISFRHYDIADEPVLINTIKEKTCFMATDF
FT                   EKSLANRKKYRCEFILPDFKTTTTGFVKTKDTPIDTTGDVQSLALIDERFTIPESFYHP
FT                   EIIFDNTTSSTSTIQNASFKNITDLVVECIMSCPKVTQPLLSGNIITVGGNTNLPGFTD
FT                   RLRHELVKELPIDWHVQVKETEHNPDEASWFGGAQLTNDEIINNISISKKDYFEHGSNW
FT                   CQKQFGFKNL"
FT   gene            <386481..>388625
FT                   /locus_tag="DEHA2F04290g"
FT                   /old_locus_tag="IPF_8730"
FT   CDS_pept        386481..388625
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04290g"
FT                   /old_locus_tag="IPF_8730"
FT                   /product="DEHA2F04290p"
FT                   /note="weakly similar to uniprot|Q12502 Saccharomyces
FT                   cerevisiae YOR322c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66266"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR024391"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU88"
FT                   /protein_id="CAR66266.1"
FT                   /translation="MAILSRVLHHNTEKLNEKPSLKHTLSSNGSLSSKGSGSHHTLTLS
FT                   IALESPPVILYGQPQDSSGSIISGLLNIDIKDTRSQKSLELASVSSHSSITSAHSHSDE
FT                   VELESITLSLIQTVKYTKPFLIPSASVVSCKDCCTKKNVIAKWDVLISRSSFSVGTHAY
FT                   PFSHLLPGSLPASSKLGSTYASSFIKYSLIATAKRPNVPKEVKVVLPLNIARSILRGPE
FT                   RNSLRVFPPTEATASVILPNVIYPKSNFSLQLRLDNIVNINNDRRWRMRKLAWRIEEHT
FT                   KVKATTCKKHAVKLKQIQESQRKTETTKELRSRTTPGGTHNSNPGQGLNKTPNLHHSTI
FT                   QTNMFLSTCPSTQTNNSLHASNNHIEGINGAPLVTENDALEDQENNITNSSHTAENLIE
FT                   EFLSPTPRRSNNDSNEASFSPPDITPEYNQNVIQDDYRNNRPESSKDTESLYLDEIRTA
FT                   TYGEIKSGWKSDFSGRGNIELVTDIDAFDFSTGLNRHMMKRSSDDPKIDEVQEGLRNGA
FT                   NISCDIDDPTLGIYVNHTLIVEVIVAEEVVPRSSEKKSNSLKNVPSSLSPVSSNSPASK
FT                   QKSNSTSNKQKQSNTSGQTQPGVTTGAARVLRMQFKVTLTERSGLGIAWDDEVPPTYED
FT                   IRAFSPPTYAETSASATPVSTPGSTIATPQLSANRPVSVEAFGGTPSQSYFNLGTRSTS
FT                   NSLTIDGVVDLDERIQDFTL"
FT   gene            <389074..>392688
FT                   /locus_tag="DEHA2F04312g"
FT                   /old_locus_tag="DEHA0F04741g"
FT                   /old_locus_tag="DEHA-IPF8728"
FT                   /old_locus_tag="DEHA-CDS0224.1"
FT   CDS_pept        389074..392688
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04312g"
FT                   /old_locus_tag="DEHA0F04741g"
FT                   /old_locus_tag="DEHA-IPF8728"
FT                   /old_locus_tag="DEHA-CDS0224.1"
FT                   /product="DEHA2F04312p"
FT                   /note="weakly similar to uniprot|Q08217 Saccharomyces
FT                   cerevisiae YOL045W PSK2 One of two (see also PSK1) PAS
FT                   domain containing S/T protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88871"
FT                   /db_xref="GOA:Q6BML8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML8"
FT                   /protein_id="CAG88871.2"
FT                   /translation="MTNRTNSDTKKNHTTFYVNDDEVSFENEGGSESIERKESDLKIPK
FT                   RQDKTFNKPHGSNNKQNLVIDADQGCIELRSPSTSTAGTTVLLPNKEQFNSINDILRFP
FT                   IESTHAYSYAHLSPNSLALRLNVLKRSLEILKDRPGLLKFMNLGTDKQFGKAPSRLEKP
FT                   KIPNFGNRIYSNPHASNSSEFFNNSDKYKIQSNASSAALSELFRPSMKRSDSLPVNQIY
FT                   ATKVDAAQGAAIHIKSSARKDPIINDDFKDIITLLENDNEALTEQSFDTSALRDLSQAT
FT                   AKDDQKLKKSLLKNKLIYALATPFVENSSSLLGDQYSLVAPQFSASSTSLSSLSKVPST
FT                   PTTGSAANSNARPFHSISSGKHALPQSIFTVETDSPWSVKAANDLALLMFGISKNMIKS
FT                   LNLMDLIAPQFREFVADKLTRSMADNILTDSKHEQGNNGRDMRDIMFAGEIVAIMRPGD
FT                   KDFAWTSVWAKKRGNLIFCTFEQIPCDAFDVVISSDKGQDEAYNVDSINEVAGKLMRNV
FT                   DTGKMKVLSDISESMGSDLSDRDENEEDDLIDEYLSHDIIDSEKINKTRYYTLQLKTDE
FT                   NIPCAVTSYPLELNDDKDEVKLKIHSLPYIGGMFVIDSLSYNIISCNNAIAKNLFGKSS
FT                   IYLKNKSINNLIPDFTEILNIGLKNHGDSLDIVPGLVLPEHFFRKFDAIRRHSSYKEES
FT                   EESLFFSSQGIRGLHRDGKSIWVDVQLRASSSEAFVVWITYSRSTGTKDSNISKEVEKL
FT                   NSSTSSLSIKSMNDKERFKTRSSSGYRRNEVNLPSQLKLFPHDDSEILEFTPGSGDISR
FT                   ETSTRRPKANTFAIPISDMNKDLEKAMNLDNGNRGPSKRKRMTSNTDSSGSYVSRKSTS
FT                   ESATMSPDTIATTVYNDNEGTNSNAIISNETYRKYSEEEILKIEDEMLENKTKNSTHWP
FT                   TVIGARRRTKKFSEFKVLKELGEGAYGKVVLAQHKEDPVYTIIIKCIDKERILVDTWVR
FT                   DRKLGTICSEIQIMAFLNNEPHVNIMRIIDFFEDSKYYYLETPLFGDPPAIDLFDFIEI
FT                   RKDLSERECRFIFKQIVSAIYHLHKHGIVHRDIKDENVIVDENGVVKLIDFGSAGYTKS
FT                   GPFDVFVGTIDYASPEVLRGEKYEGKPQDIWALGILLYTMLYQENPFYNVDEIMEGDLR
FT                   IPYVVSENSLNLIKKILVRDIKSRPTITDIVEDVWLDI"
FT   gene            <392855..>395431
FT                   /locus_tag="DEHA2F04334g"
FT                   /old_locus_tag="IPF_8727"
FT   CDS_pept        392855..395431
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04334g"
FT                   /old_locus_tag="IPF_8727"
FT                   /product="DEHA2F04334p"
FT                   /note="weakly similar to uniprot|P53135 Saccharomyces
FT                   cerevisiae YGL113W SLD3 Protein that interacts with Cdc45p
FT                   in initiation of DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66267"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU89"
FT                   /protein_id="CAR66267.1"
FT                   /translation="MSEDNPKTPRVKLPFTFEVQSALSTSCPNTITVLSKIDSILLENL
FT                   PENFYDNQQIFKLQDNVYEFLGSLFSNFFYVKIQERITDKDWKIGVIYNIHDRYYGMIQ
FT                   VPKDIKSKDIDSKVQGRIPISSYRNKDDFISGWNFNLERLDKSEVKTPIVDNFTMKPPS
FT                   TNISAEYFPNMSDHSPQSQTDPVKFLYSRYYSILYSLNTPLSYFPKTTISRFKNLCGND
FT                   NSAVKEHLSSLHLSVKELDDRHGGKYGILKTLDVSKIGTGDFDMKTKYENQNQKEFLNK
FT                   NHDLFVKLTATEKNQNDINDTNTNANQEKQVHSSDDNNLSFALDLKVREAQLQILILLE
FT                   LLDCWQVVESDFLATNLKRQEKEEKQMTKQKKKSLVRKKSITSKKIVPTFLGMGVDIQD
FT                   KHIVSQPASTEINEFIVYETLNTLLDRMGLWDTLLDKSTGDQDESSFGFLAYVLIPYFR
FT                   QRLPLTIKYIIERVKGLSLKLNSKPNRQNMPKQLNLNETNEITNEVTNERDSTANTQAS
FT                   RTSKFAKVHIDPRRVPFLKKSSSTIASKYDLLPAFSLKRSKSTLSSKNLQKRQVDMSSN
FT                   LKSFSESNRDNIEKSSTLSRSLSEKSDSGSRRQIIFGNAKKLKSQPDIILNNPQTAFSQ
FT                   VEATPAKRKPEAVTAGISSEITTPTHPNRYQKISIAKTPVDQFIRPTIAASYKETTIPC
FT                   STVKERPSLGDRLISASLAPPVDMAINSSPMSTIAVPKRDQSTAEVIASSPFNSIGAAV
FT                   DIKSSPFKGGSSRKRNKPGEPISFQESAFFDTTLNGSPVSTLLREANTNDSTSIFKRNS
FT                   TKRRKPISTNIKQTTTDITNGGDIMSNINKQDQAFEEDINETATLL"
FT   gene            complement(<395554..>397038)
FT                   /locus_tag="DEHA2F04356g"
FT                   /old_locus_tag="DEHA0F04785g"
FT                   /old_locus_tag="DEHA-IPF8725"
FT                   /old_locus_tag="DEHA-CDS2381.1"
FT   CDS_pept        complement(395554..397038)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04356g"
FT                   /old_locus_tag="DEHA0F04785g"
FT                   /old_locus_tag="DEHA-IPF8725"
FT                   /old_locus_tag="DEHA-CDS2381.1"
FT                   /product="DEHA2F04356p"
FT                   /note="similar to uniprot|P53040 Saccharomyces cerevisiae
FT                   YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA complexes
FT                   involved in transcription initiation of RNA polymerase II
FT                   and in chromatin modification similar to histone H4 and
FT                   highly similar to CA5745|CaTAF60 Candida albicans CaTAF60"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88873"
FT                   /db_xref="GOA:Q6BML6"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037796"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML6"
FT                   /protein_id="CAG88873.1"
FT                   /translation="MDPSSKVPLSHTLWSPHDTVKDAAESLGINLPEEAAKNLAMDVEY
FT                   RIHEILETAIKFMRHSKRKLLMTSDINHALKILNIEPLYGYDNSQPLSFKEALVGAGGQ
FT                   TLYYIDNHEIEFEKLINQELPSVPRQTTFTAHWLAIEGVQPMIPQNPLPSEIKSLPPII
FT                   RGATSSILGNDILNSGFSNENSVKDAPNGADAGAKNKKLTEKEVEVKPLVKHVLSKELK
FT                   LYFDKVVEVLISTDPEKESLKYAAINSLKNDPGLHQLVPYFIQFVAEQITNQLRNIDIL
FT                   STMLEVISALADNKTIFLDPYVHALMPCILTLLLAKRIGPIIKDNSSNEVLKNQLAVRE
FT                   FAAILLEHIIKVYGSSYSTLKPRVTRTLLRALLDSSKPIGTHYGALLGLKNMGNEVVKL
FT                   VLIGNLKMWCKLVVDEGDKNDSEKEILLNTTLDILRNLRIDLDKADDMEVDDTGFSDEI
FT                   KDKLKDRLGDTLADLVLKQPDVKSIVRGLFFGEINI"
FT   gene            complement(<397400..>398215)
FT                   /locus_tag="DEHA2F04378g"
FT                   /old_locus_tag="DEHA0F04807g"
FT                   /old_locus_tag="DEHA-IPF8723"
FT                   /old_locus_tag="DEHA-CDS4564.1"
FT   CDS_pept        complement(397400..398215)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04378g"
FT                   /old_locus_tag="DEHA0F04807g"
FT                   /old_locus_tag="DEHA-IPF8723"
FT                   /old_locus_tag="DEHA-CDS4564.1"
FT                   /product="DEHA2F04378p"
FT                   /note="similar to CA5748|IPF2905 Candida albicans IPF2905
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88874"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML5"
FT                   /protein_id="CAG88874.2"
FT                   /translation="MKAFFNSGTSRNSFFKQEQERIESIIKEPLLEYVLQDLPHLQTTK
FT                   EQQDDIWEMIAIKLNTDQFQSTLTSTDNNNKEVDEIATLNGPYIKDVYIKLMDDFMQRV
FT                   YSINRYKQIYKAEYTRPPDGGPAPIGYAAFSLPIREILAERTDKLLCELFYLKGYDIEV
FT                   MAKLSKERFEEQQRNEHKNKSAVANNLNQDQEPHKESSDNTSADDDKEKTHKALEQMKE
FT                   QSGKSKLDFYEKEFVKKNKKLDQLNNENKRLLELNHELVIELQKLREKS"
FT   gene            complement(<398397..>398771)
FT                   /locus_tag="DEHA2F04400g"
FT                   /old_locus_tag="DEHA0F04829g"
FT                   /old_locus_tag="DEHA-IPF8722"
FT                   /old_locus_tag="DEHA-CDS6631.1"
FT   CDS_pept        complement(398397..398771)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04400g"
FT                   /old_locus_tag="DEHA0F04829g"
FT                   /old_locus_tag="DEHA-IPF8722"
FT                   /old_locus_tag="DEHA-CDS6631.1"
FT                   /product="DEHA2F04400p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88875"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML4"
FT                   /protein_id="CAG88875.2"
FT                   /translation="MGSCFSKSDKEPVGSKRSTGNNRFSRNEQKLGGNTESDTAGNGNQ
FT                   IINEKYKNNTNRNVQGSNTRSHGKTLGGEETNEKNPNTKEAAAKAAELRYNKQRQSLKE
FT                   SQDKLKTMSKKSKLEKGLQS"
FT   gene            complement(<399030..>400898)
FT                   /locus_tag="DEHA2F04422g"
FT                   /old_locus_tag="DEHA0F04851g"
FT                   /old_locus_tag="DEHA-IPF8721"
FT                   /old_locus_tag="DEHA-CDS1514.1"
FT   CDS_pept        complement(399030..400898)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04422g"
FT                   /old_locus_tag="DEHA0F04851g"
FT                   /old_locus_tag="DEHA-IPF8721"
FT                   /old_locus_tag="DEHA-CDS1514.1"
FT                   /product="DEHA2F04422p"
FT                   /note="some similarities with uniprot|P38330 Saccharomyces
FT                   cerevisiae YBR238c and similar to CA5749|IPF2908 Candida
FT                   albicans IPF2908 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88876"
FT                   /db_xref="GOA:Q6BML3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BML3"
FT                   /protein_id="CAG88876.2"
FT                   /translation="MFRLLSANTQQTLRPAILSKVRSNKANISLPSSSIQVNPPSPAQY
FT                   NLTCQFTRHNSSASSQKTKSSKVDAFVNKAQRDPVLREALDSEANSKLNYFKEQLSLAF
FT                   QYRSAKDRDSQRAFVATVDNLFKAFEDESLRSSYSSRDLYSYTQILNFSVYHNRTNRLS
FT                   SSRNRDSDQYQNENLHDEVLIKSAVLNLSETIISGEFNKILNANILSYLFYSMKQFQLY
FT                   PEMLNLWENGVNDGETGKLFLNEKILAVILPIAYEQKRFSYEEILHIYELNTKELSTVQ
FT                   HELLCSIGKIAIGSGDYSRGLDSLEALLQLYESKQQSTQHVLASLGELHLNFIGSCKDI
FT                   KISKHFFDKVVQYDLPYYVCLKVPYIQSLLQNCFELNESLDNIIYFWKSTITHYSNEKN
FT                   SAGLNSRYSILNNTFFTIFFKIYPTLNAESFNKLREVIALYAEIKPVDEVFLNTIIGNY
FT                   SWGDKNVLEQLIENYSIYNVKRTPVSYRICLKKTGELPQYTNEDILIKWNDSLQHLDQN
FT                   GFNYIPIADWAALRDATILSNSGSDRKDFYLAVANQYKDYIQDQRSCIRFVKYWLKKRE
FT                   HLKSFSTLTFGSDADFSNEVDIVVPQFRHLKPNINYQKISSKIIGK"
FT   gene            <401470..>405441
FT                   /locus_tag="DEHA2F04444g"
FT                   /old_locus_tag="DEHA0F04873g"
FT                   /old_locus_tag="DEHA-IPF8720"
FT                   /old_locus_tag="DEHA-CDS0164.1"
FT   CDS_pept        401470..405441
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04444g"
FT                   /old_locus_tag="DEHA0F04873g"
FT                   /old_locus_tag="DEHA-IPF8720"
FT                   /old_locus_tag="DEHA-CDS0164.1"
FT                   /product="DEHA2F04444p"
FT                   /note="similar to uniprot|Q9C258 Neurospora crassa
FT                   NCU03784.1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88877"
FT                   /db_xref="GOA:Q6BML2"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML2"
FT                   /protein_id="CAG88877.2"
FT                   /translation="MPSRSSGWNRSGNATETSTLLPVHKSTKIDSEIASEDEKVAEKRP
FT                   KLGTFEGVFLPTALNELSILMFLRFGFIIGQMGIMGTFLLLIMSYTIDILTVMSISAIS
FT                   TNGTVKGGGAYYMISRSLGPEFGGAIGVIFCIGQILNASLNVVGLIEPILVNFGEHNGD
FT                   ILQILPVGYFWQALYCSIVLACCTGVALVGAKLVSKTAFYLFIILSLSTLSIPVSALFV
FT                   KPFNPLPPPHQNLAYTGFSWSTVKQNLWPHFTSGAAGSVLAPGEKESFKNLFGIFFPST
FT                   AGIFAGASMSGELANPSKSIPQGTLKGSLLTFIFYSLVIASLGSTISRDLFYQDIKVIQ
FT                   TVNMHKVVVLLGEISTSLFSAIMGIVGAATMLSAIADDKIIPGLSAFTVSKMPARERKL
FT                   GESLSVLATWCVAQTFLFADINQIATFITMAFLMTFIVTNLACFLLRVGSAPNFRPSFK
FT                   YFSSRTALTGCLTSIFAMFIVDGISASLIIVFLMLLIIIIHYLTPPSKFGDISQLLIYH
FT                   QVRKYLLRLKLQMSVKYWRPQILLLCDDPRTSWNLIGFCNHLKKGGLYILGHVVVLNDE
FT                   AKAENNESEFGINSYKEIQKQRHAWSKLRDMSNIKAFVQIALGPTLPWGVRNVYLGSGL
FT                   GGMRPNITVLGFYDFVKHGVELPFLSSFKDKNKITELPTDECRKERKVSIGQWVQIVED
FT                   LIIMQATVAVAANFGTLNLPQPDVKRHHFWSQPKTSNSDTRKYIDLYPIQMSSINHLEN
FT                   GKSVLSTNFDTYTLILQLGAILATVPEWKYSLYTLRVIVFVENQSEVNDEKKRVSELLS
FT                   TLRIEAEVKIICLDDGSLDSYNLLVKGYARTSGNKKVFDRLDRTLKNDQWWKNLCNARR
FT                   ILKELEKQKVRKQFKKNLSTQSDVDEALKNITSLDLNHPSSRAVPSNYPSSNNGFKNNR
FT                   RYTISNLQDKGLSLSFNMKTQQHDFFAFEDSSTSDSSDSERDDGSTSIKNHFGTTTLDN
FT                   YPSRFSNTDDNQSPSNKNLQDMDEHAQLKTLARLKEYDDSKLGRNEASTDRLSIMSSRS
FT                   NLMPNFSSVKFPKAKFDDDDHEVDGDNPSIRFVIDDDSDSDDEKEKEDAKEEATEVAKR
FT                   NRFTKVTTSADRERGISHGSRLEQKGKKGSKKSDIINALKSKGILEEPPKSSPFMTNDD
FT                   DIIRRMNSPEFLSVENEGENDTEKIPSGGLSSLPNSALSGFEEGSGVHSTSESGPQSAE
FT                   SHEGKGLTQKQLQDALKSLSFNDLPAKGQHLILNELMRINSPLDQTDVIFSTLPAPLIG
FT                   THLDEEESFIYTHNVAIWADGLPPLLLINSQTVTVTTAL"
FT   gene            <405634..>408375
FT                   /locus_tag="DEHA2F04466g"
FT                   /old_locus_tag="IPF_8715"
FT   CDS_pept        405634..408375
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04466g"
FT                   /old_locus_tag="IPF_8715"
FT                   /product="DEHA2F04466p"
FT                   /note="similar to uniprot|P21372 Saccharomyces cerevisiae
FT                   YBR237W PRP5 RNA helicase in the DEAD-box family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66268"
FT                   /db_xref="GOA:Q6BML1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BML1"
FT                   /protein_id="CAR66268.1"
FT                   /translation="MNSTGSNYSLKHNNTQDNNHNSEESVTNKTGELDKPGVKDGQALS
FT                   KEEKLKRRQEQLAAWMQKRQQENQEPSGKVTISATDETNIDKEKLIRQQRIEEWKRKRL
FT                   QKSEGLETDRSKIKTFEVKSSNEPTIKINASMKKTITPANGRSKKRPIFGDEDEDDEKE
FT                   SKPKFKKPTLDLAEIEEKKPEKSIDTEIDELDKYLSLLEEKEQGVENKKIENHDDDGIA
FT                   NGPGVGNVNESDDEEIDEDQKQQDILSSKLNRLQNKQKQLDDVDHNQIQYHPFRKDFYT
FT                   EPTEISKLPEEEVANLRLKLDGIKVRGVNCTRPIIRWSQLGLPSTIMSIIEGRLNYSSP
FT                   SSIQAQAIPAIMSGRDIIGVAKTGSGKTLSFVLPLLRHIQDQPPLKKGDGPIGLIMTPT
FT                   RELALQIHKELNHFTKKLNISSCCCFGGSSIESQIAELKKGAQIIVGTPGRIIDLLAAN
FT                   SGRVTNLQRVTYLVLDEADRMFDMGFEPQVTKVFTRVRPDRQTVLFSATFPRKMELLAK
FT                   KILDNPMEIVVGGISVVASEITQKVELFENEDDKSLEEAKFSKLLSTLNDYGDKDAECK
FT                   ILIFVEKQIAADELLVKLLTEKYPCLAIHGGKDQIDRKHAIREFSSSNSGVNILIATSI
FT                   AARGLDVKGLNLVINYEAASHMEDYVHRVGRTGRAGRKGTAITFVSSKQGRAITDLVKA
FT                   MRLSKVSEDEINPRLIEISTKFLEGVKSGKEKYNFGFSGKGLDNLQEIRESNRDLERKV
FT                   YGEENDSSTFKANEKKQNKTDIHQSDLDVKLPDFHIIEGRAPETAGPDKCKFHSRITIN
FT                   DLPQKARWITVNRDSLSKVIESTGTSITNKGNYYPPNSKIPKTIKQNGKEVTPPPKLYL
FT                   LVEGLTEKAVHDAIILLREKMIEGLEVAAKEESMGPTGKYTV"
FT   gene            <408615..>409439
FT                   /locus_tag="DEHA2F04488g"
FT                   /old_locus_tag="DEHA0F04917g"
FT                   /old_locus_tag="DEHA-IPF8711"
FT                   /old_locus_tag="DEHA-CDS4530.1"
FT   CDS_pept        408615..409439
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04488g"
FT                   /old_locus_tag="DEHA0F04917g"
FT                   /old_locus_tag="DEHA-IPF8711"
FT                   /old_locus_tag="DEHA-CDS4530.1"
FT                   /product="DEHA2F04488p"
FT                   /note="some similarities with uniprot|P28817 Saccharomyces
FT                   cerevisiae YDR036C EHD3 Protein of unconfirmed function
FT                   plays an indirect role in endocytic membrane trafficking
FT                   member of a family of enoyl-CoA hydratase/isomerases and
FT                   similar to CA5879|IPF12076 Candida albicans IPF12076"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88879"
FT                   /db_xref="GOA:Q6BML0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BML0"
FT                   /protein_id="CAG88879.2"
FT                   /translation="MSEFNLEDYKKYDKFIVSEVEEGFYHVQFNNPKSLNAFTEQVWRD
FT                   YAEILERLDKCEETSVILISSAIPKAFSSGLDLKDAIKTMSSTVSNSEKERYDSLHQHI
FT                   VDFQYCIAAPARIRTPTICLMNGINYGLALDISSACSIRVATADCKFSIREIKIGIPAD
FT                   IGSLQRMPTIVNNKSLMYQYALTGGVFGADEATKLGFVSAVLPDLNAGVEYCKNLGENI
FT                   NQHQQWAIKGTKESIQSIVDNGSPSEGLKNIAHYNATHIDGRFVRAMSGIKL"
FT   gene            <409664..>411577
FT                   /locus_tag="DEHA2F04510g"
FT                   /old_locus_tag="DEHA0F04939g"
FT                   /old_locus_tag="DEHA-IPF8710"
FT                   /old_locus_tag="DEHA-CDS1428.1"
FT   CDS_pept        409664..411577
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04510g"
FT                   /old_locus_tag="DEHA0F04939g"
FT                   /old_locus_tag="DEHA-IPF8710"
FT                   /old_locus_tag="DEHA-CDS1428.1"
FT                   /product="DEHA2F04510p"
FT                   /note="similar to CA5880|IPF12074 Candida albicans IPF12074
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88880"
FT                   /db_xref="InterPro:IPR024319"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMK9"
FT                   /protein_id="CAG88880.2"
FT                   /translation="MAYALRRGQKIKGFSISKRFVSSPAVSLNDEIVGSFESHSTTKTS
FT                   RTIPNNALNTSRNTPSQLFLNSLSESYFAPTVKTGTTLPKNEVIKRELCKLVELRQFDT
FT                   LIDLFLKLTSRAESSSWSSILTSQELSYFIRDIIKHQIKLINQAADHKISLRSDTKIKS
FT                   KLAEARRFREKIRKLYGNLIYSDGQSSIYAVTMRSSLYNSNDLTGYKLSVTDYENLIML
FT                   ELYNKKIDLASKWFQRFEQQYPQGQHYELMTYNMWVLKFQVYCGGSPFLWKIPQTDLYA
FT                   NYYNPRKSAFKSETSWLEVFTEFLKNHGKSSNTAVISDKLNETLIYSIGYARNLDYLTK
FT                   YIESIWGITPDGNVSENFTILKSDDPKFPSLNTLKAMVISLSYNQEFFQAMTYVNAFQK
FT                   IYGDSIDLSSAKAKNFWDSTFKWCDISTKFDEERALSYYIKQTTDTSTRNKKKPSLKEA
FT                   QENADFDYEGFLLFISELKSKRSTTMVKLWELHKDTNTFFSPKSYKVYLNYLFEDQTEE
FT                   KLYDVMSLLAKQYHYYHVSKNSFNKIHLTTNKLNDTDESVYSLYNTALRELINVKWKAG
FT                   YAGQCQPLIDEWALNQQMHNTTSQWFKDTIMPQYRVMMENKREEVMIKQKTEDDEKLLD
FT                   LF"
FT   gene            <412469..>413272
FT                   /locus_tag="DEHA2F04532g"
FT                   /old_locus_tag="IPF_8709"
FT   CDS_pept        412469..413272
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04532g"
FT                   /old_locus_tag="IPF_8709"
FT                   /product="DEHA2F04532p"
FT                   /note="similar to uniprot|P35178 Saccharomyces cerevisiae
FT                   YDR087C RRP1 involved in processing rRNA precursor species
FT                   to mature rRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66269"
FT                   /db_xref="GOA:B5RU91"
FT                   /db_xref="InterPro:IPR010301"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU91"
FT                   /protein_id="CAR66269.1"
FT                   /translation="MSQTSGFVKKLAANDRKIRDAAFESLRKYLSSRSSSKLTLLEMEK
FT                   LWKGLYYSMWLCDRPRPQERLAESLAQLYSEVIPVAAFSDFTEAFWVIMIREWPNVDQW
FT                   RVDKFYLLIRRILRHNFKRLKTEKWSSKAVDSFLSVYEKYPLSGDKSVSVALPYHICDI
FT                   YLDELELVIFEELKDKQEALDEQEKKDMTKYQELVKSKIDIASEVPIQKLITPFQKLSK
FT                   ECPLKTLREKCKEEVLNDERLKDWNIFESEDTDSEEDDDEWEGFN"
FT   gene            <413438..>414550
FT                   /locus_tag="DEHA2F04554g"
FT                   /old_locus_tag="IPF_8708"
FT   CDS_pept        413438..414550
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04554g"
FT                   /old_locus_tag="IPF_8708"
FT                   /product="DEHA2F04554p"
FT                   /note="weakly similar to uniprot|Q02775 Saccharomyces
FT                   cerevisiae YDR088C SLU7 Protein involved in 3' splice site
FT                   choices acts in concert with Prp18p during the 2nd step of
FT                   splicing and similar to CA5883|IPF2425 Candida albicans
FT                   IPF2425 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66270"
FT                   /db_xref="GOA:Q6BMK7"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMK7"
FT                   /protein_id="CAR66270.1"
FT                   /translation="MSSQEKHKPEYDSSGKEVNPYIPKFISAVPWYHNKSNDEKSDDYL
FT                   SHQRSNVADEAKDHSIPQPGSGINDEFEIKGETEIKKVEDYDSKRDRWHGYEAQEWDKI
FT                   AENWDKIKKKKQKTKNASVEEDSDDTDYELELVELGLDSKDIKNNLKEDPLEKTIRDRQ
FT                   DVPAYILNITSSNKIHYDPKSRLTKDPSKGFINDKNQFVKKLTGEAKRLDNLQKFAWEQ
FT                   NRQQEEMKQREAFEQKLTGKKHSEGGPDEYQVDLNLNMEANPTAMMLQARHKQEQQQAS
FT                   HDQKKSDLVAKYGGGEFLNKSKEFVNVTESIQTGDKPINKDKNGLKRSIYPEDNYSMNH
FT                   QSIWGSYYSGGQWGYCCCKQTTRNSRCTLN"
FT   gene            complement(<414585..>415652)
FT                   /locus_tag="DEHA2F04576g"
FT                   /old_locus_tag="DEHA0F05005g"
FT                   /old_locus_tag="DEHA-IPF8707"
FT                   /old_locus_tag="DEHA-CDS4105.1"
FT   CDS_pept        complement(414585..415652)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04576g"
FT                   /old_locus_tag="DEHA0F05005g"
FT                   /old_locus_tag="DEHA-IPF8707"
FT                   /old_locus_tag="DEHA-CDS4105.1"
FT                   /product="DEHA2F04576p"
FT                   /note="some similarities with CA5884|CaSLF1 Candida
FT                   albicans CaSLF1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88883"
FT                   /db_xref="GOA:Q6BMK6"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMK6"
FT                   /protein_id="CAG88883.1"
FT                   /translation="MGTGADIIKKLTPAPMPTFNAWNTIRAGSRLKTDGDDSELDAKVS
FT                   SKENTNGCEDSLESAKRGPIGKEHMLRAAMAAVKTTGDTDRGELVCVGENTTVVRPKFK
FT                   NKTWSRKDATSTIKGRSRRRAGSQAAIHHTTTCPNVTMTSDLFGGGNFYQGPGGSYGGY
FT                   AFGNPSDLVPPIYTPMCVNNSIPMPMPTHMPGPIPMMGTKPDDYPVQGKGPGSFMALPS
FT                   SPIHPYFHQLSPSPPIDPYQMPYHPYYHPAHIHVDPMSNPYRIQEIKNQVLYYFSPENL
FT                   NTDDYLKSLIDRTTGGVLLTELIKFKRLNIMTNNGRDIIILQNIIKYECFPELELIQMN
FT                   QGIGVRSKYWRIQVV"
FT   gene            <416412..>417590
FT                   /locus_tag="DEHA2F04598g"
FT                   /old_locus_tag="IPF_8704"
FT   CDS_pept        416412..417590
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04598g"
FT                   /old_locus_tag="IPF_8704"
FT                   /product="DEHA2F04598p"
FT                   /note="similar to CA5885|IPF2419 Candida albicans IPF2419
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66271"
FT                   /db_xref="GOA:B5RU93"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU93"
FT                   /protein_id="CAR66271.1"
FT                   /translation="MSQLNESKETMPSPPVLKTTIIQLNKELDQDDSNYEILTNEYNQN
FT                   KESTSVTTTNIPASMVGSIQGKKKRRRSSANVDSDELLKRKNDTKQLHSIIEKRRRIKI
FT                   NREFEALKYLIPACRLTSSSGGTNGKGAGTNNGSKIDGMYKLTILKSSVEYILYLHHII
FT                   QQQHNLINANMDNNKYKFDIDFAKIPLDVNTYRNINKDFNFKELITSIQDTPSFNSPKE
FT                   RDSVIEEDYEEDSVNDDKSQLLSPDITPDMAPALSMLNKYMTIARESSTSSVSPNGGLQ
FT                   STFSCPSTTDNSPYNNPMKFSSTGKFNKFQLPDPALTPTEYENVDANQYQYGPKKKLFK
FT                   AKIPPNNTVLFNRPLNIKCVSSDRTREDKLSDQDASKTLLALRKSSIDSLLN"
FT   gene            complement(<417674..>418529)
FT                   /locus_tag="DEHA2F04620g"
FT                   /old_locus_tag="8701.2-42559.1"
FT   CDS_pept        complement(join(417674..418465,418527..418529))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04620g"
FT                   /old_locus_tag="8701.2-42559.1"
FT                   /product="DEHA2F04620p"
FT                   /note="similar to uniprot|Q12395 Saccharomyces cerevisiae
FT                   YLR128W DCN1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66272"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU94"
FT                   /protein_id="CAR66272.1"
FT                   /translation="MPRISLATKSSFRSQFVTVTGASVSLASQWLDKYDWNLQESINGY
FT                   LNQDSYSRARPLKIDSKLNAIYDKYKDSNNENKIDINGTIAYLEDLNFDPEHPISLTLA
FT                   FFLEAPTMGVFTKEKFLNKWQNEKINSLSGMREFILRLHNDLETNHELFQELYNFTFGF
FT                   LMEVPGQRLLNYELAVDYWRLLLMNKKEFEPCYGRLEQWFDFILNEYKRGLSNDTWKMF
FT                   YLFIKTIALKDPSNFEDYDEMSAWPSVIDEYIEYLKENKLLN"
FT   gene            <418701..>420782
FT                   /locus_tag="DEHA2F04642g"
FT                   /old_locus_tag="IPF_8700"
FT   CDS_pept        418701..420782
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04642g"
FT                   /old_locus_tag="IPF_8700"
FT                   /product="DEHA2F04642p"
FT                   /note="some similarities with uniprot|Q874R3
FT                   Schizosaccharomyces pombe apc2 Apc2 protein and similar to
FT                   CA5887|IPF2415 Candida albicans IPF2415"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66273"
FT                   /db_xref="GOA:B5RU95"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU95"
FT                   /protein_id="CAR66273.1"
FT                   /translation="MITIPLSKENFNQVIPIPTLQDLAANSSNSDQQSNNIENDIDYLL
FT                   HWLSPFWPDNRVFNEPSQRVKSAVRSCLRDESSQLDFVKLYGNSIKPRFFEELSPVLLD
FT                   DRVLLTEAIDKIKFIKDYYNQYIKYLNLNKLPYDILNRNLNSLFHSILVENKQSKFIKN
FT                   LTNYLYEMLFGDEKCLHGSVHGYISVLLSIELIDELNSIIIRLSIKQIKDYILATCTKV
FT                   WDKPLLEEINCWIKSDLFPSFNLIMRLSNFDFSEKYLYDLIKIAHDELVSLRIKEIFGL
FT                   VVDYPNSYIALSELHQCLSFKFNSHNTGTNISNLSTVINSNINTSEIDSANSLITISNF
FT                   SSILINNSANSQAYQRAKLVDTFIQLCHEELLHSGANTVNVITCYTSTIKSFLIIDPKG
FT                   VLLDRVVRPIRRYLKTREDIIIKLVHGLLDQSESNDLLELAQELRNGTKKTVIADDLMD
FT                   LTWVPDPIDALPDFKKSKMTDIIESLISIFDSKEIFINEFTQLFGERLINLHDYDVKDV
FT                   TDHLDLLKLRFGENEFTTLDIMIKDIEQSKITNEKINYRNEYSFHSTILSHLYWPTVCE
FT                   NVSHNDSFKLPDTISNQFEKFDKEFAGVKKGRGLKLLPSLGLVRLELSIRNTKLSFEVT
FT                   PDKASIISLFHDKVDELRLTNIASQLDMQPYVASKAIDYWIKQNVLTETSKGIYKVNE"
FT   gene            complement(<420860..>422437)
FT                   /locus_tag="DEHA2F04664g"
FT                   /old_locus_tag="IPF_8699"
FT   CDS_pept        complement(420860..422437)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04664g"
FT                   /old_locus_tag="IPF_8699"
FT                   /product="DEHA2F04664p"
FT                   /note="weakly similar to uniprot|Q03761 Saccharomyces
FT                   cerevisiae YDR145W TAF12 Subunit (61/68 kDa) of TFIID and
FT                   SAGA complexes involved in RNA polymerase II transcription
FT                   initiation and in chromatin modification and similar to
FT                   CA1622|IPF10045 Candida albicans IPF10045"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66274"
FT                   /db_xref="GOA:B5RU96"
FT                   /db_xref="InterPro:IPR003228"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR037794"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU96"
FT                   /protein_id="CAR66274.1"
FT                   /translation="MNNNNSGENMNTSGNPDSGASTPNLQNRQMAQRPVSIQPSQVNQL
FT                   AQALRNEVSLAKAAGNDIAKAQQHYAKAESIKQVLLNYRDQQNARKAQQQQQQQQQPVG
FT                   TSNQVNQPASAGITPINRQSSPQPTPQGQSPVLNQSQPIHQSPTNSASPVPSIPANSNN
FT                   NNAATIEKFNQAKARLGEFERKIQQLQNSKKSYNLNPEQVTSIESQLTELKSKYAQYQR
FT                   YAIYIKSQLVEQAKSNITSAPGMSNAPTPGTVANQRVPSIGNSAPQGISSPSMPKQGSL
FT                   PPDVGNLSNKQASVSAKGKSVSPPPTNVNATPSKSGPGSQSSSHGVPPINLSGITKPSV
FT                   PSIPISSSINVKPPTAVTLKPTSNNNRATLSSGVANGIGQILGTPAILKLPTYDLSSSG
FT                   AGGAIPDNGGRVLTKRKLSELVNNIGADEGDGKTNIDGDVEELLLDLADEFITSVTGFA
FT                   CRLAKHRKVDSVDVRDVQLHLERNWNIRIPGYAMDEIRTTRKWQPNPSYNQKVSGVEIS
FT                   KSVNGNIN"
FT   gene            complement(<422615..>424951)
FT                   /locus_tag="DEHA2F04686g"
FT                   /old_locus_tag="IPF_8695"
FT   CDS_pept        complement(422615..424951)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04686g"
FT                   /old_locus_tag="IPF_8695"
FT                   /product="DEHA2F04686p"
FT                   /note="weakly similar to uniprot|Q06593 Saccharomyces
FT                   cerevisiae YPR194C OPT2 Oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66275"
FT                   /db_xref="GOA:B5RU97"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU97"
FT                   /protein_id="CAR66275.1"
FT                   /translation="MSNPNSVSTDNRVMNHNESNDSQNEDQTDSLLSTSSSVAKRNYKK
FT                   IYGSTDEENLQSIELNNDVLELPKVVRESVPLEDDPNIPVMTFRYFILSTIFIVPGAFL
FT                   DTMNSYRTTSAVYSIFFVQIVSHWAGKWMAKTLPKKNVNVCGFEFNLNPGPWSIKETAM
FT                   ITITANSGATGNLATNAISLAELHFNEKVNAAIAILFMWAIVFIGYSYAAIAKCFVLYD
FT                   PQFTWPQALMQTTLLQSQARSDRDSKHGSMQMKVFFYVLLAVTIWEFLPEFAFPLTSSL
FT                   AILCWIAPYNKTVNFIGSGMGGMGVLNFSLDWANITSSIMLYPYWIQVIQFLGFVLGAW
FT                   IMIPLVKWGGVTSFKHGLMSNSLFLSNGTRYPTDELLTDDLRLNMTAYKYYGPVNLGAQ
FT                   RAWNMFFDYAAYISGIVWVVLFGYDQMKNSLNVLRNTYTTKDQNGGFTSIHLQYTDRLN
FT                   KLQSKYEEVPMFWYLILFIISFSTLMFIFLSGQMFLPWWCCIVALALGSIIVTPLSWLY
FT                   ALSNFQLAIGTFNELFYGYMVQNMKSVHPVSAVVFGAISGSAWYRAQYHLLCMRLGFYI
FT                   HLPPKAVFFSQIYGEIIGVPFNYIALRWVLDTKREYLDGTKEDPLHQWTGQTITSYHTN
FT                   TINYVILGPKRLFYHYPLLPYGFLLGAIAPVALYILHRKFPNSRLKFRLWNTTVFFSTL
FT                   STFYGNLSTGYASKFIGGTVTMYWAYNYRHSLWKSYNYILAAAFDTGYNFAVLLIFLLF
FT                   SFGRTIRMPPWWGNNEQSVERCFAL"
FT   gene            complement(<425095..>429321)
FT                   /locus_tag="DEHA2F04708g"
FT                   /old_locus_tag="DEHA0F05170g"
FT                   /old_locus_tag="DEHA-IPF8692"
FT                   /old_locus_tag="DEHA-CDS0138.1"
FT   CDS_pept        complement(425095..429321)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04708g"
FT                   /old_locus_tag="DEHA0F05170g"
FT                   /old_locus_tag="DEHA-IPF8692"
FT                   /old_locus_tag="DEHA-CDS0138.1"
FT                   /product="DEHA2F04708p"
FT                   /note="similar to uniprot|Q06698 Saccharomyces cerevisiae
FT                   YLR419W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88892"
FT                   /db_xref="GOA:Q6BMK3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMK3"
FT                   /protein_id="CAG88892.2"
FT                   /translation="MAKKKVKEVTPEVKEKRKNKKPIEEPEEIKKPQRGLAIGDNFGWT
FT                   GKLPATLLHEHCQKQKWGKVIFDMKKTSKGFIGIANLSWENPKTKEVIHIKMMPDSDMY
FT                   EPKETTNEARHYVATYALFRINYVKNMKMILPKIFRDYWSDLETKRLETLKSNKEKHDV
FT                   IYNGNPFTVFLEQRAKSEQLLKEKEQKQQNDLKVRKPTVNISSSNKTSSTSPNLKSTTK
FT                   RQGNMNHNSPSFPKKVWANAPFIDFPSELRISIENSIKNHINWILDDDASQNNEEHLHS
FT                   LVRLGFRESHIKESFQYTSSFIDSLEWLLFHIPEDDLPPFFSKSDQDSSVSLKISKNIQ
FT                   FEYLVNRVSQSGFDMDEILTTLEENKNDELKTCVQLTHRIVEYSPVPGDFGESQELWEQ
FT                   EIDGIQMIDANKIHYIENSQNRIVTISLNSKNLKQDDLLSLKLYKSDNYPNDLLGIQLI
FT                   VNNNSFKLANYIKLSILRQLIQYIIKNGFLGDCYIFSIVEWLEDNISMIIDNPGPLIQG
FT                   DLSRESSREKNQAISSKKAFKNKREKKLQPEDIDNLSKKYQVKLKSNEILNSLKKRSEL
FT                   PAWKKRDQLVSVINSNKVTIVTGETGSGKSTQIVQFILDYLNSTGDFESSIICTQPRRI
FT                   STIGLAERISEERNDDLGKETGYIIRGENKTSNGTRISFVTTGVLLRMLQSLMTSSDQN
FT                   EIGIFNKLQYIFIDEVHERSVDSDFLLVILKKIMKKFPKLKIILMSATISVDKFRNFFN
FT                   MDLNHIHIEGRTFPIEDYYLDSILNDLDYTITTNDQIIKPKADSHFFKQGNINYDLIAS
FT                   LCLKIDKELSEDRNKGSILVFLPGIMEINHCIRNIEKAFDESRRKNWCLPLHSALSSID
FT                   QKRVFKIPPKDVRKIVVSTNVAETSITIPDCVVVIDSGRSKTLFFDSKIHTTKLIENWC
FT                   SKAEVSQRRGRSGRITNGNCYHLYTKETETGMLDQPIPEIKRTRLENLYLVVKAMGIKK
FT                   VEEFLSGGLDPPDQHSLSKSKKVLTEIGALNKDNLSHLGNYLSLLPTDLLSGKLLIFGC
FT                   IFGCLEICLTLASIRSTGSPFLNNFENRERIKQTQNSFSKGQGDLIGMANAFRQYEDLK
FT                   GESKNAKKFLNENFLSYLTLKEIASTRTQYISILKDIGFVAINYNPRNSNNEGHKSLNR
FT                   NNENYSIVRAIIASSFYPQIARVQLPDPKYVQSLVGAVEIDPDAKQTKFWIRNENYIDN
FT                   VKNGVEANDVLPATRAFLHPSSVLFETNNVNDSNTPSNEDFTNEEDINKVRQMYKDLKP
FT                   RVPGSSNAAKATFVAYGTSHYTQKLYLRDITPTSTIAALLFGGDIAYDMTSQVTSGKSS
FT                   PGIVLDNWMPIRTWCKNGVLIKRLRILLDSLIEDKLSNPHYSGNEDGSTSSNDEILVVI
FT                   ERILNI"
FT   gene            complement(<429417..>429488)
FT                   /locus_tag="DEHA2F04730r"
FT                   /old_locus_tag="Deha0F.29"
FT   tRNA            complement(429417..429488)
FT                   /locus_tag="DEHA2F04730r"
FT                   /old_locus_tag="Deha0F.29"
FT                   /note="tRNA Trp (CCA) cove score=70.45"
FT   gene            complement(<429759..>431084)
FT                   /locus_tag="DEHA2F04752g"
FT                   /old_locus_tag="DEHA0F05214g"
FT                   /old_locus_tag="DEHA-IPF8690"
FT                   /old_locus_tag="DEHA-CDS2814.1"
FT   CDS_pept        complement(429759..431084)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04752g"
FT                   /old_locus_tag="DEHA0F05214g"
FT                   /old_locus_tag="DEHA-IPF8690"
FT                   /old_locus_tag="DEHA-CDS2814.1"
FT                   /product="DEHA2F04752p"
FT                   /note="similar to uniprot|O93870 Candida albicans FCR1
FT                   Fluconazole resistance protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88893"
FT                   /db_xref="GOA:Q6BMK2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMK2"
FT                   /protein_id="CAG88893.2"
FT                   /translation="MTGGSPSSIEENDHHLRKKRVGKACDSCRIKKTKCDGKKPCNRCM
FT                   LDNKICVFTEKKKVKDKSHPNGYVELLETRLDLLRKSLEKMIQLSRPHLPFLNELMDEE
FT                   TEENDVIPINRVVQYLINNEGLLYKVPVEWENGALIAANLEADSKNISEAAKKFYDHKV
FT                   DASDNPGRTNYYEEATKDKALNEEKDNSRIQNGSKLADTLNEELSDGGNSPTSTSLTEK
FT                   LNLDDFSLGGYSSNLLLGNAYPDIFSDFESDSNNSVNYAHNIPFGNSRQSSANTNGNAS
FT                   LFTPIPISNSVTSLTNEFENHGIHSPTSIGSILPSQTSTSLRRSSSLHNQRPFSPSHQK
FT                   MKNNGHIFKPQHTGSSHSHLNSVYVSNNGNEFHLQKKLSSSSSSAASTPATTAISPINT
FT                   KLEEESTLPSDAIQLQNFNYEGLNIMDTANIDSFMINNPFMK"
FT   gene            <431726..>432568
FT                   /locus_tag="DEHA2F04774g"
FT                   /old_locus_tag="DEHA0F05236g"
FT                   /old_locus_tag="DEHA-IPF8688"
FT                   /old_locus_tag="DEHA-CDS4462.1"
FT   CDS_pept        431726..432568
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04774g"
FT                   /old_locus_tag="DEHA0F05236g"
FT                   /old_locus_tag="DEHA-IPF8688"
FT                   /old_locus_tag="DEHA-CDS4462.1"
FT                   /product="DEHA2F04774p"
FT                   /note="similar to uniprot|P47137 Saccharomyces cerevisiae
FT                   YJR096w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88894"
FT                   /db_xref="GOA:Q6BMK1"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMK1"
FT                   /protein_id="CAG88894.2"
FT                   /translation="MKTIRLNSGKEIAEVGLGCYDIPNSVTKQIVFEACQAGYRHFDTA
FT                   VLYGNEYEVGQGISQWLKSSKDHKRSEVWYTTKLWNSQCGYMQAKAGIKSCLEKVADLQ
FT                   YIDMLLIHSPLCGPEERLNTWKACQEAVDEGLVKNIGVSNYGKHHIEQLLSWDGLKYPP
FT                   AVNQIEISPWCMRQELAQWCLQQNVHVEAYAPLTHGYKLSHPPSEFVPILEKYQIDMAQ
FT                   LLIKWSLQKGYIPLPKTKTPARLKSNITLDFELTDEEMSIIDQPDAYDPTDWECTNAP"
FT   gene            <433769..>434776
FT                   /locus_tag="DEHA2F04796g"
FT                   /old_locus_tag="DEHA0F05258g"
FT                   /old_locus_tag="DEHA-IPF8687"
FT                   /old_locus_tag="DEHA-CDS3856.1"
FT   CDS_pept        433769..434776
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04796g"
FT                   /old_locus_tag="DEHA0F05258g"
FT                   /old_locus_tag="DEHA-IPF8687"
FT                   /old_locus_tag="DEHA-CDS3856.1"
FT                   /product="DEHA2F04796p"
FT                   /note="highly similar to uniprot|P00359 Saccharomyces
FT                   cerevisiae YGR192C TDH3 Glyceraldehyde-3-phosphate
FT                   dehydrogenase 3 and highly similar to CA5892|CaGAP1 Candida
FT                   albicans CaGAP1 Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88895"
FT                   /db_xref="GOA:Q6BMK0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMK0"
FT                   /protein_id="CAG88895.1"
FT                   /translation="MAITIGINGFGRIGRLVLRIALQRSDIKVVAVNDPFIAPEYAAYM
FT                   FKYDSTHGRYKGEVTSKDDSLVIDGQSIKVFGEKDPASIPWGKAGVDYVIESTGVFTTT
FT                   EGAQKHIDGGAKKVIITAPSSDAPMFVVGVNEQKYTPDLKIVSNASCTTNCLAPLAKVI
FT                   NDKFGIEEGLMTTVHSITATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVIPE
FT                   LNGKLTGMSLRVPTVDVSVVDLTVRLKKSATYEEISEAIKAASNGELKGILGYTEDAVV
FT                   STDFLGSDYSSIFDQKAGILLSPTFVKLISWYDNEFGYSTRVVDLLEHVAKASN"
FT   gene            <435080..>435973
FT                   /locus_tag="DEHA2F04818g"
FT                   /old_locus_tag="DEHA0F05280g"
FT                   /old_locus_tag="DEHA-IPF8685"
FT                   /old_locus_tag="DEHA-CDS4278.1"
FT   CDS_pept        435080..435973
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04818g"
FT                   /old_locus_tag="DEHA0F05280g"
FT                   /old_locus_tag="DEHA-IPF8685"
FT                   /old_locus_tag="DEHA-CDS4278.1"
FT                   /product="DEHA2F04818p"
FT                   /note="similar to CA5893|IPF2392 Candida albicans IPF2392
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ9"
FT                   /protein_id="CAG88896.2"
FT                   /translation="MDKLFLDQTFKLYKSNDTLPQLTQPQLDYISTIICQYLFQTLAND
FT                   IISEYRSYQDLFTDFKITHNVRQFNHFTITYISVRHRGLLPRQTIIFIKSPNNNDETRP
FT                   FNALVMIKATNSSLLSVLIQVIENLATEVPIIIRDLRFTEKYLNLIINNVSSGLVSMNN
FT                   YAEVIGDVELIYSTSHLVSNDSLRNITISVPEKDIQNLADSQGLVENINAFLKRTSQLN
FT                   FNNIPLFRFTSRLINLSQDGKLKISSDKLHLVRNSDFIDNIFTSNQSQHDALEDQENPF
FT                   IWFLIGSIYNENFTQL"
FT   gene            <436222..>438519
FT                   /locus_tag="DEHA2F04840g"
FT                   /old_locus_tag="DEHA0F05302g"
FT                   /old_locus_tag="DEHA-IPF8684"
FT                   /old_locus_tag="DEHA-CDS0931.1"
FT   CDS_pept        436222..438519
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04840g"
FT                   /old_locus_tag="DEHA0F05302g"
FT                   /old_locus_tag="DEHA-IPF8684"
FT                   /old_locus_tag="DEHA-CDS0931.1"
FT                   /product="DEHA2F04840p"
FT                   /note="similar to uniprot|P31382 Saccharomyces cerevisiae
FT                   YAL023C PMT2 Transfers mannosyl residues from dolichyl
FT                   phosphate-D-mannose to seryl and threonyl residues in
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88897"
FT                   /db_xref="GOA:Q6BMJ8"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ8"
FT                   /protein_id="CAG88897.2"
FT                   /translation="MSSSGIYSGEKDALRRVGKSSTKNDTVDSINSLNENAAPDFDKLK
FT                   RTQYDETKEFISSLKFLESFLAPILFTILSFSVRLYKIGINEHVVWDEAHFGKFGSYYL
FT                   RHEFYHDVHPPLGKMLIGLSGYLAGYNGSWDFPSGEMYPDYIDFTKMRIFNATFSALCV
FT                   PLAYFTFKQIGFTIASTWLFTLMVCLELSYVTLGKFILLDSMLLFFTVATVFCFTRFHN
FT                   FNSDPNTKNFSRKWWKWLLLTGFAIGCTCSVKMVGLFVTTLVGIYTITDLWNKFGDKTI
FT                   TWRKYSYHWIARVIGLIIVPIIIFLISFKVHFDLLYKSGTGDANMSSLFQANLLGSDVV
FT                   GGAREISIGHSVVTLKNQGLTGGLLHSHIQTFPEGSKQQQVTTYTHKDTNNNWVFQRAR
FT                   GMEPYDTEKSQDIDYVLDGMVVRLVHPMTGRNLHTHNIPAPISKSEWEVAGYGNLTLGD
FT                   YKDNWVVEIMEQNGEEDKLRLHPLTSSFRLRNTELDCYLGVSGNNLPAWGFRQGEVACY
FT                   QNPFKKDKRTWWNIENNANKLLPPSPPDFKLPKTRFLKDFIQLNLAMMATNNALVPDHD
FT                   KQDDLASSAWQWPTLHTGIRMCSWADDKIKYFLIGSPATTWPSSIGVILFAFIVLFYLI
FT                   RWQRQYNDFPDQQKLKLFTMGGIYPMFGWGLHFMPFIIMGRVTYVHHYVPALYFAMMIF
FT                   CYELELFTLPLRNSSSAISKLAYALIFAAWYAIVIGTFWYWRHVSFGIEGPKEDWTHLD
FT                   LLPSWRIANDNY"
FT   gene            <438725..>439336
FT                   /locus_tag="DEHA2F04862g"
FT                   /old_locus_tag="DEHA0F05324g"
FT                   /old_locus_tag="DEHA-IPF8683"
FT                   /old_locus_tag="DEHA-CDS5327.1"
FT   CDS_pept        438725..439336
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04862g"
FT                   /old_locus_tag="DEHA0F05324g"
FT                   /old_locus_tag="DEHA-IPF8683"
FT                   /old_locus_tag="DEHA-CDS5327.1"
FT                   /product="DEHA2F04862p"
FT                   /note="some similarities with uniprot|Q12425 Saccharomyces
FT                   cerevisiae YPR067W ISA2 Protein required for maturation of
FT                   mitochondrial and cytosolic Fe/S proteins localizes to the
FT                   mitochondrial intermembrane space overexpression of ISA2
FT                   suppresses grx5 mutations and similar to CA5895|CaISA2
FT                   Candida albicans CaISA2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88898"
FT                   /db_xref="GOA:Q6BMJ7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ7"
FT                   /protein_id="CAG88898.2"
FT                   /translation="MTYLTYRHGYSTETGTKSNTAPKAFKSSSFNQPKEIPKASTSQTQ
FT                   TAEVPQEDIDDFNITKLIHGTTDMKIAITKRASNKLTSIAEDDKNPNAALKVEVESGGC
FT                   HGFQYNLKLTDLTEELKDENNELLVFKRMGDDGEVAQVVLDDSSLQILQDSKVDYTKEL
FT                   IGSQFKIVDSPYTSTACGCGASFDFDFEKLEKVREREANK"
FT   gene            complement(<439525..>441408)
FT                   /locus_tag="DEHA2F04884g"
FT                   /old_locus_tag="DEHA0F05346g"
FT                   /old_locus_tag="DEHA-IPF8682"
FT                   /old_locus_tag="DEHA-CDS1481.1"
FT   CDS_pept        complement(439525..441408)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04884g"
FT                   /old_locus_tag="DEHA0F05346g"
FT                   /old_locus_tag="DEHA-IPF8682"
FT                   /old_locus_tag="DEHA-CDS1481.1"
FT                   /product="DEHA2F04884p"
FT                   /note="similar to uniprot|P31383 Saccharomyces cerevisiae
FT                   YAL016W TPD3 protein phosphatase 2A regulatory subunit A
FT                   and highly similar to CA5896|CaTPD3 Candida albicans
FT                   CaTPD3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88899"
FT                   /db_xref="GOA:Q6BMJ6"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ6"
FT                   /protein_id="CAG88899.1"
FT                   /translation="MDSGHDDLYPLALLMDELKHDDVSNRVEAMQKLDTIAIALGPQRT
FT                   LNELLPFLNDVAQDDEEEVFAVLANKLGDFVPLIGGRENCEPLIQILLILASMEEPIVR
FT                   DKAIDSLNNISLELAHDQLIEIFLPMIQSLSQGNWFSKKIASCGLFKSIIIKVDSSTRR
FT                   DLLNVFYKLICDESPMVRRSAANSLPNLINKLTWFTENYPNNEDKVTNKDWEIISQLFQ
FT                   HLINDEQDSVKFLSIDVLISILDFFQQVNDQSHNSEFLISSLKLINDESWRVRYTAADR
FT                   FGKIAKNFATDESDLSKLIDPFISLMNDNEGEVRKAIAKQLPEFCELLSNFPTTNQAIL
FT                   NKIIPIVNKLSQDPHENVRSSLASSITNLSPILGKQSTIDNLLPIFLVMLKDEFPEVRL
FT                   NIISNLSVVNEIIGINLLSINLLPAITELAQDNKWRVRLAIIEYIPKLANQLGESFFND
FT                   ELLTLCMSWLWDPVFAIRDAAVNTLKELTIIFGSVWADNEIINRLLNNNNSGNENIDED
FT                   NKIDYSNFIIRITCLFAITKLIPVMNNDIIVSKLLPFINNFIDDSVPNIRFNIAKSYLV
FT                   IAETLVKSKDNGAQKLINNEILPNLQKLQSDDDVDVRFFASKSIQGIKDLN"
FT   gene            <441991..>442923
FT                   /locus_tag="DEHA2F04906g"
FT                   /old_locus_tag="DEHA0F05368g"
FT                   /old_locus_tag="DEHA-IPF8681"
FT                   /old_locus_tag="DEHA-CDS4117.1"
FT   CDS_pept        441991..442923
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04906g"
FT                   /old_locus_tag="DEHA0F05368g"
FT                   /old_locus_tag="DEHA-IPF8681"
FT                   /old_locus_tag="DEHA-CDS4117.1"
FT                   /product="DEHA2F04906p"
FT                   /note="weakly similar to uniprot|P36069 Saccharomyces
FT                   cerevisiae YKL128c PMU1 and similar to CA5897|IPF2384
FT                   Candida albicans IPF2384 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88900"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ5"
FT                   /protein_id="CAG88900.1"
FT                   /translation="MPQPSKLDILDSRLSPEDTFTFHNELHKQQEQKQEYWKFEIVPDF
FT                   FKQSDSETDETTFNYLKESFGRVKSWKDVFDGLGGLNETAESNVCYKVFFLARHGQGYH
FT                   NLAHDKYGNDAWNDYWSKINGDGEIVWGPDPELTELGQNQAKENYKQWQIELKDGCRLP
FT                   TKWFVSPLSRSIDTLTMTWENITKLGEARPLIKENIRETIGVHTCDMRSTRSIIDSKYS
FT                   PKGYVIEPGFAEKDIYFKKDYRETVREHALRINEFFQEVFTVKDDIICVTSHSGSIRAS
FT                   LLVLGHRQFSVGTGGMIPVFVKGTKIVNK"
FT   gene            <444072..>446474
FT                   /locus_tag="DEHA2F04928g"
FT                   /old_locus_tag="DEHA0F05390g"
FT                   /old_locus_tag="DEHA-IPF8679"
FT                   /old_locus_tag="DEHA-CDS0832.1"
FT   CDS_pept        444072..446474
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04928g"
FT                   /old_locus_tag="DEHA0F05390g"
FT                   /old_locus_tag="DEHA-IPF8679"
FT                   /old_locus_tag="DEHA-CDS0832.1"
FT                   /product="DEHA2F04928p"
FT                   /note="weakly similar to uniprot|P38966 Saccharomyces
FT                   cerevisiae YDR089w and similar to CA5901|IPF2374 Candida
FT                   albicans IPF2374 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88901"
FT                   /db_xref="GOA:Q6BMJ4"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ4"
FT                   /protein_id="CAG88901.2"
FT                   /translation="MKFGSNLNHLSIREWKWYNLDYNDLKYKIRILTQEDNYEISELYQ
FT                   DFVNNFNRINLFIETKNDELIRKVTFFEANFNRLLEESNINTIVKQINFDEIFYQTIEI
FT                   SVILKKLLKFITIQKIACRKIFKKLVKYYANKTEAGQFVSSLKDKLSRNERSFINFSLA
FT                   NLTGRLTLLFNSIKVERGNLCQFVNEKSHIPRCKRTSLISLFHNTDDLEFDYNISLKKN
FT                   FSMSCLISADVNNLNELFLNLNIYLGFNNCNVDKESTRMSYTYLFNDNMNDEPCTIITH
FT                   EDKKYSLIIACVGGLRKYSYCRIETDIADSLLKYLIDPSKNEVLDKLPTLYDDNLTKAT
FT                   IDSILNNKLSPKFRLICNRSRFSLSNEADLHQEPDTFHNPEDDYLITVDEGILTTSDIN
FT                   IVSSTSFDFDRTHFERFPINKLSIYTNDLNLSNFEDNLTSEINNHKISNKFQISYLKKL
FT                   PTRIQKLVQIHSLNLFKNLDLYQYMLSCYMNVIPNDKYIDNHYSVLLNLDLFKSFENIE
FT                   NYRNTLDIETKLINSKSDQILRHQSSLKSLPDYYAKHTQPSERPLLSKSHQRNSLLSNN
FT                   SSQTGLYTLHNSYSRENLNNSLTSHTSILNSDHSDEFDVDSELEYYDNNNIASMNYESG
FT                   DSVINKVILTIIQLKRKAYGVSRDVESYGSTNERYNNYKKDPSIVIRSTFNEYQYQFER
FT                   DFDKILSFFYFSLIFISLFISGVEIGIIYSILSSQSNFDRFPIVQNIWLILVIIIGLIV
FT                   SSFLSLISLLLIFRRFHSCPKSHYLVITFGSFLIITSFFWCMFILFF"
FT   gene            complement(<446586..>446675)
FT                   /locus_tag="DEHA2F04950r"
FT                   /old_locus_tag="Deha0F.28"
FT   tRNA            complement(join(446586..446622,446637..446675))
FT                   /locus_tag="DEHA2F04950r"
FT                   /old_locus_tag="Deha0F.28"
FT                   /note="tRNA Tyr (GTA) cove"
FT   gene            <447286..>451713
FT                   /locus_tag="DEHA2F04972g"
FT   CDS_pept        join(447286..447307,447425..451713)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04972g"
FT                   /product="DEHA2F04972p"
FT                   /note="similar to uniprot|P47169 Saccharomyces cerevisiae
FT                   YJR137C ECM17 Sulfite reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66276"
FT                   /db_xref="GOA:B5RU98"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU98"
FT                   /protein_id="CAR66276.1"
FT                   /translation="MGSQIEAISNIVKNIEGSVFVTQPAKSVESSFSKYLPNANTLIDS
FT                   NDPYSVINNYAEHRTEGEEQDDEIITVITNGSTIFRNLPFLSSTAFKTSKIVSHVELVN
FT                   FDFSIVSTLRDLNVPVLVSQSTNESVVFSKLSYNLSQRFGQPVFHFFAPSNYRSALSEK
FT                   VDGKIIIDDLSKYEFNDLLSKFGVSPFEVVTGSSKAQHSIVYFGQLNDELISAAKNENV
FT                   VLVSIKVYKPFDLQKLLTIIPSSVETITFVSQTTSPSTSFAPLLLDFFQEYSKYQTLKN
FT                   FTKVAAAFFGYIKSEKYSEIIGNLLSNIKSESPVQNLSFGKTNTELATKASKERHGESL
FT                   KAITNVHNLEQAYLKILQQVNTDSLNILNEFNADNIGVETNPEYGYGAYLNFEEQQKQL
FT                   TDLVYAAIQDNLFKSIDNEKLIDNLSKWLINVRENIETTSNSVLETIKLLETDTNSSNA
FT                   AKILDLKEYFKVNKNWLIGSDAWSYDLGSSGVHNLITSNKNINMLIIDSEPYEDKSNDK
FT                   TVNGFRKKDVGLYAMNYGGCYVASVAIYSSYTQVLQAFIEAEKFNGPAIVLAYLPYHNE
FT                   FDNTLSILKETKLAVDSGYWPLYRYDPTIEDESKSFILDSSNLRNQLKNFLDRENKLTL
FT                   LAKKDPLLSRNLTSNATTEIKAKQLQAANDSYSKLLQGLSGPPLTVAFASDGGNAEAVA
FT                   KKINRQALGRGLKSIVLAMDDISMEDLPNETNIVFIASTSGQGEFPTNGKQFWDGLKNS
FT                   NDIDLSTIKFSVFGLGDSEYWPRKEDKHYYNKPSKDLFNKLKFYGGVELIDIGLGDDQD
FT                   ADGFNTGLNEWEPKLWKALGVDNVEGVEEPKPLTNEDMKIQSDYLRGTIVEGLNDQSTG
FT                   AISAVDQQLTKFHGIYMQDDRDIRDDRKSKGMEPAYAFMVRVRLPGGIATPSQYLRMDE
FT                   LSNERGNGTLKLTTRATFQLHGVVKHDLKPAIRGMNAALMDTLAACGDVNRNVMVSALP
FT                   HNAKVHSQISKTGALISEYLLPQTTAYHEIWLQGEDEGDKAGASKNWENRKEGPKKEKT
FT                   LVAGNALTDFEPMYGPTYLPRKFKVVITVPPYNDVDVYAHDIGLIAIVEGDEVIGYNVL
FT                   AGGGMGSTHNNKKTYPRTGSMFGYIAKDQIHIACEKIMLVQRDFGDRTNRKHARLKYTI
FT                   DDLGVEVFKGKVEELLGFKFEKAKPFEIKSNVDYFGWCKDETGANHFTAFIENGRIEDT
FT                   PELPQKTGLSKIAEYLLQNERPGEFRLTGNQHILISNINDDDLDTVKSLLAQYKLDNTD
FT                   FSGLRLSSAACVAFPTCGLAMAESERYLPELITKLEEALEDYGLRHDSVVMRMTGCPNG
FT                   CARPWVAEVALVGKAFGAYNLMLGGGHHGERLNKIYRYSIKEDEILSILKPLFKRWSLE
FT                   RNEGEPFGDFCIRIGIIKPTTEGKFFHDDLPEDA"
FT   gene            complement(<451839..>452177)
FT                   /locus_tag="DEHA2F04994g"
FT                   /old_locus_tag="DEHA0F05478g"
FT                   /old_locus_tag="DEHA-IPF8676"
FT                   /old_locus_tag="DEHA-CDS6432.1"
FT   CDS_pept        complement(451839..452177)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F04994g"
FT                   /old_locus_tag="DEHA0F05478g"
FT                   /old_locus_tag="DEHA-IPF8676"
FT                   /old_locus_tag="DEHA-CDS6432.1"
FT                   /product="DEHA2F04994p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88903"
FT                   /db_xref="InterPro:IPR018851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ2"
FT                   /protein_id="CAG88903.2"
FT                   /translation="MPYTKAEKAKLIQYIKNHADKRLQTLNSESDRIAEVCENKVLRRL
FT                   NSVSVTLWNIKLKDVLEIERHHKPTIKGLLKDIRSLQENSTSNSNSSTNISYNIRNRTT
FT                   SNGKISKP"
FT   gene            <452467..>453306
FT                   /locus_tag="DEHA2F05016g"
FT                   /old_locus_tag="DEHA0F05500g"
FT                   /old_locus_tag="DEHA-IPF8675"
FT                   /old_locus_tag="DEHA-CDS4473.1"
FT   CDS_pept        452467..453306
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05016g"
FT                   /old_locus_tag="DEHA0F05500g"
FT                   /old_locus_tag="DEHA-IPF8675"
FT                   /old_locus_tag="DEHA-CDS4473.1"
FT                   /product="DEHA2F05016p"
FT                   /note="similar to uniprot|P38886 Saccharomyces cerevisiae
FT                   YHR200W RPN10 Non-ATPase base subunit of the 19S regulatory
FT                   particle (RP) of the 26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88904"
FT                   /db_xref="GOA:Q6BMJ1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR027040"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMJ1"
FT                   /protein_id="CAG88904.1"
FT                   /translation="MVLEATMIAIDNSEYMRNGDYLTSRYDAQLTATEFIFQNKVNSNP
FT                   ENTVGLLAYGGNGPQVLSTLTTDFGKILSGAHETKISGENHFSSGIQVAALALKHRQNK
FT                   VQSQRIIIFVGSPVTESEKDLEKLAKKMKKNNVAIDIINFGEESVNTSKLEKFNSIINN
FT                   HDNSHLVSIPPGPRLLYEVIATSPILVEDGFDMGGNGTDMGMDAFGGGNGDIIDPNMDP
FT                   DLALALRLSLEEEKARQEREAADKAKDESGSNDLEQIAEDKEQPDHNNEDTNMKDAN"
FT   gene            complement(<453539..>454510)
FT                   /locus_tag="DEHA2F05038g"
FT                   /old_locus_tag="IPF_8673"
FT   CDS_pept        complement(453539..454510)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05038g"
FT                   /old_locus_tag="IPF_8673"
FT                   /product="DEHA2F05038p"
FT                   /note="some similarities with uniprot|Q04659 Saccharomyces
FT                   cerevisiae YMR048W CSM3 Protein required for accurate
FT                   chromosome segregation during meiosis and similar to
FT                   CA4317|IPF2109 Candida albicans IPF2109 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66277"
FT                   /db_xref="GOA:B5RU99"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="InterPro:IPR040038"
FT                   /db_xref="UniProtKB/TrEMBL:B5RU99"
FT                   /protein_id="CAR66277.1"
FT                   /translation="MDLEEELSLFQHEETVPTESGQQSQTNGSAEREGDDLLGLDQTIK
FT                   LSSRAKIAKIDNERIFNKSKGLNYVIRNHSKLIRVFQKNDKALQKTLSSKKSSLSSKAV
FT                   RSLKHENEFKNLSSMLQFYQLWCHGLFPKAKFKDCLQLLRSFGSKSGQLKLYRRELIEQ
FT                   ELRKLKENKGIMDTERMEMPETQNQQSEPLPENQGPEGIHDIADDDWSFMNTNQSNGLF
FT                   VGEDDDLYHTPTTPPAEAVSRDVGSAASNSGHNASLDAVNTKTNVPASSNDSDDSDDPF
FT                   SDDDIPIGSEPMNKYDEYPDEEIEVDDHEHEDELAIMREMGM"
FT   gene            <455061..>456101
FT                   /locus_tag="DEHA2F05060g"
FT                   /old_locus_tag="IPF_8671"
FT   CDS_pept        455061..456101
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05060g"
FT                   /old_locus_tag="IPF_8671"
FT                   /product="DEHA2F05060p"
FT                   /note="some similarities with CA1099|IPF12312 Candida
FT                   albicans IPF12312 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66278"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA0"
FT                   /protein_id="CAR66278.1"
FT                   /translation="MLYSLISNLLCFIWPLFLTLKSLSGEYCKKRTVDGKNSDQIKFLL
FT                   NYWICFIIVDYIERSVLYNAIFWPCFGFGFLPELFSCSIKLWLFYNHGCLVINYCYLNQ
FT                   FLRKVTCELEAVDPLEVFEVNLVNPVMKTLLTENHLAPLKLLSSMKIGTISWTVGRIVE
FT                   FCQCFVKSADQSFLQFSLDYICYMDSKQELEKHFEITKRFLASVISFIQYQFIRLNVQD
FT                   EESLPKIVQLLLIPNVQQNVPLHHTPKFESHNDRIEPVRMDSKGTKANDTLEPELEYQS
FT                   KSSISDQKYSINNKLLPRYVGNCQFTTYSKRKSQRTSSKPKYLDNAISGYVTTTISNPF
FT                   QFRKFR"
FT   gene            <456259..>457365
FT                   /locus_tag="DEHA2F05082g"
FT                   /old_locus_tag="DEHA0F05566g"
FT                   /old_locus_tag="DEHA-IPF8669"
FT                   /old_locus_tag="DEHA-CDS3492.1"
FT   CDS_pept        456259..457365
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05082g"
FT                   /old_locus_tag="DEHA0F05566g"
FT                   /old_locus_tag="DEHA-IPF8669"
FT                   /old_locus_tag="DEHA-CDS3492.1"
FT                   /product="DEHA2F05082p"
FT                   /note="weakly similar to uniprot|P47172 Saccharomyces
FT                   cerevisiae YJR141w required for cell viability and similar
FT                   to CA4316|IPF2111 Candida albicans IPF2111 unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88907"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI9"
FT                   /protein_id="CAG88907.2"
FT                   /translation="MYFTEYLPRINSISVIVENNDPIGNLIDIRLSSRDQVLIKFHDNE
FT                   ISVNLPVKIKRDDKIRIANANQTADYLQLTIALTPHDSNDVSEKTESFMDFSSSNLVQK
FT                   WSCKDLKTKTPQTDNKNNFKLTCLKCSHAIIDSKEYDRFFDMPSELWSEMMEFWHCHKP
FT                   AEDPNEKDSHRNYNGNLKPGDNDVIIGSSYFLINKSKQLEISDQDVKCGLCKYNLGILD
FT                   NSTLKLFKWNLALKYKENIETFPSYIYVYNLIVDKINLSAIRKFNVTSESRQDYMFIWI
FT                   MNIGVDVSTENFVLNNSMKVFYYHDDIRGISKDDESIESVVLQDDVFNDFSKQLSKINN
FT                   FIPNLKKTMTLKLDEEVKIFNVSFITGF"
FT   gene            complement(<457405..>458643)
FT                   /locus_tag="DEHA2F05104g"
FT                   /old_locus_tag="DEHA0F05588g"
FT                   /old_locus_tag="DEHA-IPF8668"
FT                   /old_locus_tag="DEHA-CDS3079.1"
FT   CDS_pept        complement(457405..458643)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05104g"
FT                   /old_locus_tag="DEHA0F05588g"
FT                   /old_locus_tag="DEHA-IPF8668"
FT                   /old_locus_tag="DEHA-CDS3079.1"
FT                   /product="DEHA2F05104p"
FT                   /note="weakly similar to uniprot|P38698 Saccharomyces
FT                   cerevisiae YHR201C PPX1 Exopolyphosphatase hydrolyzes
FT                   inorganic polyphosphate (poly P) into Pi residues"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88908"
FT                   /db_xref="GOA:Q6BMI8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI8"
FT                   /protein_id="CAG88908.1"
FT                   /translation="MSVRSYLVTLKKQLETNSIKSPLRFVTGNQSADLDSVISAISFAY
FT                   FNYKKDESLLIPLINISRTDFKLRRDIVTLLDSYSITEDSLYFIEDFKRITASDVPIEL
FT                   TLVDHCNIQGDVFTDYLSKGKLDIVGIIDHHQDESVFLNANPRIIHSNGSCSALVFNYW
FT                   YDQFSNKDIFYEKDNEIVPLLLGSLLIDTSNMSQKVEEGDVIAFKEYQNILQKNEILLK
FT                   GLGNYACQSTDNIEKLLKGYYKQIKVAKKDMKGFKFYDILKKDYKQFKFTSRCNVSTVV
FT                   GFSSIGKSFYWLLSNYSMQEISETFNEIMKDFNLDLLIMTTSYTRQENDQYTREFSYAF
FT                   NSSNPRKDILLQLANLANDELKLDSDIYKLENLNSYLADLGKGQTFKIYNQNNTAASRK
FT                   QIVPVIKDILENN"
FT   gene            complement(<458800..>461064)
FT                   /locus_tag="DEHA2F05126g"
FT                   /old_locus_tag="DEHA0F05610g"
FT                   /old_locus_tag="DEHA-IPF8667"
FT                   /old_locus_tag="DEHA-CDS0960.1"
FT   CDS_pept        complement(458800..461064)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05126g"
FT                   /old_locus_tag="DEHA0F05610g"
FT                   /old_locus_tag="DEHA-IPF8667"
FT                   /old_locus_tag="DEHA-CDS0960.1"
FT                   /product="DEHA2F05126p"
FT                   /note="similar to uniprot|P46971 Saccharomyces cerevisiae
FT                   YJR143C PMT4 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88909"
FT                   /db_xref="GOA:Q6BMI7"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI7"
FT                   /protein_id="CAG88909.2"
FT                   /translation="MSQAVRKRGGKKSATPPTSSIVDDDLNKLKAYNEDSETPKEPERK
FT                   YYIALIIVTLCAIYTRFSKIDTPAKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLLIA
FT                   FVGYLVGYDGNFKFENIGDNYIEHNVPYVAYRSFSAIQGAAVVPVMFLTMKNLGYSVPA
FT                   CLFSSLLVCFDNAHVAESRLILLDATLILSVALTIFAYTRFITYRKVPFSRKWWTWLSL
FT                   TGVFLSCVISTKYVGVFTYVTIGIGVLYELWYLLDFKRGLTLTDLSKHFFARLWALIIV
FT                   PFMIYLFWFYLHFAILVKSGPGDSFMSSEFQESLLESPMARHAKDVHYNDIISIKHKET
FT                   DAFLHSHLFDYPLRYEDGRVSSNTQQVTCVFDSENKESSDINNHWEILPPNDADAEGKA
FT                   VYTNDIVRFRHVGTGGYLLSHDVASPLKPTNEEFTIAYDDDANADHYNETLFRLRLSES
FT                   GNDKNKRKLVRTKAIPLKVIHVDTVVAMWTHDDELLPEWGFGHQEVSGNKKVQDRSNIW
FT                   TFDEIVNLKEDDKRAEYVPKVIRKIPFLKKWWELQLLMFHHNNILSSQHPFASQPDSWP
FT                   LALSGVSFWNDNEERKQIFFTGNVIGFWLEVGFLAIYVGLLLADQVTRRRHVYILNNKA
FT                   RSRLYNTLGFLFIGWSAHYLPFFLMNRQKFLHHYLPAHLIAALFSGGLVEFLCSNNSNK
FT                   KTGQPKGVLKIRMAAFVSICAVGVVWFFFYFRPVTYGDISLSVEEVKRRQWLDIKLHYA
FT                   K"
FT   gene            complement(<461317..>464652)
FT                   /locus_tag="DEHA2F05148g"
FT                   /old_locus_tag="DEHA0F05632g"
FT                   /old_locus_tag="DEHA-IPF8665"
FT                   /old_locus_tag="DEHA-CDS0309.1"
FT   CDS_pept        complement(461317..464652)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05148g"
FT                   /old_locus_tag="DEHA0F05632g"
FT                   /old_locus_tag="DEHA-IPF8665"
FT                   /old_locus_tag="DEHA-CDS0309.1"
FT                   /product="DEHA2F05148p"
FT                   /note="some similarities with uniprot|P32380 Saccharomyces
FT                   cerevisiae YDR356W SPC110 Inner plaque spindle pole body
FT                   (SPB) component ortholog of human kendrin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88910"
FT                   /db_xref="InterPro:IPR007483"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI6"
FT                   /protein_id="CAG88910.2"
FT                   /translation="MNGSSRSLIRALNNVADHWKDNANVDKISSEESELFEVISLFNEK
FT                   HNDLQSIKQSIDINGELFRIYNGYIKPASNLPREILFLEILIQLSPILIDNEIKLWSKT
FT                   YLKPAVDSAGYDIQLVLKSREFIRQLSMKTIPSKDPLLIERRDQIALIVMDTIIQLYIG
FT                   QSDERYDVIGLHLPKENSDSQLYYERIRYMKKNCEDLLHEYGLKKTKEYFSLINRYFKT
FT                   SSERLDMLTLLLRLVSSHTLQVYQIVDTDLFYNVLRSLLYDYNESILLVSLSLLVMLIP
FT                   QVCNKMVKSFPDLLVIYIRLANWESFNRHIPNRTDYLSKSLDENFKLWDLAEADSLNDV
FT                   ALTNSKIELDVSHFITLLYGLFPLNLSKFCQSPFNFLINRPTEIFKIKLLSSIMEDKGS
FT                   PRERNLELDVIDTTREFLRSFSFHPNFLQYDKLTLQNELENPLLWLLKETTDNDLRSEE
FT                   ISLECLSFNPHLVINAVHGHEELARSSWDKPSSDTNTNTNNNNNNQFGFIYTGTGESNA
FT                   GSLSNSRHVSRKSSFATPTYLNLKDITLQKLPISLQHLNSKLSNQIGERKSSISDIKFK
FT                   DVKFDKGLKEEHQINENENEYTPPDSDLGAYNRFDLDVDGSQESKQYDRFESNQSLSDM
FT                   FSAHEKLYLFSPKSSDPKIDSNVPARDQSKNPNSPNEKVKNELLQRPITSPITSLETTS
FT                   VHRKSISGTISNVTTLDSSQVQDNNITNNKFQHGTALEYYHRELLLMKNELEFSNYMRD
FT                   LNKTHYIKLKLKLNKLSKQTRQHDQSIEHKNNTLKIDSLKLGYNTLTETLKELKLQLTE
FT                   SRSKFKDENSILFSKIKDLENENYKLKTDLKNATTEQQLLGSNLSHSIQVVLPEKEFEV
FT                   NRLKTKLSELEQMNETLNQEIKLVTEKNTSKETKHLDETQTSSTFNLSEQEKQIYNLKN
FT                   DILMLNDKNLKISQELIKAQDLYDAAIKSYESKLSSSKGDLTKNISTFTSQYERRIQEL
FT                   AAIILKYEGLLDEKNSRIAQFSTSKPIEINNTKYNDATKAMSDKSYDSGIPQARNNASQ
FT                   ESYELESKGRETPTSVEGMYSGQPDHVPLHQNYVSSSHFPSQTAVTPIVRGRGGIQKRS
FT                   KKHM"
FT   gene            <464786..>465721
FT                   /locus_tag="DEHA2F05170g"
FT                   /old_locus_tag="DEHA0F05654g"
FT                   /old_locus_tag="DEHA-IPF8664"
FT                   /old_locus_tag="DEHA-CDS3948.1"
FT   CDS_pept        464786..465721
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05170g"
FT                   /old_locus_tag="DEHA0F05654g"
FT                   /old_locus_tag="DEHA-IPF8664"
FT                   /old_locus_tag="DEHA-CDS3948.1"
FT                   /product="DEHA2F05170p"
FT                   /note="similar to uniprot|P47173 Saccharomyces cerevisiae
FT                   YJR142w"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88911"
FT                   /db_xref="GOA:Q6BMI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI5"
FT                   /protein_id="CAG88911.2"
FT                   /translation="MTQTSYIDIIRKIDSFTYEEDEFYYKLRAHDGSATLGYITPTISK
FT                   YFEDEQDILLDAEKKTLTISPYLDTIEKRNALFSSIATKWRKIPYFSESLDKGWRNELY
FT                   TVYNPTHTPYVQIERAFSVLIGVITYGVHINGYIPPHKSSNGNLKMWVPRRSATKPTYP
FT                   GMLDNTVAGGLGYPYGIWETVIKECYEEAGLGEDFVNSHVRSAGVVSYIFEPNGHKDTV
FT                   QPEVEYIYDLEFDNETDVLPYPEDGEAEDFTLMDVSEVLDRLLNNEFKPNCGLVVTDFL
FT                   VRHGYITPESDENYLEIVSRCHRMMPFPTI"
FT   gene            <465827..>467698
FT                   /locus_tag="DEHA2F05192g"
FT                   /old_locus_tag="DEHA0F05676g"
FT                   /old_locus_tag="DEHA-IPF8663"
FT                   /old_locus_tag="DEHA-CDS1506.1"
FT   CDS_pept        465827..467698
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05192g"
FT                   /old_locus_tag="DEHA0F05676g"
FT                   /old_locus_tag="DEHA-IPF8663"
FT                   /old_locus_tag="DEHA-CDS1506.1"
FT                   /product="DEHA2F05192p"
FT                   /note="weakly similar to CA4309|IPF2127.3 Candida albicans
FT                   IPF2127.3 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88912"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI4"
FT                   /protein_id="CAG88912.2"
FT                   /translation="MVSEILYNTPDFDPGSNLNQLIKSILDYQSKRQSDESLRLKKNYS
FT                   PNDFISKVNNLEEFFYDNISYLTKIPQKNHQFLWLLSLESLATALYRYKLFYYENLLND
FT                   SYVDRQEIYNTNHILGTIATRLESITSRFRDLANRFFSEHISIGKFICSGTYSTIIMNK
FT                   LFNFITTSFKLLTIDEAEDMLYINEVTLTIQSIGEFLFRYYTYIGGLEEVAKQELNNDV
FT                   FPTLTEFIKTIYVIGKSQLILPFMVPSEISNDEFKPIIHPKTPLKVIQSSTIDFTFLKD
FT                   YYKYIAFNLLSLSLSQETSIEHEYNVQSDIYFRVLLSFPNLSTTVYERFEISNNQPENL
FT                   FDTGQLQERIQNDNIDFSSVSLLERQEISLLFILNYLLQLTELRNLIEPEQYYKSELTF
FT                   LVRSLSTSISQDIHVSASRSGSLHPSTAPSYSQLNMLDSSNKIKQVSNIKFSSLSSIIL
FT                   HGTYKEKLIMIINFCEKLNQKSLNIPHIIERFNLDSNLENDFQHLVSMIDTEKYPGKLI
FT                   YAKTISKITRLLKMISIKHLVQSAGINNVPESYLNRLFCSKEPLSVSTKVKEIVKFTQY
FT                   SDSNKEVLIRFESLDNRTNPSLNSSIKNQINNYNTTKELEKLSDHLK"
FT   gene            <467823..>467911
FT                   /locus_tag="DEHA2F05214r"
FT                   /old_locus_tag="Deha0F.3"
FT   tRNA            join(467823..467860,467875..467911)
FT                   /locus_tag="DEHA2F05214r"
FT                   /old_locus_tag="Deha0F.3"
FT                   /note="tRNA Met (CAT) cove"
FT   gene            <467966..>468928
FT                   /locus_tag="DEHA2F05236g"
FT                   /old_locus_tag="DEHA0F05742g"
FT   CDS_pept        join(467966..468018,468073..468928)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05236g"
FT                   /old_locus_tag="DEHA0F05742g"
FT                   /product="DEHA2F05236p"
FT                   /note="weakly similar to uniprot|Q9P7V3 Schizosaccharomyces
FT                   pombe SPAC30.03c Translin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88913"
FT                   /db_xref="GOA:Q6BMI3"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR016069"
FT                   /db_xref="InterPro:IPR033956"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI3"
FT                   /protein_id="CAG88913.2"
FT                   /translation="MSKLQGLFGLFQEEINTEINFKNKINDLENLFNAELAIIKSEYAN
FT                   LSTIQPSNLPYDFSSEDITSVPFVFALRELCQEKIINNENRDITELGTVNEVKVIDNLN
FT                   LLSDRYHRYLQELNGINCKAIFKDRFSHKINEEIIYVLMANRYFKTISYIYQVDLKGKQ
FT                   LDKILHPLISKSDQDIMGLVITPEEIQRVLSLEKLNYNDYLLGLLRLIETVVEYTIDTI
FT                   ISISISSENSPKQLQNIQYSLSLINLQIVTKLQNGFQMLDLKNDNIRRKFDGLKYNFKK
FT                   MNGIVYDLSLRKLIVNEVEIY"
FT   gene            complement(<469009..>474339)
FT                   /locus_tag="DEHA2F05258g"
FT                   /old_locus_tag="IPF_8661"
FT   CDS_pept        complement(469009..474339)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05258g"
FT                   /old_locus_tag="IPF_8661"
FT                   /product="DEHA2F05258p"
FT                   /note="weakly similar to uniprot|P47171 Saccharomyces
FT                   cerevisiae YJR140C HIR3 Transcriptional corepressor
FT                   involved in the cell cycle-regulated transcription of
FT                   histone genes HTA1 HTB1 HHT1 and HHT2"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66279"
FT                   /db_xref="GOA:Q6BMI2"
FT                   /db_xref="InterPro:IPR033053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMI2"
FT                   /protein_id="CAR66279.1"
FT                   /translation="MIDDMIISLIYQEADEKLLNTLYEIFTYLNSAKLARFTLEYLISG
FT                   KDESDDLFGLIPVEDLCKQKYKLLLQRLHISKPSSSDGDGTRELELIKEKLAFLEPIKA
FT                   DYNTSIENTTNLKTVNINIEYAQRDLNWTSVIDDINKKVKHLQDKEKSQELSRLRIKDL
FT                   DPYLLTENPIERVRFTIPVPEDESTHDDDVEKNDSKEVDKENNEVPDGEILIDEGSNHI
FT                   NSDEEIFLEAREFLEKEINDGKETQDSKNPSEKDVEGSTCKLDHIPANREVIEGEKHIS
FT                   EENAISKSAPMIQRSSKRVRYRNEESSMEINDVEITRSCFVETERFFENLNSYLDLFNK
FT                   EAATNLTLTNIVNIYVPEKNNNDENSAEGYVNDFLFILNDWNTRKYTHSLFVDDDTPAG
FT                   STASKSTEDEKIKLMEVLSTFGKKGDSLNSDLSKDIKDISSYETTEEIQKFLHDINENP
FT                   CHYEELKLLILRKLLSIQRPKGDFKGHAAYCLITDTIWNSKLYDRIREWTIQCESIILN
FT                   HLRLEGCDALGISHMLDDFSFSVAIYEILVDTYISIKDQINSMTSLNYKRTTHKPNKAT
FT                   LNNISLELVKIGDKLNRWTQHFEDLLERIDLSFAMMDQDFFTYYCRYKWSFIHKEKSQN
FT                   TIWQEKGFIMSQLHELHDNISTKKEAEAHIPLPNYENINEISVDSIKTQVTTTSILSIL
FT                   AKILYAKPGTNNDEAIHLLETILISDSSPDESIEALPLNKEVSTFDKDALIAIKDFLEE
FT                   SPVDMKLSSWNILFSYYDENNQFAKFQHGFEQNVSFILYYLNSNTYNGLIGTKFETLAK
FT                   VLGSYGKHVRIFLSHLRENNWKLSRDSHRTSSSIERTFSELLKLFELFYLFSIHEEAAL
FT                   ISSSKLSVKARSNKAYERFKDIFISTVSVIVIYYKELLMNTVKIEESKVPSEIEKTIGN
FT                   LICDFHEQLGWRRVCDAAEGLFLNLAQDILVAFDNNLFEKQLAQLISCRYHYSVSIDTF
FT                   TPANHETKKTAEFDLSSTQRMADFILPLCFKKNPLKATPKSDMKLLIDEFYEVVGDPDF
FT                   DSCEILSRNDSLFEHFLESTSITSRFLRDTFYGLEELDFRNPPDNANIIRSGLYYMQGL
FT                   LMFASYKIRKKSTQSRAVELENIIMLLKNDLVYCTNRMESWFLLGQAYGFLVEDDLIWT
FT                   SDKLTVPERKIGTANLQRKSLICYLMAINESTKANIKKDLPLKTTIGSLMALFSKEMYN
FT                   AAMKPMDMHAFKVQNIPRFIKKPTGAAFVSVSTSSVNSNLCLKVIQQSLHIAIKSKRND
FT                   WTYYYYLSKVQRKLNKSPRIVLDTLQQASNIAKEQSNPSDPIIEPHYKKCSLIYKYAKE
FT                   GSLSFQSGLEFLKNDMVINYEKGNKSIEKPMDFYEIIVECLKAVISYDKKRWHHKPRYR
FT                   LAKVLFEEFGKITEAKEEISSIVSLKSTNKTLVSIWKPENERPGKHFYYTFQYAHFYVV
FT                   LLSSDRNLIGLIQMLPKLRRSNSIMVSLYSLWETLCSSICKIIRNSLKVDEGFTERFMS
FT                   SSGYQKFMMNSKSLLENMKGDGVPGELQIHLCFLHAITDMKKLNNGFGPTSLIDDTMVA
FT                   IFIRIYLYFEKQSNNLKPMGTPEPTESPNEKAKKLAKRDFFPLISDMLKTFRRDIENIL
FT                   KDQPDIYNDFVSCSDKKVEKEGVVGKENNVNSKILEEEQSREVIKTPELKMDSINFESV
FT                   SDKHITQNKLEADTILQENNDKSPKNNGIKDNENSIPDSRARTLDEMLFNKGLEKKVQG
FT                   ESPTAKKQKLNSDHHDSASE"
FT   gene            complement(<475004..>475930)
FT                   /locus_tag="DEHA2F05280g"
FT                   /old_locus_tag="DEHA0F05786g"
FT                   /old_locus_tag="DEHA-IPF8657"
FT                   /old_locus_tag="DEHA-CDS4062.1"
FT   CDS_pept        complement(475004..475930)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05280g"
FT                   /old_locus_tag="DEHA0F05786g"
FT                   /old_locus_tag="DEHA-IPF8657"
FT                   /old_locus_tag="DEHA-CDS4062.1"
FT                   /product="DEHA2F05280p"
FT                   /note="similar to uniprot|Q03193 Saccharomyces cerevisiae
FT                   YDR090c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88915"
FT                   /db_xref="GOA:Q6BMI1"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMI1"
FT                   /protein_id="CAG88915.1"
FT                   /translation="MYNAVAENVLGTIGTILWCIQLVPQIIRNYYVKDCEGVPSVMMFL
FT                   WALSGVPFSIYFFGTDGSIPLRVQPQLFTLCCVITWIQTLYYPPVQCGLRKVIIYASTF
FT                   IIIAAGAEVGFILWLRPIYREGKEWPLLIIGIIAALLIALGLIPPYFELAKRRGRVIGI
FT                   NFVFVSMDSLGAIFSLVSIVVGTMDILSIVLYAIVIALEFGIFASHTIWYIRFGKKEKA
FT                   KENNQERDHEQEQEAESAYESSQEYSQEHLQEHSKEHSQEHSKEHSQEHSQEHENSLNK
FT                   MVEIQAQISRSDKSEYEYNEKYNNYDI"
FT   gene            complement(<476052..>478979)
FT                   /locus_tag="DEHA2F05302g"
FT                   /old_locus_tag="IPF_8655"
FT   CDS_pept        complement(476052..478979)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05302g"
FT                   /old_locus_tag="IPF_8655"
FT                   /product="DEHA2F05302p"
FT                   /note="weakly similar to uniprot|P14736 Saccharomyces
FT                   cerevisiae YER162C RAD4 Protein that recognizes and binds
FT                   damaged DNA (with Rad23p) during nucleotide excision
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66280"
FT                   /db_xref="GOA:B5RUA2"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="InterPro:IPR036985"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA2"
FT                   /protein_id="CAR66280.1"
FT                   /translation="MSEYRYKELLKESLKGSEVDNGTNTRKRRKTGGQYVFNGLDNTKI
FT                   ENQEVITISDNDQESEDSVNSSDFEDVSLDDEEESHGLNLFPDNTDSNDKQESLSITIN
FT                   PVQEEVKKKRKFNSISKSEREQRRIIHQMYVGLMLTHGVIRNRWCNDYNLLMELKKNVS
FT                   PQILELLHQKDSDDVLPLVKSRRFLDGLKKLMMMYSLNYRVTSQGLVRKNWNELSIKQS
FT                   KIEANVTFSKFFNLVTKFRGSRDIAAQGFVSLLRSVDLNARLVFSLQPPDYTSITELPK
FT                   INNNNQTTSSPEVTQSPLLQRFASRNSKRNLLDSMRKKSTTVTDEVKHANYFEDSSYPI
FT                   FWVEVWDKYVKKWVSIDPIVLQTIEVPPMRRKCKFEPPSTDIRNQLTYVIAYDRLGGVK
FT                   DVTRRYSLYYNAKTVKKKIHFRSEEDEIWYNRILKASCSQLRRNKINKIDILESKEFHT
FT                   RDLAEGVPNNIADFKNHPVYALESQLKQNEIIFPKDESSTCGFFRNKSSKKSQEKAVIP
FT                   IYKRSHVHGLRSAKAWYLRGRVLKVGVQPLKLKKKQMHQKQPTSDDDEEEETTRLYAEF
FT                   QTKLYIPPPIVHGEIPKNAYGNIDIYTPSMLPDNGYLVDTTSQFSMKIAERAAKIIDVD
FT                   YAKAIVAFDFGKSGKKKSQSRNPTAREGGILIDIQYKEAVYLVMNTLLEEEESLKRRVV
FT                   ELNSLNNWKYFLTKLRISERLNKVHGKLNSEDEESNFTDESEDDDFSIHSDNSGSDTKE
FT                   FGGGGFFISGNPESNSATEKYEATPEGFEEPYIGKSEGNEGVMEAKYMVEDTDFIEEES
FT                   GGGFFVEDPEPEAKYSQARIGGPSINVELDDMPDYYFKQDENGELIYDPSSDGNQLRSE
FT                   SSGADGTDTPKGNHDLSCTYLSKEALPDRVLTQDDTHEETSQMILSPEAANDIEATGKT
FT                   IVDKNDSSVSSCGKSSSGVESFQDSLGEEIAKEEQVFGFEYSDTD"
FT   gene            <479250..>481634
FT                   /locus_tag="DEHA2F05324g"
FT                   /old_locus_tag="DEHA0F05830g"
FT                   /old_locus_tag="DEHA-IPF8652"
FT                   /old_locus_tag="DEHA-CDS0856.1"
FT   CDS_pept        479250..481634
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05324g"
FT                   /old_locus_tag="DEHA0F05830g"
FT                   /old_locus_tag="DEHA-IPF8652"
FT                   /old_locus_tag="DEHA-CDS0856.1"
FT                   /product="DEHA2F05324p"
FT                   /note="weakly similar to CA4348|IPF3638 Candida albicans
FT                   IPF3638 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88917"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH9"
FT                   /protein_id="CAG88917.2"
FT                   /translation="MDKPHRSFYRSLDRERLLYKKKYVVIEPSIKYLLVKLQKEREGKI
FT                   HEMQVSGQVLPNPFKMQNLLEPIIYHTTLSLLYILDDRCLDSKYLQSQYANQVEHLTII
FT                   LNKIVTSKTTKLNYEQIRSQIEEQSGISLELMASEVISKFAGTDIPYNTNSVFIKPLQM
FT                   ALLCFLALSRRAYKQQYSIERDLVPWMHSIMAPSVSVSCESLRSLSKIPPCITSDILLR
FT                   TPMSKNEYYLQADIWLDFMKDIGAAYHKRIKHLKLCINNLIFYGIQYDSHKLPELIFRS
FT                   LHFFTNTTTGYQFSLVTQEFLNGIIWKLVFDYLRSSITYKPNIMANIIKTQEVVVQFLS
FT                   KVGDKREKVHSKLNIEGNMGIVLAINNISQEKSEKLFKIAEKNLMHLDLHHSNSKPMVA
FT                   YHFTRIFLSVTPEELLHNFNNGASDYFQSATLWLGFIRKLNEFGLLDEKRSKKILLELV
FT                   NNKERILITKDIILILLQPIKTLDDIDEFISILQKNSGAKEKDSLLAMAHSSSILPKYL
FT                   TILYRNVHLRNRPHPEVKYPWDKYKKLHPITTIKDQESPQNFRNFSSILSYARYLYDTG
FT                   FKKKTSKIVGIMLNGEINVQPENLYELYKSELFDKNNFNPDESCLSALIKAAMKQVDGN
FT                   DKASCIMWGDMYAPQVAIHEFKQHVMTEAFDKDLGKADNDPGIYPQDDLWQRYIHLLEK
FT                   YDYISELSTIIQWWENLNFRPNYLTLLMLLGSLPTEYGSRYIKHVQKVREDSAKSTYAH
FT                   IGEDPKSNAQNYLAWSWPSLEELERFKLKKSKLSNSSIRID"
FT   gene            <481869..>483347
FT                   /locus_tag="DEHA2F05346g"
FT                   /old_locus_tag="DEHA0F05852g"
FT                   /old_locus_tag="DEHA-IPF8651"
FT                   /old_locus_tag="DEHA-CDS2400.1"
FT   CDS_pept        481869..483347
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05346g"
FT                   /old_locus_tag="DEHA0F05852g"
FT                   /old_locus_tag="DEHA-IPF8651"
FT                   /old_locus_tag="DEHA-CDS2400.1"
FT                   /product="DEHA2F05346p"
FT                   /note="highly similar to uniprot|P08417 Saccharomyces
FT                   cerevisiae YPL262W FUM1 Fumarase converts fumaric acid to
FT                   L-malic acid in the TCA cycle"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88918"
FT                   /db_xref="GOA:Q6BMH8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH8"
FT                   /protein_id="CAG88918.1"
FT                   /translation="MLRLTSKYTPVARSIQLRSLSSTSALLSSTRTESDAFGEIEVDSA
FT                   KYYGAQTARSKHNFKIGGEAARMPIPVVRAFGILKKSAAIVNEGLGALDPKLSKAIQQA
FT                   ATEVAEGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPNDHCN
FT                   MSQSSNDTFPTVMHIAAATEISNSLIPELTKLRDALQAKSDEFKDIIKIGRTHLQDATP
FT                   LTLGQEFSGYVQQLTNGIERIEKTLPNLQFLAQGGTAVGTGLNTVKGFDSKIAEEVSKL
FT                   TSIPFKTAPNKFEALAAHDAVVEASGALNTVAVSLFKIANDIRYLGSGPRCGYGELSLP
FT                   ENEPGSSIMPGKVNPTQNEALTMVATQVFGNHSAITFAGASGQFELNVFKPVMISNLLS
FT                   SIRLIADGSASFREHCVVGITANVDKIEKTLHESLMLVTALNPKIGYDAASKTAKNAHK
FT                   KGLTLKESALELGVLNEQEFDEWVRPEKMIGPKD"
FT   gene            <483586..>484647
FT                   /locus_tag="DEHA2F05368g"
FT                   /old_locus_tag="DEHA0F05874g"
FT                   /old_locus_tag="DEHA-IPF8649"
FT                   /old_locus_tag="DEHA-CDS3640.1"
FT   CDS_pept        483586..484647
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05368g"
FT                   /old_locus_tag="DEHA0F05874g"
FT                   /old_locus_tag="DEHA-IPF8649"
FT                   /old_locus_tag="DEHA-CDS3640.1"
FT                   /product="DEHA2F05368p"
FT                   /note="weakly similar to uniprot|P06843 Saccharomyces
FT                   cerevisiae YER161C SPT2 Protein involved in negative
FT                   regulation of transcription exhibits regulated interactions
FT                   with both histones and SWI-SNF components has similarity to
FT                   mammalian HMG1 proteins and similar to CA4352|IPF3642
FT                   Candida albicans IPF3642 Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88920"
FT                   /db_xref="InterPro:IPR013256"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH6"
FT                   /protein_id="CAG88920.2"
FT                   /translation="MSLSNILQHVKRKGQIIPKTNQSGRDGTPETNRSTEESNNKNQYR
FT                   YSNGETRTVDPVVARLKAARKLERERKEQEAREKKGLAPKKPKSVPRTNTNSSRNNEVK
FT                   NNNGVGRMNNSSIRSGANMCPNVPPSHKPVKKMNFNDLMKKASKIDQSKLSVSIKPKAK
FT                   SPEVRPTTSKHKPSSRASSAPTEGYRNVPKRKEGRPTTSKYSNSDDNKPSARAPLPVRK
FT                   PSTKLEEKLKSSGKTKPSDTRSNRSRSYNDSEDEYSESFIVSDEEEADYGNSNVPDYDR
FT                   DEIWAIFNRGKKRSYYDRYDNDDSGDDMEATGAEIWEEERRSKRNAELEDRKELEEEQR
FT                   LAALKKARKMKQR"
FT   gene            <484774..>486390
FT                   /locus_tag="DEHA2F05390g"
FT                   /old_locus_tag="DEHA0F05896g"
FT                   /old_locus_tag="DEHA-IPF8647"
FT                   /old_locus_tag="DEHA-CDS2053.1"
FT   CDS_pept        484774..486390
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05390g"
FT                   /old_locus_tag="DEHA0F05896g"
FT                   /old_locus_tag="DEHA-IPF8647"
FT                   /old_locus_tag="DEHA-CDS2053.1"
FT                   /product="DEHA2F05390p"
FT                   /note="similar to uniprot|P23796 Saccharomyces cerevisiae
FT                   YMR283C RIT1 Modifies initiator methionine tRNA to
FT                   distinguish it from elongator methionine tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88921"
FT                   /db_xref="GOA:Q6BMH5"
FT                   /db_xref="InterPro:IPR007306"
FT                   /db_xref="InterPro:IPR033421"
FT                   /db_xref="InterPro:IPR033449"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH5"
FT                   /protein_id="CAG88921.2"
FT                   /translation="MDKLTLSHLDINSVTKELRKDSLSIKNRLQSIIYDASFVETTKDK
FT                   FKLPLIPNERCGLWYLPPNEQKDTSYFKSTDGHTGQWSFSLRRLNFHLLPIISAYGGIA
FT                   IIDSTRKGKLMPDALSKTIPIWCAVLNTILYEGDSDKDILDGLGLEKDSTDAKFLLSLK
FT                   NEHNWVSTPKYMVFASERNEISKLIDSFAKEVKKLGLVTKEKLMSHLDGKKKPLIPQWH
FT                   YPGCKNNDEEIVNNDSFFFDHRQESNTERTYFLVQCVTASKKTNVYGGSILTVRNNLTN
FT                   GEIKLTSWYYIQGSADDHELWATKDICNGNLNSGFFWEHIFADNGKRNDDIIDNDTGYI
FT                   YDWISENELVLRMNRTYEKYVKHRALLSNEDLDLDLSHVKTDSNDTGIIFGIIDRNMNY
FT                   NSFITTYKNVSQLVILSELFSISNIPDNPKVTILQYKVESSKKGSKKLREIFPTLIPQI
FT                   NLQNASKNNTIMILCDTGKDISAGLVLVLLCKHFDLDWAPLQCCPKINKDLVKQQVGLL
FT                   LNVRKVNPSRNTLQSVNTFIM"
FT   gene            <486550..>487335
FT                   /locus_tag="DEHA2F05412g"
FT                   /old_locus_tag="DEHA0F05918g"
FT                   /old_locus_tag="DEHA-IPF8646"
FT                   /old_locus_tag="DEHA-CDS4683.1"
FT   CDS_pept        486550..487335
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05412g"
FT                   /old_locus_tag="DEHA0F05918g"
FT                   /old_locus_tag="DEHA-IPF8646"
FT                   /old_locus_tag="DEHA-CDS4683.1"
FT                   /product="DEHA2F05412p"
FT                   /note="similar to uniprot|P38777 Saccharomyces cerevisiae
FT                   YHR049W FSH1 Serine hydrolase that localizes to both the
FT                   nucleus and cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88923"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH3"
FT                   /protein_id="CAG88923.1"
FT                   /translation="MTVTKKILCLPGYLQSGKVFAEKSSGLRKLLTKKLNLQLDYVNPP
FT                   FVIKNKEDLPFILAEEVEDADQKWKSIIDQNCNRCWWQHQDPNVYEGFDESLKFLVEYI
FT                   KTNGPYDGIIGFSQGAAMSAIVTNVISELLPNHKNFQIAVFFSGFAFTEPVDPSKDNKL
FT                   NLNYHIDDINEYKTKVKIINSYERYYNDMHSNTKILNIYGSKDMTVPGIRSQYLSTTFK
FT                   NENLTEYIHEGGHFIPNKKQFLSPIIEDFREIFDIRSNL"
FT   gene            <487462..>489036
FT                   /locus_tag="DEHA2F05434g"
FT                   /old_locus_tag="DEHA0F05940g"
FT                   /old_locus_tag="DEHA-IPF40268"
FT   CDS_pept        487462..489036
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05434g"
FT                   /old_locus_tag="DEHA0F05940g"
FT                   /old_locus_tag="DEHA-IPF40268"
FT                   /product="DEHA2F05434p"
FT                   /note="weakly similar to uniprot|P32783 Saccharomyces
FT                   cerevisiae YBR236C ABD1 Methyltransferase catalyzes the
FT                   transfer of a methyl group from S-adenosylmethionine to the
FT                   GpppN terminus of capped mRNA and similar to CA4342|IPF3629
FT                   Candida albicans IPF3629"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88922"
FT                   /db_xref="GOA:Q6BMH4"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR016899"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMH4"
FT                   /protein_id="CAG88922.2"
FT                   /translation="MSDKEAGVASSLGSNSPINKDEVDVKNTEEHSKQESKSDINKPPL
FT                   KKIKADDGIDISDSFSRRENKGNNKVISSVYNDENKKTPAWMKSKTTDKYDKYGSRSTP
FT                   IATPTAPVNNPDERYSKYMTNSVNSNDRVRRPPTETTSSQYDKKRAHDEAEDDVVAPYS
FT                   NLAVANPSSNLYQTFQSHINNREGKDINSIVRSHYNQRTQQSKFQGSRTKSPIYKLRNF
FT                   NNAIKYILLGNWVKPNPDSNRPTVILDLCCGKGGDLNKCEFVSVDQYIGIDISDASIKE
FT                   AFSRYSRNKARFIPQTAESKKERDTRRYNFEACFATGDCFSSSIPEILEPNFPGIIDGL
FT                   FPVDCVSLQFAMHYAFETEEKVHQLLTNVTKSLRAGGTLIGTIPSSDFIRDKIVNRAFI
FT                   DQENRKFGNDLYSVTFHKDPPDEGVFRPPFGNGYNYSLKDAIDDVPEYVVPFEVFRGLC
FT                   EEYGLVLKYKKNFIDIFNQEIPKYFSKLNKNLIEGMKRSDGKYGAEGLEKEAVGFYIGF
FT                   VFEKLGN"
FT   gene            <489470..>491965
FT                   /locus_tag="DEHA2F05456g"
FT                   /old_locus_tag="DEHA0F05962g"
FT                   /old_locus_tag="DEHA-IPF8643"
FT                   /old_locus_tag="DEHA-CDS0753.1"
FT   CDS_pept        489470..491965
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05456g"
FT                   /old_locus_tag="DEHA0F05962g"
FT                   /old_locus_tag="DEHA-IPF8643"
FT                   /old_locus_tag="DEHA-CDS0753.1"
FT                   /product="DEHA2F05456p"
FT                   /note="weakly similar to uniprot|P47166 Saccharomyces
FT                   cerevisiae YJR134C SGM1 Protein of unknown function
FT                   required for wild-type growth rate on galactose and
FT                   mannose"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88924"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH2"
FT                   /protein_id="CAG88924.2"
FT                   /translation="MAKKNNKKATKKNEVAKKDIDMKKPDTKAVEEGESQETDREESTV
FT                   DETAIEDPIISEDVSNIEPDTEQNNEVGIDHEQDIPAVVVSESNPTDTVVDSEEARQAS
FT                   IATTDTPPKTKKRLTLSERLALAAKGKKQRSSTPTPTSSAAGTPPATGSDEPKNVIIKE
FT                   ENDPLAENKVTIKDEEKVGKTGSESELASDGKYRDELKQLAAEIENLKANNSELSEENK
FT                   QLKSQSSKPGNINKETIQLKEQLASKDETIEQLMKEGQVLSVKELKLNESIKKLKASNN
FT                   DLEQSLNDYSKKNEQVLLKLNEQEDFLKKHKFKSINQLIDDYNDISKKLSQSNDDLEKE
FT                   KQLDWEGKYKEQQRLYETESSERKQSIKKLNELKIQFDMSKKQNSLELESKNTTINDLK
FT                   RSISSIRDENSKEIYRLENKIESLRVENERSPGSLSGNKDYNNCERNDTDTISNPKQID
FT                   YEEFVKLSNNHHSLQQQYLSSQENWKLIESNLLNKIDVLTSSVDSLKKSKSKSMNEIQK
FT                   LQNSLQRKMEEYDQLIEKFDELTNEKEEIVFQNQVKDTDYQELQEKFDKFQQIYNTDRQ
FT                   NLNSKIKQLTESLEKSKNNSNTSLGPFEQTSPNRQNLNGLHLNLEPPKLMKHHSSNSIN
FT                   DASYNNSGWPDIKFGESSTTPAVSREYSAVFMNRSHNNSSASLMDNVDTATELANDNYS
FT                   FNSKYPSHMGNGSISGIIPTSGNNNIQLINKMSSNIRRLEIELSTMKDENTQLSLDKEQ
FT                   AQQEILKQFKLMEEVNSLKKQITTLQTEIDQKSRQEETMLELIGEKSEQVEELRADVQD
FT                   LKDLCKLQVQQMIEIQESK"
FT   gene            <492131..>493921
FT                   /locus_tag="DEHA2F05478g"
FT                   /old_locus_tag="DEHA0F05984g"
FT                   /old_locus_tag="DEHA-IPF8639"
FT                   /old_locus_tag="DEHA-CDS1647.1"
FT   CDS_pept        492131..493921
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05478g"
FT                   /old_locus_tag="DEHA0F05984g"
FT                   /old_locus_tag="DEHA-IPF8639"
FT                   /old_locus_tag="DEHA-CDS1647.1"
FT                   /product="DEHA2F05478p"
FT                   /note="weakly similar to uniprot|P38882 Saccharomyces
FT                   cerevisiae YHR196W UTP9 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88925"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMH1"
FT                   /protein_id="CAG88925.2"
FT                   /translation="MSDLRRCLDDSNLYFTNIISKNGRNEVQIFPINKKASESIILDSL
FT                   IVKIELQADEIVTSCCWINNSGINNSERAKKRGKRRQSSSESDLDEATSDNKNLAVALE
FT                   NGDILILSPLHNDIIDRISYGHKIISLTPSLIHDSVWGVLEESRSIVEISLAQSKEVKN
FT                   FKFKEDEQIQSAKTIRQTGGSSRSQHILIGSNNLYLVDPSKPKKSLLTTFPQISEASPI
FT                   SIIEQSRLKENLVVVVRENENQIYLYNTSDSAKFSTFKTSTSQIYGVQLIANTDMTEEL
FT                   LMAVTSEGVEVFKIDFDSNHQEQIPTCLIKTNFHDSIDNIIFMDVFLREKQSLIGVWYN
FT                   GNEPKFENINWNFNSAGEIQVSIDYNEKVNGVVDNRIDDIEFPETTKINNLAVNKLYKD
FT                   LVKLLNVSKKTTEEKIIRLCSSNNNDDNIKETIKLFSTSESSSALITKLFEIISKEVAS
FT                   QPSKNSALSVWLKWLLLVHGGFIAKQPDQHDNLKTLQTGLTEGMKLMPRLLGLQGRLQL
FT                   LKSQTQLRDNLNNMSIESDDEEDKESTDIMVNNDDSENITIANGESDDFEEADVASFAI
FT                   DAEADDEDEDKDEEEAEEED"
FT   gene            <494150..>494220
FT                   /locus_tag="DEHA2F05500r"
FT                   /old_locus_tag="Deha0F.4"
FT   tRNA            494150..494220
FT                   /locus_tag="DEHA2F05500r"
FT                   /old_locus_tag="Deha0F.4"
FT                   /note="tRNA Gly (CCC) cove score=60.42"
FT   gene            <494390..>497548
FT                   /locus_tag="DEHA2F05522g"
FT                   /old_locus_tag="IPF_8637"
FT   CDS_pept        494390..497548
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05522g"
FT                   /old_locus_tag="IPF_8637"
FT                   /product="DEHA2F05522p"
FT                   /note="similar to uniprot|P46970 Saccharomyces cerevisiae
FT                   YJR132W NMD5 Karyopherin a carrier protein involved in
FT                   nuclear import of proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66281"
FT                   /db_xref="GOA:B5RUA3"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA3"
FT                   /protein_id="CAR66281.1"
FT                   /translation="MDANLLLECFSATLQSDQSVRHQAELQLRQLVLTPGFLGGCLDII
FT                   SSNNPAVSLPIKKAAAVFFKNRVVKYWGSEKQNKIDNDEKPGIRDRILPVLIESDYNTK
FT                   QQLIPVLRVLISYDFPNNWKDLLETTGALLQQVPVGATKDEDFSQLYTGLLCFSEISRK
FT                   FRWVSNSDRERELDAIIVQVFPHLLNIGNSIIANSENMTELTAEILKLILKVYKFVTYF
FT                   DLPVVLQTRESLIAWGEFHGSIVNMNTPTYVLSSTLSEQEKSFLQISKCYKWAVANLYR
FT                   IFTRYASKSLSKKFAYTDFQKMFCDDFIPHLITNFLSIIEQWCSKKRWLSLSCIYYLLQ
FT                   FLSHCVTQKPTWVLIKPYFENLVSHLIYPLLCPSDHVLEIFETDPHEYIHSNFDIYDEF
FT                   DTPDVAALGLLVTFVDKRKKTTLEPIIKFVYNQLTDLQQQPETLEVAKKREGALRLMGG
FT                   ISHYVVIPHSPYYSQMEQFLTALVFPNLSSKFDFLKARTLEVSSKFADLNFENKDNLSV
FT                   LFHGILNNFSTSNEESSLPVDFECALVIQAYIHLPEFQEALSTIILPTMSKLLDLSNQI
FT                   DNDAISAVMQECVENFSEQLQPFGVDLMAKLVEQFMRLAVDINEASKVDVDEFDGEYED
FT                   QTDKIMAAVGLLNTMITVLLSFENSREICAKLEEVFSPVIEFVLINKIDDFLTEVGELM
FT                   ENSTFLSRSISPIMWKNFTYLYQSFTDGIALMYTEELSQCLQNFLIYGQEDLMKSPQLV
FT                   ENFYNIFNIIIESEDAQVGFNDIVLACELAQTFILMLQTQAQAYIPNLVNSVLKISQSM
FT                   QQDEQHVKSSSFNITIQNVIIAAMVHDSNATLMNLQNHHQLVPFFVEWFKTISILKRVY
FT                   DLKLSTLGLISLMDNNEALNLLGNDIVAQIGSKLASIMKTLPKAIENLEHKRKNFSESE
FT                   FTSDQPYDDAWENHNDYDDDDDDVTGAQDLTHEPEASTTEYLDFLQQENVKLKNSGFFD
FT                   EEDLELIEDPLAASPLDSLNVFQIFKQFSQRLHANDNAKYSIIFGSLDVSDQKIFTDIF
FT                   EVVN"
FT   gene            <498821..>500173
FT                   /locus_tag="DEHA2F05544g"
FT                   /old_locus_tag="DEHA0F06050g"
FT                   /old_locus_tag="DEHA-IPF8634"
FT                   /old_locus_tag="DEHA-CDS2731.1"
FT   CDS_pept        498821..500173
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05544g"
FT                   /old_locus_tag="DEHA0F06050g"
FT                   /old_locus_tag="DEHA-IPF8634"
FT                   /old_locus_tag="DEHA-CDS2731.1"
FT                   /product="DEHA2F05544p"
FT                   /note="weakly similar to CA1939|IPF8000 Candida albicans
FT                   IPF8000 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88927"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG9"
FT                   /protein_id="CAG88927.2"
FT                   /translation="MLIKTLLVIALQFVNLTLGLNILMSSKNSWVSKNTRHLYAGLKAE
FT                   GHNVKLIAPLNNNGHITEAGLASENNGASKREQGEQEEKREIVNGGDFGHLLPVHQKYY
FT                   KTIKKLNNLPRGAKNVILKKDLENSDGGSTETVRNNYFGQDPLDESVWYVNASPLESLL
FT                   IAFDVLLPQFEPDFKPDLVVLGPDEGLSLTPSTSSHQPLFHENHPNSDNVLDSMMRLTM
FT                   LKKFPVIGVSTGDDHHIYFQDETFFNIQQNVLSKQLLKKNVFTKNIKFINARVIDLINK
FT                   LTTSEQGILPENVALNVNFPSINHDVSHCTTSWKNKNNNDPTFKQVVYDKKYDHSKHNI
FT                   LPKYELVNDTIHIVGEYRVKIDEDAEQQTFVDKKSYYYSHISRRSSSTDSTTEPSGVSQ
FT                   DYSDNDDINQIMSNIDELNVLKNCGISVSVNHLIKGHGLGKDFFDLESLFN"
FT   gene            <500495..>502165
FT                   /locus_tag="DEHA2F05566g"
FT                   /old_locus_tag="DEHA0F06072g"
FT                   /old_locus_tag="DEHA-IPF8633"
FT                   /old_locus_tag="DEHA-CDS1916.1"
FT   CDS_pept        500495..502165
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05566g"
FT                   /old_locus_tag="DEHA0F06072g"
FT                   /old_locus_tag="DEHA-IPF8633"
FT                   /old_locus_tag="DEHA-CDS1916.1"
FT                   /product="DEHA2F05566p"
FT                   /note="weakly similar to uniprot|P50276 Saccharomyces
FT                   cerevisiae YGR055W MUP1 High affinity methionine permease
FT                   integral membrane protein with 13 putative membrane-
FT                   spanning regions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88928"
FT                   /db_xref="GOA:Q6BMG8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG8"
FT                   /protein_id="CAG88928.2"
FT                   /translation="MAPTLLPKVSIGSSTFSRMPLLERRKYHKLGTLSCMSLIVNKMIG
FT                   TGIFSTPAIIFQYCQGNVGLYLFLWLVGGIIIFSGLVIFLEFALNLPFTNGGEKNYLLR
FT                   VFRKPKGLMGCIYSFQMVLLGFSSGNAFAFGKYVLFAVNGEEIKEEEWSVKIIGVLCIS
FT                   FCIFLHIKFPNQGTSLFNLLGVFKIFILVLIIAIGLLVSVDIIKLPTTVDNFSNLFEST
FT                   TKKDNNYYSISVALLEIIYSFKGWENANYVLSEVSDPYHVLTIAAPSAVVITTILYFLV
FT                   IISYLIVIPKQELLDSGVLVAGIFFNKVFGESITSRILPIIISSSNLGNVMVVSFAHAH
FT                   VNQELARNNYLPFSKYFEDINNSLLLHWFITVIIMVAPPSSEIYEFVVNLYIYPGTWIN
FT                   LLITIGLIYLHLNSRGEKWGKHNTGNGLETNSANNSIYDDNDNLILQLNDDSYTEFDSL
FT                   ISVENDNDTSKFSAPIICIVIFLFSNIFLAVFPFFPPPSDSSSSQSIIPYWCFPVVGTS
FT                   VLLSGVAWFYIRRWFHTWRYDKYKIGEPNVKYEDDYSTN"
FT   gene            <502571..>503641
FT                   /locus_tag="DEHA2F05588g"
FT                   /old_locus_tag="DEHA0F06094g"
FT                   /old_locus_tag="DEHA-IPF8631"
FT                   /old_locus_tag="DEHA-CDS3611.1"
FT   CDS_pept        502571..503641
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05588g"
FT                   /old_locus_tag="DEHA0F06094g"
FT                   /old_locus_tag="DEHA-IPF8631"
FT                   /old_locus_tag="DEHA-CDS3611.1"
FT                   /product="DEHA2F05588p"
FT                   /note="weakly similar to CA0879|IPF19542.5f Candida
FT                   albicans IPF19542.5f unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88929"
FT                   /db_xref="GOA:Q6BMG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG7"
FT                   /protein_id="CAG88929.2"
FT                   /translation="MDESSTSLSSSMSMSSSQPRQLIESNYKLALKFFMNKNFSKSYEI
FT                   IKKLYQNSFGQFASDIISEQLFIKILNLYLTEIGLFIDKANQDTNFNLERNERQEVITT
FT                   LTQDQILDELYKIYNDDINAIPSEILYNLFLIYYINGAIITNAGNLKLKFDKLYYQFDY
FT                   SSRLEDVYLKKLIDLYVFQVLPDNENFDDASSIVSENPIFSSQIEESLSRLSNIRVTKV
FT                   KKQQEEEEKEKEKQQKLNEKKKREQQNQKELKDRQNLTYKSLNQIKQSSGKVDSSKKDD
FT                   GTARESNSGYDIASLRQKVLYSLNFSKNYIKTNSPLILLIILLLFISSRYLKVRKINVM
FT                   ERLKSTLQMAFKISYL"
FT   gene            complement(<503661..>505163)
FT                   /locus_tag="DEHA2F05610g"
FT                   /old_locus_tag="DEHA0F06116g"
FT                   /old_locus_tag="DEHA-IPF8630"
FT                   /old_locus_tag="DEHA-CDS2338.1"
FT   CDS_pept        complement(503661..505163)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05610g"
FT                   /old_locus_tag="DEHA0F06116g"
FT                   /old_locus_tag="DEHA-IPF8630"
FT                   /old_locus_tag="DEHA-CDS2338.1"
FT                   /product="DEHA2F05610p"
FT                   /note="weakly similar to uniprot|P48581 Saccharomyces
FT                   cerevisiae YOR368W RAD17 Checkpoint protein involved in the
FT                   activation of the DNA damage and meiotic pachytene
FT                   checkpoints"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88930"
FT                   /db_xref="GOA:Q6BMG6"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="InterPro:IPR016587"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG6"
FT                   /protein_id="CAG88930.2"
FT                   /translation="MSDESLDFQKSSGTSGNGVSSSPFTFTASTNQVSHLADVFSSITS
FT                   INSQALMIITTNGIIIYSEYNHICNVQLSIDPSLFGTYNFYSENNTSSSQNNEELRLGV
FT                   DISLISDAFIAAASSSVSKSKTKATANNGNTVTANGSVDNQVCYITYNGEGYPLVIEFE
FT                   DSLMSEKIEFLTFYLDMTYPYDVSNSQEEEEEEQYNLVINHSEIQFEVILKSDVFTNLL
FT                   KDLQQINTIDLFMFISNEMRQLGSNRQNSKKSRKSGPLYLDKQFNFISKGPIGHSKLIF
FT                   PNEKTILEKLNIYGMDHDDSEMKPINTSLISCYNFGNFSKIFKAVKLSIKCKIMKDLSG
FT                   ILSIQLLCKNPQLTNYSGTLITFNMLESTTIVDKFDKNEEPEEFERFHLNNIFEDESYE
FT                   YIKDYNDKNPKRVPMPNIESTNIQEYEELGNEKDEPPILSYASFRNNSKSATSNNVQIN
FT                   ETIYEEDKNGNNKKRKKEIESAKDSDKDVKTVGSAIEIPLFL"
FT   gene            complement(<505423..>506481)
FT                   /locus_tag="DEHA2F05632g"
FT                   /old_locus_tag="DEHA0F06138g"
FT                   /old_locus_tag="DEHA-IPF8629"
FT                   /old_locus_tag="DEHA-CDS3654.1"
FT   CDS_pept        complement(505423..506481)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05632g"
FT                   /old_locus_tag="DEHA0F06138g"
FT                   /old_locus_tag="DEHA-IPF8629"
FT                   /old_locus_tag="DEHA-CDS3654.1"
FT                   /product="DEHA2F05632p"
FT                   /note="similar to uniprot|P32366 Saccharomyces cerevisiae
FT                   YLR447c VMA6 H+-ATPase V0 domain 36 KD subunit vacuolar
FT                   singleton"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88931"
FT                   /db_xref="GOA:Q6BMG5"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR016727"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG5"
FT                   /protein_id="CAG88931.1"
FT                   /translation="MEGIFFNVDYGYVEGVVRGYRSGLLGNNQYVNLTQCDNLEDLKLQ
FT                   LSATDYGNFLASHSGPLSTSIMQDNLSKKLFQQFQYLKSQASGKLIRFLDFISYGYMID
FT                   NVSLMITGTLHERDRSEILSKCHPLGWFDTLPTLSIATDIESLYNTVLIDTPLAPFFKD
FT                   CLTADDLDDLNIEIIRNRLYKNYLEAFVNFIEDEFTSPDKEIMTNLLNFEADKRVINIS
FT                   LNSLNNPDLTAENKLSLFPSYGRLYPTYHSKLSEIDDVEQLKAIVDSIGEYKDLFSEAP
FT                   DSNSGGSKNLEDWFYLLEMQYCKNAFTQQFTLSTIWAWLRSKEQEIRNITWIAECIAQN
FT                   QKNRIDNYISVY"
FT   gene            <506695..>508020
FT                   /locus_tag="DEHA2F05654g"
FT                   /old_locus_tag="DEHA0F06160g"
FT                   /old_locus_tag="DEHA-IPF8628"
FT                   /old_locus_tag="DEHA-CDS2813.1"
FT   CDS_pept        506695..508020
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05654g"
FT                   /old_locus_tag="DEHA0F06160g"
FT                   /old_locus_tag="DEHA-IPF8628"
FT                   /old_locus_tag="DEHA-CDS2813.1"
FT                   /product="DEHA2F05654p"
FT                   /note="some similarities with uniprot|Q04632 Saccharomyces
FT                   cerevisiae YML071C COG8 Component of the conserved
FT                   oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
FT                   tethering complex that functions in protein trafficking to
FT                   mediate fusion of transport vesicles to Golgi compartments
FT                   and similar to CA0131|IPF13402 Candida albicans IPF13402
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88932"
FT                   /db_xref="GOA:Q6BMG4"
FT                   /db_xref="InterPro:IPR007255"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG4"
FT                   /protein_id="CAG88932.2"
FT                   /translation="MSGILLDTLSEDLDPTLAEFLKSNSELRQISEQYLVDLLINDDLL
FT                   CTDTYTTTSKSSNTDVSNVEGQPRTLTEEIAELDSQQREIKMQLASITNNNRDLIIDIS
FT                   KDLTSIREDVNSGFDKEINSMIKILDMENSNGEKFEIPENERLNNTMITYNSILSNIDS
FT                   VLDLLELPTLCKVCILQGNYQESLEISILVQTLVIRFPNLKIFQNIHYQVEQELKLMVK
FT                   GLIKLLNTNLKQNNILKIFQILNKLDLLNYNTSSAISSSVNVTSNKKLQKDKFLKIVYL
FT                   NARFKFIINELSNLTPLLKFNKLTYLKRYIEIYREFIFNSLSIYHAIFNFSPASNDIDI
FT                   KHEEDNLLISQFIKNLASLLAEELKKYLPELIAPSEKDDNIDKQTQKDGLILQIIYLCQ
FT                   SLAKYNVDFESLITWELCYRNNSILSEEDWLKNMAKVKKFRA"
FT   gene            complement(<508137..>511622)
FT                   /locus_tag="DEHA2F05676g"
FT                   /old_locus_tag="DEHA0F06182g"
FT                   /old_locus_tag="DEHA-IPF8626"
FT                   /old_locus_tag="DEHA-CDS0269.1"
FT   CDS_pept        complement(508137..511622)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05676g"
FT                   /old_locus_tag="DEHA0F06182g"
FT                   /old_locus_tag="DEHA-IPF8626"
FT                   /old_locus_tag="DEHA-CDS0269.1"
FT                   /product="DEHA2F05676p"
FT                   /note="some similarities with uniprot|Q08562 Saccharomyces
FT                   cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
FT                   DNA-dependent ATPases plays a role in antagonizing
FT                   silencing during mating-type switching contains an N-
FT                   terminal domain that interacts with Sir4p and a C-terminal
FT                   SNF2 domain and similar to CA4382|IPF8576 Candida albicans
FT                   IPF8576"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88933"
FT                   /db_xref="GOA:Q6BMG3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG3"
FT                   /protein_id="CAG88933.2"
FT                   /translation="MASDEPSQNIINLSSDDDEEVDENVSLKDIQINGHEIHERGNNQD
FT                   WRQANSNSNTTHINQPPKRQRLDSLYSNNGPFRSPSKQGNDLSHIGNSNHIQQRQLYPK
FT                   TLPNAVLDRTVFGPRSVSSNTTIQNHPRQSEPQSIPKNNLIQNQYMQADPQSIPNNNTI
FT                   QYQSRQADPQEDVIILSSEDEDMDSDGDIMILDAEEASRIGKFKTSSFERNANRSSRDM
FT                   GNYEAPANTGPYYSVPAVNPNEMHVTYNNPAPVPHFTKDDGPEVEKLNFQRAQETLEEN
FT                   VRRKDELLYKHEQLTSDFTKSSRQANELLQHLTLLQSHLKREEIQENRDENTILSLKNE
FT                   ISFKGAEYHNFRRSKDATATSLSGIASKLSWLTVSIRDAKSRIHNYGKHRNGVNIIDNP
FT                   FVLNNNSGRNNSDYENESIMNNPFGNIPGFSANVYSDNDQQHLQNLLNNIRPDEELDEE
FT                   GLSLTPSELAITLLKHQRMGLAWLLRMEESKSKGGILADDMGLGKTVQTIALIMAHKSD
FT                   DDNRKTNLVIAPVSLLRQWAAEIESKIKPNAQIKIAIYHGSVKKNLRTFNSLKKYDVVL
FT                   TSYGTLSSEWKKHYQGPLEEARLSRNQNVIPDLDAGGTSYTSPFFATDAVFYRIILDEA
FT                   QNIKNKSAIASKASYCIKGIHRFCLSGTPIQNNVEELYPILRFLRIKPYNDESKFRSDI
FT                   VLPIRSKSSGYDDFDKKKSMQKLRALLRAILLRRSKNSLIDGKPILSLPDKLVTEDTVQ
FT                   MEDEELTYYRELEQGIQKKAKTLLASEKLGSTSSILTLLLRLRQACCHSFLVEMGRMKA
FT                   AESEATKTLITRDWKSMYVNIQKFDEDTINRIRNEVHQGNLLKGENEGESNTNSDEDLF
FT                   TCPICYDVLGYESIVLFSGCGHMICNNCIENFFERFETGDGSEGNRLASCFSCSKSIKE
FT                   NELIDYNMFHMIHQEGYDRDKIAEFYNINYSSNGKTTNMQKIRQLIQENKGFTPSAKME
FT                   KCMHLIKDVLENYPDEKIIIFSQFLSLFDLMKLVLANEKIPFLRYDGSMSLDEKNSTIK
FT                   QFYQGSTKVLLISLRAGNVGLTLTCASHVIIMDPFWNPYVEEQAMDRAHRIGQQRDVRV
FT                   HRILTEGSVEGRIMTLQNEKKEIISGALDEKGMKSVSKLGRQELGFLFGLNELR"
FT   gene            complement(<511862..>512467)
FT                   /locus_tag="DEHA2F05698g"
FT                   /old_locus_tag="DEHA0F06204g"
FT                   /old_locus_tag="DEHA-IPF8624"
FT                   /old_locus_tag="DEHA-CDS5349.1"
FT   CDS_pept        complement(511862..512467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05698g"
FT                   /old_locus_tag="DEHA0F06204g"
FT                   /old_locus_tag="DEHA-IPF8624"
FT                   /old_locus_tag="DEHA-CDS5349.1"
FT                   /product="DEHA2F05698p"
FT                   /note="similar to uniprot|P39742 Saccharomyces cerevisiae
FT                   YLR292C SEC72 Non-essential subunit of Sec63 complex
FT                   (Sec63p Sec62p Sec66p and Sec72p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88934"
FT                   /db_xref="GOA:Q6BMG2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG2"
FT                   /protein_id="CAG88934.1"
FT                   /translation="MNVALGYDAKTKKISLPDEAEKLVPSLKLEVDQLNTLTSELIANG
FT                   ADVPAPPTQENFNKDMTKMIRKLYEGGVQAFKQGKFQESAKQFTIGIDMICRRHKFEAF
FT                   QGTLQELSLFLMSRADAYLKTKNYLGAFNDADMLLGMMMCTPDNFLRRGVANYFLGNYE
FT                   AARADYQRGLAFDEDNERLVTELEICLDKILEENGDYL"
FT   gene            <512838..>514199
FT                   /locus_tag="DEHA2F05720g"
FT                   /old_locus_tag="DEHA0F06226g"
FT                   /old_locus_tag="DEHA-IPF8623"
FT                   /old_locus_tag="DEHA-CDS2705.1"
FT   CDS_pept        512838..514199
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05720g"
FT                   /old_locus_tag="DEHA0F06226g"
FT                   /old_locus_tag="DEHA-IPF8623"
FT                   /old_locus_tag="DEHA-CDS2705.1"
FT                   /product="DEHA2F05720p"
FT                   /note="some similarities with uniprot|Q869X8 Dictyostelium
FT                   discoideum"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88935"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG1"
FT                   /protein_id="CAG88935.2"
FT                   /translation="MNLEQKDIVVNDINFSSYGKDEDQQQDAKTAEGDSEQTEYKTVPS
FT                   SITHKFKPKKRRMGNLILKSNCLVTDENQDGNARGSDAEYEYTNRTIGKTVSGILSKFF
FT                   HSRRPDSFGETSEEPGNPEYPNLRSHDDLGESKTTRNKLSRVFETYRKRNGLQGQPKDE
FT                   GYYKSNSEGEKSFNRFLKLEQALDAKRDEKNSRSMNDETERVSYTSKDLSLGSTVLNNS
FT                   QEIYTENGSFVHPGSKGKIDTKFIINDSPKTESAALENTVFSPNSHRPSLRDIPGIENI
FT                   EVSTSDQNTWKQSYSTFRMAFKIKPVKNILNDKSLKPQNSQFKSLDDEIDSHLYYQSRT
FT                   NLLSKCFPNKNHINQNSKRESQNENIDFAPEMEEPDKLIPSIPTSPNSLSDNFTAIKGI
FT                   LQQKYKSSFSRDKSKRQNLSVKFVSPTLSPIEMTNNEMNDNGHNNTEIISQTTS"
FT   gene            <514594..>515805
FT                   /locus_tag="DEHA2F05742g"
FT                   /old_locus_tag="DEHA0F06248g"
FT                   /old_locus_tag="DEHA-IPF8621"
FT                   /old_locus_tag="DEHA-CDS3153.1"
FT   CDS_pept        514594..515805
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05742g"
FT                   /old_locus_tag="DEHA0F06248g"
FT                   /old_locus_tag="DEHA-IPF8621"
FT                   /old_locus_tag="DEHA-CDS3153.1"
FT                   /product="DEHA2F05742p"
FT                   /note="similar to uniprot|P07172 Saccharomyces cerevisiae
FT                   YIL116W HIS5 Histidinol-phosphate aminotransferase
FT                   catalyzes the seventh step in histidine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88936"
FT                   /db_xref="GOA:Q6BMG0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMG0"
FT                   /protein_id="CAG88936.1"
FT                   /translation="MFELKSLVRPNILTLEPYRCARDDFKTGILLDANENTHGPALKDV
FT                   SNEEETLELNRYPDPHQIDLKEQIIAFRNEKPNKFLKDYNQDKLTPENLCLGVGSDESI
FT                   DLLLRCVCVPGKDKLLICPPTYGMYSICATVNDVALTKVPLEYPSFQVDIDGILNKVTK
FT                   DSSIKLAYLTSPGNPTGKLLKVSDIVQLVESAASKWNGLIVVDEAYIDFTTSEADTASE
FT                   SMTTLVNQYPNLVVLQTLSKSFGLAGIRLGITFANPELSKYLNAMKYPYNISSLTANIA
FT                   LRATSIDSGLKIMSKYVLSIITQRNLLMDGLQKIDGVGRSIGGLDSNFVLVEILDKNKE
FT                   PSNETAKALYNKLAVSNEVVVRFRGNELNCTGALRISVGTADENKILLEKLQKCLQEVY
FT                   NESS"
FT   gene            <516020..>516754
FT                   /locus_tag="DEHA2F05764g"
FT                   /old_locus_tag="DEHA0F06270g"
FT                   /old_locus_tag="DEHA-IPF8619"
FT                   /old_locus_tag="DEHA-CDS4881.1"
FT   CDS_pept        516020..516754
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05764g"
FT                   /old_locus_tag="DEHA0F06270g"
FT                   /old_locus_tag="DEHA-IPF8619"
FT                   /old_locus_tag="DEHA-CDS4881.1"
FT                   /product="DEHA2F05764p"
FT                   /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
FT                   YMR188C MRPS17 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88937"
FT                   /db_xref="GOA:Q6BMF9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF9"
FT                   /protein_id="CAG88937.2"
FT                   /translation="MAKQNFIGLVISQGKMSKTVKVRVQTKAYDTKVHKEVIKRKDYLV
FT                   HDEGNLCKEGDIVRIQAIPKISARKYFAIADIKINKGQQFALYESLAKEKVAKEATEKI
FT                   EQFLERRKEYENTIVQVEDLKTLDKLSNTFQSDPSADREFLLSEINAIKEKYNIKSWPS
FT                   TEPVLKLEVNEAAKDLTILQNRVDNIKIILEKLMSEEYASHRQQILSDLSKTPVEELKP
FT                   FTQKNILRKFILDPRNECPVTL"
FT   gene            <517232..>518632
FT                   /locus_tag="DEHA2F05786g"
FT                   /old_locus_tag="DEHA0F06292g"
FT                   /old_locus_tag="DEHA-IPF8618"
FT                   /old_locus_tag="DEHA-CDS2602.1"
FT   CDS_pept        517232..518632
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05786g"
FT                   /old_locus_tag="DEHA0F06292g"
FT                   /old_locus_tag="DEHA-IPF8618"
FT                   /old_locus_tag="DEHA-CDS2602.1"
FT                   /product="DEHA2F05786p"
FT                   /note="similar to uniprot|P31381 Saccharomyces cerevisiae
FT                   YAL022C FUN26 Nucleoside transporter with broad nucleoside
FT                   selectivity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88938"
FT                   /db_xref="GOA:Q6BMF8"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF8"
FT                   /protein_id="CAG88938.2"
FT                   /translation="MVSNSPRYSEESARPEHHAMYDPTVFQINRRFRIKLSQLKYFTFT
FT                   IIGIALLWPWNCFLSASAFYSERFEHSPQLVRIYSSTMMSVSTITSALYNYYLSQVQVG
FT                   VNYNHRVNVGFSMTIGVFIIMAFSCVLNVFITMDDYLFFTGLMIMVFISAAATCLAQNG
FT                   TMATVNVMGSLYANGVMVGQAIAGVLPSSALIISILIVGDKKADADKENQYMDKNYGVF
FT                   IYYITASLIAVLSISLLYFTNHYKIESTYKTLNHMVEEQQPLNSSDDDSEGEPEVTQKK
FT                   YVPFMVLWSKLKLIVSTIFLTFGITLIFPVFASTVESVHKDSDHTLLQRKIFIPFIYLV
FT                   WNLGDFLGRVCCGKPRLAVLIKNPKVLLMYSIARLIFIPLFLTCNVNSASSGKSNAIIN
FT                   SDTWYIMLQFLFGLSNGQLCTSCFMIVGNNCDTDDEKEAAGGFTTVFLSVGLAFGSVFS
FT                   YLLVLMIN"
FT   gene            <518768..>521551
FT                   /locus_tag="DEHA2F05808g"
FT                   /old_locus_tag="DEHA0F06314g"
FT                   /old_locus_tag="DEHA-IPF8616"
FT                   /old_locus_tag="DEHA-CDS0555.1"
FT   CDS_pept        518768..521551
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05808g"
FT                   /old_locus_tag="DEHA0F06314g"
FT                   /old_locus_tag="DEHA-IPF8616"
FT                   /old_locus_tag="DEHA-CDS0555.1"
FT                   /product="DEHA2F05808p"
FT                   /note="weakly similar to CA3733|IPF11897 Candida albicans
FT                   IPF11897"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88939"
FT                   /db_xref="GOA:Q6BMF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMF7"
FT                   /protein_id="CAG88939.2"
FT                   /translation="MSFWDNNKDTFLAAGKATAKGIGTGTKALGKAGYRTYKNSQGERR
FT                   GVPDNEADKAERSSYETRNNTNTSAYSGAYSGSNTGSNTGSNSGTSYYQSQPRHVDVNA
FT                   YPLPPKRVAGPGEVRPLGHQDQGQQHQQMQQPQQHYSQNAQYSQAPYQPQQPQYPQQPQ
FT                   QPQYPQQPYSQDTQYSQAPYHPQQQIQPQPLTEGERPIPTPPTQAGTQPQFQPQLQQYQ
FT                   NGHIQQSHPAETQQPTYQVEQQQQSYSTEPQQQLQQPIFQPQPQSQDPYQQSPEANDSN
FT                   QRPPAYDDSQLQNTQQEPTQVDSEPVKKSLPDPSSFAPPPIHKNRGVSEPSDSASYKKT
FT                   GVSGKPSHVGKHGTSTTPKPTTLDMDPSKIGQPPPKPYRENSETTLNSASSNVRQTPPL
FT                   PTRQSSNTTQNQLQTTSTPVPPPRSNTASVNSTSSQASSLPAPLPLPDNTGSEGSQKKA
FT                   PPPKPIKKPMQLTSDGSSRNAEPDTLKQEPKNYMPNFAEEIALRKNTNSSLSGKGNLNS
FT                   EDFNSELNSKLEPVNFENHAKPEPSDATPSLVKPKPKVMPKPKIGPKPSISPKPETKGK
FT                   PIIKSKSEIKAKPDLKPKPIIGTKPVTVFGSKKIGNDMPISDSPSNLHVNKSNTPPPPI
FT                   PRPRSAASNTSTPPPPPPSRNYRRAKAAAPPIESGPPNLDLQLSTGWFATTSGPMVLPK
FT                   DLSGLNYNTSYSYVTRGSDKSHTRNINLRLRDLAIISYAITWSNDNINNAKMEVTKFIP
FT                   SPISNKIPTVDELVANQNRFGEYVASWSENKMGQKVGTGECWDLARDALLKGCGKHAFV
FT                   STYYHHGYPIISLQGSENGVSYVDGKSPLDELRRGDILQYTSCIFKDKIRGSVSTVGNP
FT                   DHTSVVLENTGDKLIIAEQNINNLKIVKKTEICLQNLTQGIVVGYRPMPAGWGGNL"
FT   gene            <521698..>523464
FT                   /locus_tag="DEHA2F05830g"
FT                   /old_locus_tag="DEHA0F06336g"
FT                   /old_locus_tag="DEHA-IPF8611"
FT                   /old_locus_tag="DEHA-CDS1702.1"
FT   CDS_pept        521698..523464
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05830g"
FT                   /old_locus_tag="DEHA0F06336g"
FT                   /old_locus_tag="DEHA-IPF8611"
FT                   /old_locus_tag="DEHA-CDS1702.1"
FT                   /product="DEHA2F05830p"
FT                   /note="similar to uniprot|P32461 Saccharomyces cerevisiae
FT                   YKL191W DPH2 Protein required along with Dph1p Kti11p Jjj3p
FT                   and Dph5p for synthesis of diphthamide which is a modified
FT                   histidine residue of translation elongation factor 2 (Eft1p
FT                   or Eft2p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88940"
FT                   /db_xref="GOA:Q6BMF6"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMF6"
FT                   /protein_id="CAG88940.2"
FT                   /translation="MTTEGLVVPALSTQQDDSTFEFDKVCSKTVVRSHLGLPNDATDDQ
FT                   VIKRIREYYNISEICNFLKQKVEGHELDMIPKYKHVTLQFPDSLICDSASIVHELQREL
FT                   GLMPRTEDSSEVKCSADSCCKTGKVESPLSQKLWILADTSYSSCCIDEVAAGHVNSDLV
FT                   IHFGDACLNVVESLPAAYVFGKPSLKLDSVITQFKEIYANRDSKILIMADAPHTQSLNQ
FT                   LYNILKPEYPNLAYADLYLNPSSNASIIGYDPCPSQSSILNVLNRTIIGLDNGDIDTDI
FT                   DTILLEHDLFHIEVPAVPRLLQLTTRFQSVTTFEPKSGLASQGPYPKLMRRYRYMHMAR
FT                   SAGTVGLLVNTLSLANTKTLINKIGQKIKEAGKKHYVFVVGKPNVAKLANFENIDIWCV
FT                   LGCDHQGIIIDENNEYYKPIVTPYELLLALNKDQNWSGKWVTDFNKVLEDMSLEDERNK
FT                   QEINDGSDNNEEDSDDEAPEFNPVTGQYVSTSKPLRKLHHLQISSQEQHPELDNEGSQD
FT                   LVKKFSSAVAIKDTVSTSAMHLQTRHWTGLGSDFQQNDSDEEANNEDGALVEDGRAGIA
FT                   RGYDYDRETKFQ"
FT   gene            <523569..>524736
FT                   /locus_tag="DEHA2F05852g"
FT                   /old_locus_tag="DEHA0F06358g"
FT   CDS_pept        join(523569..523744,523800..524736)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05852g"
FT                   /old_locus_tag="DEHA0F06358g"
FT                   /product="DEHA2F05852p"
FT                   /note="similar to uniprot|Q06417 Saccharomyces cerevisiae
FT                   YLR426W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88941"
FT                   /db_xref="GOA:Q6BMF5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF5"
FT                   /protein_id="CAG88941.2"
FT                   /translation="MRLSSSQFISSIMRLSKSEKLKLECLNHEIVSCNMNLDKFIIGLW
FT                   RSAKYFLAIVLFLSIFDGFHWKYNVTTILLGFCICLHGFSKKYKILPIFKAIDEMDIAL
FT                   ITGGSRGLGLEIAKELILQKKIGKVIILDIISPEFQFIDKDLSKIEYHKCDVGNRRELQ
FT                   FVIEKVIENLNNQKKNISICINNAGIRHNESLLSLSQEKIDSIFNVNTMSHILVLKAIL
FT                   KNHVEEVIPRELTNNNLFIVSVSSILGTLAPKNLSIYSASKAAIIQIHEALTQEVSHLP
FT                   MIRLLLVTTGQLTTSMFGDVIPPMKFLAPVVNHIDLAKDVVCKIEKGEKGVLCAPLYAN
FT                   FLPIVKCLPIFMQDYCRWFSGIDTQIKENQ"
FT   gene            complement(<524789..>525392)
FT                   /locus_tag="DEHA2F05874g"
FT   CDS_pept        complement(join(524789..525284,525364..525392))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05874g"
FT                   /product="DEHA2F05874p"
FT                   /note="weakly similar to uniprot|Q04969 Saccharomyces
FT                   cerevisiae YML055W SPC2 Subunit of signal peptidase complex
FT                   (Spc1p Spc2p Spc3p Sec11p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66282"
FT                   /db_xref="GOA:B5RUA4"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA4"
FT                   /protein_id="CAR66282.1"
FT                   /translation="MSAIKKTNLNSIVQLRATCDDNLHASLSELGYTQSFSLIDTKLAL
FT                   GYSTVVIAGLLYVVDKKFGFEKTYNVTVLSVILYFLISGILFYLTSTKKYKNVKYIGYD
FT                   DSNKKISVATWTNKYDPIYHLKIRFNDEESLAIVTSFEFMKVFDAFGYYKQDELTRLLK
FT                   NELDKINKKSN"
FT   gene            complement(<525541..>527517)
FT                   /locus_tag="DEHA2F05896g"
FT                   /old_locus_tag="IPF_8607"
FT   CDS_pept        complement(525541..527517)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05896g"
FT                   /old_locus_tag="IPF_8607"
FT                   /product="DEHA2F05896p"
FT                   /note="similar to uniprot|Q06436 Saccharomyces cerevisiae
FT                   YLR427W MAG2 DNA-3-methyladenine glycosidase II that
FT                   catalyzes of the hydrolysis of alkylated DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66283"
FT                   /db_xref="GOA:B5RUA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR039739"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA5"
FT                   /protein_id="CAR66283.1"
FT                   /translation="MSINNKDSIMSLTPKNDSNVPNRGYASDKSKETTSKKKSQQNKPK
FT                   PNQKVKYSKEFGTLNDDFSQKIENQIKSGKPVNGTNRKNQISINHLLEFQSYKDSKEYQ
FT                   SRHLKSKRRNSNNSSRPANSHGHKSKDYFYSKVHLKGMSFINVNYKFVVDYRNDYKAQQ
FT                   LDPNVPIDTKDILRIVVPKGNSCPICLSDEPLAPRMITSCGHILCLTCLLSLLESEVPV
FT                   FKKRENTAVVEKYRDCPLCFSVIRKNEIKPVLIDNIDERFEVPKVNDEVVLSLMVRPHD
FT                   KVLALPSSHKEYHEVIDSFPWVNQSISDMPDFGQFSRIFKGDLHYLLNMYESEKQTILA
FT                   AYEEEKLLYNDDGKFTNLAIKNIDEDIAKWKAYYEDIEGKSSKYAGDHRSKNKDLDSSN
FT                   SYFYYQTGFNASSTYVLSPLDMKVLKTNNNNNYTYLPSSIVAKIENIRYEELAPESSIT
FT                   KYKYLSHLPLGTTIGFLECNWSQNEFISPETWQMYKNDLLKRTKNSSKKFRKEEKDRKR
FT                   AMNEEEIKTRNFFERENNGSSESNDYYDSQIERGNFGSLSIIDHRELPPLSSENVLEPS
FT                   HNNEISSDSSVGEYQTTIWGTKIPKAEIMNGDSDSDDWDATEMIRKAKEEINRQETDKG
FT                   KGKGKQKKKKKLVLLSSNSNWQM"
FT   gene            <527847..>530363
FT                   /locus_tag="DEHA2F05918g"
FT                   /old_locus_tag="DEHA0F06446g"
FT                   /old_locus_tag="DEHA-IPF8605"
FT                   /old_locus_tag="DEHA-CDS0734.1"
FT   CDS_pept        527847..530363
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05918g"
FT                   /old_locus_tag="DEHA0F06446g"
FT                   /old_locus_tag="DEHA-IPF8605"
FT                   /old_locus_tag="DEHA-CDS0734.1"
FT                   /product="DEHA2F05918p"
FT                   /note="similar to uniprot|Q08919 Saccharomyces cerevisiae
FT                   YPL176C Hypothetical ORF AND uniprot|Q08693 Saccharomyces
FT                   cerevisiae YOR256c Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88945"
FT                   /db_xref="GOA:Q6BMF3"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF3"
FT                   /protein_id="CAG88945.2"
FT                   /translation="MSENHQSYERVSSNETDIPRQPPNYDDLESNLVDRTDNGIEQFEI
FT                   EDEDFEQPRENDGFMVRASFMTKKFASNFSARVMHPVSKMIDPIYEGYSHFNLLYEKSI
FT                   LKLGNPLVVKRLLYVFFIMIVIFLITKYNISDGVNGVSGGAFSSGKFYDIDMLANSARD
FT                   YIDAKVMKENLEYLSSMPHIAGSKGDLTLSKYVQSYMKENGIKMVDFEELQSFTNYPAF
FT                   DKKKTYVKLADDSYEATLYEQDKKDMEYLSYNPNSLNTNDEYESFYIYGNFGTQEDLKN
FT                   LRDHNVNLQDSILLIKYGGSIPDANKIQIAQQQGVKAVIFISSKFDIGTGDNKVTHDDV
FT                   IQKENVGVSRFSPGDVLTPGWSSEDGYVTRLPWFKSQTTPKIPTIPISWKDASHFISQL
FT                   GENGVKFDDGLYSGSKSSEAKHKIKLRITHDQRQTNQIWNIIGSIPGREQVEKGIIIGA
FT                   SRDSTCFGTMSTNTGTVILLELIKIFSALQRQYNWSPARSIYFASFDASEYNLAGSTEW
FT                   IESRKETLKKEGYAYIDLSDAVAGDDLSIKSHPFLHSVIKDALKKVKSDKDDSKHRRDD
FT                   NRISLYDLYTQQNKGSDDISNNLIDQKNYIPIINLANIPSLEIKFTGLNYPENSCYDNF
FT                   DNFEKSGVDSSMSKHKQLVELLSKIALTLAEVPIIPYNFANMASKLVSYSDDLENYANA
FT                   KINQYEKQVVPIMHFTTLRNSIDRLKTSGVRFEEWCKAWKQFVKESSDIEPSLLAMNRW
FT                   KWNDNMIELNEKFIVKYVKPPRPGYVNVLFGVPFSAPDNGNEDYEWNTFPSVRDYLEVN
FT                   DFGRAQHEIDQLANLIDSAAQQFLLL"
FT   gene            <530566..>530655
FT                   /locus_tag="DEHA2F05940r"
FT                   /old_locus_tag="Deha0F.5"
FT   tRNA            join(530566..530604,530619..530655)
FT                   /locus_tag="DEHA2F05940r"
FT                   /old_locus_tag="Deha0F.5"
FT                   /note="tRNA Tyr (GTA) cove"
FT   gene            complement(<530711..>531496)
FT                   /locus_tag="DEHA2F05962g"
FT                   /old_locus_tag="DEHA0F06512g"
FT                   /old_locus_tag="DEHA-IPF8604"
FT                   /old_locus_tag="DEHA-CDS4682.1"
FT   CDS_pept        complement(530711..531496)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05962g"
FT                   /old_locus_tag="DEHA0F06512g"
FT                   /old_locus_tag="DEHA-IPF8604"
FT                   /old_locus_tag="DEHA-CDS4682.1"
FT                   /product="DEHA2F05962p"
FT                   /note="similar to uniprot|P32656 Saccharomyces cerevisiae
FT                   YER163C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88946"
FT                   /db_xref="GOA:Q6BMF2"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF2"
FT                   /protein_id="CAG88946.1"
FT                   /translation="MTNNEIPKPSGEGMWVIGYGSLIFKPLPYYQFKVSGYLKGFIRRF
FT                   WQSSSDHRGTPEAPGRVVTLVSLDDLKKNRKFHNDIHMYEAGDKYQETDLLSRTNSSAD
FT                   LGKEDIHDITHNISKLEEDDLKVWGCAYYVGPDDVAKVKDYLDIREKNGYTTHKVPFHV
FT                   LNVCDDSENAKEVMQNIPKNKNGDYIIESLIYIGTTDNVSFVGPEDIEKTGEKIRTSRG
FT                   PSGENSEYLIELCKAVRHLDDEGRSRDYYLEDLVKFVEL"
FT   gene            <531932..>534862
FT                   /locus_tag="DEHA2F05984g"
FT   CDS_pept        join(531932..531952,532061..534862)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05984g"
FT                   /product="DEHA2F05984p"
FT                   /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
FT                   YLR138W NHA1 Na /H antiporter involved in sodium and
FT                   potassium efflux through the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88947"
FT                   /db_xref="GOA:Q6BMF1"
FT                   /db_xref="InterPro:IPR004712"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF1"
FT                   /protein_id="CAG88947.1"
FT                   /translation="MTWSQLELEKAHIAYACIGIFSTIFSLVSLFVKERLYIGEATVAT
FT                   IAGLILGPHCLGWFEPVTWGNSDYITLEICRIVLCIQIVAVAVELPRKYMKKHWLSVAI
FT                   FLLPVMTCGWLVVGLFIWVLIPHFNFSSALLVSACVTATDPVLAAAVVGKGKFAERVPG
FT                   HLRNVLSAESGCNDGMAFPFIFLSLNIILHPGNAGEIVKDWFLLTILWECFFGVALGVI
FT                   LGLLMRYAVAFAEKKGLIDRESFLAVFVFLAFNSAGIGSMLGVDDLLVSFAAGTAFGWN
FT                   GDFAKKTEESHVSTVIDLILNLSFFVYFGAIVPWPEFNNAAIGLNVWRLIILALVIIFL
FT                   RRMPAVLILKPFTPDIKSWREALFCGHFGPIGVGAIFAAILARKDLEAHFTSEETPLAL
FT                   LPENNFPHYQLLACIWPIVCFIVITSIIVHGSSVAVLTLGKRLNRMAITMSFTTTNTQD
FT                   QGPSWMSRLQKLDKASTSFSLHRIDTQAPSTEKGHKLQQSNTVETSGIKVRPAGGAKRR
FT                   KHKKKRDPRSRLKKSLSRASADSEADEIVPSQRHKPQAEFLQLGRTPSTAIRTPSDEES
FT                   EPESAVGIDNSKEDFDDSPGSSNSIEVVANEDQGRMVFAVPPYDSHGRVEQDEDQDNGK
FT                   VSFARNAMEGRKSVPSTAFQEGEKIIIEDQAGEIIETLPLKSLQGQPENEDDLSIHSMN
FT                   SLSRQLSKYSTAQSDRTSTETSLNTKEKPNSPLGKLARSSSLSLGRKGKRKGYYKKNDP
FT                   KHRKVFAHQVDNFIVIENADGDIIRRYKVNRHTANRARSNTGNSMVGKALNFVGLKKNN
FT                   PKNNVDANDLEKNDIENILIPEHDDTNNPNHPLKNPKFENAIESKLTKILLDDRSKSSN
FT                   FLSVGNKSETIQEDSERGVSDDDYDTSSGSEETDEDEDQVLEETDIEKKRRLAALGQMP
FT                   THRRKEDEED"
FT   gene            complement(<535042..>536349)
FT                   /locus_tag="DEHA2F06006g"
FT                   /old_locus_tag="DEHA0F06556g"
FT                   /old_locus_tag="DEHA-IPF8601"
FT                   /old_locus_tag="DEHA-CDS2869.1"
FT   CDS_pept        complement(535042..536349)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06006g"
FT                   /old_locus_tag="DEHA0F06556g"
FT                   /old_locus_tag="DEHA-IPF8601"
FT                   /old_locus_tag="DEHA-CDS2869.1"
FT                   /product="DEHA2F06006p"
FT                   /note="similar to uniprot|P07991 Saccharomyces cerevisiae
FT                   YLR438W CAR2 L-ornithine transaminase (OTAse) catalyzes the
FT                   second step of arginine degradation expression is
FT                   dually-regulated by allophanate induction and a specific
FT                   arginine induction process"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88948"
FT                   /db_xref="GOA:Q6BMF0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034758"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF0"
FT                   /protein_id="CAG88948.2"
FT                   /translation="MTSPNFNISSELAVKYETDYSAHNYHPLPVVFTKAKGAHVWDPEG
FT                   KEYLDFLSAYSAVNQGHCHPKIVEALVDQASKLTLCSRAFSSDVFGVFAKYITEYFDYE
FT                   MVLPMNTGAEAVETGLKLARRWGYVEKGIPEDEAVILSAVNNFHGRTLGVISMSTDPEA
FT                   TSKFGPYLQGVGPQIPGEPKGTLLRYGEIEDVEKAFNNAGDKIAAILLEPIQGEAGIVV
FT                   PPEGYLTKVQALCKKHNVLLICDEIQTGVARTGKMLCYEHSANVKPDVILLGKAISGGV
FT                   MPVSAVLSSKKIMLCLEPGSHGSTYGGNPLACRVATAALQVVKDENLVDRSNKLGELLR
FT                   SKLEELKAKSNGVISEVRGKGLLCAIVIDDSKTNGRTAWDLCLLMKDHGVLAKPTHDHI
FT                   IRLAPPLVISEADLLKGVDSIEKSLSELNDAPKAAH"
FT   gene            <536753..>537337
FT                   /locus_tag="DEHA2F06028g"
FT                   /old_locus_tag="DEHA0F06578g"
FT                   /old_locus_tag="DEHA-IPF8600"
FT                   /old_locus_tag="DEHA-CDS5424.1"
FT   CDS_pept        536753..537337
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06028g"
FT                   /old_locus_tag="DEHA0F06578g"
FT                   /old_locus_tag="DEHA-IPF8600"
FT                   /old_locus_tag="DEHA-CDS5424.1"
FT                   /product="DEHA2F06028p"
FT                   /note="similar to CA2562|IPF19953 Candida albicans IPF19953
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88949"
FT                   /db_xref="InterPro:IPR013900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME9"
FT                   /protein_id="CAG88949.1"
FT                   /translation="METADFKRAANKGIEPQHENSDIASLSTLGMRIRKSVADGYNVPS
FT                   NKYNGYNAYDRMGYTSHGEYGRVEPKAIGIFGGNQDGSNIDYEPARVPLPTHMSQPPAL
FT                   TNVGSTIGTCSNLSEWENNYASHAPAISTLGVFDQGAKGKRKFDDIDEDAVAYGSGAGA
FT                   SPGAISTNTTYDMGTEYYRAKYGELKFDEDF"
FT   gene            <537804..>539672
FT                   /locus_tag="DEHA2F06050g"
FT                   /old_locus_tag="DEHA0F06600g"
FT                   /old_locus_tag="DEHA-IPF8599"
FT                   /old_locus_tag="DEHA-CDS1375.1"
FT   CDS_pept        537804..539672
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06050g"
FT                   /old_locus_tag="DEHA0F06600g"
FT                   /old_locus_tag="DEHA-IPF8599"
FT                   /old_locus_tag="DEHA-CDS1375.1"
FT                   /product="DEHA2F06050p"
FT                   /note="similar to uniprot|Q2VQX1 Saccharomyces cerevisiae
FT                   YLR443W ECM7 Non-essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88950"
FT                   /db_xref="GOA:Q6BME8"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME8"
FT                   /protein_id="CAG88950.2"
FT                   /translation="MMFNNIGYHFLLPFRNLTAQARFLQIIRLFTCIAALTFIIATLIG
FT                   SLANRNIYIARINCARLDVARGLYNSLRSSVSLSSSILGDSEDNVLPVDSSLTNSEIAV
FT                   LTSYAENQVADAPQYIVTSLWSWCYGNYNITQHMDRHGVVHISKHNDVLTCSKSTKRYI
FT                   FDYKDELELIGLQSILAYAYQSSDLNDKKYEETIAKRNNKYKLVPSGLIFGASSQLVIL
FT                   IFGYILYSNRGPEQSLNKIPVFVMNIIALISVASFLSLAVSSSLVTNLLIEIRGEIKSN
FT                   LGDYGIALHFGDIWFSLLWLSFTFSLLSSVSWTFPLWCANPRDFDEEEDFDDFPYGSDN
FT                   ITDNEEAGMSDLSGLRRNPSVSDKYNRFNKTSANISSGVQYKASADFGAKNDNDVEERD
FT                   FSDDEDHEYETDYVYNDTSNRKYDAYGARNEDELRKLGETLSRKMSVRRLNRNLSKKSR
FT                   KSYLRDANYPIFEDESSNLLYHDVNISNSQYPMTDSMAHHYREETFDGYVNSHKPTTSA
FT                   STMSLGTSKILTSHINKVREEGNNTPTRNASDKSVDRRKNNKEQDTNFRSNSLQERHFQ
FT                   HNTRNNPFLQSDTLESLENKRNSTGDSFLNFDEMEILDNNNYINRL"
FT   gene            <539882..>541132
FT                   /locus_tag="DEHA2F06072g"
FT                   /old_locus_tag="DEHA0F06622g"
FT                   /old_locus_tag="DEHA-IPF8598"
FT                   /old_locus_tag="DEHA-CDS3034.1"
FT   CDS_pept        539882..541132
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06072g"
FT                   /old_locus_tag="DEHA0F06622g"
FT                   /old_locus_tag="DEHA-IPF8598"
FT                   /old_locus_tag="DEHA-CDS3034.1"
FT                   /product="DEHA2F06072p"
FT                   /note="weakly similar to uniprot|Q04658 Saccharomyces
FT                   cerevisiae YML066C SMA2 Spore Membrane Assembly"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88951"
FT                   /db_xref="GOA:W0TYT5"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYT5"
FT                   /protein_id="CAG88951.4"
FT                   /translation="MIYDRSQDSENSHSSLFDSSNSTLNISEKQIELQDFNLGDCLPEA
FT                   EHMDKDEISPSFRLGLQNYEDTVNSSLMGQYSNSNDGFPSEEEPIGTLSMRTGTMNFAK
FT                   SIWRMFCIAIILQVFLGFSYMMFLPQFSLQFRDDSPEARRLLSSISEGLKMISYLAKDL
FT                   SVTLNDNSNILNDINYIDTIDTFSDNYIYQFNAIQYCKYNTVNTTTECISTNGLDIFTS
FT                   LVTDIGLQLGNVSKAEDPGKLATSLVTTYSNLVDSLDEMRDSNTSHTFALAPIDLKTIK
FT                   IAHGLKKSQKYGKMMSYLASPVNFMHPIIWMILGLSCLALSGTSKFAIFNQRNLFGYSI
FT                   IILVFLVLCFGITLFNWAATTWYFYRIHGQMNKVNIAQFKLGTGFIILTSCVSLYAVLL
FT                   YQLTQILRSKNSIYNFS"
FT   gene            complement(<541486..>542808)
FT                   /locus_tag="DEHA2F06094g"
FT                   /old_locus_tag="DEHA0F06644g"
FT                   /old_locus_tag="DEHA-IPF8597"
FT                   /old_locus_tag="DEHA-CDS2824.1"
FT   CDS_pept        complement(541486..542808)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06094g"
FT                   /old_locus_tag="DEHA0F06644g"
FT                   /old_locus_tag="DEHA-IPF8597"
FT                   /old_locus_tag="DEHA-CDS2824.1"
FT                   /product="DEHA2F06094p"
FT                   /note="highly similar to uniprot|P06106 Saccharomyces
FT                   cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
FT                   serine sulfhydrylase required for sulfur amino acid
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88952"
FT                   /db_xref="GOA:Q6BME7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME7"
FT                   /protein_id="CAG88952.1"
FT                   /translation="MPSHFDTLQLHAGQPVEKPHKPRAPPIYATTSYVFDDSKHGAQLF
FT                   GLETPGYIYSRIMNPTNDVFEQRMAALEHGIGAVATSSGQSAQFLAIAGLAHVGDNFIS
FT                   TSFLYGGTYNQFKVAFKRLGIETKFVNGDKVEDFAKLIDDKTKAIYIETIGNPKYNVPD
FT                   FEAISKLAHDHGIPVVVDNTFGAGGYLINPIDHGADIVVHSATKWIGGHGTTIAGVIVD
FT                   SGNFPWEKYPERFPQFSKPSEGYHGLVLNDALGKAAFIGHVRIELLRDLGPALNPFGSF
FT                   LLLQGLETLSLRVERQSYNALKLAQFLEKSPYVEWVSYLGLPSHEYHERSKKYLNNKEN
FT                   YGGVLSFGVKDLGENKEDPFQEASPRFVDNLKVASNLANVGDSKTLIIAPYYTTHQQLS
FT                   DEEKAASGVSKDLIRVSVGTEFIDDIIGDFEQAFKTVYESS"
FT   gene            <543172..>544026
FT                   /locus_tag="DEHA2F06116g"
FT                   /old_locus_tag="DEHA0F06666g"
FT                   /old_locus_tag="DEHA-IPF8595"
FT                   /old_locus_tag="DEHA-CDS4075.1"
FT   CDS_pept        543172..544026
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06116g"
FT                   /old_locus_tag="DEHA0F06666g"
FT                   /old_locus_tag="DEHA-IPF8595"
FT                   /old_locus_tag="DEHA-CDS4075.1"
FT                   /product="DEHA2F06116p"
FT                   /note="similar to CA2566|IPF12122 Candida albicans IPF12122
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME6"
FT                   /protein_id="CAG88953.2"
FT                   /translation="MTKEYKQCKGITSKGIQCKINAPDGYCHYHIGQCGKGKKINSSPA
FT                   NVRSIDGKGREIIHGSPISRGTSPTKQTEKIGYIYVYTLTRLLSNNDKNWSLKVRNLPN
FT                   VSSKHRDTWVPFKSEKSPYMLIKVGMTTQTVQRRLRQWQDKCHHELTCLHPQKKIESSN
FT                   KLDSIIHRFKGLSIKKERGKFRTYDGDQFGFLCPRGVNVAESEIHKMLIAKYGSGDVYC
FT                   TGCKENSPIENSSKLKTLKERLHTKDPFRNGYNIHVEWFLIPKKDLDTVYQLIDMVCSK
FT                   YYN"
FT   gene            complement(<544121..>545872)
FT                   /locus_tag="DEHA2F06138g"
FT                   /old_locus_tag="DEHA0F06710g"
FT                   /old_locus_tag="DEHA-IPF8593"
FT                   /old_locus_tag="DEHA-CDS7871.1"
FT   CDS_pept        complement(join(544121..545199,545644..545872))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06138g"
FT                   /old_locus_tag="DEHA0F06710g"
FT                   /old_locus_tag="DEHA-IPF8593"
FT                   /old_locus_tag="DEHA-CDS7871.1"
FT                   /product="DEHA2F06138p"
FT                   /note="highly similar to uniprot|Q07478 Saccharomyces
FT                   cerevisiae YDL084W SUB2 Suppresses the cold-sensitive snRNP
FT                   biogenesis brr1-1 mutation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88955"
FT                   /db_xref="GOA:Q6BME5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BME5"
FT                   /protein_id="CAG88955.2"
FT                   /translation="MSHEGQEELLDYSDSEEIAVPTTTAPSAAAGEGANDKEADKKGSY
FT                   VGIHATGFRDFLLKPELLRAIGDCGFEHPSEVQQVCIPQSILGTDVLCQAKSGLGKTAV
FT                   FVLSTLQQLDPVPGEISTLVICHTRELAYQIRNEYARFSKYMPDVKTEVFYGGTPITRD
FT                   LEKLKNKDTCPHIVVATPGRLHALVTEKSIRLNNIKSFVIDECDKVLEAVDMRRDVQDI
FT                   FRNTPHQKQVMMFSATLSQEIRPVCKKFMQNPLEIYVDDEAKLTLHGLQQYYIKLDEKE
FT                   KNRKLSDLLDSLEFNQVIIFVRSTQRANELNKLLCSSNFPSIAVHSGLPQEERIERYKS
FT                   FKEFNKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAVSLV
FT                   STKDDEEVLEKIQSRFDVKITEFPEEGVDPSTYMNT"
FT   gene            <546109..>546534
FT                   /locus_tag="DEHA2F06160g"
FT                   /old_locus_tag="DEHA0F06732g"
FT                   /old_locus_tag="DEHA-IPF8592"
FT                   /old_locus_tag="DEHA-CDS5979.1"
FT   CDS_pept        546109..546534
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06160g"
FT                   /old_locus_tag="DEHA0F06732g"
FT                   /old_locus_tag="DEHA-IPF8592"
FT                   /old_locus_tag="DEHA-CDS5979.1"
FT                   /product="DEHA2F06160p"
FT                   /note="weakly similar to CA2569|IPF12117 Candida albicans
FT                   IPF12117 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88956"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME3"
FT                   /protein_id="CAG88956.2"
FT                   /translation="MLRLSFCKIRSISAKSVPISRNIAFRYLAAAKRPIVYQRTYASSS
FT                   KPDDVSEEAQRVGNLINVFRQNPEIRSLLDDFQNLLAEKGLQPDGKQPTMFQMMKILAD
FT                   KDVKASLLKLKEALDGANIQLTQEDLNAFMNLYGLKK"
FT   gene            complement(<546616..>547443)
FT                   /locus_tag="DEHA2F06182g"
FT                   /old_locus_tag="DEHA0F06754g"
FT                   /old_locus_tag="DEHA-IPF8590"
FT                   /old_locus_tag="DEHA-CDS4521.1"
FT   CDS_pept        complement(546616..547443)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06182g"
FT                   /old_locus_tag="DEHA0F06754g"
FT                   /old_locus_tag="DEHA-IPF8590"
FT                   /old_locus_tag="DEHA-CDS4521.1"
FT                   /product="DEHA2F06182p"
FT                   /note="similar to uniprot|P32263 Saccharomyces cerevisiae
FT                   YER023W PRO3 Delta 1-pyrroline-5-carboxylate reductase
FT                   catalyzes the last step in proline biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88957"
FT                   /db_xref="GOA:Q6BME2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME2"
FT                   /protein_id="CAG88957.2"
FT                   /translation="MEDYTIAVLGCGVMGTAVTSAILKAKFEPYPSKIICCTNSEKSST
FT                   ELKSKLDSDVIETSYGSESNNKAVSKADIVILGCKPFMFKDVYEQVKGSLSGDQLIISL
FT                   LAGTTIEELSIMSPYVAKVMTNTPAQFGCGMAVVSFSDEAESKYSDLVMKLIDPVGKAM
FT                   KLPEKNMDAATALVGSGPAFCLLIMEALVDGGVRMGLPYAVAKESAAKVMEGTAKMVLE
FT                   TGEHPAALRSKICTPGGTTIGGLLKMEDAGVRGGIARAVEEAANISASFAKKK"
FT   gene            <548122..>550662
FT                   /locus_tag="DEHA2F06204g"
FT                   /old_locus_tag="DEHA0F06776g"
FT                   /old_locus_tag="DEHA-IPF8589"
FT                   /old_locus_tag="DEHA-CDS0730.1"
FT   CDS_pept        548122..550662
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06204g"
FT                   /old_locus_tag="DEHA0F06776g"
FT                   /old_locus_tag="DEHA-IPF8589"
FT                   /old_locus_tag="DEHA-CDS0730.1"
FT                   /product="DEHA2F06204p"
FT                   /note="weakly similar to uniprot|P47156 Saccharomyces
FT                   cerevisiae YJR119C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88958"
FT                   /db_xref="GOA:Q6BME1"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME1"
FT                   /protein_id="CAG88958.2"
FT                   /translation="MTFNKDLLVPCPIVTPTMEEFSDPIKYLSSEEVAKLGSEYGLIKV
FT                   VPPKGWQPTFSISPEFKFHTRLQKLSDLGLTTRSRKFFIDNINRFMKMSRKRQLKLYFR
FT                   VGLNDAKEFSPTRLKVYYYDLHVMVEKMGGYDNMNGDKWAQINDLFGLKKESTHIEDEY
FT                   LINLRSYANFLSYNQKNYDFPESDSEDDYDNCLICGKHDNPSQTLLCDNCDNPFHLSCL
FT                   EPSLETVPSGSWYCDKCLIGTGEYGFEEQVDLKYSIPEFYQLCNEFERKFEHEYNNDEP
FT                   LSVDKIEQKFWEFIDVEKSDLEVRYGADIHNLKPGEISGFPMANTPGISPEDPETKYYM
FT                   NHPWNLTKLPFAEGSLLNYINTSISGMTVPWIYIGSLLSTFCWHVEDHYTLSANYCHLG
FT                   ATKKWYGIPSYDADKFEKLMKDSAPDLFQKQPDLLHQLVTLLSPMTLVKNGIKCVYADQ
FT                   RPNEFVITYPRVYHAGFNCGFNFNEAVNFTMNTWLGFGEKSISDYRLIKKENVFNHYQL
FT                   VENILKKINTQDDINHTNLRLAEASLKCLREFVQTQLKYISMIDISKFEVKFEPKLFKQ
FT                   RKFEDEQNGTFEATSEQEDEEDLCDICRTHISFQYCIINNRDRNLFSTHGVTGESLAPP
FT                   HTVPPITSVKHESQDFPKISIHQLLTPESSPHELSVPQATPKTVHRISDSSSSTRLSAL
FT                   SETSITDTTSNPLPKLSEEQEFQNLIRAAKRSSSPDSSLCKTGKIDKTAPKRRKSSRIE
FT                   SLSKKAHITSFAARTLAGPRRGKMSVVQNNSRFKHLNDKPQIRLCLACLVSSCPKSIIS
FT                   IPLGSVMLYEVDPSTMLQFISQTSRKIALLSTNI"
FT   gene            <550977..>552929
FT                   /locus_tag="DEHA2F06226g"
FT   CDS_pept        join(550977..551092,551534..552929)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06226g"
FT                   /product="DEHA2F06226p"
FT                   /note="highly similar to uniprot|P00830 Saccharomyces
FT                   cerevisiae YJR121W ATP2 subunit of mitochondrial F1F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88959"
FT                   /db_xref="GOA:Q6BME0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME0"
FT                   /protein_id="CAG88959.1"
FT                   /translation="MVFPRLFNSASRNAFTAAKRNFVFNRGLASAAPVAGKVRAVIGAV
FT                   VDIQFDEGNLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTDGLVRGAPVNDT
FT                   GAPISVPVGRETLGRIINVIGEPIDERGPIKTKQKNPIHADPPSFVEQSTSSEVLETGI
FT                   KVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDL
FT                   YREMQETGVINLEGDSKVSLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVD
FT                   NIYRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPAD
FT                   DLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIAVVGKEHYDVASGV
FT                   QQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVR
FT                   LQETVKSFKEVLDGKHDHLPENAFYMVGGIEDATAKAEKLASESK"
FT   gene            <553200..>554612
FT                   /locus_tag="DEHA2F06248g"
FT                   /old_locus_tag="DEHA0F06820g"
FT                   /old_locus_tag="DEHA-IPF40212"
FT   CDS_pept        join(553200..553217,553290..554612)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06248g"
FT                   /old_locus_tag="DEHA0F06820g"
FT                   /old_locus_tag="DEHA-IPF40212"
FT                   /product="DEHA2F06248p"
FT                   /note="similar to uniprot|P47154 Saccharomyces cerevisiae
FT                   YJR117W STE24 Highly conserved zinc metalloprotease that
FT                   functions in two steps of a-factor maturation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88960"
FT                   /db_xref="GOA:Q6BMD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD9"
FT                   /protein_id="CAG88960.1"
FT                   /translation="MFSLANSFSFLDSASINWKSIIVGFTVGQFLFENYLDYRQYQVLK
FT                   RTTPPDTLKAEVSQETFDKSQDYSRAKAKFGFLSDSINLFQNLAIIKYDLLPKFWNIAG
FT                   TLMAKSSFILPKFMGGIITQSLFFLFSTQIISTIVSLPLSYYSNFVLEEKYGFNKLTVG
FT                   LWLTDKVKGIALGIALGSPVVAAFLKIIDYFGDSFILYTCGFLFVVQLVGMTIFPTLIQ
FT                   PLFNKFTTLDEGELKTAIENLACEQKFPLTKLYVIDGSKRSSHSNAYFTGLPWSKQIVL
FT                   YDTLIKHSTKEETVAVLAHEIGHWKLSHLPQMLVFSQAHLFLSFSMFSAFIHNNSLYSS
FT                   FGFTSVQPIMIGFMLFNDIFQPVECVAQFGMNLLSRKNEYEADAYAKKCGYSDDLAKAL
FT                   IKLLSENLSTMDADWLYSSYHHSHPILSERLRAINYVSKEKVGKKDE"
FT   gene            complement(<554700..>555425)
FT                   /locus_tag="DEHA2F06270g"
FT                   /old_locus_tag="DEHA0F06842g"
FT                   /old_locus_tag="DEHA-IPF8578"
FT                   /old_locus_tag="DEHA-CDS4920.1"
FT   CDS_pept        complement(554700..555425)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06270g"
FT                   /old_locus_tag="DEHA0F06842g"
FT                   /old_locus_tag="DEHA-IPF8578"
FT                   /old_locus_tag="DEHA-CDS4920.1"
FT                   /product="DEHA2F06270p"
FT                   /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
FT                   YDL087C LUC7 Essential protein associated with the U1 snRNP
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88961"
FT                   /db_xref="GOA:Q6BMD8"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD8"
FT                   /protein_id="CAG88961.1"
FT                   /translation="MAEEQRKLVEQLMGKDALISPAVKRRDPEMTSHRVCKSFLVGVCP
FT                   HDLFIGTKQDLGKCPKLHLEKHKLEYEYRTRKKGEAFPEFEYEYYKHLQTYINEIDRNI
FT                   EIALKRLEHTPEEKEKIAKVTKELDNLDTKIGLMTQEIDCLIKENETLKCLFESVKLND
FT                   LCKERDQLAESARNIAENVGQSSQQKLQVCEECGAYLSRLDSDRRLADHLIGKIHLGYV
FT                   QMRAAYYELHNKFKRSTTY"
FT   gene            <555980..>557434
FT                   /locus_tag="DEHA2F06292g"
FT                   /old_locus_tag="DEHA0F06864g"
FT                   /old_locus_tag="DEHA-IPF8576"
FT                   /old_locus_tag="DEHA-CDS2450.1"
FT   CDS_pept        555980..557434
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06292g"
FT                   /old_locus_tag="DEHA0F06864g"
FT                   /old_locus_tag="DEHA-IPF8576"
FT                   /old_locus_tag="DEHA-CDS2450.1"
FT                   /product="DEHA2F06292p"
FT                   /note="similar to ca|CA2555|IPF12105 Candida albicans
FT                   IPF12105"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88962"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD7"
FT                   /protein_id="CAG88962.2"
FT                   /translation="MKKYQLIGRKKVFTKSKASVNYPTAHLCSLPVEILMEVFNCLEND
FT                   LKTLLKLSLVCNKFHLIINKNFLYNNIIITNPRRFSKFSQTHLPSASHSITRRFGYNEP
FT                   SNNINLVKSVHFINPPTRNSTNRKTKIAGTYDVESVQSTDEEASFDEYIHSFTNLLKEA
FT                   YGLKTITISEISPEFSFPHDIPGDSSSVFSSFKSKRPPRTLGKLVLKVQSGWSIPFRTS
FT                   HISSLFNVYGAIDELVLHNFVLDDSKLTSSSKIGGINKLVLFSCIYSNSLSKKVPNQKK
FT                   RCPDILAEVTELRLLNILSGSDLSVIDVIKQNGKLSKLTLDLDSQVFYSMTKNSSNEKQ
FT                   FNFARYNLFFKLLCSGQGFYANLTELELINFDLFDSFRHKHKIKEEDEDNDDWVAPSTD
FT                   TFESLLTYLSTIQNLSIVLKERPKKVRTCIKCGFTKSEQPDKKIHSLNNREWSILLHPL
FT                   LSENEDCTVKIFDHKGNRVFVRSKYI"
FT   gene            complement(<557441..>559204)
FT                   /locus_tag="DEHA2F06314g"
FT                   /old_locus_tag="DEHA0F06952g"
FT   CDS_pept        complement(join(557441..557523,557630..558165,
FT                   558217..558500,558603..558863,558917..559042,
FT                   559094..559204))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06314g"
FT                   /old_locus_tag="DEHA0F06952g"
FT                   /product="DEHA2F06314p"
FT                   /note="similar to uniprot|Q08271 Saccharomyces cerevisiae
FT                   YOL132W GAS4 Putative 1 3-beta-glucanosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88966"
FT                   /db_xref="GOA:W0TYT0"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYT0"
FT                   /protein_id="CAG88966.4"
FT                   /translation="MRCFLVITCLILKSVEAFIHPITIRGKSFVDSVTQEPFFIKGVDY
FT                   QPGGSSGVTDTKDPLSDPKECVRDIIMLQDLGINTIRIYSINADLNHDICMSMLAAAGI
FT                   YLVLDVNSPLPNHHLNRNEPWKTYNEQYLKNIYKVVEQFSYYNNTLGFFAGNEIVNDKI
FT                   SAKNSPTYVKAVIRNLKKYIDYNSPRQIPVGYSAADDLDYRVSFSEYLECVDDSVTDSV
FT                   DFYGVNSYQWCGEQTFYTSGYNILANDYSSFSRPVFLSEYGCNEVLPRRFDEVQTLYSS
FT                   KMNKIFSGGLVYEYSQEPNNYGLVSILDNGDIKVLPDFIALKSQFESLPLIDNYQFIQN
FT                   TLGNLKGSQKSSLPKCKKTYSNLNIDKTVPKIANDPMYSNIDVERGKYVELNEDDLISS
FT                   YNILNYKGEPYAVDDSMEIIFDHMSGAEIVRNNKNDKERNSGSSPSIHNLLSKLLVYLI
FT                   VLEITLWL"
FT   gene            <559515..>559587
FT                   /locus_tag="DEHA2F06336r"
FT                   /old_locus_tag="Deha0F.6"
FT   tRNA            559515..559587
FT                   /locus_tag="DEHA2F06336r"
FT                   /old_locus_tag="Deha0F.6"
FT                   /note="tRNA Arg (TCT) cove score=75.37"
FT   gene            <559595..>559685
FT                   /locus_tag="DEHA2F06358r"
FT                   /old_locus_tag="Deha0F.7"
FT   tRNA            join(559595..559632,559649..559685)
FT                   /locus_tag="DEHA2F06358r"
FT                   /old_locus_tag="Deha0F.7"
FT                   /note="tRNA Phe (GAA) cove"
FT   gene            complement(<559886..>562936)
FT                   /locus_tag="DEHA2F06380g"
FT                   /old_locus_tag="DEHA0F07040g"
FT                   /old_locus_tag="DEHA-IPF8570"
FT                   /old_locus_tag="DEHA-CDS0426.1"
FT   CDS_pept        complement(559886..562936)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06380g"
FT                   /old_locus_tag="DEHA0F07040g"
FT                   /old_locus_tag="DEHA-IPF8570"
FT                   /old_locus_tag="DEHA-CDS0426.1"
FT                   /product="DEHA2F06380p"
FT                   /note="weakly similar to uniprot|P38244 Saccharomyces
FT                   cerevisiae YBR074W Uncharacterized zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88967"
FT                   /db_xref="GOA:Q6BMD6"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMD6"
FT                   /protein_id="CAG88967.2"
FT                   /translation="MAETESGTGNSPSHRLSETSNASGNRSHQQSKQIASYKSSKPNVF
FT                   IRFIRAIFGYRKTSVTLFVFITIIATLILVELSNSLDFSVKLPTNNLERTILDNSWLDL
FT                   QKIGKEEHPYTSKGNDYVHDYLEAKITELIGKSLFIECDNDVNYTNNIIFKTENDLYNQ
FT                   VTYYESNNLLVRINGSDSSLPALLVSAHFDSVPSSFGVTDDGMGIASLLGILNYYSSDG
FT                   IDQPMRTIILNFNNNEEFGLMGATSFLHHPWFKQVRYFLNLEGTGAGGKAVLFRGTDYG
FT                   IVKYFKHVRYPFGTSLFQQGFNNHLIHSETDYKIYKENGGIRGIDLAFYKPRDIYHTAS
FT                   DSIKNIDIKSLWHMLSNSLDFVEIVSSQRIDLDDEDTSPESDEKSREFAIFSSFFNWFF
FT                   VIPASQLVLINVTCLAVIPLISLPLLVIIFNYKKNWHIGFINAIKFPVSLVLSICILNI
FT                   ITHNVIASINEFLPNSSYDSIVSTLYSLFLLLNYLFLNGINFIFKGYKGLYHDEKLILI
FT                   IQTSFIYWVLLIVSTNKLSKNKIGNDHTGEFPLIMLFLLQSIGALFGLFSWSFKKTTPD
FT                   ELRNNDDEACQALLSREEHNNYGSNEAELESGEPISSNSSVSLNSSSSQVTNNLVKNLR
FT                   KSFSYDWSIQYVVIVPLSSLIVYNTGSLLLSGLNKSIQESLNAEKLIFDLIQLVAVTLA
FT                   IPFLPFIFKINRLLVTALVLVFCSGFISIFLKSPFDQLNPLKLRFVQSINLDESSDISV
FT                   VNVFGRYGSPMNNVLLDLPSLKETNESLECNNLQDGMQLCSYKTLLSPNLSPDVTDFND
FT                   YLDVQVLKNSSSDYPYGLLSGEIKINVPENRVCRLSFNNSNFENSKQSLVRTILVYEDN
FT                   NYENSSNKLFPFEVSEFQLANLPEGFSRDKKGTYIYKNLNGIDKLELNKLSWDKPYHVG
FT                   FQWMPKFVDSVSAENENTNVPYTTDFNNLGIQVECFWGNLGYANNENKSEDERIPAYGE
FT                   VLHYSPNYVSWANKESGLVSVSKYVEI"
FT   gene            <563137..>564276
FT                   /locus_tag="DEHA2F06402g"
FT                   /old_locus_tag="DEHA0F07062g"
FT                   /old_locus_tag="DEHA-IPF8569"
FT                   /old_locus_tag="DEHA-CDS8916.1"
FT   CDS_pept        join(563137..563223,563275..564276)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06402g"
FT                   /old_locus_tag="DEHA0F07062g"
FT                   /old_locus_tag="DEHA-IPF8569"
FT                   /old_locus_tag="DEHA-CDS8916.1"
FT                   /product="DEHA2F06402p"
FT                   /note="highly similar to uniprot|P32347 Saccharomyces
FT                   cerevisiae YDR047W HEM12 Uroporphyrinogen decarboxylase
FT                   catalyzes the fifth step in the heme biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88968"
FT                   /db_xref="GOA:Q6BMD5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD5"
FT                   /protein_id="CAG88968.2"
FT                   /translation="MPEFAPLKNDLILRAARGEKVERPPMWIMRQAGRYLPEYHEVKGK
FT                   LDFFETCRNAEIAAEITIQPIEHFNGLIDAAIIFSDILVIPQVMGFEIEMVEGKGPVFV
FT                   DPLRSPKDLSRVNYKPDILKGLDWAFKAITLTRTKLNGRVPLLGFCGAPWTLLVYMTEG
FT                   QGSKMFRYAKEWIYEHTEESHKLLQATTDACIEFLAQQVVAGAQMLQVFESWASELGPN
FT                   EFNEFSLPYLRQISEKLPKRLQELGITEKIPLTVFAKGAWYALDSLCDSGYDTVSLDWL
FT                   YKPEDAVKVVNGRRITLQGNLDPGTIYGSDEVISKKVEQMIKGFGGGKQNYIINFGHGT
FT                   HPFMKPEKVEHFLKECHRFGSQ"
FT   gene            <564498..>566402
FT                   /locus_tag="DEHA2F06424g"
FT                   /old_locus_tag="DEHA0F07084g"
FT                   /old_locus_tag="DEHA-IPF8567"
FT                   /old_locus_tag="DEHA-CDS1443.1"
FT   CDS_pept        564498..566402
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06424g"
FT                   /old_locus_tag="DEHA0F07084g"
FT                   /old_locus_tag="DEHA-IPF8567"
FT                   /old_locus_tag="DEHA-CDS1443.1"
FT                   /product="DEHA2F06424p"
FT                   /note="similar to uniprot|Q66RH0 Saccharomyces cerevisiae
FT                   YDR049W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88969"
FT                   /db_xref="GOA:Q6BMD4"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR041175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD4"
FT                   /protein_id="CAG88969.2"
FT                   /translation="MDKVNNTDIDANDSYLYDLPEKILGSLELIYFDSSTTVVPSQSVP
FT                   STSTQVVEVNTDTKEDKPIQNISVCSVCKPQYDLKATQNEKRDHYRSDYHRLNLKRSIS
FT                   NLPPLSESEFDRLIEEESIESISGSDDSSESESEDELSSSTKLDTIIEKFDSVSIDKNE
FT                   TNDDEEEGTISYLNTNSPFIYFKSILIPEGKVFGVYKSVFTERQLQEDPVETLRSFSNP
FT                   PIKTKKSALLMIGGGHFAGAIISHIPKNIKGNAPNFKESKQEQLTNIIESKTFHRYTTR
FT                   KKQGGSQSASDNARGKANSAGSSIRRYNEQALTREVRDLLMSWKGHIDDCTNIYIRANG
FT                   PSSRRILVGYDGCVLHTSDDRIRSFPFTTKRATTSELKKAWSNLSYLTIHDMPKSNEKL
FT                   KKRLQKQRDNLKNSQQQHSKKPEEIVLDENDKHSNELIGFLKKSKAPMLVNYIHKNNLS
FT                   PNHELSPKDQYVHNPTLLHFASSQGLSHMVQVLIVNLKADPTISNQFGKTPFELAGNTA
FT                   TRRAFQIARYSLGEDYCDWQLSKVGSPKSKEEVEREQKEEQKKIDEDKKKMIEDELAKR
FT                   TEMEQKKPTYSSGGTLGSGKIPSSLTETSGLSEQQKMRIMREQRARAAEARMKRMQGN"
FT   gene            complement(<566430..>569084)
FT                   /locus_tag="DEHA2F06446g"
FT                   /old_locus_tag="IPF_8566"
FT   CDS_pept        complement(566430..569084)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06446g"
FT                   /old_locus_tag="IPF_8566"
FT                   /product="DEHA2F06446p"
FT                   /note="similar to uniprot|P38086 Saccharomyces cerevisiae
FT                   YBR073W RDH54 DNA-dependent ATPase stimulates strand
FT                   exchange by modifying the topology of double-stranded DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66284"
FT                   /db_xref="GOA:B5RUA6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA6"
FT                   /protein_id="CAR66284.1"
FT                   /translation="MYKSGLRAAFKPPRRIDSSQSSLDAKSSSPAPINQCVDAKVSQDK
FT                   EASPYRAASSESSRQAYKRPKIGSNVMKAEDSPSVLAPGPKDEESVRMYMVQWRKFTNK
FT                   KNKTWDGDGLIVVSSSGITFKCDVKGNGNYKQMGKTSKTKTEGIIALGSYELEIDYEIA
FT                   DKTTLNNSQDVGQENKVPSHHIPAPPRNQFKKVVPLGISNAQSTARVSTSNRNPLYDPD
FT                   AEHSLIMTRPPNKTREETIDVVVDPVLSRLLRPHQREAVSFVYECLMGFKNFKGNGALL
FT                   ADEMGLGKTLTTITLIWTLLKQTPYSEDISPICKKVLITCPVTLIGNWKKEFKKWLNIN
FT                   RIGVLTVNNKQNASKDKQEIKSFGKTRIYQVLIMSYEKVLSCQNELSTIDFDMLVCDEG
FT                   HRLKNSSNKVLKVLNDMNISKKVLLTGTPIQNDLVEFYNIINFINPSVLGSFQSFQKDF
FT                   IKPILRSREVNCINKDTIKRGEIKSNELIELTKEFTLRRTSSILSGYLTEKTDIILFCP
FT                   PTELQIALFKFVLDSKKFNALLREDNNSLTLITLFKKICNSPSLLFQDKLFNSLIENEH
FT                   DSTIDLTTLSKKTASSKVNILIPLLIEINQIGDKTVLISNYTQTLDLLETILHKLNISF
FT                   SRLDGSTPNKLRDKLVNDFNKQPVSTNSVFLLSAKSGGVGLNLIGASRLILFDNDWNPS
FT                   IDLQAMARIHRDGQTKPVFIYRIMTTGCIDEKIFQRQMMKNNLSDKFLDNKTDSKSNLF
FT                   DMNDLKDLFTVNEETLSNTHDLLQCDCSGIGEDINPLSIDIDSDDADEETNNPGGWITA
FT                   LDYKQEDQKPKRQQASMINALIDYKHYNPVNVSEQLDCGDMVTKNIIQKSKERSMPIPI
FT                   TYMLTKVTNCTSV"
FT   gene            <570096..>574586
FT                   /locus_tag="DEHA2F06468g"
FT                   /old_locus_tag="DEHA0F07128g"
FT                   /old_locus_tag="DEHA-IPF8562"
FT                   /old_locus_tag="DEHA-CDS0112.1"
FT   CDS_pept        570096..574586
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06468g"
FT                   /old_locus_tag="DEHA0F07128g"
FT                   /old_locus_tag="DEHA-IPF8562"
FT                   /old_locus_tag="DEHA-CDS0112.1"
FT                   /product="DEHA2F06468p"
FT                   /note="weakly similar to uniprot|Q03496 Saccharomyces
FT                   cerevisiae YMR259c"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88971"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019442"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD2"
FT                   /protein_id="CAG88971.2"
FT                   /translation="MLSEEDVKTVEQYLIVNKEVRPEELKKIFPSLYSTLINADSVDSA
FT                   RILCSDTLCIWMLRSIKMMRMQHAEQLCEVLTEDTSSRIFEYIMDFLESGTGPLVNSLV
FT                   SLLHRLIGFCKVLMPLHVDLFHRWVDQAMKLPCTSRNLYFLVDILSKEINKQYILTEHE
FT                   RFTERCIGIMWSNPLANAASKAFVSIYQRLYEKGHDEEWMDKWQGLVMNGLNEKDLSRN
FT                   IQVYLLPLLFKISPKSYGIFIERNLSLHINDLSNSEIDIYLGLLKVGQDLALMPETLHK
FT                   SNTIVPFDYITSLLTHEESKFRISSFALLVGSAKGSQPIQKQVYDVLIDKNILQIFFMD
FT                   CDSVELRNDFASLLRQFLIRIRDSMYSLSRDLEKIRKKNYDLSKQDELQELITYGYDFL
FT                   TWFLNFLKRNFIPGSSYAQLSLSMKSLQILVDLNLDNVPRSQAYDKLSTKTKIKISNNK
FT                   MVFPFSIEIFDGQLLRLIIDNITNNYEDIRDTSVNLLLGCSENILSENILSAEQDIIDK
FT                   ALITLTELKGKKSEGGAKVLQFLAQLYDHIDDVVRLKGLINTLKDKLDFGLNHEFNNEK
FT                   LPREQRVHGIFTALKLIFQNIDKKRYSVETPYWTGQFSHIFSQVTKIWLQTKPLLSNAT
FT                   DDNEGNDSSEDKLVLNYSWKAIKESTALLSTILEISNPEKNALIDKITFLSGANLIMDQ
FT                   LASVKHRGAFSSVYPSFVSACEICFKSNDQELASKPSLWLKQNIKLIKSKTQYISRRSG
FT                   GLPYLITAILTAEKSYNKSKEYKDLIDYTFEELISIAKEEYIQNADEKMDIPQVHAFNC
FT                   IKHIFIDSQLSSLCTPYVNQVLTLSLINFYNPTWAIRNCAVMLFTALQNRLFGTSKLGE
FT                   LLPCISSRLFFAKYNGIEDILFQNLVDASAAVEQDTKFNVIFPILTILSRLENTSTFDP
FT                   KLQKFETLLIKCSHHKYWKVREMAAKSLAAILLPDSLIPTIRILIDNCHHSHGDFNSIH
FT                   GNLLSILEIIKRIETKLPDYRLTDREASNIFEHTIEFLTDSDMFSWSTAKCFVDIVRCI
FT                   LMNNFEISLGNNNLNIIGNFIIRNLTTDIFDNTLNGARQLLLSAMTELVFSQYLKIGRT
FT                   EDIIDLIRLCLLSRDVYEVQLVAIRFCDSHINHIIEMDSNNYYTAILEELWDLVKDDSC
FT                   WSFVRSNALELIRKVTSRGEELEREELRSKIEILISFTSKEYSEDSNSKALEALGPLIG
FT                   QISGCANDDETSNLQRFLDLAYEFASDGRPAIARLSSVNAIIAFVTTTMKKREHGPCVA
FT                   KGVFMLYLALYDDDDDIRYESAKCLSHFFAFEFTMVPTAITAVFGPNFLAKFGSVISEP
FT                   IFVDNFVNSKPQLKWKLTQADAQTEDSLFDVESMNLYRNDIQTRQTAIHLLMACNSMEP
FT                   INNESVVKLTEKVNKDMYYIIDFVARKGHDGYIGWCKDEFIFTSILEGTLNVKAVIKLT
FT                   NDTELNERLEFLWKLFDKHQVHYMVKHTSDFFICT"
FT   gene            <575310..>576389
FT                   /locus_tag="DEHA2F06490g"
FT                   /old_locus_tag="DEHA0F07150g"
FT                   /old_locus_tag="DEHA-IPF8558"
FT                   /old_locus_tag="DEHA-CDS3586.1"
FT   CDS_pept        575310..576389
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06490g"
FT                   /old_locus_tag="DEHA0F07150g"
FT                   /old_locus_tag="DEHA-IPF8558"
FT                   /old_locus_tag="DEHA-CDS3586.1"
FT                   /product="DEHA2F06490p"
FT                   /note="similar to uniprot|P38241 Saccharomyces cerevisiae
FT                   YBR065C ECM2 Pre-mRNA splicing factor facilitates the
FT                   cooperative formation of U2/U6 helix II in association with
FT                   stem II in the spliceosome function may be regulated by
FT                   Slu7p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88972"
FT                   /db_xref="GOA:Q6BMD1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034356"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMD1"
FT                   /protein_id="CAG88972.2"
FT                   /translation="MSDEFPAICDSCCGPDKHIKMMRQANGEECKVCTRPFTVFRWNPN
FT                   NGTNKSKKTIICMTCARARNCCQSCMLDITYGIPLEIRDTALKMAGLEHASQIKSSNTS
FT                   QNREVKAIMADKQEAKYNNEDNDVNKSNDRSEMARDILSKLSEKLNGNTNALIKKAPKN
FT                   SKTTKKNEIINVKNADISKILGKLPLGGSIVVPETTPELSSFFLFGFSDDIPQYIISDF
FT                   CNKFGKIKSLSIVHRAKCGYVVFTTRKAAESFATTIMENGLNKNTATPGLLILNNKYPV
FT                   RVSWGKQKPLVTTNEECHKLSLVITKVMRQLAEKDKIFEDQKITKKAKNHKTSSDANEH
FT                   SSNTASTQHYKALRPDFEL"
FT   gene            <576534..>577232
FT                   /locus_tag="DEHA2F06512g"
FT                   /old_locus_tag="DEHA0F07172g"
FT                   /old_locus_tag="DEHA-IPF8555"
FT                   /old_locus_tag="DEHA-CDS5666.1"
FT   CDS_pept        576534..577232
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06512g"
FT                   /old_locus_tag="DEHA0F07172g"
FT                   /old_locus_tag="DEHA-IPF8555"
FT                   /old_locus_tag="DEHA-CDS5666.1"
FT                   /product="DEHA2F06512p"
FT                   /note="weakly similar to uniprot|P38242 Saccharomyces
FT                   cerevisiae YBR070C ALG14 Essential protein required for the
FT                   second step of dolichyl-linked oligosaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88973"
FT                   /db_xref="GOA:Q6BMD0"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMD0"
FT                   /protein_id="CAG88973.2"
FT                   /translation="MDFESQLCIKVVLLLLPFFIIGIRLLWVLPAVNSPAMGSEKEKGL
FT                   SQIPSELRGSNIMIFLGSGGHTGEMMRILANVDLNNFNRTWVTSSGDSTSILKCKKYED
FT                   ERLTSGQNKSDYLVLHRARTVGESIISSVFSTVRSLISTIKHLYELPQFPSILLLNGPG
FT                   TSVPLAYIIFLLKFLGLCKTRIIYIESLARVKQLSVSGLLILPITDRFIVQWKQLAVKY
FT                   KRAEYYGILI"
FT   gene            <577370..>579721
FT                   /locus_tag="DEHA2F06534g"
FT                   /old_locus_tag="DEHA0F07194g"
FT                   /old_locus_tag="DEHA-IPF8554"
FT                   /old_locus_tag="DEHA-CDS0886.1"
FT   CDS_pept        577370..579721
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06534g"
FT                   /old_locus_tag="DEHA0F07194g"
FT                   /old_locus_tag="DEHA-IPF8554"
FT                   /old_locus_tag="DEHA-CDS0886.1"
FT                   /product="DEHA2F06534p"
FT                   /note="some similarities with CA5514|IPF730 Candida
FT                   albicans IPF730 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88974"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC9"
FT                   /protein_id="CAG88974.2"
FT                   /translation="MGIRPISNTGNTFNGLIKEFPGLGVDRFNTIANLYLLTHCHTDHL
FT                   CGLRNKSFDSIVYCSETTKKLVALDPSFRHVLPFIIPIETNVPFTITLNGEEITMTLIP
FT                   AYHCPGATMFLLEGATKNILYTGDIRAESWWVETLSKCPSLFPYTAGLKVLDNIYLDTT
FT                   FIYRGEPFIEIPSNNEGISVVTSLIKSYPRDDPDVQFYFVDSTSGFEEAWAQIANSLQG
FT                   TLHTSEENKLRIESLDCNHLYTHYGHVLNHLINKQSNSRNLKFHACGKYLPSCMSDVPK
FT                   FPIRIKQCIDFNILDFTGVFCPILLSSISSSERTSGLKMLGKTLKGNIVYEFRGRRWLC
FT                   KKDGNELLPADIKLVFSRHSSYSECRNFVSKFKFRDVYPCTESKDTWQNGMIMSRLFGD
FT                   LVYKPYKGDITLLEYDKAKSLEYGPHHSSLLNRPVKIINRWNFSECVDEIRWVKRFLSK
FT                   IDNNSSDIVHQNSNQFNFEGQKFISKFDLSNYTEDERQFHEERHKDIQLQKIVIGRGEA
FT                   WYRKIIENQQKLYCKYHNDIEGGVRSVLRNDPNSDVQFNDGMKLGGIDRYNYDNGSISD
FT                   ESTDEQSHYDSPNISHKNIDDSSVKFGINSNERIHAEPQLEVCRNDELTDIEDESDSIM
FT                   SEDPFNENAKFERALRRKTVPIKEDINEALPQQNNFKRPCLQRTNKYNNKRSKKSDFSF
FT                   IESSFNSFEISFRRHISETEDASITKNASSMMLANRQISSSKIYFKSCASVNSSTIQNV
FT                   SNDLNNDPANWFSLKLKSVDTQFNQVTKFT"
FT   gene            complement(<579948..>580283)
FT                   /locus_tag="DEHA2F06556g"
FT                   /old_locus_tag="DEHA0F07216g"
FT                   /old_locus_tag="DEHA-IPF8551"
FT                   /old_locus_tag="DEHA-CDS7006.1"
FT   CDS_pept        complement(579948..580283)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06556g"
FT                   /old_locus_tag="DEHA0F07216g"
FT                   /old_locus_tag="DEHA-IPF8551"
FT                   /old_locus_tag="DEHA-CDS7006.1"
FT                   /product="DEHA2F06556p"
FT                   /note="highly similar to uniprot|Q04307 Saccharomyces
FT                   cerevisiae YDR045C RPC11 RNA polymerase III subunit C11"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88975"
FT                   /db_xref="GOA:Q6BMC8"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC8"
FT                   /protein_id="CAG88975.2"
FT                   /translation="MLSFCPYCANMLIMAQKDDGCNRFFCSTCPYEFKIDGFQMYDRKK
FT                   LSRKEVDDVLGGEGAWDNVDQTLAQCPIDSCGGDKAYFFQLQIRSADEPMTTFYKCVKC
FT                   SHQWREN"
FT   gene            <580491..>582863
FT                   /locus_tag="DEHA2F06578g"
FT                   /old_locus_tag="DEHA0F07238g"
FT                   /old_locus_tag="DEHA-IPF8550"
FT                   /old_locus_tag="DEHA-CDS0866.1"
FT   CDS_pept        580491..582863
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06578g"
FT                   /old_locus_tag="DEHA0F07238g"
FT                   /old_locus_tag="DEHA-IPF8550"
FT                   /old_locus_tag="DEHA-CDS0866.1"
FT                   /product="DEHA2F06578p"
FT                   /note="weakly similar to uniprot|P32833 Saccharomyces
FT                   cerevisiae YBR060C ORC2 Subunit of the origin recognition
FT                   complex which directs DNA replication by binding to
FT                   replication origins and is also involved in transcriptional
FT                   silencing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88976"
FT                   /db_xref="GOA:Q6BMC7"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC7"
FT                   /protein_id="CAG88976.2"
FT                   /translation="MTFEEKSSPENKGFNDSDIFLTPSKKHVSLSATPSHRQSPFDLTL
FT                   SPNKSPSKRGVIKLEKTADDIVLFSPVKTPNGRAGLPSPKKRTIAELDKSARKRAISTS
FT                   GIYSKLMDDDLEENNNEYLDRQEVSLAEAIIKESRDNKQEDVDEYFRAYGSDVELEEDL
FT                   TVNKKPKRRGRKPKKEVKVEEDDEIDDEDIEIEDDGELEDDDDEEFKLPKKERKAKNKR
FT                   IIREVSDIDDISEEDEAEKEILPKRQKITASPFAVTSVDEAISPSKRKVGRPSKASKVI
FT                   GKIKSIFQMDDEAFFTENKQATNRIKENADTSDVTKDSDSFFSMTLDNVTQSSIVSVPT
FT                   VSGIPNTKEGKRKVEVATVDSNKFIPLPIPNINEEGEIEDEEYVKKYLPNVNIEEKYSG
FT                   RLIDERAFFLDGTEGYFEQHMGRPKASANSLSQLAPPLEYDEFIPYVELSKLIRSKEKN
FT                   KLNDLHKSLYHQWCFELTCGFSLNFYGVGSKIKLIGDFVQNYLVDWYEQNMQEDEEYPD
FT                   ILVVNGYNPAVKFKKVAHDILSVFISQEKKKQDNVKFPKHISETIPFLMKYVEDRRVHR
FT                   PGQFIKPKLILVIHNIDGKPFLNERTQSLLSQLCSIPEIWLISSTDNINVSLLWDSFKL
FT                   KSFNFLWHDLTTYEPYTVEMSFRDVLSMGKSKKFVGNKGAKYVLSSLTKNARNLYKILL
FT                   TKQLEIMRNTTTTKAGRNGLKGSIKLGIEFKQLYNTCLEEFVTSNEISFRTMLGEFVEH
FT                   KMCSAVKDEAGVEMVFVPFNFDEMEKLLAEEFASNEM"
FT   gene            <583031..>586042
FT                   /locus_tag="DEHA2F06600g"
FT                   /old_locus_tag="DEHA0F07260g"
FT                   /old_locus_tag="DEHA-IPF8547"
FT                   /old_locus_tag="DEHA-CDS0467.1"
FT   CDS_pept        583031..586042
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06600g"
FT                   /old_locus_tag="DEHA0F07260g"
FT                   /old_locus_tag="DEHA-IPF8547"
FT                   /old_locus_tag="DEHA-CDS0467.1"
FT                   /product="DEHA2F06600p"
FT                   /note="weakly similar to uniprot|P38080 Saccharomyces
FT                   cerevisiae YBR059C AKL1 Serine-threonine protein kinase
FT                   member (with Ark1p and Prk1p) of the Ark kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88977"
FT                   /db_xref="GOA:Q6BMC6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC6"
FT                   /protein_id="CAG88977.2"
FT                   /translation="MGNFPKLPEGTQLPVGGHQVTILKYLSEGGFAHIYKVKIDPKEED
FT                   TDIACLKRVIVPDKNGLDQLRKEVDVMKNLRYGRNIVKYYDSHAARLENGTYQVLVLME
FT                   LCPNKSLLDYMNVKIKTKLTEPEILKIMSDISIGIYEMHKMKLVHRDIKIENVLIDAKN
FT                   DFKLCDFGSTSSPIMPPKDQQQFQLLSHDIMYQTTPQYRAPEMIDLYRGFPIDEKADIW
FT                   ALGCFLYKLCYYTTPFEANGDIAILHATFQFLPAPVFSGDLKNLIIIMLQENPLFRPNI
FT                   VQVLMLLCTMMKIEFKSLKLEDIYNTGPYNFHALHEYQRHKQNELLKQQQLYYQQNAYA
FT                   NGGKATSEVNLAKHYGNQIRSQNQSPFIRSQGGTPSQAYGQLNASNTADLQHQTQAELP
FT                   AALSHDLEPQKNKQEAGVTSPNNEVNSETEDDNTSEIGLENLDNVEERYPSLEDLLEDP
FT                   TKRTKSIDSDRVSQKDNAPPNLPNQNIRQPNMQNYGPQVPTQPVILSNADLQKLTPDQF
FT                   QQYHYQHQAYQYQLDQYQKQLYQQNEQQKHQQANALNPNSIDHNITTGKSKEPSEFEKK
FT                   EAWERHHSKIEKDAELLVDDIFATNSKSPALAPVQVQNTNQSAKGDIESLSKLKKSVSS
FT                   EYPSTSSDGHSKQHGEICAEDSIEPSIGAHNAQDAAGVFNDDGKEISSRSRHSLDGHNL
FT                   RPEGGHDQRDVFINDASNKVNDVDSFESFSGKYPDILSNMHIDAPFNSSPQTKVSNNSN
FT                   IPSINSSSTAAKYPFTYQQPSQQNVAYSNPKPDVNANKSDIRKHANPWGDYTKNANVAP
FT                   VKRVSSHSGIVNSQPASISNEPAPIIPVHEQMNALSLKERPSSMQQRGNSNEQSSEANL
FT                   IDLEVGLESSSSSTNTPALNPKTKDLYKLNTESSLSGFDLDDEKKPSESKHQFKKRLSS
FT                   AQNPSSFSFQEEVIDFASDDENPENSSEMNRLSIRNSLSKKPKSRKSSEHKRSDSANSE
FT                   GKKRLSLFGSSQGN"
FT   gene            <586245..>589085
FT                   /locus_tag="DEHA2F06622g"
FT                   /old_locus_tag="IPF_8541"
FT   CDS_pept        586245..589085
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06622g"
FT                   /old_locus_tag="IPF_8541"
FT                   /product="DEHA2F06622p"
FT                   /note="similar to uniprot|P42842 Saccharomyces cerevisiae
FT                   YNL313C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66285"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA7"
FT                   /protein_id="CAR66285.1"
FT                   /translation="MSSEKYLRSVLSQLVLSISAEKVDVPSEISSDLQPVTNCILYILK
FT                   GVSSKLIHEQDYYSLLFTDASKKILESFPSNDLYTVLNEYLHEVINNFEQRFQEETISK
FT                   LHLQIIAIALLQTFIQLNFTGPGIEFNSQQLFFPGVDEKTVQLESIKLINIEGEQAYEL
FT                   MVDPLFFIISCLLFEKLMQVDSRLSLVNKTLLAPLEEIIEATGNICSASPDDPVKASLQ
FT                   WWRARALQVHLSLISEPASVLSSVSSLLLNPSVANALAPAIDDNLELKKHIQLVYFLEC
FT                   ARSGIHSQTEHLAIPLLGKARQLSELNFVISGAKAKRTKFQTFHTSALIILAKSKKSTL
FT                   FDNENDNPETFGLESDLLLEKPQFESLDDLELQDEPNSKRIKIDEISTINDEEGDEEKL
FT                   LPIAMRQDDIPDELKALDPNEQPALNDLDSVQLLLRLTTLRQTTPSNNPLVEEELLALA
FT                   SRILYASSKSVNWSIFSRALWERSILETTKARTIERGILQMTSLVEEIGIKVKTRIIPQ
FT                   AMEEGDEEGSSAAASRLRFIHQLPLMPQWAMDMRLAEKYMSLGVLRSAVEIYERLQLSC
FT                   ETALCYAAADEEKEAERIILERINSHPEDARAVSILGDIRQDPNLWIKAWEIGKYSKAK
FT                   ASLSRYFYNPPQSSGLTKDLEQAIKHMNDCLTANPLSYEHWFFYGCCGLESHQYEVAAE
FT                   AFTRCVALDDTNSHAWSNLASALLRTDKTRPALNALKKAIRCAGESNKSWRIYENYLIV
FT                   AAKLNEWNDVLIAARELINIRGNSDGEGSIDIPIIEKLVEILVATEYPSAEDTRFTHYQ
FT                   KSCIDLVCNILPSVITKSARCWRIVARVELWRQKPWAALECHEKAYRALSQRPELETDE
FT                   SAWNEAIDSCSDLVAAYESLGELPGKHDAGDLVCKDWKYKAKTTVRSLMSKGKAMWEDS
FT                   EGWYRLQDMKEQLLNN"
FT   gene            <589431..>590534
FT                   /locus_tag="DEHA2F06644g"
FT                   /old_locus_tag="DEHA0F07326g"
FT                   /old_locus_tag="DEHA-IPF8538"
FT                   /old_locus_tag="DEHA-CDS3502.1"
FT   CDS_pept        589431..590534
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06644g"
FT                   /old_locus_tag="DEHA0F07326g"
FT                   /old_locus_tag="DEHA-IPF8538"
FT                   /old_locus_tag="DEHA-CDS3502.1"
FT                   /product="DEHA2F06644p"
FT                   /note="similar to CA5508|IPF745 Candida albicans IPF745
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88980"
FT                   /db_xref="GOA:Q6BMC3"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC3"
FT                   /protein_id="CAG88980.1"
FT                   /translation="MVDDKYIGLALAMSSSLAIGTSFIITKKGLIDASARNGSSQVQGH
FT                   EYLQNPIWWAGMITMAIGEVANFAAYTFAPAILVTPLGALSVIIGAVLAAVFLKEELGT
FT                   LGKMGCAICLMGSVIIVLHAPPDKEIETVDEILGYATKPGFLFYCFMVTLYSLFMIYKI
FT                   VPQYGHTNPMIYISICSSVGSISVMSIKAFGIALKLTLSGHNQFTYVSTYLFIGVVVLC
FT                   ILTQMNYFNKALDQFDTSIVNPLYYVTFTTFTLAASFILFRGFNTTSAINIISLLIGFL
FT                   IIFSGVYLLNISRKNNDGKDNREIFGVHNGKEMAPLDNGVGGFSSMRRSLQVNRQDYNE
FT                   EETVGLRRFDSFELGSDEDSQDYHQRT"
FT   gene            complement(<590769..>591227)
FT                   /locus_tag="DEHA2F06666g"
FT                   /old_locus_tag="IPF_8537"
FT   CDS_pept        complement(590769..591227)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06666g"
FT                   /old_locus_tag="IPF_8537"
FT                   /product="DEHA2F06666p"
FT                   /note="highly similar to uniprot|P38912 Saccharomyces
FT                   cerevisiae YMR260C TIF11 Translation initiation factor
FT                   eIF1A"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88981"
FT                   /db_xref="GOA:Q6BMC2"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC2"
FT                   /protein_id="CAG88981.1"
FT                   /translation="MGKTGKGKGGKNRRRGKNDNGGQKRELIYKDEGQEYAQITKMLGN
FT                   GRIEVSCFDGEKRMGHIRGKLRKKVWMSQGDIILVSLRDFQDDQCDVIHKYNSDEARTL
FT                   KNVGELPENAKINETDTFGADEDEDVNFEFGAEDSDEEEGEDLDIDDI"
FT   gene            <591421..>592356
FT                   /locus_tag="DEHA2F06688g"
FT                   /old_locus_tag="IPF_8536"
FT   CDS_pept        591421..592356
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06688g"
FT                   /old_locus_tag="IPF_8536"
FT                   /product="DEHA2F06688p"
FT                   /note="weakly similar to uniprot|P46963 Saccharomyces
FT                   cerevisiae YML112W CTK3 Gamma subunit of C-terminal domain
FT                   kinase I (CTDK-I) which phosphorylates the C-terminal
FT                   repeated domain of the RNA polymerase II large subunit
FT                   (Rpo21p) to affect both transcription and pre-mRNA 3' end
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66286"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR024637"
FT                   /db_xref="InterPro:IPR024638"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA8"
FT                   /protein_id="CAR66286.1"
FT                   /translation="MDSFEASTQFTQILKGLTPSIQNLTRAAHFALKNSESEDYLFHTI
FT                   IDTLDDPNIELNTKSTIFQFIEVLMHESLVISSQPKSHYTYPYVHNLKNSLPKILLKVL
FT                   PGSNNSSLYNAYNSLKNISETCKVNYDEYNKKYSGISELFTDEDLENIDTNLPFPDIKV
FT                   EDEIEASDPLITTWDLLIKKKKQSQYERLRLLKHSRMIEESVEEEDMFSYKGGKSQKDQ
FT                   NNGKANELLLSKKHILLRMEDDRETHKRSKENIWVVNRPKDASILTEDEFLVHYWNKYR
FT                   VMAEEEEKTFMDSLDELNGLVVESYKDKQF"
FT   gene            complement(<592448..>595874)
FT                   /locus_tag="DEHA2F06710g"
FT   CDS_pept        complement(join(592448..595775,595852..595874))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06710g"
FT                   /product="DEHA2F06710p"
FT                   /note="similar to uniprot|P38426 Saccharomyces cerevisiae
FT                   YMR261C TPS3 115 kD regulatory subunit of trehalose-6-
FT                   phosphate synthase/phosphatase complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88983"
FT                   /db_xref="GOA:Q6BMC0"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC0"
FT                   /protein_id="CAG88983.2"
FT                   /translation="MTIIIGTLFLPYTVKFDVGGRVDYDIDITQKDATVPNIQNDARNQ
FT                   QRKSVSAGMGTGISQSSILPSLSTSQQHTPRSGSPTFNDNASIMTGSDTDQVNSAQEFF
FT                   HSHKRTPHDSQNILTDNLYDKLGSKLIQPRSRYSNVAFQSSVVDPKKKSEDAGLPGLKI
FT                   NRSSNNLTSLNNSSFSSYSNMIGLNPTTNSSTMSVPSTRQRTPISRQGFTLHSNSSSNS
FT                   IPTRIKEVEEEEARESDYASDKSVDEDHIENFNDLVHGRTESKLTPFGGFSKPDLEDGI
FT                   LNQENIFEDAPWKVVLAGKGNVSLTKAVQIAVDAGGINDHKWVGTLAMPSDAVPNSVIN
FT                   GISDSLSENYDCEAVFPNDITFQGHYKSFCKQILWPTLHYQIPDDPKSKAFEDHSWGHY
FT                   KLLNQLVADKIVDLYKKENGSSDPNDPNNMIWIHDYHLLLVPKMIREKLPEAKIGLFLH
FT                   VSFPSSEVFRCFAQRKAILSGMLGANCITFQTDEYVRHFWQTCNRLLLADANEFGITYE
FT                   GKFTMINTIPVGVDAKSLEGYLGSNEVNEWRNMIRERWSNKKLIVSRDKLEKLRGIKQK
FT                   LLAYEKFLHSNPEYVDTTVLIQICPGTTQDSSYESEIMSIVGRINALTGDISFSQPVVL
FT                   LQQDIGFEQYVALQCEAEVFVVASMREGLNLTCHEYIIATTEKKSPLMLSEFTGSSPLL
FT                   NCNGEGAILINPWDLKRFAELFKVSLDMGQDEKVKRWTNCYKTICNHDSRNWVENCLQG
FT                   INEGWDYDHSRNLNKLIPFTRDIFDSFYSRNDGGKRLFFLNLDTPSAIASTNDPSSKFH
FT                   KLTSKSAVAAAGKNGAFSESSRFASLLNELLSDPLNHVYLTSYLKRSDLDTLYNRSPNL
FT                   GLVAENGGYIKLTESDKWISIIDEVELEGWMPQVSQLIASKVERLPGSHMEVEDCTIRF
FT                   HPGKSFENDRERSLSILGDCIQHVNELFSDQDGVHATLIRNVLIVQKNKLSMKALKFII
FT                   SYYNQKKQGIKSESLIEEYQVKQVPGSAPSTPISETASLPPIKSPTSKIQKNLVTALFL
FT                   SGGSTLIDEPGYEYANGLERSGEIPEVITVTVLGADSRTSATYCVSGKNELLGILSNPV
FT                   SEPYKSHTA"
FT   gene            <596059..>597099
FT                   /locus_tag="DEHA2F06732g"
FT                   /old_locus_tag="DEHA0F07414g"
FT                   /old_locus_tag="DEHA-IPF8533"
FT                   /old_locus_tag="DEHA-CDS3725.1"
FT   CDS_pept        596059..597099
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06732g"
FT                   /old_locus_tag="DEHA0F07414g"
FT                   /old_locus_tag="DEHA-IPF8533"
FT                   /old_locus_tag="DEHA-CDS3725.1"
FT                   /product="DEHA2F06732p"
FT                   /note="weakly similar to uniprot|P38430 Saccharomyces
FT                   cerevisiae YMR262W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88984"
FT                   /db_xref="GOA:Q6BMB9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB9"
FT                   /protein_id="CAG88984.2"
FT                   /translation="MNGYVQFLADSHCHLDVECSSQRAEELGNFLNTSESIIDRREFFH
FT                   IMSSNHVDIFHIDLILDKLENKTVLPYFGIHPWYSHLFTDLKLEEFENEQEWKQIHYES
FT                   VLDPTPPSELLEVLPNPISFDSHVNEIRRLANKHQKKGFSVGIGEIGLDKLFRIPSNGY
FT                   FGNQKLPLNDNPNKLSACRVKMDHQAYIFARQLKLASSLKRPISLHCVKAHGLLYDQVT
FT                   SKKELDGISSVILHSYSGSLDQAGLWIRHFSKSNRLLYFSLSNWINGSAKKQDSLKDLV
FT                   KLLGNDQILLETDVGIDKYLLDPERREEYFNQLKEIFIKICSIKGWGEDLAKEIIFDNW
FT                   NKSIAQ"
FT   gene            complement(<597317..>598063)
FT                   /locus_tag="DEHA2F06754g"
FT                   /old_locus_tag="DEHA0F07436g"
FT                   /old_locus_tag="DEHA-IPF8532"
FT                   /old_locus_tag="DEHA-CDS4828.1"
FT   CDS_pept        complement(597317..598063)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06754g"
FT                   /old_locus_tag="DEHA0F07436g"
FT                   /old_locus_tag="DEHA-IPF8532"
FT                   /old_locus_tag="DEHA-CDS4828.1"
FT                   /product="DEHA2F06754p"
FT                   /note="similar to uniprot|P00942 Saccharomyces cerevisiae
FT                   YDR050C TPI1 induced under stress conditions"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88985"
FT                   /db_xref="GOA:Q6BMB8"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMB8"
FT                   /protein_id="CAG88985.1"
FT                   /translation="MARQFFVGGNFKMNGTRESVSKIVDGLNKAELPSNVEVVIAPPAP
FT                   YIALAVNENKQKTIEVSAQNCFDKASGAYTGEISPEQIKDLGATWTLTGHSERRTIIKE
FT                   SDDFIASKTKFALDQGLSVILCIGETLEERKANVTLDVCARQLDAVARVVSDWSKIVVA
FT                   YEPVWAIGTGLAATPEDAQETHKAIREHLSKSIGADAAEKTRILYGGSVNGKNAPEFKD
FT                   KADVDGFLVGGASLKPEFVDIIKSRL"
FT   gene            complement(<598422..>599509)
FT                   /locus_tag="DEHA2F06776g"
FT                   /old_locus_tag="DEHA0F07458g"
FT   CDS_pept        complement(join(598422..599435,599495..599509))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06776g"
FT                   /old_locus_tag="DEHA0F07458g"
FT                   /product="DEHA2F06776p"
FT                   /note="similar to uniprot|Q99288 Saccharomyces cerevisiae
FT                   YDR051C"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88986"
FT                   /db_xref="GOA:Q6BMB7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB7"
FT                   /protein_id="CAG88986.2"
FT                   /translation="MGKPKYILLVRHGESEGNCDKSVNRYTPNHKVALTDEGHSQAKSA
FT                   GLVLKEFLQHVSSEDEDRNKTRNPKSILFYTSPYLRARQTCNNIIDGIKYVPGVMYKVH
FT                   EEPRMREQDFGNFQSTSEQMEKIWQERAHYGHFFYRIPHGESAADVYDRIASFNETLFR
FT                   QFQQDNFPNILILVTHGIWARVFLMKWFRWSYEEFESLRNIPHCQYLIMKKQSEGGKFR
FT                   LKTPLKTWDDLPDSDIDEEVVKREFGDEVCFNTKNKLANPEDFDITSIIQAQRDAIKSN
FT                   RYKDRQIKDAFQKSMNTDQHEKDTYPSSPSTLASRFTLDDQSVANSVSNSKHNSLENLQ
FT                   ED"
FT   gene            complement(<599762..>600833)
FT                   /locus_tag="DEHA2F06798g"
FT   CDS_pept        complement(join(599762..600746,600811..600833))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06798g"
FT                   /product="DEHA2F06798p"
FT                   /note="highly similar to Candida albicans Q5ADU3 Potential
FT                   translation initiation factor eIF3-gamma-p40 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88987"
FT                   /db_xref="GOA:Q6BMB6"
FT                   /db_xref="InterPro:IPR027524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB6"
FT                   /protein_id="CAG88987.1"
FT                   /translation="MNMATKQVKSYQAPTTTSIDVESSVVLSLIRHTSEHYPSLYSGAL
FT                   LGFESDSGALDITHAFAYPYPDQYEGGSLRSRSGAKYQQDILDSLKKLGYGIGFQGWFQ
FT                   STVSGNFVTTQLVDALVQQQLTNKNSFILIHNMASIGKELDLKAIRLSESFVRTYLDGK
FT                   WKSKDLENHKLSFLNIFDEIPIRIRNQHLVNLYLASSTNDTKSENEFDILNLSSNQNVT
FT                   AQLLESLYGQVDAYNYDQTNYNYYQRQHQKEQSKIMQWKQQRKLDNLERAKIGEKELDT
FT                   EEWQSLFKLPTEPSRYNNMLHSHAIDVLADDILKRCDEDLTKSFAIERKLTTDK"
FT   gene            <601065..>602846
FT                   /locus_tag="DEHA2F06820g"
FT                   /old_locus_tag="DEHA0F07502g"
FT                   /old_locus_tag="DEHA-IPF8529"
FT                   /old_locus_tag="DEHA-CDS1670.1"
FT   CDS_pept        601065..602846
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06820g"
FT                   /old_locus_tag="DEHA0F07502g"
FT                   /old_locus_tag="DEHA-IPF8529"
FT                   /old_locus_tag="DEHA-CDS1670.1"
FT                   /product="DEHA2F06820p"
FT                   /note="similar to uniprot|P15180 Saccharomyces cerevisiae
FT                   YDR037W KRS1 Lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88988"
FT                   /db_xref="GOA:Q6BMB5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB5"
FT                   /protein_id="CAG88988.1"
FT                   /translation="MSEEVAKVAEQLQKTYLDDVTGEQVSKTELKKRQKQRANDAKKAE
FT                   KAAKSAASAPKVAKKKDQLVDLNPNQYFEIRSRQIDELRQANLADGSAFNPYPHKFHVS
FT                   IQLPAFAEKYKDLKKGESLKDVEVKVSGRIMGKRESGSKLKFYVLKGDGVQIQIMAQAQ
FT                   DVENAEEYEKMHEYLRRGDIIGVTGYPGRTSPAKGGEGEVSVFATSVQLLTPCLHMLPT
FT                   EHYGFKDQEARYRKRYLDLIMNESTRDRFKVRSQIISFIRKFLDTRDFTEVETPMMNVI
FT                   AGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNP
FT                   EFTTCEFYQAYADVYDLMDMTELLFSEMVKKITGDYKVTYHPEGPEGKALTLDFTRPWK
FT                   RVNMIEELEKVFNVTFPAGDQLHTEETGKFLKQILIDHKLDCSPPLTNARMLDKLVGEL
FT                   EDASINPTFIFGHPQMMSPLAKKDRDNVGLCERFEVFVATKEICNAYTELNDPFDQRQR
FT                   FEEQARQKAQGDDEAQMVDETFCNALEYGLPPTAGWGCGIDRLAMFLTDSNTIREVLLF
FT                   PTLKPDALVKGEETSDN"
FT   gene            complement(<603005..>603910)
FT                   /locus_tag="DEHA2F06842g"
FT                   /old_locus_tag="DEHA0F07524g"
FT                   /old_locus_tag="DEHA-IPF8527"
FT                   /old_locus_tag="DEHA-CDS4230.1"
FT   CDS_pept        complement(603005..603910)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06842g"
FT                   /old_locus_tag="DEHA0F07524g"
FT                   /old_locus_tag="DEHA-IPF8527"
FT                   /old_locus_tag="DEHA-CDS4230.1"
FT                   /product="DEHA2F06842p"
FT                   /note="highly similar to uniprot|P38238 Saccharomyces
FT                   cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
FT                   methylates the 2'-O-ribose of nucleotides at positions 32
FT                   and 34 of the tRNA anticodon loop"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88989"
FT                   /db_xref="GOA:Q6BMB4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB4"
FT                   /protein_id="CAG88989.1"
FT                   /translation="MGKSSKDKRDLYYRRAKEEGWRARSAFKLLQLNEQFQLFKGVKRV
FT                   VDLCAAPGSWSQVLSRELFENQKQADAKIVSVDLQPMTPIEGVTTLQADITHPKTLQKI
FT                   LEIFGGEPADFVCSDGAPDVTGLHDLDEYIQAQLILSALQLTTCILKPGGAFVAKIFRG
FT                   RDIDLLYSQLSYLFERVICAKPRSSRGTSLEAFIVCLGYKPREGWNPILDLTKSTEEFF
FT                   EGANIGRSDNLEHLDLPEDEERLIAKFVACGDLNDVDSDATYTLDTNFKKLALDPVQMP
FT                   TAPPYKKALEMKRRGDLVRR"
FT   gene            <604086..>604889
FT                   /locus_tag="DEHA2F06864g"
FT                   /old_locus_tag="DEHA0F07546g"
FT                   /old_locus_tag="DEHA-IPF8526"
FT                   /old_locus_tag="DEHA-CDS4472.1"
FT   CDS_pept        604086..604889
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06864g"
FT                   /old_locus_tag="DEHA0F07546g"
FT                   /old_locus_tag="DEHA-IPF8526"
FT                   /old_locus_tag="DEHA-CDS4472.1"
FT                   /product="DEHA2F06864p"
FT                   /note="weakly similar to uniprot|Q03201 Saccharomyces
FT                   cerevisiae YDR041W RSM10 Mitochondrial ribosomal protein of
FT                   the small subunit has similarity to E. coli S10 ribosomal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88990"
FT                   /db_xref="GOA:Q6BMB3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMB3"
FT                   /protein_id="CAG88990.1"
FT                   /translation="MLSRILGVRNHSFRAFSTIGVCYNKSNTSPKKYLSPNEFASQKQV
FT                   DEIEEQAYKQNLLNEEYKYDPKYLSENELNPISKRPIPLNVELLKYKPVQLPPTHGHEV
FT                   AKIEFKGYDKDDLIRASEFAARAAFYLGIPCSKVQSLKTEKRLYTVIKSPFAQAKSKEN
FT                   FKRTTYGRKVYAYDATPEVVDLWLSFINKHAIEGVKYNALIHTRESLDFCEKLDALSAD
FT                   DMHMPDAYKGSDDPIANKVEELLKSDTFKKYFDEANIAESPKESK"
FT   gene            complement(<604955..>605636)
FT                   /locus_tag="DEHA2F06886g"
FT                   /old_locus_tag="DEHA0F07568g"
FT   CDS_pept        complement(join(604955..605565,605621..605636))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06886g"
FT                   /old_locus_tag="DEHA0F07568g"
FT                   /product="DEHA2F06886p"
FT                   /note="weakly similar to uniprot|P38239 Saccharomyces
FT                   cerevisiae YBR062C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88991"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB2"
FT                   /protein_id="CAG88991.2"
FT                   /translation="MSTYEDDHNINTSTTPSNNDNRHGRQHQTLSTIIDSFLTQDTQQG
FT                   SSENSHEAFTNALRVMNTEEGSTLALELMNSLENSELNLNDNKEKGVSQDFLDSLERVS
FT                   INDLPNKDTADCPICTNKFIDDKYPLLVKLPCSVQQINGKKAKGHIFDLECIGPWLKMN
FT                   STCPLCRFDVLEVNKKRKEKLEEELRKAKEEDDEEEEEEYWDDYG"
FT   gene            complement(<605808..>607004)
FT                   /locus_tag="DEHA2F06908g"
FT                   /old_locus_tag="DEHA0F07590g"
FT                   /old_locus_tag="DEHA-IPF8524"
FT                   /old_locus_tag="DEHA-CDS3202.1"
FT   CDS_pept        complement(605808..607004)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06908g"
FT                   /old_locus_tag="DEHA0F07590g"
FT                   /old_locus_tag="DEHA-IPF8524"
FT                   /old_locus_tag="DEHA-CDS3202.1"
FT                   /product="DEHA2F06908p"
FT                   /note="weakly similar to CA5943|IPF3490 Candida albicans
FT                   IPF3490 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88992"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB1"
FT                   /protein_id="CAG88992.2"
FT                   /translation="MSFNTEQLDTKLDGLTLGDSYKQEKFSENNRSNSENIPNVAQGTD
FT                   LTIPGKISYIDKPKTSLLSSSLAKDFPHAHANALSPTVGERDVNLYMNMDDRMDTETNL
FT                   TDDHPEPIILASSVGKEIDGRLIPSSSTISLLSLNGQNSGQGGCYDTTEVDGNGGSSGY
FT                   GTMTSPKNSNNHFAGNYNYSHITSNTTPQTAFMDRKSGHNNITSRNSLTHLNQIRLQPY
FT                   QRFSSPSSQQPFIQQETTSSTTCQSIPIENKSSIIVPDSPSLDPTSVGGSPSGLWLSSQ
FT                   TPSKPSTGSFKNNSRSELFHMMQSQQQKQNYDSMQPAEPIHSIQPTSQSTNQLIYNANA
FT                   SNNYTTTSTISYLKIDGSTSPILHPVQTPSEDPPMTPLYLNSNSLSQNDVGYFGNLAE"
FT   gene            complement(<607307..>609001)
FT                   /locus_tag="DEHA2F06930g"
FT                   /old_locus_tag="DEHA0F07612g"
FT                   /old_locus_tag="DEHA-IPF8522"
FT                   /old_locus_tag="DEHA-CDS1787.1"
FT   CDS_pept        complement(607307..609001)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06930g"
FT                   /old_locus_tag="DEHA0F07612g"
FT                   /old_locus_tag="DEHA-IPF8522"
FT                   /old_locus_tag="DEHA-CDS1787.1"
FT                   /product="DEHA2F06930p"
FT                   /note="similar to uniprot|P32891 Saccharomyces cerevisiae
FT                   YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
FT                   pyruvate transcription is heme-dependent repressed by
FT                   glucose and derepressed in ethanol or lactate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88993"
FT                   /db_xref="GOA:Q6BMB0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB0"
FT                   /protein_id="CAG88993.1"
FT                   /translation="MFTTRLALSHRSVLRKSIPTISRRFNSNRASNKRSNLVNGIFGSI
FT                   IIGSIGIAYKYGQDSIRHSPPSDVFPLESTTKLENISPPKYCSENELLQAVKELKELLG
FT                   DENVFNSKVELEHHTKNEFTHHLPREHEKPRYVIYPLSTEDVSESMKILFKYNVPVVPF
FT                   SAGTSLEGHFFSTRQGISMNTSRMDKILRVHHDDLDAVVQAGVNWQKLNEELAPHNLMF
FT                   GTDCGPNGLISGMINTNASGINASRYGAMISNVISITVVLADGTIVKTKQRPRKSSAGY
FT                   NLTGLFIGSEGTLGIVTEATVKLHVKPHFETVVVGQFPSILDSTNTVAQIYRAGIQPNA
FT                   IELLDKEMMHCINYSGYFTRHWLECPTIFFKIGGINETVVTEYVNKLKQISMQNNCEEF
FT                   IFAQNEEEQEELFSARKNAFYAILNYGRNEIDEDVRLWVTDIAVPLSKLSPVLTKVDEL
FT                   IKKSGLRSVILGHVGDANFHADVFYKPDEKKKCETLIHEMMLLGLENEGTSSGEHGIGN
FT                   GKRKYLELELGIDAVDLMRRLKFSLDPKRLLNPDKIFKIDPTDDREY"
FT   gene            <609712..>609784
FT                   /locus_tag="DEHA2F06952r"
FT                   /old_locus_tag="Deha0F.8"
FT   tRNA            609712..609784
FT                   /locus_tag="DEHA2F06952r"
FT                   /old_locus_tag="Deha0F.8"
FT                   /note="tRNA Arg (TCT) cove score=75.37"
FT   gene            <609792..>609882
FT                   /locus_tag="DEHA2F06974r"
FT                   /old_locus_tag="Deha0F.9"
FT   tRNA            join(609792..609829,609846..609882)
FT                   /locus_tag="DEHA2F06974r"
FT                   /old_locus_tag="Deha0F.9"
FT                   /note="tRNA Phe (GAA) cove"
FT   gene            complement(<609999..>610955)
FT                   /locus_tag="DEHA2F06996g"
FT                   /old_locus_tag="DEHA0F07700g"
FT                   /old_locus_tag="DEHA-IPF8520"
FT                   /old_locus_tag="DEHA-CDS4043.1"
FT   CDS_pept        complement(609999..610955)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06996g"
FT                   /old_locus_tag="DEHA0F07700g"
FT                   /old_locus_tag="DEHA-IPF8520"
FT                   /old_locus_tag="DEHA-CDS4043.1"
FT                   /product="DEHA2F06996p"
FT                   /note="weakly similar to CA4360|IPF6050 Candida albicans
FT                   IPF6050 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMA9"
FT                   /protein_id="CAG88994.2"
FT                   /translation="MLRSQSISNLNEQRKSKMGFLSSLRSRKSSSNDLHSKLISEPSNM
FT                   QKNKPRPLSSSVSSINLNQKFHEPTDHSSYSSNVSRQRQGSISTEDKENVSSIPRLKSR
FT                   RNLQNTTESRTLKTRSSAPNLNKSKRTSMFTNSVTATPVINIFPDSNDNIIDESSVETP
FT                   ELISPETITDMNDSLYASPIHLELIDDEFSDEDLQSRKLHRTTNLTNINDFIRLIDDGE
FT                   KYQSGNYLPINNRKSLDFEKFERNKIRKSLQTNLDKECSTNFISSLNLVENAVFLSIEK
FT                   YQNSQNDFVNFLEDDDYINAIKNDPYDNESDEYYLNF"
FT   gene            complement(<611132..>612913)
FT                   /locus_tag="DEHA2F07018g"
FT                   /old_locus_tag="DEHA0F07722g"
FT                   /old_locus_tag="DEHA-IPF8518"
FT                   /old_locus_tag="DEHA-CDS1856.1"
FT   CDS_pept        complement(611132..612913)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07018g"
FT                   /old_locus_tag="DEHA0F07722g"
FT                   /old_locus_tag="DEHA-IPF8518"
FT                   /old_locus_tag="DEHA-CDS1856.1"
FT                   /product="DEHA2F07018p"
FT                   /note="weakly similar to uniprot|Q08622 Saccharomyces
FT                   cerevisiae YOR205C FMP38 The authentic non-tagged protein
FT                   was localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88995"
FT                   /db_xref="GOA:Q6BMA8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMA8"
FT                   /protein_id="CAG88995.2"
FT                   /translation="MLGRIRPFVRYSVFRAGTYRTLFTSPYRMQISLIYNLFATCNSCG
FT                   IKLQNENPSKPGFYRPPSARPKLVKPEDESFNRLMDGLSVEDRKLLLNSSDATLPQPVT
FT                   ASTAAATTTNTKKEGDIQCIRCREAMYKSNFSWDELPVESIDKIMSTIPPDGNVVYIVN
FT                   AVDFPLSLNRSIFKYRNPSQITFLVTKCDLLFPSAQLSNRYGATFFKDYLSRTHGADPE
FT                   KVFVTSGMIDWNMKDIIKALPDNSYMVGGVNSGKSTVIKSLLYTMEKSKPNYLSSKQQT
FT                   KLEKQQDRMINSNAVNRHQHTKSQRKVEQKFKMTYGPGTSYMPGFTRGHIVHDIDGKTI
FT                   VDVPGFSANESHGIYGYLDPSTIKTLSKGVKVHKRGMYDSLYESVRNGQVLTIGGLFYL
FT                   ATPQNAVYQIKNCINHKFHVFNSMDKAISILQTIEKNKALENVFLVNKQSLDKLQKFII
FT                   PPFYGSIDLVIKNLGHLNITPTGKKIDNEPLVIYLPEGVEAIIRQPLTRYITRSLAGRD
FT                   KNGNPLRKELWKSKSVTHLQRFNGTTPFASLLIPSTGSDNLQCISEYNSKLNDTPITYD
FT                   NNTHLDESNKYKYWVNI"
FT   gene            <615258..>617225
FT                   /locus_tag="DEHA2F07040g"
FT                   /old_locus_tag="IPF_8511"
FT   CDS_pept        615258..617225
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07040g"
FT                   /old_locus_tag="IPF_8511"
FT                   /product="DEHA2F07040p"
FT                   /note="weakly similar to uniprot|P14922 Saccharomyces
FT                   cerevisiae YBR112C CYC8 General transcriptional co-
FT                   repressor acts together with Tup1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66287"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA9"
FT                   /protein_id="CAR66287.1"
FT                   /translation="MSNMKRTCGFGDVEDGRYRDSAIETWVAVGDCSLALGMMKAAKHS
FT                   FEYAMKHDPSNSRALVGLAYSLRMKDGKVKDGQQTKNGSGSQEAADRLTMALEKYPHVT
FT                   HTGEVMQELGECYFSMGMVEQAHSAVQRGLQADESHTGLWLLNGKVLHRAGRNAQAVDG
FT                   LRRCLSLLPRSLETCTRDEINVARLAHAELAAIATTEGNSEGAVAELVAALSLPPPSLD
FT                   KVDEHIALWCGLATARERANDLVGALQTCDEAERVVGNSPRILLTHAYLLLSTDDRYAH
FT                   TAIDLLEMLVKSEGEHAQANDDGDFLPWYLTGKAYSKLDSPRAAYDSYQVAFRRAPKSP
FT                   IPWLAIGKLYLQLNQLPDTLAAYSQALRLQVDEKSPATATAWDGLSCVYERSNGQLMDA
FT                   ADACNRAATCFKLMGDADSAQFFENRTRQLQMAASREGPVPPLRDAPDVPNSLLRELVV
FT                   LLPSERIAFVQGTETSYTHQPPQQNVNSPPAQRQRSQTPTNGSVQTPQPRPSQPVVPQH
FT                   YQVQQPYKQLHDNSPRQNLAPPHQMWSPNQQQHQQRQYTPNIPPPAMANPNQYPHYFYQ
FT                   QPPSNGLPPGAMPAHNQQVLQRSPLNNPQMIRNDLQQPMGPNMVPGPPPPPPPPGYAYG
FT                   QYMPMQGAMNFPSPANNWSK"
FT   gene            complement(<617457..>618299)
FT                   /locus_tag="DEHA2F07062g"
FT                   /old_locus_tag="DEHA0F07777g"
FT                   /old_locus_tag="DEHA-IPF8508"
FT                   /old_locus_tag="DEHA-CDS4461.1"
FT   CDS_pept        complement(617457..618299)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07062g"
FT                   /old_locus_tag="DEHA0F07777g"
FT                   /old_locus_tag="DEHA-IPF8508"
FT                   /old_locus_tag="DEHA-CDS4461.1"
FT                   /product="DEHA2F07062p"
FT                   /note="weakly similar to uniprot|P25616 Saccharomyces
FT                   cerevisiae YCR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88998"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMA7"
FT                   /protein_id="CAG88998.1"
FT                   /translation="MNKLTNSLKALKPKSTPKLFVIDWDETITNEDTIKLVAQAAYNKK
FT                   LEYEPKFDHFTDIYLKAFNEYNQDFTSKYGERDTIEKEIKFQTGMQNVEMKSINEIKRL
FT                   RLFEGIAEDEFQAQANHVTLKPHFTDFLGKCQELKIPVIILSVNWTKLIMEAVLQKIGF
FT                   KENENLKIMVNELEFVNGISTGNFNESISIRTGLDKLNIVNSLIKQYGKTCYIGDSMTD
FT                   LLSLIDSDIGIAIEEGSVIESVKKLNFPIKNLSEAEELHKEEVYVGNWSQVINLLNKH"
FT   gene            <618493..>618912
FT                   /locus_tag="DEHA2F07084g"
FT                   /old_locus_tag="IPF_8506"
FT   CDS_pept        618493..618912
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07084g"
FT                   /old_locus_tag="IPF_8506"
FT                   /product="DEHA2F07084p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMA6"
FT                   /protein_id="CAG88999.1"
FT                   /translation="MSKQGNQELPPLGELGNIAREASDQNIDPKTPLKDAENKVREESE
FT                   GSAKFENQKAPGKFEGEHNKGKFEEGKNPDTSGKFEGKFESKDKGDLGKFESKDKDSLG
FT                   KFESADKKDLGKFEGKFESNEKDRLGKFEGSFEQK"
FT   gene            <619159..>619590
FT                   /locus_tag="DEHA2F07106g"
FT                   /old_locus_tag="IPF_8502"
FT   CDS_pept        619159..619590
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07106g"
FT                   /old_locus_tag="IPF_8502"
FT                   /product="DEHA2F07106p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66288"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB0"
FT                   /protein_id="CAR66288.1"
FT                   /translation="MSTNKSNKEASEQNSIPQSTAETNSQSDVESTSADNGAPSTEQQQ
FT                   SIMNLFRNALNPNGENPQVDEYLTSTFGYLQNVFNKMQTAEDKDATAEEIAQDLTDRFD
FT                   KWISERENKKKDSDKKEESDKQEESEKEGTEPLKIEEVD"
FT   gene            <619791..>620882
FT                   /locus_tag="DEHA2F07128g"
FT                   /old_locus_tag="DEHA0F07887g"
FT                   /old_locus_tag="DEHA-IPF8501"
FT                   /old_locus_tag="DEHA-CDS3542.1"
FT   CDS_pept        619791..620882
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07128g"
FT                   /old_locus_tag="DEHA0F07887g"
FT                   /old_locus_tag="DEHA-IPF8501"
FT                   /old_locus_tag="DEHA-CDS3542.1"
FT                   /product="DEHA2F07128p"
FT                   /note="similar to uniprot|O74916 Schizosaccharomyces pombe
FT                   SPCC757 SPCC757.05c protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89003"
FT                   /db_xref="GOA:Q6BMA2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMA2"
FT                   /protein_id="CAG89003.2"
FT                   /translation="MVADTERSSHEDLEDFKVGELSLLSLHKSLVDTPSVSKSELKISQ
FT                   LLKDSLEKAGLTVELQMVGSGPQRYNVYAYIGKTRDTKVLVTSHIDTVPPFLPYHVDGT
FT                   KIYGRGSCDAKGSVATQIMSYLSLFKSGDLKEGDAALLFVVDEESSGLGMRNVSKSLNA
FT                   SWESGIFGEPTGLKLGVGHKGIYTFDIEVDGKASHSGYPELGISATEILIPVLDKLLKM
FT                   KLPESKLLGPSTLNIGMINAGVAPNVLPENATSSLSIRVADNLPKVREIVSETIGNVEH
FT                   LTLKPEVQVDAQYLDYKVPGFDSVILAYSTDIPRLTVKLKHRFLYGPGSIHVAHAANEY
FT                   IENSDLISAIDGYQKLIKHALQN"
FT   gene            <621308..>622399
FT                   /locus_tag="DEHA2F07150g"
FT                   /old_locus_tag="DEHA0F07909g"
FT                   /old_locus_tag="DEHA-IPF8500"
FT                   /old_locus_tag="DEHA-CDS3541.1"
FT   CDS_pept        621308..622399
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07150g"
FT                   /old_locus_tag="DEHA0F07909g"
FT                   /old_locus_tag="DEHA-IPF8500"
FT                   /old_locus_tag="DEHA-CDS3541.1"
FT                   /product="DEHA2F07150p"
FT                   /note="weakly similar to uniprot|P25617 Saccharomyces
FT                   cerevisiae YCR016W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89004"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMA1"
FT                   /protein_id="CAG89004.2"
FT                   /translation="MSQNIPAWKKIGLKIKDDVQDDPIALTTHIEDVKVTNKQAKKLNK
FT                   QKRKLEESNNDDKREPKRVKLPKSERAPPPEKDQLAYLRQYENDKLNWKFSKQKQNWIL
FT                   KNIKNIPKDYEAALQSYLEGLQGGSRKRVVDDLMEVIKKWNKAAEEAEARVEREIQRQL
FT                   SGETTKDDDEDEEKNEDKKAKRQTSESEETVPDYDYAKRCGVLVKILNDEDIELKGIAI
FT                   TDDDIKIGGIGEDSEQSTEVTEEIKQTDGEEEEGNKESDNVQDNLTIDEVEVSGLSKSD
FT                   GHIDRIERNKEKSNDISREKESHETTSEEPASEQELQAKEEKKDKSKKKNKDKVKDSSE
FT                   GKITKSKKDKKEKKKDKKKKNKD"
FT   gene            <622549..>626403
FT                   /locus_tag="DEHA2F07172g"
FT                   /old_locus_tag="IPF_8499"
FT   CDS_pept        622549..626403
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07172g"
FT                   /old_locus_tag="IPF_8499"
FT                   /product="DEHA2F07172p"
FT                   /note="similar to CA4354|IPF3647 Candida albicans IPF3647
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66289"
FT                   /db_xref="GOA:B5RUB1"
FT                   /db_xref="InterPro:IPR013932"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR039852"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB1"
FT                   /protein_id="CAR66289.1"
FT                   /translation="MKSVDNHVYLILFQVLEKIIIRTMPEINFNSLKDKALDVDPDLRF
FT                   MALEDFKKYLNEPTTAASTKSIESFIPLLFRLLKDTNPNVQSQAVKSFAPVIRFISSES
FT                   ILKLLNQLHDEILKENTAGHKDYKKITTSIPNMTLRSIFNTNSKFSNRLSRSIVDSFIP
FT                   KLINNVITIDSIELLIDLIKNLGFVLTNEEITNLLHTTMNIAFEEENIIGKRSVIAFDL
FT                   LLNYLDNTESSCNILNDLVKQISSKFDSLPKSSHSINLRLSLFSVILKSVQTYDGYDGS
FT                   IFYGVTIKHIFQIAITYMKVEDLETELDVEDYDFDLMIQENLIREIALNTINDLINALP
FT                   LELFEAYLNDTVKLIQTFISYDPLNFDNDNDIDLDEESEIEFSDDEDDINNNDDYENDC
FT                   SWKLRNKSAILTRTLTSRYPTILPLVYSELIPCMTDAMNDRNEIVSNDSIKTLITIINS
FT                   TSADNEVITNSRKVGRSGSDVSMTLENSPISQLFRDVTPILENKIFNNLLVSKKINRFP
FT                   IFLKLIESLITTNHHLSTEFLDEIFNAIKGLNLKTSGNMEYLSLYKTIFLNNDINEVSK
FT                   NFVNYILSDLSMSIDNKTSYHNIIMESLNISIIIFQNFKRIDRLNFFESQIQKLFHSII
FT                   KICHDKQYSSELRQKSISALSELNVNIEINEDSFRKTTDILKESLNYEVTVKVTIESLI
FT                   KIFNKKCKNFWRYLKEIDFVNFLIAKSIAFISSTDDSLYYISLKLLDIITKIQHIDNLE
FT                   DDQANKLLSLLVNFSESTNDYTQLYLLFNIIGRILTNCQTDDKFLQGMIKIMNEKLTDV
FT                   DDFDLTSFEFLIQQLSRKLCNENLSEIFMTSLNLKLFISAKTLSIITLENNLQDKIDEA
FT                   EVELNHYINKDISISNDKILFDIQFLGSIGSQKELRSITLASFLQLLKNSNESIRLASS
FT                   RSIGLLIVKDINKDLPLLLDNYEDNQDERDLNLISMKQLLKNDNLNNSILLKIWDRIWK
FT                   TISRYDEKVISSTSELRLSGDVLSRMCLVNNEYISNLIDKVDSASNESIIYTIIVILKQ
FT                   LMYKLESNNDILSTLLLHNLKFLTLSNIEIKQALIGTLLTGLHNKSELLLPILPNRVLP
FT                   LLYDELSAKDEFKKIIPMGPYKYVIDEGLEIRKLCYELLYTIILFDDSLLKANNINIYE
FT                   IGLNIVNKGLTDSETDIVILSSINLVNLVNKDFNFLIYNNELLPKLIDVLKLNLNKKLK
FT                   SKASTQETETFEESLRSVVKLSKVINNSLLINNYNNNDWNLFYTEMKTNYILTFNSVDI
FT                   "
FT   gene            <626856..>627092
FT                   /locus_tag="DEHA2F07194g"
FT                   /old_locus_tag="DEHA0F07953g"
FT                   /old_locus_tag="DEHA-IPF8498"
FT                   /old_locus_tag="DEHA-CDS7680.1"
FT   CDS_pept        626856..627092
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07194g"
FT                   /old_locus_tag="DEHA0F07953g"
FT                   /old_locus_tag="DEHA-IPF8498"
FT                   /old_locus_tag="DEHA-CDS7680.1"
FT                   /product="DEHA2F07194p"
FT                   /note="some similarities with CA0264|IPF8434 Candida
FT                   albicans IPF8434 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89006"
FT                   /db_xref="GOA:Q6BM99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM99"
FT                   /protein_id="CAG89006.1"
FT                   /translation="MQESVHGNTSIASAVVDSTNNAIDQGFLLLDTLLYYIFNAVVLLL
FT                   NLTDVVGEFTEKVSFNYQIVYTSFKHKLYNNIN"
FT   gene            <627450..>627557
FT                   /locus_tag="DEHA2F07216r"
FT                   /old_locus_tag="Deha0F.10"
FT   tRNA            join(627450..627486,627521..627557)
FT                   /locus_tag="DEHA2F07216r"
FT                   /old_locus_tag="Deha0F.10"
FT                   /note="tRNA Pro (TGG) cove"
FT   gene            complement(<627715..>629781)
FT                   /locus_tag="DEHA2F07238g"
FT                   /old_locus_tag="DEHA0F08019g"
FT                   /old_locus_tag="DEHA-IPF8497"
FT                   /old_locus_tag="DEHA-CDS1236.1"
FT   CDS_pept        complement(627715..629781)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07238g"
FT                   /old_locus_tag="DEHA0F08019g"
FT                   /old_locus_tag="DEHA-IPF8497"
FT                   /old_locus_tag="DEHA-CDS1236.1"
FT                   /product="DEHA2F07238p"
FT                   /note="highly similar to uniprot|P49367 Saccharomyces
FT                   cerevisiae YDR234W LYS4 Homoaconitase catalyzes the
FT                   conversion of homocitrate to homoisocitrate which is a step
FT                   in the lysine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89007"
FT                   /db_xref="GOA:Q6BM98"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR039386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM98"
FT                   /protein_id="CAG89007.1"
FT                   /translation="MALLYLSTRSSLKKTGARCLSSSSILYRGQNLTEKIVQKYAVGLA
FT                   DDKKVFSGDYVTIKPAHCMSHDNSWPVATKFMGLGATNVHDNRQIVCTLDHDVQNKSEK
FT                   NLEKYHNIENFAKEQGIDFYPAGRGIGHQIMIEEGYAYPLNLTVASDSHSNTYGGIGSL
FT                   GTPIVRTDAASIWATGQTWWQIPPVAKVELVGQLPKGATGKDIIVALCGIFNNDEVLNH
FT                   AIEFTGEGVKNLSVDYRLTIANMTTEWGALSGLFPVDETLVNFYDERVKKLPQPHPRVN
FT                   ENTVKNLSENKVNSDNDAVYAKHLVVDLSSLSPYISGPNSVKVSTSLHDLSKQNIKINK
FT                   AYLVSCTNSRLSDIKAAADIIKGHKVAEGVEFYVAAASSNVQKDAEAIGAWQDIIDAGA
FT                   KPLPAGCGPCIGLGTGLLEDGEVGISATNRNFKGRMGSKDALAYLASPEVVAASAVLGK
FT                   IGGPEELQGNPVPTNPEIVRSITSNESTETVDPDASGSSVDVLDGFPQSIEGELILCDA
FT                   DNINTDGIYPGKYTYQDDIPRSKMAEVCMENYDSEFKQKTKAGDIIISGYNFGTGSSRE
FT                   QAATAILARDMKLVVAGSFGNIFSRNSINNALLTLEIPALINKLREKYAQSNELTIRTG
FT                   WFLKWDVTKNQVTVSDSEGNLILTQKVGELGTNLQDIIVKGGLEGWVKAQLKN"
FT   gene            <630019..>630855
FT                   /locus_tag="DEHA2F07260g"
FT                   /old_locus_tag="DEHA0F08041g"
FT                   /old_locus_tag="DEHA-IPF8495"
FT                   /old_locus_tag="DEHA-CDS4328.1"
FT   CDS_pept        630019..630855
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07260g"
FT                   /old_locus_tag="DEHA0F08041g"
FT                   /old_locus_tag="DEHA-IPF8495"
FT                   /old_locus_tag="DEHA-CDS4328.1"
FT                   /product="DEHA2F07260p"
FT                   /note="similar to uniprot|Q03530 Saccharomyces cerevisiae
FT                   YMR274C RCE1 Type II CAAX prenyl protease involved in the
FT                   proteolysis and maturation of Ras and the a-factor mating
FT                   pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89008"
FT                   /db_xref="GOA:Q6BM97"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR039731"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM97"
FT                   /protein_id="CAG89008.2"
FT                   /translation="MYTITKAFVLCIIVAISYVATIHVGVPEHIKGIERNNPDVIHHRI
FT                   VRITTLCSILILVLPMMLTYMGGYPSYISVIWSFGLVPGMTLSGHLATDIVNIFRSIKL
FT                   ISILYMGPILDYPWEIQFDASIAQQDFYDCFYSIWGVRDHIFAPITEELIYRSVLLTLL
FT                   QPFESISDLQKILLTPLFFGVAHVHHGYDLYKNRNVDFSTAALTVVVQVMYTTVFGVLS
FT                   NYLFLETGNNLWCPIVVHCICNLMGFPNLSVDRPLFWTITYYLLLIVGICGFIKLL"
FT   gene            <631326..>635162
FT                   /locus_tag="DEHA2F07282g"
FT                   /old_locus_tag="IPF_8493"
FT   CDS_pept        631326..635162
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07282g"
FT                   /old_locus_tag="IPF_8493"
FT                   /product="DEHA2F07282p"
FT                   /note="weakly similar to uniprot|P50111 Saccharomyces
FT                   cerevisiae YMR273C ZDS1 Protein that interacts with
FT                   silencing proteins at the telomere involved in
FT                   transcriptional silencing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66290"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="InterPro:IPR040206"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB2"
FT                   /protein_id="CAR66290.1"
FT                   /translation="MSEDEIVDQTRSYESAAKDIEQEKKMVAALKRLSISNMMSYDPDL
FT                   PIEDMEYQYQYQQQNDDSANKSPPKLSQVRRSSSLSHNSSLKGRPSPSEDAMLQIQGTV
FT                   EDNASDQPQQEQELDTETLLWVPANLHPEVDPEQFKIHVKTTVGEIMERKSSRKNSLSR
FT                   HSSLSSSFLADDREETNPSEPETPEKNIQNNNNLEAEQQSYQEKRFSNPSLRDLSFELE
FT                   NLSRIAGMDSTDAVTIARTLSSSSLGYTDVEKQAFDELSSPPHVSPNNSTRRRETDTTQ
FT                   NKAFVDPESPTSRKTVNRLPQEYAYDHSSQHQQHTQQLPRQHQSYQMPKSQFSPNDFSL
FT                   KRSRRLDYRKLSNPSASGSSLQNNKAGKLAELRNNLNSPSQSPVTHQYHLPKQPEHKSK
FT                   SKQRNARDSQLLFSYRNPNVPPEAQSSNDSPYPNSASSSSPLEQQFNTHKFSQHNLTAK
FT                   RISHIKSHKDQYGLPQKQGYSRTSSRSSSGGSGNKSIQSFEKEKARPIQSPPTQPFPSH
FT                   TINKQKIPPPQNQYRSDNGKHHHRSHGRRNNNSAQQIPSQSNNYVFQLQIPKTRSEGKK
FT                   LVSQTDLIKKESVPRIKISKEPSNNITENKSTQLNQNLDLLRSEINEFKESLTKIDSPA
FT                   SSESRSISDSDLPESSDNNESDFSFEASYQNISYEDSLGIEKDVLKELNREKITNINDV
FT                   ESDLEYGKANPFVSSPKQKLIQEPVSEFIGREKNDNNEELLKATDFDIDFDQNENKDAI
FT                   ELSAIDQEPLINEIADIPDEEFISRSNEPISQASPAGEVQNKKSFGLLPNHSSSSFNSD
FT                   TSESKKSLKKKKSWPWLKERSASFSTSDGNKLPSLPEAKSPSRSFSTPETPTKKRQEQE
FT                   QIVKEVPKAHDVKPSGSIGKENMISKFFKKKRSNSSTSVSSSSDVTNMETKPGQDSGVT
FT                   VDYESDSEAKKNLQGKLKGGIFKKMNRNKMHEKEKERLQSLKSTSVTSLVSSIDKGSST
FT                   EDLLEPEASRETKNLQDSGRDSQYSPNNVLDVGKQKEIERSSELRTENDEETLMNYSKG
FT                   KERETEKTKPKIKTNLLGSRKEKALRKSDHVKTEISKQDTEGEPDQVDVDDSGRSTVKV
FT                   KTDEEKEVSRSALDIQEKLKKSIKRTSKANQPIEFTDSAFGFPLPPPSQSTLVMLDYRF
FT                   PVHVERAIYRLSHLKLANPKRSLREQVLLSNFMYAYLNLVDHTLHLEQLNNSSENTTEV
FT                   VDDTKELNFATDDLMVSDDELEETKNELDSDQVSIDLDIVDLSNTSATRAETE"
FT   gene            <635560..>636690
FT                   /locus_tag="DEHA2F07304g"
FT                   /old_locus_tag="DEHA0F08118g"
FT                   /old_locus_tag="DEHA-IPF8491"
FT                   /old_locus_tag="DEHA-CDS3396.1"
FT   CDS_pept        635560..636690
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07304g"
FT                   /old_locus_tag="DEHA0F08118g"
FT                   /old_locus_tag="DEHA-IPF8491"
FT                   /old_locus_tag="DEHA-CDS3396.1"
FT                   /product="DEHA2F07304p"
FT                   /note="similar to uniprot|Q03529 Saccharomyces cerevisiae
FT                   YMR272C SCS7 Required for the hydroxylation of the very
FT                   long chain fatty acid (VLCFA) located in the endoplasmic
FT                   reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89012"
FT                   /db_xref="GOA:Q6BM96"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR014430"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM96"
FT                   /protein_id="CAG89012.1"
FT                   /translation="MSRNLPLLASAEVVKHNTQNDCWVTLYNRKVYNVSGFIDQHPGGG
FT                   DIILPYAGKDVTAIMADTISHEHSESAYEMLDDEMLVGYLATDEEERELLNNKNNTPVE
FT                   VRLEDSSSVDLYEFHDSLPPAEKLAIQTDYEEDIKKHKFLDLNKPLIPQMLCSTFSKEF
FT                   YLDQVHRPRHYGKGSAPLFGNFLEPLSLTPWWVVPAVWLPPNFYIFYVGFVNQDKLVAL
FT                   SFWVMGLFVWTLVEYCMHRFLFHLDGYLPEHPVALTLHFLLHGVHHYLPMDGYRLVLPP
FT                   TLFVLLAYPFYKLVFAIFPFYMACSGFAGGTLGYILYDVIHYVIHHTKLPQFLQDIKTY
FT                   HLEHHYKNYEMGFGVTSRFWDVIFETEITSTFQKRN"
FT   gene            complement(<636837..>638078)
FT                   /locus_tag="DEHA2F07326g"
FT                   /old_locus_tag="DEHA0F08140g"
FT                   /old_locus_tag="DEHA-IPF8490"
FT                   /old_locus_tag="DEHA-CDS3067.1"
FT   CDS_pept        complement(636837..638078)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07326g"
FT                   /old_locus_tag="DEHA0F08140g"
FT                   /old_locus_tag="DEHA-IPF8490"
FT                   /old_locus_tag="DEHA-CDS3067.1"
FT                   /product="DEHA2F07326p"
FT                   /note="similar to CA4851|IPF5818 Candida albicans IPF5818
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM95"
FT                   /protein_id="CAG89013.2"
FT                   /translation="MSTKKEREVILNSIEDEYRHDLSLHLYSTFLFHQINPLFPRRNWA
FT                   SWPLPFDRVPDPRSSKTFVGSENCIEQFDDIDHETNVNRENELDMRESVSTDDEDESED
FT                   TGDDDEVSVKDEVIHQNRHKRYTRIRSVATKETLSNSKVDIMIELHALLERKIHSKLKN
FT                   VADKQNLTMSADVSSAMTNEVCKKLANKVDHLVNNIINFQKQGKTRLSSSRPYPRLLNW
FT                   QDILLAGLDVDESHKKTLDSTSHANLYQKCERIFDNPKYTYEYDDNEEEGDDENQSNDV
FT                   PDTYVINPEQGEEESTLDTSKQKFNYSEYLSKVEETHRGLINYKNFKQRMLKNRNQEDK
FT                   LRELKKAIFMRKLNLQTKYSNIDWSKTKKRPKIQGRKAPKKYRIQNEDKDSQKEDALAH
FT                   GGISLTADDFTVNI"
FT   gene            <638425..>639087
FT                   /locus_tag="DEHA2F07348g"
FT                   /old_locus_tag="DEHA0F08162g"
FT                   /old_locus_tag="DEHA-IPF8488"
FT                   /old_locus_tag="DEHA-CDS5158.1"
FT   CDS_pept        638425..639087
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07348g"
FT                   /old_locus_tag="DEHA0F08162g"
FT                   /old_locus_tag="DEHA-IPF8488"
FT                   /old_locus_tag="DEHA-CDS5158.1"
FT                   /product="DEHA2F07348p"
FT                   /note="similar to uniprot|P13298 Saccharomyces cerevisiae
FT                   YML106W URA5 Fifth step in pyrimidine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89014"
FT                   /db_xref="GOA:Q6BM94"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM94"
FT                   /protein_id="CAG89014.2"
FT                   /translation="MENFQAQFLDLALESQALQFGTFTLKSGRQSPYFFNLGFFNTGKL
FT                   LSALATSYANAIIKSGLKFDIIFGPAYKGIPLTAITVAKLAELDPETYGNVGYSFNRKE
FT                   KKDHGEGGSIVGCQLSGKKVLIIDDVMTAGTAINEAFAIIKEGKGEVIGSIIALDRQET
FT                   TADSELSATQAVSKRYGLPVISIVSLSDIVRHLKDKITPEELSSIEFYRKQYAPKDA"
FT   gene            complement(<639187..>639996)
FT                   /locus_tag="DEHA2F07370g"
FT                   /old_locus_tag="DEHA0F08184g"
FT                   /old_locus_tag="DEHA-IPF8487"
FT                   /old_locus_tag="DEHA-CDS4593.1"
FT   CDS_pept        complement(639187..639996)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07370g"
FT                   /old_locus_tag="DEHA0F08184g"
FT                   /old_locus_tag="DEHA-IPF8487"
FT                   /old_locus_tag="DEHA-CDS4593.1"
FT                   /product="DEHA2F07370p"
FT                   /note="similar to uniprot|P29478 Saccharomyces cerevisiae
FT                   YML105C SEC65 signal recognition particle subunit homologue
FT                   of mammalian SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89015"
FT                   /db_xref="GOA:Q6BM93"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM93"
FT                   /protein_id="CAG89015.1"
FT                   /translation="MAKRPVLEDVLDDEIDNMDMDIAQFDPSLRTPIAPVQPGPQITRS
FT                   QDQEPPLFPNFPHPEQDKSVERKDIVDPNKFSAEERAELKKFQIIYPCYFDKSRSHKDG
FT                   RRVSESKAVSNPLAKTISDACRHYNLPVMLELDKTHPQDFGNPGRVRVLIKDNNKNGMP
FT                   VDSRFKTKRAVLNIIADYLKTHPTTLASIGPKSGIPLPSEYETGFEPGEIPKVKGFKMN
FT                   TIVPVHSELTIKHPMTKSIYDPEPEQPQVKAPQAPKQPKKKVMKIRG"
FT   gene            complement(<640248..>642473)
FT                   /locus_tag="DEHA2F07392g"
FT                   /old_locus_tag="DEHA0F08206g"
FT                   /old_locus_tag="DEHA-IPF8485"
FT                   /old_locus_tag="DEHA-CDS0998.1"
FT   CDS_pept        complement(640248..642473)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07392g"
FT                   /old_locus_tag="DEHA0F08206g"
FT                   /old_locus_tag="DEHA-IPF8485"
FT                   /old_locus_tag="DEHA-CDS0998.1"
FT                   /product="DEHA2F07392p"
FT                   /note="similar to uniprot|P07834 Saccharomyces cerevisiae
FT                   YFL009W CDC4 F-box protein required for G1/S and G2/M
FT                   transition associates with Skp1p and Cdc53p to form a
FT                   complex SCFCdc4 which acts as ubiquitin-protein ligase
FT                   directing ubiquitination of the phosphorylated CDK
FT                   inhibitor Sic1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89016"
FT                   /db_xref="GOA:Q6BM92"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR031740"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM92"
FT                   /protein_id="CAG89016.2"
FT                   /translation="MSANNQPSLYPLQDAIAKFDCKPVNPNGKLSDVWLQNEYQKLSII
FT                   SDQSGRESRKRIRNREETAGEGDAYDREGTESCDDMIISDTDCNSQISGQSAIISGISS
FT                   FRENGLVHPPKRRLMSVPSPTNTVTPAVTETNNSNETLLQTNQIIQEHIIVQPRTPTAI
FT                   NSPTNTPISDIEEQSQQLPLPSPSASPVQSTGDKISNFDPIEHQLSNIPTTQSELMEMM
FT                   VSLSGYLSEKNQNHFIFRLLQNTNRSSLSSFSGLIENSLKRDLISNLPLEITYNILSHL
FT                   DYKALCSLARVCSNWYKIIDNSGIWAQLLKKDKLILSDGAIEREIADPQKLLKEWSSKS
FT                   DINEANVMQTLYKKRCTILNRWMDPTYEPKRISVPGHGSHVVTCLQHDDEKIITGVDDK
FT                   LINIYSTKTGELLKVLKGHEGGVWALKYTGNTLVSGSTDRTVRVWNIKTGKCTHVFRGH
FT                   TSTVRCLDILHPVKIGKNDNGEDIIFPEVPLLVTGSRDHNLHVWKLPLMNEGEEAEDDV
FT                   VGQQTYDSNEIENPYLITVLLGHTQSVRSVSGYGNIIVSGSYDTTVRVWDLLDNGNCKH
FT                   VLAGHGDRIYSTALNFHTKRCYSGSMDSSINVWDIESGKLLHTLEGHSSLVGLLELSEE
FT                   YLVSAAADSTLRVWNPKSGDNICKLEGHSGAITCFQHDSLKIVSGSEIMLKLWDINSGK
FT                   FVRDLLDDITGCAWGLCFDNNICTAAVQRCRNDTDETFIEILDSSGP"
FT   gene            complement(<642946..>646221)
FT                   /locus_tag="DEHA2F07414g"
FT                   /old_locus_tag="IPF_8483"
FT   CDS_pept        complement(642946..646221)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07414g"
FT                   /old_locus_tag="IPF_8483"
FT                   /product="DEHA2F07414p"
FT                   /note="similar to uniprot|P26637 Saccharomyces cerevisiae
FT                   YPL160W CDC60 Cytosolic leucyl tRNA synthetase ligates
FT                   leucine to the appropriate tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66291"
FT                   /db_xref="GOA:B5RUB3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB3"
FT                   /protein_id="CAR66291.1"
FT                   /translation="MSATIKLENTARRDALIDIEKKYQKVWADDKVFEVDAPTIEEEPS
FT                   IDDAEELRKKYPKYFATMAYPYMNGVLHAGHSFTLSKVEFSTGFERMNGKRALFPLGFH
FT                   CTGMPIKASADKIKREIEEFGEDFSGAPAEDVEEQPKEKVKRDDITKFSATKSKAAAKQ
FT                   GRGKYQFEIMLQLGISKEEVVKFSDPDYWLKYFPPLVQKDVTAFGGRVDWRRSFVTTDA
FT                   NPYYDAFVRWQINRLRDCGKIKFGERYTIYSEKDGQACLDHDRQSGEGVNPQEYTGIKI
FT                   EVTEFAEEAKKLFQENNFELEGKKVYLVAATLRPETMYGQTCCFVSPKIDYGIFDAGNG
FT                   NYYICTERAFKNMSYQNLTPKRGVYKSSVQVNGKALIGSKIHAPLAVHKELRVLPMETV
FT                   LASKGTGVVTCVPSDSPDDYITTKDLINKPEYYNIEKEWVCDDIIPIIRTQRYGDKCAE
FT                   FLVKELKIQSPKDAVQLAEAKESAYKEGFYNGTMIFGKYVGLASSDAKSKVRADLVASN
FT                   DAFVYNEPEGSVISRSGDECIVSLEDQWYIDYGEESWKSQALECLADMQTFAKETRHGF
FT                   EGVLDWLKNWAVTRNFGLGTRLPWDKKYLIESLSDSTIYMAYYTIARFLHSDYYGAKAG
FT                   KFDINPELMTDEVFDFIFNRREDINTNIPIDQLKEMRREFEYFYPLDVRVSGKDLIPNH
FT                   LTFFIYTHVALFPKRLWPKGIRSNGHLMLNHAKMSKSTGNFMTLEQIVEKFGADASRIA
FT                   LADAGDTVEDANFDESNANAAILRLTTLKEWCEEIIKNKDSLRTGPTDSFFDVAFENEM
FT                   NDLIGKTYAQFEITNFKAGLKYGLFDYQTARDYYRDSVTSNIGMHKDLVIRYIETQALL
FT                   LAPVAPHFSEYIYRDVLGNSGSIQSTKFPSATKPVEKSISDALEYVRDLSRSIREAEGN
FT                   VLKKKKGKPSEVDPSKPAKLRLFVATSFPEWQDNYIEIVRQLFESQSLDDNKIIREKVG
FT                   KDMKRAMPFISLLKQRLANEDPQTVFNRELTFNETDVIKSVLANVKKSSVSVDIQDVEI
FT                   ISFDSGAKKGTNVMTGEEVEITITGKIIDSAVPGEPGIMINNI"
FT   gene            complement(<646442..>649264)
FT                   /locus_tag="DEHA2F07436g"
FT                   /old_locus_tag="DEHA0F08250g"
FT                   /old_locus_tag="DEHA-IPF8482"
FT                   /old_locus_tag="DEHA-CDS0532.1"
FT   CDS_pept        complement(646442..649264)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07436g"
FT                   /old_locus_tag="DEHA0F08250g"
FT                   /old_locus_tag="DEHA-IPF8482"
FT                   /old_locus_tag="DEHA-CDS0532.1"
FT                   /product="DEHA2F07436p"
FT                   /note="similar to uniprot|P49960 Saccharomyces cerevisiae
FT                   YMR268C Prp24p U4/U6 splicing factor AND similar to
FT                   CA2062|IPF7858 Candida albicans IPF7858"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89018"
FT                   /db_xref="GOA:Q6BM90"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR031766"
FT                   /db_xref="InterPro:IPR034398"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM90"
FT                   /protein_id="CAG89018.2"
FT                   /translation="MNKDIDGEIHKLKEQLSKWPYTSNDHDKLIDILRVDRKGKTQDLH
FT                   EARQNKAQYFTLSTKDIVNWLQDLQAIEDNNLRIKSILEFYRIVIHDYPTAQYWGRCLD
FT                   FVLNNYNDTQNIISESIIKELFKEALNDTVHDFKNSKEIWETVLAFFNNALDISGNEAD
FT                   FDTLLKLHLKRISYPHESIRESFSQLSGFISKYDSKKYEQHMLAANKVFSKTLKAQRYY
FT                   EEFEIGISKNPNDVKVWIDYMESVNKYAKGIDEVSVLFYRAITSDRKGSVDDPRWVSIW
FT                   LAYIYILYQEEIDVKSIVLEPVLFKFVRSYPGSAVSYAEYIRNCPIFENGVELFSNMKT
FT                   RALQLDLMNSNSYDDWKVLALAILSYEFSLVHSGENIDMVADLYTDAADYVDIALENNN
FT                   DVFHSVEKLVVSIYETLDDPDMARKVLMKLLENFSDQCEIWLYSYEFERRNHSSYELIS
FT                   KLLERAVDNSKTLDWPERIMQEWLSFEQIQGNIHSYERALIKVDKVIREMSLKRMHIQE
FT                   AFESESTDKIKRNIDDDEGEQDRSNKRQRRDSMNETTRNREEYSVKISNLPQNISEEKL
FT                   KKFFDDCGTPKEIKLFQEDGKAPEAIIEWTDSKEVFASLTKNIKLIDGNEVSVIRMLGS
FT                   TLWVSNFPPSFSHERVKNIFEQVGTVVSIRFPSLKSNQSRRFCYVEYASPELAHLAISN
FT                   YQGKEFEDEISNKRYRLVVDMSKPNSKKTKTDTAITEREIYIQNLNFKTTTESDLESLF
FT                   QTIGTIDSVKVPLNEKMKNQGNINNGYAFVVFKSEVAAKNALQLNGTTLHDRKISVSQS
FT                   QAKKHNNKSEKDPAAISNQFEELSTISIFNVSDTINRDQMTAFLTKRVGPVRHVEVFPN
FT                   QEAALAEFEVPSDAGKASLILTSEEFEGKLLNVGSKSDLTRTLNGTKNVPTKKPKLMVP
FT                   PTLQRRVRKK"
FT   gene            <649424..>650191
FT                   /locus_tag="DEHA2F07458g"
FT                   /old_locus_tag="DEHA0F08272g"
FT                   /old_locus_tag="DEHA-IPF8480"
FT                   /old_locus_tag="DEHA-CDS4748.1"
FT   CDS_pept        649424..650191
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07458g"
FT                   /old_locus_tag="DEHA0F08272g"
FT                   /old_locus_tag="DEHA-IPF8480"
FT                   /old_locus_tag="DEHA-CDS4748.1"
FT                   /product="DEHA2F07458p"
FT                   /note="similar to CA2063|IPF7859 Candida albicans IPF7859
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89019"
FT                   /db_xref="GOA:Q6BM89"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM89"
FT                   /protein_id="CAG89019.1"
FT                   /translation="MDAKIYLQSYGWKEGEALKQGGLRKPILVKHKKDTKGLGHDTNDA
FT                   EAWWERLFDGQLKNLEVKNGSAGAVSFEQNNEAVEKDVRKATSPLYRMFVKGQGLAGTV
FT                   GKTKHTQVKSTKLDGSKVFEAVTENLKEDGPIKSSKSKSNKKDKDIKEKKVRDKKSKKD
FT                   KEEKKNKKKSKKNEKIELDKVDLETKKITKEKKEKKEKKEKKTKRIESDKKDKDEKIRS
FT                   SSTNKSEKKRKRDDKMEKDDSSSKKKKKSVTTA"
FT   gene            <650336..>653902
FT                   /locus_tag="DEHA2F07480g"
FT                   /old_locus_tag="DEHA0F08294g"
FT                   /old_locus_tag="DEHA-IPF8478"
FT                   /old_locus_tag="DEHA-CDS0244.1"
FT   CDS_pept        650336..653902
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07480g"
FT                   /old_locus_tag="DEHA0F08294g"
FT                   /old_locus_tag="DEHA-IPF8478"
FT                   /old_locus_tag="DEHA-CDS0244.1"
FT                   /product="DEHA2F07480p"
FT                   /note="weakly similar to uniprot|Q01846 Saccharomyces
FT                   cerevisiae YML104C MDM1 Intermediate filament protein
FT                   required for nuclear and mitochondrial transmission to
FT                   daughter buds"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89020"
FT                   /db_xref="GOA:Q6BM88"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM88"
FT                   /protein_id="CAG89020.2"
FT                   /translation="MSMNNDVQLSFQTKHGIIFRIGTWLATIFVITFITRYTLKYWISI
FT                   LFGFLTCISIAFYLIIGDSSVKPIPNYSKKSTRFSFVDEEKWSHELHKLYKDTRMLNEP
FT                   VIEQSFLISETLEDFINLIIKEFIDSWFVQISNSTVFQDSIRQELKYVIRNLHERFTQL
FT                   DFAKLLVFRILPIIHDHFNHFVKIQHGIRLNGNTSKLPTGSMEYAIAAARQYDRGKVHP
FT                   GVTVSMNSNDVNEKKHLRNKVDSILPHLLSPEENTNKAGTSLVKEIISCTILSRVIHLL
FT                   GDGDFYNLLIVNLIGDNIKHREQVKQLRAALEEHTRSLKRQTSKGISMTASSEYLQNYK
FT                   RINKNSTIQKNMDNHSFNEALQCVSKVSSVAELKHLSSYTGFQLSRVKDENPGSSKEIN
FT                   VLLSRLNLLKSKIDNKLAQLSITSEKKIHKDEDAANLTLLDILNNSVGLKFFTEFMNDR
FT                   SRSQLFQLWLAIDEIRAPLEDIDIEEDGEARLSLSLEFSNLGDIVEIYREFFQNSSLEI
FT                   DRDVFNRVESFVNNKDPIYKLELYQKSRKALFKLQNNIYESISNDDFPPFKKSELFLKL
FT                   LETHIFDSKPDEINSPMSWSSSGKRKIKQISDPLEDSSESEADEVSPGVIKAVEDAFTQ
FT                   IMNSSDDKKSEIISDSKNSNSRSSSADIAESTSNNPISTIHLKKDLFGESSNLFTDDSV
FT                   NFSNGNRNSKLFDDISDHSFSDSDSINFDSDSQNQNINLSNPSHSDSQIFLAAPGNLRL
FT                   AEEISKLSEEIDKLSEQQAVLSPLLKKAELTNNVGELKILRKSKVSLDREINAKELQKQ
FT                   QFIVQENDNSLYGKSRVSIQSYISNNENGKNYILYIVEVQKLSSENQNNVTAGWIVARR
FT                   FSQFFRLNEYLKSRYPLVVNIKFPKRTVSVLKFQQKQIVEQRKALLEEYLQQLLKIPEV
FT                   CSNKVFRSFLSSENFTSRNSQSIDGNTNVNLSKLRNSVEIVANKLYNGISGKISSNSLS
FT                   NADKSFPLPDQPMEKYMKDMQKELRQFDESEHTNSIEKPVFVKPVCDLLISVFRLNTPK
FT                   SWLRGRALLVILHQVFGNTLEKKAYEVIDFFLRTEENVLDLLIWGKNIIFPMGRLMEPP
FT                   EPRNSYQRSTTKQEAKALLEIFMQETCSKIFGLANTTYACNNIFELLQNGFLNKHLILQ
FT                   IFDEIINQLFPEASTDVSSVSV"
FT   gene            <654096..>654701
FT                   /locus_tag="DEHA2F07502g"
FT                   /old_locus_tag="DEHA0F08316g"
FT                   /old_locus_tag="DEHA-IPF8476"
FT                   /old_locus_tag="DEHA-CDS5348.1"
FT   CDS_pept        654096..654701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07502g"
FT                   /old_locus_tag="DEHA0F08316g"
FT                   /old_locus_tag="DEHA-IPF8476"
FT                   /old_locus_tag="DEHA-CDS5348.1"
FT                   /product="DEHA2F07502p"
FT                   /note="similar to uniprot|P43582 Saccharomyces cerevisiae
FT                   YFL010C WWM1 WW domain containing protein interacting with
FT                   Metacaspase (MCA1)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89021"
FT                   /db_xref="GOA:Q6BM87"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM87"
FT                   /protein_id="CAG89021.1"
FT                   /translation="MVTNDSKNTPNVPEGWLAKFDDKYNTFFYVNLKTKKSQWEAPSGT
FT                   SFEPKSADEVLPPPYSPTSSSGARAQYQTQDRPQAQPQVQSQPQPHVQQYPPQQGYPQG
FT                   YPPQGYGYPPQQGYPPQGYGYPPQQQYMQQKPQRSRMGGMGGLGMGLGGGMLGGMLLGN
FT                   MMGNNEMEAYHDGFQDGGMSGGDDMGGDMGGDMGGGDF"
FT   gene            <655407..>655877
FT                   /locus_tag="DEHA2F07524g"
FT                   /old_locus_tag="DEHA0F08338g"
FT                   /old_locus_tag="DEHA-IPF8473"
FT                   /old_locus_tag="DEHA-CDS5963.1"
FT   CDS_pept        655407..655877
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07524g"
FT                   /old_locus_tag="DEHA0F08338g"
FT                   /old_locus_tag="DEHA-IPF8473"
FT                   /old_locus_tag="DEHA-CDS5963.1"
FT                   /product="DEHA2F07524p"
FT                   /note="weakly similar to uniprot|P43582 Saccharomyces
FT                   cerevisiae YFL010C WWM1 WW domain containing protein
FT                   interacting with Metacaspase (MCA1)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89022"
FT                   /db_xref="GOA:Q6BM86"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM86"
FT                   /protein_id="CAG89022.2"
FT                   /translation="MVETDPKNPPNVPKGWLAKYDEKYKAFFYVDLRTKKSQWEAPSFE
FT                   HADKVSPPPYSPTTSNGAQFQSQNQPRPNPQQPHPQSQLPPQGYGQPSQQQQGFAPQQQ
FT                   YVQQMPQNTHIGGMGGMGGMGIGGGMLGGMLLGNMMGSRRHSRRMPRRSRRC"
FT   gene            <656206..>656610
FT                   /locus_tag="DEHA2F07546g"
FT                   /old_locus_tag="DEHA0F08360g"
FT                   /old_locus_tag="DEHA-IPF8472"
FT                   /old_locus_tag="DEHA-CDS6417.1"
FT   CDS_pept        656206..656610
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07546g"
FT                   /old_locus_tag="DEHA0F08360g"
FT                   /old_locus_tag="DEHA-IPF8472"
FT                   /old_locus_tag="DEHA-CDS6417.1"
FT                   /product="DEHA2F07546p"
FT                   /note="highly similar to CA2680|CaMCI4 Candida albicans
FT                   CaMCI4 NADH dehydrogenase (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89023"
FT                   /db_xref="GOA:Q6BM85"
FT                   /db_xref="InterPro:IPR006806"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM85"
FT                   /protein_id="CAG89023.2"
FT                   /translation="MRFTRVLRQAEEVLVKAASGNPTGLTGIYQHPNPRPALIALYNHT
FT                   LTVLDTKFPKESVYKQSVEALTRNRLKVVQEEEITENIENKIGGGLIEEIIIQAHEELG
FT                   LANDLSSLKCWEELEEKPLDDQWVYFGKKI"
FT   gene            complement(<657018..>657641)
FT                   /locus_tag="DEHA2F07568g"
FT                   /old_locus_tag="DEHA0F08382g"
FT                   /old_locus_tag="DEHA-IPF8471"
FT                   /old_locus_tag="DEHA-CDS5284.1"
FT   CDS_pept        complement(657018..657641)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07568g"
FT                   /old_locus_tag="DEHA0F08382g"
FT                   /old_locus_tag="DEHA-IPF8471"
FT                   /old_locus_tag="DEHA-CDS5284.1"
FT                   /product="DEHA2F07568p"
FT                   /note="similar to uniprot|P07560 Saccharomyces cerevisiae
FT                   YFL005W SEC4 Secretory vesicle-associated Rab GTPase
FT                   essential for exocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89024"
FT                   /db_xref="GOA:Q6BM84"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM84"
FT                   /protein_id="CAG89024.2"
FT                   /translation="MSGRAPSRSYDMIMKLLLVGDSGVGKSCLLLRFVEDKFNPSFITT
FT                   IGIDFKIRTIESNGKKIKLQVWDTAGQERFRTITTAYYRGAMGIVLIYDVTDSRTFENV
FT                   ENWYSTVTQHANEDAQIFLVGNKCDDEENRQVSKEQGQELASKLNIPFLEASAKSNENV
FT                   DPIFYELAGIIQEKHVNTEGAQTASSAGGVDVSQTPNTFKSNCC"
FT   gene            complement(<657965..>659737)
FT                   /locus_tag="DEHA2F07590g"
FT                   /old_locus_tag="DEHA0F08404g"
FT                   /old_locus_tag="DEHA-IPF8469"
FT                   /old_locus_tag="DEHA-CDS1691.1"
FT   CDS_pept        complement(657965..659737)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07590g"
FT                   /old_locus_tag="DEHA0F08404g"
FT                   /old_locus_tag="DEHA-IPF8469"
FT                   /old_locus_tag="DEHA-CDS1691.1"
FT                   /product="DEHA2F07590p"
FT                   /note="highly similar to uniprot|P15624 Saccharomyces
FT                   cerevisiae YLR060W FRS1 Beta subunit of cytoplasmic
FT                   phenylalanyl-tRNA synthetase forms a tetramer with Frs2p to
FT                   generate the active enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89025"
FT                   /db_xref="GOA:Q6BM83"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR040659"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM83"
FT                   /protein_id="CAG89025.2"
FT                   /translation="MPTIPVDKQDLFDLLGRSYTTEEFDELCFEFGIELDEDTTEECKG
FT                   DERPQFKIEVPANRYDMLCIEGIAQALNEFLGKKSSPGFKYNPSKPEISLTIHKSTEQV
FT                   RPYAASAILRNVQLDERRYDSFLALQDKLHTNLCRNRTLVAIGTHDLDTLTPPFTYEAL
FT                   PPSEINFIPLNQEKEMDGNQLMEFYEKDKHLGKYLHIIKDSPVYPVILDANRTVCSLPP
FT                   IINSNHSKISAQTRNIFIDVTGTDRTKTEIVINQLVAMFAGYCKVPFEIEPIEIKSEHN
FT                   KQDRITPDISARPFEAEIPYINSCLGLDLTGQEISDLLKRMSLHAKPSSKKDLIDIGIP
FT                   ITRPDILHQCDIMEDAAIAYGYNNLTKTKAKGDSLVAAPLPVNKIGDILRIASAQAGYL
FT                   EVLPLTLCSHDENFKFLRTKDDNTTAVKLENPKTIEYQVVRTTLVPGLLKTIKENRKHS
FT                   LPIKVFEAGDIVLKNPELERGAFNQRNWSAIYAGKTSGFEFVQGLLGKIMQTMRTSWLE
FT                   NPKESTERGYWIEQDDENPTFFPGRGAKVFFRAGDGSKEQHIGAIGVLHPEVMANFEIP
FT                   YAASSVEINAEVFL"
FT   gene            complement(<659940..>662840)
FT                   /locus_tag="DEHA2F07612g"
FT                   /old_locus_tag="IPF_8466"
FT   CDS_pept        complement(659940..662840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07612g"
FT                   /old_locus_tag="IPF_8466"
FT                   /product="DEHA2F07612p"
FT                   /note="similar to uniprot|P43564 Saccharomyces cerevisiae
FT                   YFL034W Possible integral membrane protein that interacts
FT                   with Rpp0p which is a component of the ribosomal stalk"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66292"
FT                   /db_xref="GOA:B5RUB4"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB4"
FT                   /protein_id="CAR66292.1"
FT                   /translation="MDFKRTPSVDSLGTAHSVYSSKTPTRSRSNIGSRTSISVLPSLPT
FT                   NVSNESIEEDLHNHSNIDEKLEREATPETSYVEFDLSSMDQKNSRNDSNFLSEKIISPN
FT                   THRTDISDVEADKDEVSDVAKKPEDAENDFFDMKTSDWKSMKTITEQDYYNDKGELEYK
FT                   HANEFDPSKIKFDAHGYTKIDTEEQVTKYAELDKKTDFLFQSRREINKKTEAAAYRKED
FT                   LDYASDEDNSEYEDDDNLDSNETLQTMRNMLTDGQKFAYVGTTKLIAIDMATELAKIKQ
FT                   STSNKVAKELSLGQRNFANWTMYITSKLYEHMNLSKDEQNMIENLSKHGVEVTDLCSSL
FT                   NQREIIKPSKQNQTQENETDDSMKEIKGKTDNNEVAVDLRWTIICDLLLLLLSDGYYDS
FT                   RSRSLLVQFAEKMSISHLEILQFERRLIESLEIDTNNKSIENKDEKLNDREFIDKYKKK
FT                   NKKKRYVYIGLATLGGSLAIGLSAGLLAPVIGLGIAGGLTTVGISGTSGFLAGVGGSAI
FT                   ITTGGIVTGAKVGSKAGARRLGDVNTFELKPLYNTKRTNLIITVSGWMNGKMDDVRLPF
FT                   STVDPVMGDMFSLLWEPEMLQSMGQTIGILATEALSTSIQQILGATVLSALMAAIQVPM
FT                   VLSKLTYLLDNPWSVSLDRAWKGGKILADTLISGNMGVRPITLVGFSLGARLIYSCLIE
FT                   LAKRGGYGLIENVIILGCPITIKNDQLGLARSVVSGRFVNGFSKRDWILGYLFRATGGG
FT                   ISSVAGLSPIESVYGIENIDCTDIVEGHMAYRKAMPKILKAVNWEILSEEFAEIEEPDP
FT                   EQHERERKLVDEFDEARAKMKEEMDTEANKKKTWKNFFKPNQKDWWNVYSEGKSKGSDA
FT                   NEPYADPSAESNQPHTQTNNPIFDVTALLEEANNIERLADNDPETLKTMRKEVDTSAKH
FT                   TKLNEEVEEEEKSTSIVNSLANKFGVKQDADPGTKD"
FT   gene            <663993..>664979
FT                   /locus_tag="DEHA2F07634g"
FT                   /old_locus_tag="IPF_8464"
FT   CDS_pept        663993..664979
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07634g"
FT                   /old_locus_tag="IPF_8464"
FT                   /product="DEHA2F07634p"
FT                   /note="similar to uniprot|Q12291 Saccharomyces cerevisiae
FT                   YLR063W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66293"
FT                   /db_xref="InterPro:IPR021463"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB5"
FT                   /protein_id="CAR66293.1"
FT                   /translation="MSRRIARSQARKLEEAEERQEEEIIDVEGRSDSMPFQSKYSIEPP
FT                   KIIDLFEMSFKNILDSEDLQKHIQSVKGDLYNRNYMSAFGNDDKRFAYASRWTPARALC
FT                   YSSLFATLEPIRLLLEKPEGDKRVLCVGGGAASELVGLAAVFCRLKEYCSKSNSSLQLD
FT                   IIDIADWSTIVGTLTSYVKENWIYNAAGFNTNFIHDDILTADVAKLDYPKLDLITLLFT
FT                   TNELFCEKRAQTVQFLQSLNTHCRKGCYLLIAESAGSYSNITIGTKKFPVQFLIDMILI
FT                   GKPGENSGSWEIVQQSESCWYRVNKKEIDYKMKLENMRFFYRLYKKK"
FT   gene            complement(<665238..>666302)
FT                   /locus_tag="DEHA2F07656g"
FT                   /old_locus_tag="DEHA0F08481g"
FT                   /old_locus_tag="DEHA-IPF8462"
FT                   /old_locus_tag="DEHA-CDS3629.1"
FT   CDS_pept        complement(665238..666302)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07656g"
FT                   /old_locus_tag="DEHA0F08481g"
FT                   /old_locus_tag="DEHA-IPF8462"
FT                   /old_locus_tag="DEHA-CDS3629.1"
FT                   /product="DEHA2F07656p"
FT                   /note="similar to uniprot|P53686 Saccharomyces cerevisiae
FT                   YPL015C HST2 Cytoplasmic member of the silencing
FT                   information regulator 2 (Sir2) family of NAD(+)-dependent
FT                   protein deacetylases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89029"
FT                   /db_xref="GOA:Q6BM81"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM81"
FT                   /protein_id="CAG89029.2"
FT                   /translation="MNQLTKILEPIAKAIQAGDKKVTFFEGAGISTAAGIPDFRSPDTG
FT                   LYSNLAKLDLPYAEAVFDIDYFKENPKAFYTLAHELYPGKFMPTKFHYLLRLFQDKKLL
FT                   KRVYTQNIDTLERVAGIEDEYIVEAHGSFARNHCIECSLEMSTEELKKQMSDKSVNDGI
FT                   PICQECGGYVKPDIVFFGEALPVKFFDTWDEDADEVEIAIVAGTSLTVYPFASLPSETT
FT                   KKSLRLLINNEVVGDFKHGKRKTDILAISDCDEAAVTLAELLGWSEELDELINKNKTLF
FT                   ESTYSIGEKTNDEEVSKKSLSKASERLAEEIRDVEAEKGTQKPEKTDKQTESKEEKSKN
FT                   DTDDLEKDISNLKI"
FT   gene            <666509..>669759
FT                   /locus_tag="DEHA2F07678g"
FT   CDS_pept        join(666509..666514,666571..669759)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07678g"
FT                   /product="DEHA2F07678p"
FT                   /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
FT                   YPL009C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66294"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR021846"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB6"
FT                   /protein_id="CAR66294.1"
FT                   /translation="MKQRITGLDLQIITAELSKEILNYRLQNIYNVSSSSRQFLLKFSI
FT                   PDSKKVVVLDCGNKLHLTEFDRPTTQTPSNFVTKLRKHLKTRRLSQIKQIGNDRVLVLE
FT                   FSDGLFYLALEFFSAGNILLLDQDRKILSLQRMVSDKGGNDRYAVNEIYKMFDESLFKS
FT                   DFNYERKTYSKEQVQGWIKSQRDKLDQRSQDGNKKKNKVFSIHKLLFVNSSHLSSDLVQ
FT                   LNLIKNGISSSASCFDFENDDAKMDLIIKALEEAESDYINLLEKSEDAINGYIVSKKNL
FT                   SYNPDNDDSTNDLEYIMDEFYPYKPYKSDMDNYRFTEIQGYNRTMDSFFSTIESTKYAL
FT                   RIDQQKQQATKRLDYAREERDKQIQSLLAQQESNIKKGDAIMYYADLVDQCKDSVVKLI
FT                   DQQMDWTNIESLIELEQSRGNKIARFINLPLNLKENKINLHLPDMDEENEENKTAFDSD
FT                   SDSDSDSDSDSSSDESESESDSDSDSDSDSETTSEARPKQKKVKKSGKPAKSKISVWID
FT                   ISLSPFANARVYFESKKSAESKQIKVEKSTEFALKNAKKKIEQDLNNKLKNENDSLKQI
FT                   RPKYWFEKFLWFVSSEGYLCLAGRDNSQIDMIYYRHFNDNDYFISSDIEGSLKVFIKNP
FT                   FKGESIPPSTLMQAGIFAISASSAWNGKVTTSAWLLHGADISKKDFDGTLISSGNFNYK
FT                   AKKTYLPPCQLIMGFGFYWLGDEETTKKYTETRLSREEEHGLKIVMDNKKQDLEHSSKS
FT                   SNKIQSSLNEVDDEKVSAKEDTEPSKEDITSEPASESKEGKKRLSAKERRMLRKGKDIK
FT                   VSENEDTDEDVFDPIEQEMKNLKLEETKKKTAEPSSQKPPNVRGKKSKMKKIAAKYADQ
FT                   DEEERKIRMEALGTLKQVEAEKQKQIDEEENKESKDKYVNEALNAERRKNQEEREYRKY
FT                   IMEEANEDESSVVNYLEILDSFISKPQPDDCLVNLVPVFAPWSALTKFKYKVKIQPGGG
FT                   KKGKCINDTLNYFANRKSDPSHTDTELDWDNEREILKGAKPNDLMGVFTVSKVKLMLPG
FT                   GQDKTARKAPAKKGKR"
FT   gene            <670271..>671656
FT                   /locus_tag="DEHA2F07700g"
FT                   /old_locus_tag="IPF_8458"
FT   CDS_pept        670271..671656
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07700g"
FT                   /old_locus_tag="IPF_8458"
FT                   /product="DEHA2F07700p"
FT                   /note="similar to uniprot|P00635 Saccharomyces cerevisiae
FT                   YBR093C PHO5 One of three repressible acid phosphatases a
FT                   glycoprotein that is transported to the cell surface by the
FT                   secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66295"
FT                   /db_xref="GOA:B5RUB7"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB7"
FT                   /protein_id="CAR66295.1"
FT                   /translation="MVSISKIVSSSLIFAANDQFRDVGSVDLAAKTQYNIVKYMYGNGP
FT                   YMQNPGYGISTDVPDQCTLEHVQVYMRHGERYPGISDGEKQKALVDKLQSYNSSLSGPL
FT                   SFLNDYEYYVKDDSLYELETTPSNAKGPFTGYETCNKAGSAFRAKYNDLYNENETLPVF
FT                   IAASKRVYDSADFFVNGFLGEDYDEDKIKRVVISEEKSSGFNSLTPRWACPSYYNPNTT
FT                   APKFKSDYLEDIADRLKTDNDGLNLTSSDIPYLFQLCSFELNSKGYSQFCDIFTQDELV
FT                   TNDYAQGYNSYHSAGAGSETSKYAGSVQLNASLALLKEDDPKNKIVLSFTHDTDIQVFY
FT                   ASLGLFDVSGEMPSDKVDVRNAFRRTEVVPMGGRLITEKYKCDGKSYVRFIANDAVIPL
FT                   QNCSDGPGFSCSLTEFEDIVSKKQSFNLLDKCNTPDDIPHELTFYWDYDEKNYNATAPR
FT                   VTA"
FT   gene            <672143..>673534
FT                   /locus_tag="DEHA2F07722g"
FT                   /old_locus_tag="DEHA0F08613g"
FT                   /old_locus_tag="DEHA-IPF8454"
FT                   /old_locus_tag="DEHA-CDS2622.1"
FT   CDS_pept        672143..673534
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07722g"
FT                   /old_locus_tag="DEHA0F08613g"
FT                   /old_locus_tag="DEHA-IPF8454"
FT                   /old_locus_tag="DEHA-CDS2622.1"
FT                   /product="DEHA2F07722p"
FT                   /note="similar to uniprot|P38693 Saccharomyces cerevisiae
FT                   YHR215W PHO12 One of three repressible acid phosphatases a
FT                   glycoprotein that is transported to the cell surface by the
FT                   secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89035"
FT                   /db_xref="GOA:Q6BM75"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM75"
FT                   /protein_id="CAG89035.1"
FT                   /translation="MVSISKLLNNGLILAGQSIYQSVATPQQASVEQYDILRYLGGKAP
FT                   YIQHPGFGIPTDVPDQCTIEQVQLLSRHGERYPSKNVGKALEKINEKFKGYNGTFKGEL
FT                   SFLNDYTYFVEDKDNYEKETTPSNSEGPFSGADNALRHGTTFRSKYNEIYNPDKPLPVF
FT                   AANYDRVALTAQYFARGFLGQDYDESNVEYVLIDEDGELGANSLTPRYGCKKFESDPHT
FT                   DYVDGFSDQYLKDALTRFQKSNPNLDLDTDDVNSLFDWCAYELNVKGYSPFCNLFSNTE
FT                   FIKNSYSLDLENYYSNGPGNNMTRTIGAPLIRASLALLKDNETEHKIFLSFSHDTDLEI
FT                   TLEALGLLGIADGEQLPNDHIPFPHTYVHSTIVPQGARIYTEKIKCDGEIYVRYVLNDA
FT                   VYPLPTCSDGPGFSCKLTDFENYVNDRLDNLDYATQCGAEDIPNNVTFYWDYTEKNYTN
FT                   ISGDN"
FT   gene            complement(<673957..>674883)
FT                   /locus_tag="DEHA2F07744g"
FT                   /old_locus_tag="DEHA0F08635g"
FT                   /old_locus_tag="DEHA-IPF8453"
FT                   /old_locus_tag="DEHA-CDS4148.1"
FT   CDS_pept        complement(673957..674883)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07744g"
FT                   /old_locus_tag="DEHA0F08635g"
FT                   /old_locus_tag="DEHA-IPF8453"
FT                   /old_locus_tag="DEHA-CDS4148.1"
FT                   /product="DEHA2F07744p"
FT                   /note="highly similar to uniprot|P23202 Saccharomyces
FT                   cerevisiae YNL229C URE2 Nitrogen catabolite repression
FT                   regulator that acts by inhibition of GLN3 transcription in
FT                   good nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89036"
FT                   /db_xref="GOA:Q6BM74"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM74"
FT                   /protein_id="CAG89036.2"
FT                   /translation="MTNNNSNSNNNQTISNLSAGLKSVNLADQQQNEVNLNLLQQQLQN
FT                   EATTQQSQSRISQFFQNQPTEGYTLFSHRSAPNGFKVAIILSELNLPFNTIFLDFNNGE
FT                   QRAPEFVTINPNARVPALIDHFNENTSIWESGAIILYLVSKYLKDNGECALWSDNLIEQ
FT                   SQISSWLFFQTSGHAPMIGQALHFRYFHSCPVPSAVERYTDEVRRVYGVIEMALAERRE
FT                   ALIMDLDVENAAAYSAGTTPLSQSRYFDYPVWLVGDRATVADLSFVPWNNVVDRIGINL
FT                   KVEFPEVYKWTKYMMRRPAVIRALRGD"
FT   gene            <675217..>676104
FT                   /locus_tag="DEHA2F07766g"
FT                   /old_locus_tag="DEHA0F08657g"
FT                   /old_locus_tag="DEHA-IPF8452"
FT                   /old_locus_tag="DEHA-CDS4290.1"
FT   CDS_pept        675217..676104
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07766g"
FT                   /old_locus_tag="DEHA0F08657g"
FT                   /old_locus_tag="DEHA-IPF8452"
FT                   /old_locus_tag="DEHA-CDS4290.1"
FT                   /product="DEHA2F07766p"
FT                   /note="weakly similar to uniprot|Q12288 Saccharomyces
FT                   cerevisiae YLR126C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89037"
FT                   /db_xref="GOA:Q6BM73"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM73"
FT                   /protein_id="CAG89037.1"
FT                   /translation="MAVEGDIRHVAVLVCDTPISGITEKFGDFGDNVVDLLQNAGNCQY
FT                   PMVKYQVAFDSNEEASYQGDLRRVYERLTDQMMGGFVQGVIVSGSRSDSFAREVPWIEK
FT                   LDEFLKYVFTLERFPVVGICFGHQMIAKLLGCKVGRNSPENGWECGTTTINLNTDILAI
FT                   KDSPFLNVLKTDDSGAVIDHLNVVEFHQDIVYGLPPPAVFEKRKTNIMSIGSSNKCSIQ
FT                   GLITESGPLKILTFQGHPEFSTEEAKEFLKKNFEMGLLDKKLFEKCTYNTSILNNQGFL
FT                   LGKVIGNFINLFNK"
FT   gene            complement(<676207..>679980)
FT                   /locus_tag="DEHA2F07788g"
FT                   /old_locus_tag="DEHA0F08679g"
FT                   /old_locus_tag="DEHA-IPF8451"
FT                   /old_locus_tag="DEHA-CDS0198.1"
FT   CDS_pept        complement(676207..679980)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07788g"
FT                   /old_locus_tag="DEHA0F08679g"
FT                   /old_locus_tag="DEHA-IPF8451"
FT                   /old_locus_tag="DEHA-CDS0198.1"
FT                   /product="DEHA2F07788p"
FT                   /note="weakly similar to uniprot|P39523 Saccharomyces
FT                   cerevisiae YMR124W Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM72"
FT                   /protein_id="CAG89038.2"
FT                   /translation="MDSEMASTATQKGKLRQRLLNSELDINVLNEQQQPKIPMQQQMAM
FT                   EQGGGVYQQQYPQAYPQAYVANGAQSQPSFLNSYESLTNQGANEGVRKASLTSQSNMTM
FT                   NKFFRRNKGDGGFDEETGADINDLTNGSNVSFDDISHIRDRGKYGVNGPHLDSTPFIPT
FT                   IGGGIGSASGKSLNNIQYRKQMNHQKKMAYASNARAMSLAGSNPMQQTSDPRAMSLSSF
FT                   GNGNGPRAMSLNSNGMMANGPRAMSLNNRMPMPPPGKGGYMPQNGPRTMSMRNNGAPFG
FT                   NGPYMQPTGGPRAMSLTNGPPGPRAMSLTNGNPMNQQYTPRPHPQQMQQMQQLNPQQMQ
FT                   QMQHMQHMQQMQQMQQSNPQQYGGYQTMNPNARAMSLNGGNPMNDPRFNHAGQFSNSQQ
FT                   RQNMPHPMPNGPNPNMAPEPNQNYAQKSNDSLMNVLEEEDENNTNSPKENQVVSSNRRE
FT                   NNGDNTIDDDDVVYKFDEHDDAGSLSRKSTLKKSNSMKLRKLNLFNSETREQPDIQETS
FT                   FDESPNESRRLSHSSQTLHNTGNDVSPSFNLRKARGARESMLNDASNEEDLAQLDERQE
FT                   KFKSLGANAEYNGSIANSLNKDVFVTANDLISPSKVGKGDNNKKSPLLKNTGYEDINEN
FT                   EENYMKNDNDMLKRRGSPEPISNSTLPNDAHSNMLSKQPSIRSLVTNTAFDKFRESPRK
FT                   SSKTLPELPASPTNSDYGTNATNTTNEDLNSEGSFSQPKQMLDETSNYSSLSSLVQSQN
FT                   NANPTSFERANINAEPLASQQASDQSISSTPRDNNENSTPPTTHNSNISNTNYNDKAQT
FT                   VDSNVAQVYPKTEGKDPSNERRMSAIRNMNTSDMLSSPIVDDNIFAPESARKERRSSKT
FT                   FSLSNKSKNIFKRFSKSGKKSADEDESFTNDEVSFNSNRNSIHSYNQGGIQARKASSAS
FT                   IGQSRPEKPLKFTKEELGIMNCNSELLNDLQLVTTELASSIKRELEFANRLKNNSSSPL
FT                   ESSDELRSQLLGKARVISDLQDKLNKERSLRFICEEHALLAENGTSPSPLKLNYEKTEL
FT                   YKQLLIKNDLVNQLQDKIEESQMKQNPGDSNLLIKYNELLEENTDLKSKVIPDLENRIE
FT                   ASRNVSSLNNNKSLNLVNNCTDHDNANSRGDYDEDYYDDEYDQSREHIEISTLKNQREE
FT                   LREVVSKLSSSYNYELKLAQEKIKNLELKVQDMNSINNKLSQRLEPNRTISSGQNNHNN
FT                   TSNSPLKILSNNKGGKLQGFAIVSPTKKLFDD"
FT   gene            <680715..>680885
FT                   /locus_tag="DEHA2F07810g"
FT                   /old_locus_tag="DEHA0F08701g"
FT                   /old_locus_tag="DEHA-IPF8449"
FT                   /old_locus_tag="DEHA-CDS7546.1"
FT   CDS_pept        680715..680885
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07810g"
FT                   /old_locus_tag="DEHA0F08701g"
FT                   /old_locus_tag="DEHA-IPF8449"
FT                   /old_locus_tag="DEHA-CDS7546.1"
FT                   /product="DEHA2F07810p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89039"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYT1"
FT                   /protein_id="CAG89039.4"
FT                   /translation="MVSGHGHQGKLEQPNGCNIGQYLWKILEPYHLQVQLSLFSIHQLY
FT                   QWRECKMRTPQ"
FT   gene            complement(<680935..>681375)
FT                   /locus_tag="DEHA2F07832g"
FT                   /old_locus_tag="DEHA0F08723g"
FT                   /old_locus_tag="DEHA-IPF8446"
FT                   /old_locus_tag="DEHA-CDS6170.1"
FT   CDS_pept        complement(680935..681375)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07832g"
FT                   /old_locus_tag="DEHA0F08723g"
FT                   /old_locus_tag="DEHA-IPF8446"
FT                   /old_locus_tag="DEHA-CDS6170.1"
FT                   /product="DEHA2F07832p"
FT                   /note="weakly similar to uniprot|Q12091 Saccharomyces
FT                   cerevisiae YPL170W DAP1 Heme-binding protein involved in
FT                   regulation of cytochrome P450 protein Erg11p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89040"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM71"
FT                   /protein_id="CAG89040.2"
FT                   /translation="MSSLDTSHQHGVSEKTPNEFEKLNNGINIKMLPIYTRSQLSLYNG
FT                   IDKPEVYVAIKGYIYDVSNNVSNYGPGRPYHKLVGKDVSRLLGLNQLQLKRTGDPYAPE
FT                   KDNAWYTGDFTDKENSIVDKWVLFFRKRYTIVGVVVDHEVGT"
FT   gene            <681593..>682721
FT                   /locus_tag="DEHA2F07854g"
FT                   /old_locus_tag="DEHA0F08745g"
FT   CDS_pept        join(681593..681595,681720..682721)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07854g"
FT                   /old_locus_tag="DEHA0F08745g"
FT                   /product="DEHA2F07854p"
FT                   /note="weakly similar to uniprot|Q00916 Saccharomyces
FT                   cerevisiae YIL061C SNP1 U1snRNP 70K protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89041"
FT                   /db_xref="GOA:Q6BM70"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM70"
FT                   /protein_id="CAG89041.2"
FT                   /translation="MANETEKYPINIQKLFAVKPPLVYKTPLDYPAESRCTNHITSVSS
FT                   FRNQWQQYVDDLVEAEKNQPPPIETIQQVQIREKGRKKQELQKSYQLQLNEWNDPELLQ
FT                   KNEQEFMKDPFKTVFISRLDYLLTELDISKNFSKYGVIESITIVRDKKSGKSRGYGFVV
FT                   FERDEDAKGCIKELAPTGLKIPVENKPFTRTILVDMERGRLVRNWKPRRLGGGLGGRHY
FT                   TRPSPTLSNNASAAASGRRLHLSSNPYQSTPSQPSHSSTRYAPRPSAPRPMVENRQPRP
FT                   AAYGSYNSSVENNESVRDKYAKYSSNNDSNSSSYRSPRTSGQNRSIRSIRQRE"
FT   gene            <682885..>684258
FT                   /locus_tag="DEHA2F07876g"
FT                   /old_locus_tag="DEHA0F08767g"
FT                   /old_locus_tag="DEHA-IPF8443"
FT                   /old_locus_tag="DEHA-CDS2670.1"
FT   CDS_pept        682885..684258
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07876g"
FT                   /old_locus_tag="DEHA0F08767g"
FT                   /old_locus_tag="DEHA-IPF8443"
FT                   /old_locus_tag="DEHA-CDS2670.1"
FT                   /product="DEHA2F07876p"
FT                   /note="weakly similar to uniprot|P40517 Saccharomyces
FT                   cerevisiae YIL063C YRB2 Ran-GTPase-binding protein involved
FT                   in nuclear export"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89042"
FT                   /db_xref="GOA:Q6BM69"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM69"
FT                   /protein_id="CAG89042.1"
FT                   /translation="MSNDTSNKRKLEEEDLSDNKKVRQESPDSVVDDLNYLKESIKQEI
FT                   FKTFEDRFNRLENEIIQLKSTSKDDSGTLSERTANEGSVDTPPDEASLKVSSGVPKLHP
FT                   LNPTVGELPKSNSNPFNEIKGFKSMESNEKSTDPKPSKHTFGGSSFKINTPMNSFVSNA
FT                   NPADTPTAPNTAQSSPQHVFGATSSFGSASAFDVAKSKKNVFEALPSKTTNEISKSPSA
FT                   EISKSNSSSVTSSFGSGTFGGNTKFNNAFQNSLKKKSFLDDKANKDGKTEETADTGNTA
FT                   KEKTPTTQQYKQVDLTPVGEIRTGEENEKSHFTSTAKIFELNLTKISDGWKERGLGRLH
FT                   LNQSLDDPQKVRLVMRSQGLLRVVLNMKVTSDTKLIKGLEASLSPGKFVRWNSINDQGA
FT                   PVQYLLKFPNQTIRDELIEKVENLKETFETESMSKGTESSSGVESKETKPNATGVKWL"
FT   gene            complement(<684325..>685143)
FT                   /locus_tag="DEHA2F07898g"
FT                   /old_locus_tag="DEHA0F08789g"
FT                   /old_locus_tag="DEHA-IPF40207"
FT   CDS_pept        complement(join(684325..685030,685094..685143))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07898g"
FT                   /old_locus_tag="DEHA0F08789g"
FT                   /old_locus_tag="DEHA-IPF40207"
FT                   /product="DEHA2F07898p"
FT                   /note="similar to uniprot|P40516 Saccharomyces cerevisiae
FT                   YIL064W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89043"
FT                   /db_xref="GOA:Q6BM68"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026635"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM68"
FT                   /protein_id="CAG89043.2"
FT                   /translation="MSNEIRLNSSKLGTKEYWNSFYKKEIANFQDNEEDTGECWFDDSD
FT                   AESKMIQFLIDKINGEELPFGKQENIKIVDLGTGNGHLLFQLHEDILEECDYQDQIKFD
FT                   FMGIDYSPDSVEFATKIAKQKYPQAAFQFEQVDLLTKENKFLSANTSQFDILLDKGTLD
FT                   AIALNQDPISELGDKIGMDVYASQVSQLMHQNSVLLITSCNFTESELIKIITQDKTNSL
FT                   SVWNKIDYPSFQFGGVKGSTICSIAFIKN"
FT   gene            <685319..>686737
FT                   /locus_tag="DEHA2F07920g"
FT                   /old_locus_tag="DEHA0F08811g"
FT                   /old_locus_tag="DEHA-IPF8439"
FT                   /old_locus_tag="DEHA-CDS2547.1"
FT   CDS_pept        685319..686737
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07920g"
FT                   /old_locus_tag="DEHA0F08811g"
FT                   /old_locus_tag="DEHA-IPF8439"
FT                   /old_locus_tag="DEHA-CDS2547.1"
FT                   /product="DEHA2F07920p"
FT                   /note="weakly similar to uniprot|P13712 Saccharomyces
FT                   cerevisiae YBR195C MSI1 Subunit of chromatin assembly
FT                   factor I (CAF-I) regulates the RAS/cAMP pathway via
FT                   sequestration of Npr1p kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89044"
FT                   /db_xref="GOA:Q6BM67"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM67"
FT                   /protein_id="CAG89044.2"
FT                   /translation="MNGEELVLNDTVENSDVSNVDMQSDKPDDVTVVEHSPIDQQTEVN
FT                   YRIWKKNAPFLYDYITTHSLLWPSLTVQFFPDLEKPLSKDAMLDPFQDFKKADSNGSKS
FT                   ENEASMQRILLGTFTLGQSTDSISILQLPYYTNLNKNLTIDKLDYNHEKEEFELTKIAK
FT                   KKINVLQKINHWGDVNKSRYMPQNPDVIASSNNLGNLVIYDRTKHASFKNSLIGEDTEI
FT                   NKPQLHLINEWNPSDADIFAIDWNKQKEGVIISANMEGNINLYDIKSKFTSKDVQTINE
FT                   SQHFGNSNIAINDIEWIPNHDSILTYVDDQGSIKLLDVRLPEHQSLVLQHQKSNKGINS
FT                   VSVNPGNQACLATGDIDGMIDVWDIRSFGSGNANSVYNIKKQHEGSITQLKWHPKYHNI
FT                   LASSSSDKSVKIFDLNTIEEEEGLIFTHAGHMLGVNDLDWSLHDDWMMASVADDNSLHV
FT                   WKPSSQIVKQYKSI"
FT   gene            complement(<686857..>687528)
FT                   /locus_tag="DEHA2F07942g"
FT   CDS_pept        complement(686857..687528)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07942g"
FT                   /product="DEHA2F07942p"
FT                   /note="similar to uniprot|P05626 Saccharomyces cerevisiae
FT                   YPL078C ATP4 Subunit b of the stator stalk of mitochondrial
FT                   F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66296"
FT                   /db_xref="GOA:B5RUB8"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB8"
FT                   /protein_id="CAR66296.1"
FT                   /translation="MKTKFCSYILTISRIGLRYMSTPVEPKQKANSIVDAMPGNNYLSK
FT                   TGFLATSAAAAIYGISNEILVIHEETILVVTFTAFAALAAKFVAPLYTEWADGEIKKVN
FT                   DLLNTSRTKHVTAVKERIDSVSQLKDVVETTKQLFAISKETAQLEAESFELKQKLAVSQ
FT                   EAKSTLDSWVRYEQQQRQLEQEQLIKSVLEKVNKEVENPKFQDKILAESVAEVEKLFAK
FT                   A"
FT   gene            complement(<688187..>688702)
FT                   /locus_tag="DEHA2F07964g"
FT                   /old_locus_tag="DEHA0F08855g"
FT                   /old_locus_tag="DEHA-IPF8437"
FT                   /old_locus_tag="DEHA-CDS5727.1"
FT   CDS_pept        complement(688187..688702)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07964g"
FT                   /old_locus_tag="DEHA0F08855g"
FT                   /old_locus_tag="DEHA-IPF8437"
FT                   /old_locus_tag="DEHA-CDS5727.1"
FT                   /product="DEHA2F07964p"
FT                   /note="similar to ca|CA3480|IPF3224 Candida albicans
FT                   IPF3224 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89046"
FT                   /db_xref="InterPro:IPR013169"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM65"
FT                   /protein_id="CAG89046.2"
FT                   /translation="MSLSLNEQANSRKSRLSKLREDRKLEKESTGDVQTQSILDQNTNG
FT                   ATPVNSTNEDIIHDTNNSSIRSRNFDLETRDAVSGIKNPPTLALSNNETVEVLASQIQR
FT                   DILQGIRHKADEASSGQDEGSPLEKHESAYHSKDLKADLAYYFNKADTKTNQAINRILQ
FT                   TKYQNSIH"
FT   gene            <689183..>692638
FT                   /locus_tag="DEHA2F07986g"
FT                   /old_locus_tag="DEHA0F08877g"
FT                   /old_locus_tag="DEHA-IPF8436"
FT                   /old_locus_tag="DEHA-CDS0274.1"
FT   CDS_pept        689183..692638
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07986g"
FT                   /old_locus_tag="DEHA0F08877g"
FT                   /old_locus_tag="DEHA-IPF8436"
FT                   /old_locus_tag="DEHA-CDS0274.1"
FT                   /product="DEHA2F07986p"
FT                   /note="weakly similar to uniprot|P51979 Saccharomyces
FT                   cerevisiae YGL251C HFM1 Meiosis specific DNA helicase
FT                   involved in the conversion of double-stranded breaks to
FT                   later recombination intermediates and in crossover control"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89047"
FT                   /db_xref="GOA:Q6BM64"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM64"
FT                   /protein_id="CAG89047.2"
FT                   /translation="MPFTPPRFMSNTGNSGIQEFALGLSTPLSGINSNNSALSGSRCHT
FT                   YRSGTLGIGRIREPVFNFDTSHIFGDHYSLNCPPVRRKPSIPIRSVKRFDLRKQADKGI
FT                   NFSDFSSSSEGNETLDVSQKSTLMSTNQPVLSTSILPEKYRSIFSFSHFNKMQSESFET
FT                   IYNSDHNCVINAPTGSGKTVLFELAMLRLFYFSNTNNKVLYLAPSKALCAEKYNDWVGK
FT                   FSFLSITIGVLTSETSLEEAEDVKRSNIIISTPEKLDLLTRRLSNYDKLLNDVKLIVID
FT                   EIHILKDTRGSTLEVVTTRINKMCSKVRIIGASASAPNLYDMSIWLRKKDDLNPAITLN
FT                   FDDTYRSVQLDKIVLGYASQKDKDFHFDQFLHSKLVGVIRHYGKNKPTLIFCPTRNSCI
FT                   ETAKYLNDNFDRNLCSQNSRIQFDEKELLVYAAHGIAFHHAGLSSDDRKKIELLFIEGK
FT                   LNILCSTSTLSSGVNLPTYLVIIKGTKRWYSGSFHEYKETDVLQMIGRAGRPQFETRGK
FT                   AVIMTTENQKDKYQRLLKGILKDGSEKIESCLHLNLAQHLVAEISLGTIGSIDDTLQWL
FT                   KSTFFFIRFTSNPSYYKEISSFHASEPNKRLHHFCQKYLDSLVNERIVSPISSGGFRCT
FT                   EYGDVMTKYYILYPTMRNIIRSKAGNTLLDVLTIFSRSSEFSEFSIKYNEKKLYKAINS
FT                   SPYIRFPLHSTEFQDSDKVMLLLQYELCGLDFPNSPELMKLYYSFEGDKCYVFKQASRI
FT                   IRCMIDVFRYKKDCVSLLNTLRFSRCVAGRCWENSVTELKQLDGIDEECIKKLRKNNIS
FT                   GFAEAKYLSQSQLEYFLGIEPGTGKNIAQSLQSLPKFKINATLASNKVRTDLETLEISL
FT                   IVSIGIDNMERGNSKIKHNFINTIIGLSTGELLDFRRIAILELVEGNINSFRLTANVTD
FT                   RQQKIHCHILSEDMVNIDARYVLSLDIIEEWKFDNLMNQKSRYESEYNSTTIKEIDNVL
FT                   TQYSKSDSESDLDSEDLILDPVKSIRSTVEVSKEKCNLRDKPYRLNAIRKLRLDGNYEC
FT                   NHLCKDKTKCRHFCCRDGIPKVKKQRNTNKHVEIESNNCDSRLTASCSSFDISQIARSQ
FT                   TSRPNGPSFQSQDYLSSPNHKRKKIRLGQRVGIFNSNNGGLFDY"
FT   gene            complement(<692851..>693864)
FT                   /locus_tag="DEHA2F08008g"
FT                   /old_locus_tag="IPF_8434"
FT   CDS_pept        complement(692851..693864)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08008g"
FT                   /old_locus_tag="IPF_8434"
FT                   /product="DEHA2F08008p"
FT                   /note="weakly similar to uniprot|Q7S897 Neurospora crassa
FT                   NCU06530 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66297"
FT                   /db_xref="GOA:B5RUB9"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR030294"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB9"
FT                   /protein_id="CAR66297.1"
FT                   /translation="MHIGHLLLKALSLQKFASEIVLENTTPGIPKVQTNLKYSPQYVEV
FT                   DLIPENEQEVYKINGRRPLVIWHGLGDNYNSSGMVDVVSIFNQRYPDMFIYPIFLDAKP
FT                   SKDQEKTLFGDANKEVEYVCEQLSAIPELKEGFDAIGFSQGGLFMRALVQRCSSVSVNN
FT                   LITFGSPHMGVSELPMCKPNDWLCKRKNAILKRQVWHENIQKSIIPAQYFRDPYEYDNY
FT                   VSHSNFLADVNNELAQKSNPAYAKNLNKLSKFVMVVFTKDTTLVPKESAGFNDWDTIYD
FT                   KTIPFDKTSLYENDLLGLRTMNENGKLAFLEIEEDHMVISDTFLVDIAENYVGGSL"
FT   gene            <694025..>694885
FT                   /locus_tag="DEHA2F08030g"
FT                   /old_locus_tag="IPF_8433"
FT   CDS_pept        694025..694885
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08030g"
FT                   /old_locus_tag="IPF_8433"
FT                   /product="DEHA2F08030p"
FT                   /note="similar to uniprot|P36144 Saccharomyces cerevisiae
FT                   YKR060W UTP30 Possible U3 snoRNP protein involved in
FT                   maturation of pre-18S rRNA based on computational analysis
FT                   of large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89049"
FT                   /db_xref="GOA:Q6BM62"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM62"
FT                   /protein_id="CAG89049.1"
FT                   /translation="MVSSFILGQSALADGTKSAKSLASHIGKENGPTHHEAVYLIINTK
FT                   IYLTKIKDYTPRIIPLSKGLDKLENKSVLLVTKDPSLPYRDALTKKDSPTEDVFNQIYT
FT                   LTKLKHISKDPKKLTKLFKEFDIIVADNRVHKFLPDILGARFYVKNKKIPFMVQMAKPD
FT                   KDARLSKGKKSTKLKDDRCEPEYVRYQMKSIVRNASYIPSATGTCISVKIGYSDWKPEE
FT                   LLTNANDVIKYLVEPKFLPVGGLLRTPKNLVSVHIKTSESISLPIFKQKEDIKEEDDDD
FT                   SDLDF"
FT   gene            <695292..>697073
FT                   /locus_tag="DEHA2F08052g"
FT                   /old_locus_tag="DEHA0F08943g"
FT                   /old_locus_tag="DEHA-IPF8432"
FT                   /old_locus_tag="DEHA-CDS1669.1"
FT   CDS_pept        695292..697073
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08052g"
FT                   /old_locus_tag="DEHA0F08943g"
FT                   /old_locus_tag="DEHA-IPF8432"
FT                   /old_locus_tag="DEHA-CDS1669.1"
FT                   /product="DEHA2F08052p"
FT                   /note="similar to uniprot|P36029 Saccharomyces cerevisiae
FT                   YKL174C TPO5 Protein involved in excretion of putrescine
FT                   and spermidine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89050"
FT                   /db_xref="GOA:Q6BM61"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM61"
FT                   /protein_id="CAG89050.2"
FT                   /translation="MENSQSLGSTSQNASSGGSKPIRTSISSFTNHFNLRKSAPGKLLN
FT                   SLMHDMEDQEVEIEHFKYKQELERKLSVTSVIGLGFGIVGVVFGLSSTIWISLIDGANV
FT                   TILYGWVITAFFSTCVVLSLSEIVSKYPTSGGVYHFSALLSNEKYSSVCSWFTGWFLII
FT                   GNWTYAVSIMFAGSQFILSIFGLKDAYYKEDAFLVLAVYFTLLTFCGFVNFKFAKFLEK
FT                   INKVCIIWSISTVLTIDFLLIFFAKKTNSIEEILTRFDNTRSGWPDPLAFMVGLQSPSF
FT                   TLSGYGMIYSMTDEVKNPERNMPKGTISAILLAGLTGIIFIIPILTILPELTLLLDETP
FT                   EIMPIDLIFKFATESYLISFLLVLLLVGTVFFQAIAALTTASRTTYAFARDGGLPFKNY
FT                   WVEVNSIEESIIPKNALFLSMSVCGALSLLSLFSSSAFNAFMGSSVISLALANGIPILC
FT                   LMLNKRKKIHGAAFRLKGFGWLVNGLSIFWVVLSFIILCLPPVIKDLTWFTMNYAIVVI
FT                   LGFAGFASLGYRIWGVGSFEGPQIDHDYFELQDLVRKDFSVDDSYVQGIDDQDDDDNAI
FT                   AGSSDVQTDLDKPNEGP"
FT   gene            <697651..>698115
FT                   /locus_tag="DEHA2F08074g"
FT                   /old_locus_tag="DEHA0F08965g"
FT                   /old_locus_tag="DEHA-IPF8429"
FT                   /old_locus_tag="DEHA-CDS6001.1"
FT   CDS_pept        697651..698115
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08074g"
FT                   /old_locus_tag="DEHA0F08965g"
FT                   /old_locus_tag="DEHA-IPF8429"
FT                   /old_locus_tag="DEHA-CDS6001.1"
FT                   /product="DEHA2F08074p"
FT                   /note="highly similar to uniprot|P39515 Saccharomyces
FT                   cerevisiae YJL143W TIM17 Mitochondrial inner membrane
FT                   protein involved in protein import"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89051"
FT                   /db_xref="GOA:Q6BM60"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM60"
FT                   /protein_id="CAG89051.1"
FT                   /translation="MSADHTRDPCPIVILNDFGGAFSMGVIGGCVWHGIKGFRNSPYGE
FT                   RGYGSISAIKSRAPVVGGNFGVWGGLFSTFDCSVKAVRKREDAWNAVIAGFFTGGALAI
FT                   RGGWRHTRNSAITCACLLGVFEGVGMMMQRVMAQPTVAPAYPEEAAPLAA"
FT   gene            <698549..>700765
FT                   /locus_tag="DEHA2F08096g"
FT                   /old_locus_tag="IPF_8427"
FT   CDS_pept        698549..700765
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08096g"
FT                   /old_locus_tag="IPF_8427"
FT                   /product="DEHA2F08096p"
FT                   /note="similar to uniprot|P14680 Saccharomyces cerevisiae
FT                   YJL141C YAK1 Serine-threonine protein kinase that is part
FT                   of a glucose-sensing system involved in growth control in
FT                   response to glucose availability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66298"
FT                   /db_xref="GOA:B5RUC0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC0"
FT                   /protein_id="CAR66298.1"
FT                   /translation="MSYNFNYNRHNSLGGNWQLPPPYGLNGSEQTPPLADNTPGVQDPQ
FT                   RTAQSNQMPGFRNPWYTSNQAPSGMVTSPNMSQSPTKGQQTIPLLQQQSKRMSFANQLP
FT                   TTYEYDGQRPSNAPPFIHPPTRVDNPFNQYYTNQEVNLGHVDRRMSAVADGAYYSANSY
FT                   NAYPPESSDPEFQSQYMQNVPLYDQGLNRRSSVATGNYHQAPHNTHVNYHHQPAKVGRS
FT                   ASIVQYQQYQQALQNQSQTSKRNAAPKARKIYNKYDLHPKVHHQPKYRRCSVNSIHISP
FT                   VNALSVYITESYRICQPKKFQYCKSTNPKRVLTKPSDAKYNNGFDNEDSDYILYVNDIL
FT                   GTDEGRKYIVLDLLGSGTFGQVVKCQNLTNQSVCAIKVIKSKPAYMNQSLTEVKLLEYL
FT                   NSNSNSKRFIRLLDTFMHKEHLCLVFELLASNLYELIKQNQFQGLNMKLVKLLTRQLLE
FT                   AMAELKGFQMIHCDLKPENILLFQPDKPDIKVIDFGSACFTRQTVYSYIQSRFYRSPEV
FT                   ILGLPYTESIDMWSLGCIVGELFLGLPMFPGTSEFNQIWKIVDMLGYPPRHMIEVGRNS
FT                   LNFFNKFPPSIPDGKPVFKVKTLEEYIQFLATTKGKEDQVKKEQPNKNYFKHRLLKDII
FT                   MNYKLPSKKMTNSMIEKECQERLLLIDFLSKVLNLNPLERLTPQEALKHPFVSDVSLHH
FT                   PSTSSTASSGDRSSNHSDLSDNLKDAGKAPTGGISDSSRAPIPS"
FT   gene            complement(<701221..>702315)
FT                   /locus_tag="DEHA2F08118g"
FT                   /old_locus_tag="IPF_8425"
FT   CDS_pept        complement(701221..702315)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08118g"
FT                   /old_locus_tag="IPF_8425"
FT                   /product="DEHA2F08118p"
FT                   /note="similar to uniprot|Q7S4H9 Neurospora crassa NCU08171
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66299"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC1"
FT                   /protein_id="CAR66299.1"
FT                   /translation="MRLLSFVIILSWISWVVAESCTGEQKLNLEDFQFVEHSNENLDGL
FT                   SEKLKSREVSLTKVIEDGNHKLTKASPWEYSAVKDAIQWESKDGFDDLNTKKWVPQGIS
FT                   SSADAYDKGDWNGKEAWIVSWHNEDDTSVRVTFVDKETNKYRHVLLVYPTAKDDFGPVQ
FT                   IHAGGIAWYGDKLYVVDTDIGLRMFDLSTIWEVDDGSKIGKDGTKYTAASYKYVIPQIS
FT                   YYKLTPQRDFKFSYVALDRTSTPYSLIVGEYRTASSGKKTRLVKWNLDSENRKLKSKTA
FT                   SFGYCIGQPRMQGAVSVGEKVYISVSNEKNPGDLYTWTAGSKPKRESSFFPPSPEDLAY
FT                   NKHGNELYGLTEGIGKRYILTYGL"
FT   gene            <703726..>704301
FT                   /locus_tag="DEHA2F08140g"
FT                   /old_locus_tag="DEHA0F09031g"
FT                   /old_locus_tag="DEHA-IPF8423"
FT                   /old_locus_tag="DEHA-CDS5455.1"
FT   CDS_pept        703726..704301
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08140g"
FT                   /old_locus_tag="DEHA0F09031g"
FT                   /old_locus_tag="DEHA-IPF8423"
FT                   /old_locus_tag="DEHA-CDS5455.1"
FT                   /product="DEHA2F08140p"
FT                   /note="similar to uniprot|P20433 Saccharomyces cerevisiae
FT                   YJL140W RPB4 RNA polymerase II subunit B32"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89054"
FT                   /db_xref="GOA:Q6BM57"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM57"
FT                   /protein_id="CAG89054.2"
FT                   /translation="MNVSTSALGVRRRKPTTQNIDDEENAATLSLGPEFQLTQLTNSGE
FT                   EEQLIALNLSEARLLIRAALKERKNKNQANSEFDDEDEDNVKEDEISNMDLAGPNSNEI
FT                   MHKTLNYLSNFSRFKNSSSTETVEKLLNDFNFSTSEPLHPFELAQLGTLECEDAEEAKS
FT                   LIPSLTNKVSDVQLQTLLTELRKYQTLS"
FT   gene            <704515..>707472
FT                   /locus_tag="DEHA2F08162g"
FT                   /old_locus_tag="DEHA0F09053g"
FT                   /old_locus_tag="DEHA-IPF8421"
FT                   /old_locus_tag="DEHA-CDS0476.1"
FT   CDS_pept        704515..707472
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08162g"
FT                   /old_locus_tag="DEHA0F09053g"
FT                   /old_locus_tag="DEHA-IPF8421"
FT                   /old_locus_tag="DEHA-CDS0476.1"
FT                   /product="DEHA2F08162p"
FT                   /note="similar to uniprot|P36048 Saccharomyces cerevisiae
FT                   YKL173W SNU114 involved in splicing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89055"
FT                   /db_xref="GOA:Q6BM56"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM56"
FT                   /protein_id="CAG89055.2"
FT                   /translation="MDEDELYDEFGNLIGDPLDSDADSLDEIPEEQDVQSEKEAEDLIV
FT                   ETGDEALVIHANNGNGLKLSEKFGPGVETIIAKPYEQAVDTPVIKPMNKKKLKVEFTEA
FT                   VTNNVDENDHRVKNLPELVYSRDYMISTMNSLPERVRNIAVIGNLHSGKTTFIDMLVLQ
FT                   THSPSISLSSSLKNFQPLRFMDNHKLEIDRGISIEASPITLLLPDLNDKSFVFNIIDTP
FT                   GHSNFASESTSALQIVDGALLVIDVVEGLTPRDKSLISELMKNNKPITIVLNKIDRLIL
FT                   ELRLPVEDFYFKISYTLDDINNFINENEYVSTYKQQMVFSPTDGNVIFASSSLEFVFTL
FT                   DSFTKLYADNHKLQGVDSQEFSRRLWGDVFYNQDKAQFVNSSNNGKFSRSFNFFISEPI
FT                   YKIITQTLTYDGSSKNLAQLLWNNFKVSLHNAQYKQDSQMLLKEIFKSVFSGSKGFVDS
FT                   VVHNIPSPIETASDRLELLSGSDNLPSARLIAQANKLIASADGERFYTLVRIYQGSIKA
FT                   GSKVRVLGQNFDEDDDDYKIEVIDELFIPGGRYKIPVKEAFAGSIVIISGIDSIISKGA
FT                   TIYDNADFNSDSKIFRPLSYERQSIFKIAIEPANPSELPKLLEGLRKLNKSYLACTIKV
FT                   EESGEHVLFGPGEIYLDCMLHDLRNFFTDDLEIKVSDPMTRFSETCIDTSVTKISAKSS
FT                   SGNNSISIISEPVDDSRLSLAIENGKINLSQPLKTTSKILRKEYGWDALSARSVWCFGP
FT                   EDLHNPSILIDDTIEGETDKKLLYSLKDSISLGFKWSVNEGPLCDEPIRNTKFKILDAV
FT                   ISGSEIQRSGTQIIPMTRKACYTGFLTSSPRLMEPIYTVYVTCSYQAIVAVKKLLDRRR
FT                   GMVTTENPVPGTQLFHIEGQVPVIESIGLESDLRLQTQGQAMCFLVFERWDVVPGDPLD
FT                   SDCYLPQLRPVPNASLARDFVMKTRKRKGLSGEPNLQKYIDIELYNKLRESGVIE"
FT   gene            complement(<707546..>709195)
FT                   /locus_tag="DEHA2F08184g"
FT                   /old_locus_tag="IPF_8419"
FT   CDS_pept        complement(707546..709195)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08184g"
FT                   /old_locus_tag="IPF_8419"
FT                   /product="DEHA2F08184p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89056"
FT                   /db_xref="InterPro:IPR018822"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM55"
FT                   /protein_id="CAG89056.1"
FT                   /translation="MYKVSEYSNNNHEREDASTKEERTAIEIDTGDAFQDNDYNMSADE
FT                   DIAEKPGDSINEGERIDEIEDKLLSSGDEDLGAEMHKIGTEVGGDSYRNSVVEFYSEDE
FT                   IENLEEDEQTSDKETENIIEDEKSDYLSNDSVVELDELNNFEDHDDVQEIPPPNNSLHK
FT                   REDSGYNNQETLEVREHEELVEDDQDEYDQDENGQDENGQDENADDKIKEIEVNAGGAN
FT                   QEIFEELDNEGFDKSEHDEIKEGREENDVKHEKENDDERGDEQRKKEEEELEEKEIEVQ
FT                   GEQQEDDDGKPVNEQVGYREVRKNENSIHGETVIEGIIEYGNDEKDEVRPDEENIPASS
FT                   NINVQSKMPNSKLESTFPIIINIAETEFLLVPFDNHRNPEIDVSHLVSLYDDNEILKLT
FT                   IEEFFGLMRTNEDLNEIHQFTVNKELVLVIPELNLSITEDNIYSRDITIEDFIVSFENL
FT                   NSNSINDGEELIHKSLSFLLTSQTRFITNFNNLTESIRRGKGFNCVSLENSVYEPIAIA
FT                   PEARTEDSHKRQSLDSSDETDAQQTKRAKVSI"
FT   gene            complement(<709435..>711939)
FT                   /locus_tag="DEHA2F08206g"
FT                   /old_locus_tag="IPF_8416"
FT   CDS_pept        complement(709435..711939)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08206g"
FT                   /old_locus_tag="IPF_8416"
FT                   /product="DEHA2F08206p"
FT                   /note="weakly similar to uniprot|P32591 Saccharomyces
FT                   cerevisiae YJL176C SWI3 transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66300"
FT                   /db_xref="GOA:B5RUC2"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR032451"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC2"
FT                   /protein_id="CAR66300.1"
FT                   /translation="MSSDEHLDHLQEDKDDDIVAGSPEGSQKQGSEAPEVAEEGAKPET
FT                   GASEENSDVDMEGDNLSDAAKSNDDETGDKDTGNQDIKNSVEKNSEVKEEDESREEQND
FT                   SDAPSKNEPMDVDEVQDDKEPQEESDKEEIQNDESEKEKSEAVQDIEDNHTQDIEEKVK
FT                   DEADDEEEKKDEQDEEKKDEQYKEEDRDENVDDKDEDKDDEDKDDEGDDDEDDDDKVKD
FT                   AENQTPIDQTHAIILPSYCSWFNMSKIHKIEKESLPEFFDTTHPSKSPKIYINYRNFMI
FT                   NSYRLNPNEYLTLTSCRRNLVGDVGTLMRVHRFLNKWGLINYQVNPNFKPGYALEKLPN
FT                   GSQIGLPYTGNFHVTYDTPRGLFPFDTHKFNEDRVDVSKLKKLLNIEQVSDKPINNKMS
FT                   SDAKNVDDLDTDSSEPPQKKHKSSKDGWTDKEISKLILGVKDFPNDWYKISKSVSTKTP
FT                   QECILKFLKLPIEDNFNDLTDQELGFLKYSSNFPISSIDNPVISNLAFMTQLVDSDVAK
FT                   AASERACKVMDIKALEKIREVYGEADQTKADSVKQNEKKPEESEINKDLDDSSENKQEN
FT                   ESKFSPKKDTDTEMSIDDEKESTIGDNKHDEEIKSNGTSEQNGNVDNISPKPQADVDLI
FT                   DEYNDENTDPLQVIKDASSNTFGIVGARSHLFANYEERELNKLTNTIVNNQISKLDLKL
FT                   NKVDELEKVYEKERKHLAKQQEEVFIDRLALTKSTIHITKKLNDAISMIQQKTENISEL
FT                   GDVSSILSDVQSLLYKPNRHSLIQNAVEKQSSDSNDKSDNGSSKDTENRNINSNSSAAN
FT                   KENNAVKPLSLDTPSSFKVWVP"
FT   gene            <713634..>714264
FT                   /locus_tag="DEHA2F08228g"
FT                   /old_locus_tag="DEHA0F09119g"
FT                   /old_locus_tag="DEHA-IPF8412"
FT                   /old_locus_tag="DEHA-CDS6884.1"
FT   CDS_pept        join(713634..713942,714016..714264)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08228g"
FT                   /old_locus_tag="DEHA0F09119g"
FT                   /old_locus_tag="DEHA-IPF8412"
FT                   /old_locus_tag="DEHA-CDS6884.1"
FT                   /product="DEHA2F08228p"
FT                   /note="highly similar to uniprot|P46990 Saccharomyces
FT                   cerevisiae YJL177W RPL17B Protein component of the large
FT                   (60S) ribosomal subunit nearly identical to Rpl17Ap and has
FT                   similarity to E. coli L22 and rat L17 ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89058"
FT                   /db_xref="GOA:Q6BM53"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM53"
FT                   /protein_id="CAG89058.1"
FT                   /translation="MVRYAATSANPAKSASARGSYLRVSYKNTRETAQAISGWKLERAQ
FT                   KYLDQVLDHQRAIPFRRFNSSIGRTGQGKEFGVTKARWPAKSVNFIKDLLRNGQANAES
FT                   KGLDASKLKVSHIQVNQAPKQRRRTYRAHGRINAYQSSPCHIELILTEENEAVEKADDS
FT                   KKVRLNVRQRGRLATQKRVTAA"
FT   gene            <714722..>715006
FT                   /locus_tag="DEHA2F08250g"
FT                   /old_locus_tag="DEHA0F09141g"
FT                   /old_locus_tag="DEHA-IPF8410"
FT                   /old_locus_tag="DEHA-CDS7468.1"
FT   CDS_pept        714722..715006
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08250g"
FT                   /old_locus_tag="DEHA0F09141g"
FT                   /old_locus_tag="DEHA-IPF8410"
FT                   /old_locus_tag="DEHA-CDS7468.1"
FT                   /product="DEHA2F08250p"
FT                   /note="similar to uniprot|P08525 Saccharomyces cerevisiae
FT                   YJL166W QCR8 Ubiquinol cytochrome-c reductase subunit 8 (11
FT                   kDa protein)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89059"
FT                   /db_xref="GOA:Q6BM52"
FT                   /db_xref="InterPro:IPR004205"
FT                   /db_xref="InterPro:IPR036642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM52"
FT                   /protein_id="CAG89059.1"
FT                   /translation="MAGAGPKAYMGWWGNIGSPKQKYVTTYTVSPYATKPLKGALYNSV
FT                   FNVFRRVKNQTLFVVIPAVIVWNVWAQARDYNEYLYTKAGREDLEKANA"
FT   gene            complement(<715178..>716230)
FT                   /locus_tag="DEHA2F08272g"
FT                   /old_locus_tag="DEHA0F09163g"
FT                   /old_locus_tag="DEHA-IPF8409"
FT                   /old_locus_tag="DEHA-CDS3674.1"
FT   CDS_pept        complement(715178..716230)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08272g"
FT                   /old_locus_tag="DEHA0F09163g"
FT                   /old_locus_tag="DEHA-IPF8409"
FT                   /old_locus_tag="DEHA-CDS3674.1"
FT                   /product="DEHA2F08272p"
FT                   /note="highly similar to uniprot|P08524 Saccharomyces
FT                   cerevisiae YJL167W ERG20 Farnesyl pyrophosphate synthetase
FT                   has both dimethylallyltranstransferase and
FT                   geranyltranstransferase activities"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89060"
FT                   /db_xref="GOA:Q6BM51"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="InterPro:IPR039702"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM51"
FT                   /protein_id="CAG89060.1"
FT                   /translation="MDKAAAKERFINEFDQLVEELKAILIGYKMPQDAIDWFVGNLNYN
FT                   TPGGKLNRGLSVIDTYCILNNTTANDLSSEEYSKVALLGWCIELLQAYFLVADDMMDHS
FT                   KTRRGQPCWYLNEGVGNIAINDSFMLEGALYILLKKHFRNEKYYVDLLDLFHEVTFQTE
FT                   LGQLIDLITADEEIVDLDKFSLSKHSFIVIYKTAYYSFYLPVALAMFMSGINSEQDLKQ
FT                   VRDILIPLGEYFQIQDDFLDCFGTPEQIGKIGTDIKDNKCSWVVNQALLHANEEQRKLL
FT                   DENYGKKDDESEKRCKQLFKDLNIEKIYFDYEEDTGAKLRKQIEQIDESRGLKKEVLTS
FT                   FLNKVYKRSK"
FT   gene            complement(<716410..>717642)
FT                   /locus_tag="DEHA2F08294g"
FT                   /old_locus_tag="DEHA0F09185g"
FT                   /old_locus_tag="DEHA-IPF8407"
FT                   /old_locus_tag="DEHA-CDS3097.1"
FT   CDS_pept        complement(716410..717642)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08294g"
FT                   /old_locus_tag="DEHA0F09185g"
FT                   /old_locus_tag="DEHA-IPF8407"
FT                   /old_locus_tag="DEHA-CDS3097.1"
FT                   /product="DEHA2F08294p"
FT                   /note="similar to uniprot|P36049 Saccharomyces cerevisiae
FT                   YKL172W EBP2 Essential protein required for the maturation
FT                   of 25S rRNA and 60S ribosomal subunit assembly localizes to
FT                   the nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89061"
FT                   /db_xref="GOA:Q6BM50"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM50"
FT                   /protein_id="CAG89061.2"
FT                   /translation="MAKGGKLRSSLKNQQLIESIDKSKSKPVVKKAEEIKEVEVQPLPE
FT                   QIKSSKPKKEKKEKKAKNQDDYQSEVLSKKEQRRLKKVQADESAPLVVEEEVEEELEEG
FT                   SDSEELDLEKLAASESESDINDDDSDEESDEEEEADEDEKDDEEEEEEEDIPLSDVDID
FT                   DDADIVPHTKLTINNMAALKDSLARIELPWSKHSFQEHQSITSAEKTETEIKDIYDDTE
FT                   RELAFYKQGLDAVKQGRAALTKLKVPFSRPMDYFAEMIKSDEHMDKLKSKLLTEAANKK
FT                   ASEDAKKQRHLKKFGKQVQNSTLQERAKQKKETLDKIKSLKRKGASNELSNGDDFQIAL
FT                   DEATSEDRGGDNKRRKPNSKRLGKDSKYGFGGKKRGSRTNDAESSADISGFSSKKMKGK
FT                   PRPGKSKRSKR"
FT   gene            complement(<717820..>719160)
FT                   /locus_tag="DEHA2F08316g"
FT                   /old_locus_tag="DEHA0F09207g"
FT                   /old_locus_tag="DEHA-IPF8404"
FT                   /old_locus_tag="DEHA-CDS3066.1"
FT   CDS_pept        complement(717820..719160)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08316g"
FT                   /old_locus_tag="DEHA0F09207g"
FT                   /old_locus_tag="DEHA-IPF8404"
FT                   /old_locus_tag="DEHA-CDS3066.1"
FT                   /product="DEHA2F08316p"
FT                   /note="similar to uniprot|P33550 Saccharomyces cerevisiae
FT                   YKR061W KTR2 Mannosyltransferase involved in N-linked
FT                   protein glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89062"
FT                   /db_xref="GOA:Q6BM49"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM49"
FT                   /protein_id="CAG89062.1"
FT                   /translation="MHNRYYLIPILVCLWGVYYSIITHYISSNNHAYMFHNEDLNEIFN
FT                   PTKASWNISFPWIDRLPRFSGPNIKTVLQKKGSHKLSSNSYLPNDFPFRERSQIGQENA
FT                   TMVMLVRNRELRGALQSMRSLEDRFNRNYRYPWVFLNDEPFDTDFIEQTTLMASGKTYY
FT                   ELIPSEDWQPPSFIDMDLMEKKLMKAHEDGVIYGGSWSYRNMCHFNSGFFYKQKRLLDY
FT                   EWYFRVEPDVKYMCDFQYDPFTVLRENNKIYGFVLTIHDYENTMPSLWPTVENFMKDHK
FT                   DLIHPNNSIDFITSNETSLNYDFELPESNTSYNLCHFWSNFEIGNLDFFRSEAYETYFK
FT                   YLDKTGGFFYERWGDAPVHSIGLNLLADKNRIHHFEDIGYFHVPYLACPTSIDVLASKR
FT                   CVCKTKGLENHDPETPHDIQPFSCLSRWWRYGSGKTFLNDIDYTFNN"
FT   gene            <719650..>721560
FT                   /locus_tag="DEHA2F08338g"
FT                   /old_locus_tag="DEHA0F09229g"
FT                   /old_locus_tag="DEHA-IPF8403"
FT                   /old_locus_tag="DEHA-CDS1438.1"
FT   CDS_pept        719650..721560
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08338g"
FT                   /old_locus_tag="DEHA0F09229g"
FT                   /old_locus_tag="DEHA-IPF8403"
FT                   /old_locus_tag="DEHA-CDS1438.1"
FT                   /product="DEHA2F08338p"
FT                   /note="some similarities with uniprot|P38126 Saccharomyces
FT                   cerevisiae YBR186W PCH2 Nucleolar component of the
FT                   pachytene checkpoint which prevents chromosome segregation
FT                   when recombination and chromosome synapsis are defective"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89063"
FT                   /db_xref="GOA:Q6BM48"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM48"
FT                   /protein_id="CAG89063.2"
FT                   /translation="MNSNNNLDIEVCLRPWVTLLPFYNFHTKAYEENETSVDFAKIIKQ
FT                   LKVSLTFYLGKAIDLQLNTNVNIKPTKINGKAFQKYFNMDFLQEKEISSEKGACLLLYT
FT                   LDENNQFDSFQNRIIAEGCFKEISIGSDIQGRSYYRHMGKDYSNSIKGILFKGSHADTK
FT                   EEVYFSVPPFLHQQKSSMNFKSLKPQSTETIKTNKNGVWKDCLFVDKTNSVSQKCLLTD
FT                   SVNPTYLFYQCPEEQVKELENKQLNSVWDIINVYNDYIEDKEIIDIECQFRNTCFEKKD
FT                   PERRNPRKIYEDSSLDEEVESEQTNNTSFGYSKIFQPKLANALLELNRSIPMEIISMRA
FT                   SDFVTITPLPDNKLIGSWEKLKMKGNLKQSIYTNVQVSLTLSNMFEHDNRFAGELLTAS
FT                   DKLILLHGPPGTGKSSLAKAIFQKFSVKAISSMKEPIDLPPILLLELAPDRIYSRYYGE
FT                   SPKKLSMLFSTIEATLKKEMHGGFIFMIIDEIESLATERSMLLANNETTDGVRMVNILL
FT                   THLDKLRHYKNFFMIGTSNLIESVDRSFKDRANALYELPLPNEETIYSILEQQIIHFLD
FT                   LGVLYQNSGPNSISCTTPTLSGSLLSQYSSRLLCQIAAYCSVSIPFCIHEKCTKLTNDH
FT                   F"
FT   gene            <721912..>723375
FT                   /locus_tag="DEHA2F08360g"
FT                   /old_locus_tag="DEHA0F09251g"
FT                   /old_locus_tag="DEHA-IPF8402"
FT                   /old_locus_tag="DEHA-CDS2433.1"
FT   CDS_pept        721912..723375
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08360g"
FT                   /old_locus_tag="DEHA0F09251g"
FT                   /old_locus_tag="DEHA-IPF8402"
FT                   /old_locus_tag="DEHA-CDS2433.1"
FT                   /product="DEHA2F08360p"
FT                   /note="highly similar to uniprot|Q9UUU2 Yarrowia lipolytica
FT                   YALI0B20372g nubm NUBM protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89064"
FT                   /db_xref="GOA:Q6BM47"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM47"
FT                   /protein_id="CAG89064.1"
FT                   /translation="MIHNLKTQQRSLRRGLATIADATNPNRVHGGLKDQDRIFQNVYNK
FT                   YGHDLKSAQKMGDWYKTKEIILKGDKWIIDEMKKSGLRGRGGAGFPSGLKWSFMNPPGW
FT                   EKNPGPRYLVVNADEGEPGTCKDREIIRKDPHKLVEGCLLAGRAMNATAAYIYIRGEFY
FT                   NEAVILQQAINEAYKEGLIGKNACGSGYDFDVYIHRGMGAYICGEETALIESLEGKAGK
FT                   PRLKPPFPAGVGLFGRPSTVTNVETVAVAPTILRRGGDWFASFGRKNNTGTKLFCISGH
FT                   VNEPCTVEEEMSIPLKELLEKHCGGVKGGWDNLLGVIPGGCSVPVMPKSVCDDIAMDYD
FT                   ALRDVGSGLGTAAVIVMNKETDMIRAIQRFAAFYKHESCGQCTPCREGTTWLQKMMDRF
FT                   VKGQATEKEIDMIFELTKEIEGHTICALGDAAAWPIQGLIKSFRPLMVDRIKQYEQESQ
FT                   CSVSYGGWVKGGKVKEGKVIDNPLPSAHH"
FT   gene            <723793..>724800
FT                   /locus_tag="DEHA2F08382g"
FT                   /old_locus_tag="DEHA0F09273g"
FT                   /old_locus_tag="DEHA-IPF8400"
FT                   /old_locus_tag="DEHA-CDS4460.1"
FT   CDS_pept        723793..724800
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08382g"
FT                   /old_locus_tag="DEHA0F09273g"
FT                   /old_locus_tag="DEHA-IPF8400"
FT                   /old_locus_tag="DEHA-CDS4460.1"
FT                   /product="DEHA2F08382p"
FT                   /note="weakly similar to uniprot|P38301 Saccharomyces
FT                   cerevisiae YBR187W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89065"
FT                   /db_xref="GOA:Q6BM46"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM46"
FT                   /protein_id="CAG89065.1"
FT                   /translation="MKLGQLIILSSILLGTTVSLDNGGSQGSAAGLEKSSGLEISNLDM
FT                   KSGKGAANIGVKEIEENDNNPTPIDAKRPLDPPVGDEQEGTGEENPSYNSFLMSISMII
FT                   VSEIGDKTFLIAALMAMRNSRFIVFSAAFSSLAVMTVLSGIVGHALPALISQRLTQFLA
FT                   SILFIVFGLKLLKEGLEMSKELGVEEELAEVEEEIASNNLNNEMENMEGGSSNKFTAKS
FT                   QNKKWYVEFGDQIRNLASFVLSPVWIQVFVMTFLGEWGDRSQIATIAMAAGSDYWYVIL
FT                   GAIIGHGVCTAAACVGGKLLATRISMRNVTLGGAIAFFVFAILYFYDALYNTEA"
FT   gene            complement(<724888..>725565)
FT                   /locus_tag="DEHA2F08404g"
FT                   /old_locus_tag="IPF_8398"
FT   CDS_pept        complement(724888..725565)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08404g"
FT                   /old_locus_tag="IPF_8398"
FT                   /product="DEHA2F08404p"
FT                   /note="weakly similar to uniprot|P38304 Saccharomyces
FT                   cerevisiae YBR193C MED8 Member of RNA Polymerase II
FT                   transcriptional regulation mediator"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66301"
FT                   /db_xref="GOA:Q6BM45"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM45"
FT                   /protein_id="CAR66301.1"
FT                   /translation="MNSIHSANSNTVSTSEINTSQIPTDSLESIRNRLNQVHLSLRKLS
FT                   DQINHHNRHPNKVKLPNYAQFQNQFQVLLTQLHTITSDLENNDELLKNTNVYPLPSFPT
FT                   TQQEGLITTLLRKKPLPEVDEWIESAIDKRKNEYVNVQKDDEFAQWCLTKIEELREDFQ
FT                   FYGFNSVEELKYLDSEDEKKETEENKKIENQKYEEELKITAGGKSGLHPNRVLKFMCQG
FT                   VLT"
FT   gene            <725704..>726501
FT                   /locus_tag="DEHA2F08426g"
FT                   /old_locus_tag="IPF_8397"
FT   CDS_pept        725704..726501
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08426g"
FT                   /old_locus_tag="IPF_8397"
FT                   /product="DEHA2F08426p"
FT                   /note="similar to ca|CA2329|IPF4784 Candida albicans
FT                   IPF4784 unknown Function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66302"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC4"
FT                   /protein_id="CAR66302.1"
FT                   /translation="MIRQNYSLANELKDKERKQQSKVQQRQKRQFKTEKLSAADPIRIF
FT                   RQIERLESNNDKTERDLSYLKNLKNDWEFIKKNGLHKAKVESFLIQKEQEEKAKVKANS
FT                   KLWGSKSIYFNPELNPLGKVPGENLSEKPIFQLPNHTKPLKSHVYTNYAKDPLIDTLEL
FT                   VLPEGEPPKFYKMVQNTQRDNTTSNVPSSNTTNAPSAGEVISSSEKGINMLVPSALLKK
FT                   PNKKESDHNSREDEYDNENDFAPEEEEYLIAIGKLPSKRSRIS"
FT   gene            complement(<726651..>727748)
FT                   /locus_tag="DEHA2F08448g"
FT                   /old_locus_tag="IPF_8396"
FT   CDS_pept        complement(726651..727748)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08448g"
FT                   /old_locus_tag="IPF_8396"
FT                   /product="DEHA2F08448p"
FT                   /note="similar to uniprot|P38127 Saccharomyces cerevisiae
FT                   YBR192W RIM2 Protein of the mitochondrial carrier (MCF)
FT                   family that is required for respiration"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66303"
FT                   /db_xref="GOA:B5RUC5"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC5"
FT                   /protein_id="CAR66303.1"
FT                   /translation="MGSSRNEKLHNLEEDAKSSFPYLASDEKSSTIRNPEKLEYTKGTI
FT                   EPKSQTKPWVHFVAGGIGGMVGAVATCPLDVVKTRLQSDVYHSTYNKTPKSSNPVIKAA
FT                   QHFKETGTVIRGLYANEGTRALFKGLGPNLVGVIPARSINFFTYGATKDFISSNFNNGQ
FT                   EETWIHLVSGINAGFVTSTATNPIWLIKTRLQLDKTKGKHYKNSWDCFKNVIKHEGVKG
FT                   LYKGLSASYLGGVESTLQWVLYEEMKSIINKRSIEAHGLRAENKTTKDYILEWSARSGA
FT                   AGAAKFIASLITYPHEVVRTRLRQAPLESTGKPKYTGLIQCFKLVIKEEGLASIYGGLT
FT                   PHLLRTVPNSIIMFGTWEIVVRLLS"
FT   gene            complement(<728006..>733777)
FT                   /locus_tag="DEHA2F08470g"
FT                   /old_locus_tag="IPF_8394"
FT   CDS_pept        complement(728006..733777)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08470g"
FT                   /old_locus_tag="IPF_8394"
FT                   /product="DEHA2F08470p"
FT                   /note="similar to uniprot|P32333 Saccharomyces cerevisiae
FT                   YPL082C MOT1 Essential abundant protein involved in
FT                   regulation of transcription removes Spt15p (TBP) from DNA
FT                   via its C-terminal ATPase activity forms a complex with TBP
FT                   that binds TATA DNA with high affinity but with altered
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66304"
FT                   /db_xref="GOA:B5RUC6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC6"
FT                   /protein_id="CAR66304.1"
FT                   /translation="MSRLDRLVVLLETGSTPFIRNTAADQLSDLAKGHPEETINLLGRV
FT                   YPYLKSTKWETRVTAARAFGGIVNHSELWDPNCSDTIKKEHEFEEKEETIVKIEELDEA
FT                   SRIKLEQDEELKKIDDNLSNLVDFNSWNLHEILKSNVKLLACGTDEFEPSNGTGQHPDD
FT                   NSTFIGKLKKQKSNITPVEETEVKPDPEVKTEHIEAVSVSCDNSDSNSPRPDSSRTASN
FT                   ARLKAMQKRRAKVNAKSGAIRVKPVDISQSSISRKLVENGEGTDEIMEDSAQYDITSQQ
FT                   GGEKLVFETKAPELSPLLSQHAKVAGLVWQFQGVYELLVADLFDEKWEIRHGSALGLRE
FT                   LIRKHGKGAGRVMNKSKEDNDRNNSATLEDLAVRLCTLFALDRFGDYVSDTVVAPVRES
FT                   SAQTLAALLIHLDDQVVLRTFDSLNKLVLQDHANDLGVPKCWEAKHGGMLGVRYFVSVR
FT                   TDVLLSRPESLDTVVNMVLHGLQESDDDVQSVAALTLTPIASQFVKTKQELIHTLLSVI
FT                   WDCLTNLRDDLSASIGSVMDLLAKLCTHKEVIAIMQKDAIESNSNSFEYLVPRLFPFFR
FT                   HSITNVRKAVLRTILEFLSIGSDVTKKWINSKALRLIFQNLLVEQNKDVLELSVLVYNK
FT                   LLKEIDQNNELESMETIFGCHFQPLLTLLMTPIGIARHNYHMNTNLIMRPSGHILGSLE
FT                   DGSAVSTPIEDDTNLDPLEPNGVEKRGRKRKSPNETKVKSDFPFHEDLKVNIDAPIFKG
FT                   DVMLVGFETFIRTRSEAATAYGNSLSYITNEETLQNIFQLLLHYLSSPHATPRLFSALV
FT                   IQEFANSLKSRDMSPPETAIALFQESLMNVLSNPDNSTLPYYRELVPTLKSVRTSCLQM
FT                   FDAFITSAKVSPTKIPQLPVVVQGENEAGPGAFGLEFAEKIVNETYQKLMKNLSPTYRM
FT                   SANQTLEDSKHRITVAIQEANTARTHRTTGILSVYAAAVLALNGIPKKLNPIIRSLMDS
FT                   VKQEESGILQQRSAIAVAHLIKELNIAGKKGAADKIVKNLCAFLCVDTSEVPEFYHNIK
FT                   FKDYILSLRKEEAKTDPADIAAHERAIIEARIKRNGALMTLEALLSIYKSNLFEEVSKL
FT                   KELMLEPLNLLKISSTNEVIEDVLKGQSIIDALGVLRALLPKLDSSLYPEIIERLPLLI
FT                   PGLSSDFSVFRYSTAKCFATISSICPTKAFTFLVKSILPMLNNAGEVKERQGAIESIYH
FT                   LSSTMGSDILPYIVFLIVPVLGRMSDTDQDVRILATTTFASIIKLVPLEAGIPDPADMP
FT                   QELLEGRDRERDFIQQMMDPTKVKSFDLPVSIKATLRKYQQEGVNWLAFLNKYHLHGIL
FT                   CDDMGLGKTLQTICIVASDHYMRAERFKETQSAEFRRLPSIIICPPSLTGHWEQEYNQY
FT                   APFLKVIVYAGAPSIRSAIRSQIHDADIVVTSYDVCRNDVEFLANHDFNYCVLDEGHII
FT                   KNAASKLTRSVKRIRGEHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFHEKFAKP
FT                   IATSRSSKTSSKEQEAGALALESLHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDL
FT                   QKQLYKDFAKKQKSTVVDEVQSEGDEAKEGKTHVFQALQYMRKLCNHPALVLSPDHPKF
FT                   AEVSTYLQSHKSDIRSIEHSPKLMSLKNLLLECGIGVNDNDYLSANYKQKQKQQQMITS
FT                   EGVISEHRALIFCQLKDMLDIVENELLKKYLPSVTYTRLDGSTDPRDRQSIVRKFNEDP
FT                   SIDVLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRLIT
FT                   KNTLEEKIMGLQKFKMNIASTIVNQQNSGLASMDTNQLLDLFDVDENAAKLVEIGENNT
FT                   DKKEENVPDDVAGGLTGKAAGAVGELADLWDESQYEDEYNLDNFIKTLK"
FT   gene            complement(<734575..>735249)
FT                   /locus_tag="DEHA2F08492g"
FT                   /old_locus_tag="DEHA0F09383g"
FT                   /old_locus_tag="DEHA-IPF8392"
FT                   /old_locus_tag="DEHA-CDS5109.1"
FT   CDS_pept        complement(734575..735249)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08492g"
FT                   /old_locus_tag="DEHA0F09383g"
FT                   /old_locus_tag="DEHA-IPF8392"
FT                   /old_locus_tag="DEHA-CDS5109.1"
FT                   /product="DEHA2F08492p"
FT                   /note="highly similar to CA2332|IPF4792 Candida albicans
FT                   IPF4792 unknown Function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89071"
FT                   /db_xref="GOA:Q6BM40"
FT                   /db_xref="InterPro:IPR010422"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM40"
FT                   /protein_id="CAG89071.1"
FT                   /translation="MAKKGVENTKKVAGNAKKAENANKKKQAQEAVLEEQEAGEWEQGS
FT                   KKANKKKEDEKFKKDEAARKKNEREALLKAEEASLPAKPLSAKQRGAAKVASRRTGKID
FT                   DFLSDNKDTPELSASGIDDALSALALTGRDGGVQTKDIDKHPERRVKAAYAAYEEKRLP
FT                   EMRKEEPGLRLQQMKNLIFKEFQKSPENPMNQDTNIKYNATRDEVDQLKTNVKSKRQEK
FT                   FA"
FT   gene            complement(<735623..>736885)
FT                   /locus_tag="DEHA2F08514g"
FT                   /old_locus_tag="DEHA0F09405g"
FT                   /old_locus_tag="DEHA-IPF8390"
FT                   /old_locus_tag="DEHA-CDS2993.1"
FT   CDS_pept        complement(735623..736885)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08514g"
FT                   /old_locus_tag="DEHA0F09405g"
FT                   /old_locus_tag="DEHA-IPF8390"
FT                   /old_locus_tag="DEHA-CDS2993.1"
FT                   /product="DEHA2F08514p"
FT                   /note="highly similar to uniprot|Q12122 Saccharomyces
FT                   cerevisiae YDL131W LYS21 Homocitrate synthase isozyme
FT                   catalyzes the condensation of acetyl-CoA and alpha-
FT                   ketoglutarate to form homocitrate which is the first step
FT                   in the lysine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89072"
FT                   /db_xref="GOA:Q6BM39"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM39"
FT                   /protein_id="CAG89072.1"
FT                   /translation="MSIQSNPYGPNPSDFLSNVNKFEVIESTLREGEQFANAFFSTEKK
FT                   IEIAKALDDFGVDYIELTSPVASEQSRSDCEAICKLGLKAKILTHIRCHMDDARVAVET
FT                   GVDGVDVVIGTSQFLRQYSHGKDMNYIAQSAIEVIEFVKSKGIEIRFSSEDSFRSDIVD
FT                   LLNIYRTVDKIGVNRVGIADTVGCANPRQVYELVKTLKSVVSCDIECHFHNDTGCAIAN
FT                   AYTALEAGAKLIDVSVLGIGERNGITPLGALMARMITADRDYVLSKYKLHKLRDLENLV
FT                   ADAVQVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPSDFGLTRYIHFANRLT
FT                   GWNAIKSRVDQLNLHLTDDQCKEVTTKIKIMGDVRQLNIDDVDSIIKDFHADLSTPLLK
FT                   PQAEGDKDVTEEPVSKKQKSG"
FT   gene            complement(<737359..>738207)
FT                   /locus_tag="DEHA2F08536g"
FT                   /old_locus_tag="DEHA0F09427g"
FT                   /old_locus_tag="DEHA-IPF8389"
FT                   /old_locus_tag="DEHA-CDS4441.1"
FT   CDS_pept        complement(737359..738207)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08536g"
FT                   /old_locus_tag="DEHA0F09427g"
FT                   /old_locus_tag="DEHA-IPF8389"
FT                   /old_locus_tag="DEHA-CDS4441.1"
FT                   /product="DEHA2F08536p"
FT                   /note="some similarities with CA2913|IPF11205 Candida
FT                   albicans IPF11205 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89073"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM38"
FT                   /protein_id="CAG89073.2"
FT                   /translation="MITIVDNDYSSKSTISTNTILKPYPMDDILQVNQYVENTSTTQKL
FT                   INNDDVEDVPLLVSDSEDVSDGEDCSTQSVNGHESDVNVKASIAAEQVKRDMKLSVQEP
FT                   EVNSEKQELTKEQFRNERNQLMTIVVKYIATKITNSFPPQYPPVPNSSEVPLDRFLLIL
FT                   TNRLQLSLPLFMKGIIYLFRYMDIIYLLRYLNQSNNFANYNEMDFCLKKLIVGCFKLAL
FT                   SREKITKNWSAISGMSNGEINTIVKTIVTRMNGKLVVKNIDLLKLKSEIFRFVKMVTNP
FT                   I"
FT   gene            <739113..>740705
FT                   /locus_tag="DEHA2F08558g"
FT                   /old_locus_tag="DEHA0F09449g"
FT                   /old_locus_tag="DEHA-IPF8387"
FT                   /old_locus_tag="DEHA-CDS2113.1"
FT   CDS_pept        739113..740705
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08558g"
FT                   /old_locus_tag="DEHA0F09449g"
FT                   /old_locus_tag="DEHA-IPF8387"
FT                   /old_locus_tag="DEHA-CDS2113.1"
FT                   /product="DEHA2F08558p"
FT                   /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
FT                   YOR241W MET7 Folylpolyglutamate synthetase catalyzes
FT                   extension of the glutamate chains of the folate coenzymes
FT                   required for methionine synthesis and for maintenance of
FT                   mitochondrial DNA present in both the cytoplasm and
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89074"
FT                   /db_xref="GOA:Q6BM37"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR023600"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM37"
FT                   /protein_id="CAG89074.2"
FT                   /translation="MSESDNNKLTPTIINDMRVPTPSTASRTYKDAINALNTLQSNFAS
FT                   IEAIKKLGPDVNKNEMSIREVYEYTRRLGYQPKDFNRMNLIHVTGTKGKGSTCAFAESI
FT                   LSQYRSTNSGPINKIGLFTSPHLKTVRERIRIDGSPINELKFTKYFFEVWDKLSTTESS
FT                   ATEFPTLQPSNVVKPMYFKYLTILSFHVFMSEGVDTAIYEVGVGGQYDSTNIIDAPTVV
FT                   GISSLGIDHTFMLGNTIDSITWNKTGIFKKGCPAVVSDQLEYPESLDVIKERATELGVS
FT                   RLEIVDTNYLPPNVKLGLAGDFQRSNAALAIKLATIHLQKLGVPSNELPDFDNSNTLPD
FT                   KFLKGLSDTQWSGRCQLIEKEGINWYIDGAHTLESINVASSWFKYTVNTKHQPNKGLKI
FT                   LLFNQQNRENANDLLRKLYGNVSSSEFKFDHVIFTTNITWSDGNYNSDLVSLNSSKEQV
FT                   DKLIIQKELAEVWSKLDQKNGYNSRKHIFHDIETSVNFIKSLTHDSPVIDVFVCGSLHL
FT                   VGGFLVVLDNERD"
FT   gene            complement(<740922..>742133)
FT                   /locus_tag="DEHA2F08580g"
FT                   /old_locus_tag="IPF_8385"
FT   CDS_pept        complement(740922..742133)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08580g"
FT                   /old_locus_tag="IPF_8385"
FT                   /product="DEHA2F08580p"
FT                   /note="similar to CA2910|IPF11421 Candida albicans IPF11421
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89075"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM36"
FT                   /protein_id="CAG89075.1"
FT                   /translation="MPAVIVVDNELKDSVKEYGQIIDSVNESVELSKTLQSFFNDQSKE
FT                   IIDKPGLIKKIYETSTASNLTKLSDREFEPTFNLITYILSQLEGSFEKVLNKDSQIIQN
FT                   LIECNPTKQPLLRDRKSIKSTTILSILNTFFNFLPETSSNRIHILTTILSIVEASNIDY
FT                   SLIQGPIGNSLVLWLTQANATDEEIKSIFWKFINLDDKKSYKSLQLIKSFTSKHTLNLN
FT                   ELHKLIKFALLSSTTDVSFLVNNTVASALKENSSDELVSLFTKYTRGELITSVPSSSGL
FT                   SSEDVEQKSRILALGKFFIDNDNKNVFNYNEIPTALASSAEGFEALLINSIKAGVIEGK
FT                   LNQLDQTFYLTRVHRFIIAGDEESISKNWENVKNALVDWKNSLANIDDIVNTSRENIVN
FT                   NNNN"
FT   gene            complement(<742352..>745285)
FT                   /locus_tag="DEHA2F08602g"
FT                   /old_locus_tag="DEHA0F09493g"
FT                   /old_locus_tag="DEHA-IPF8383"
FT                   /old_locus_tag="DEHA-CDS0482.1"
FT   CDS_pept        complement(742352..745285)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08602g"
FT                   /old_locus_tag="DEHA0F09493g"
FT                   /old_locus_tag="DEHA-IPF8383"
FT                   /old_locus_tag="DEHA-CDS0482.1"
FT                   /product="DEHA2F08602p"
FT                   /note="weakly similar to uniprot|Q12152 Saccharomyces
FT                   cerevisiae YPL150W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89076"
FT                   /db_xref="GOA:Q6BM35"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM35"
FT                   /protein_id="CAG89076.2"
FT                   /translation="MNGSRVSDQNTKARLAAQFNQFYLQITSPEVTQIGNYQIIKEIGE
FT                   GAFGKVYLANHVLLNVQVVLKCGLIDDPNIVREVYYHRQLQHKNIVKLYEVIKSERHLW
FT                   MALEYCEGSELFYYIYEKRRLEYHETQNLFNQIITGVKYVHSLNLAHRDLKLENILLAD
FT                   SKRSIVKLTDFGFVREFNPVKRQFLSTVCGTTVYMAPELIKNQPYSGFAIDIWSLGVIL
FT                   FTMLYGEMPFDEDDDLKTKYKIINEEPLYRDSIPQDAIELLRKMLSKDPRARPGLSDIS
FT                   NSSFLIDISNKTSEKNNRSSFYNDQESILSISQHYSSEMQPFQSKMDRNLMRKLDKLNI
FT                   DIIQLQQDVLNGEKNPLTAFYELSLVREFTKKKKHYREKKRKYNEAKKSLINSRKKVKS
FT                   ALSLSEQGSGSQPLERIISSLSLSSNRNSISRTNLSKIGSRKSIEFSDPYKKPRGSESN
FT                   RNSLTGQRMSKTVSNLDHDYTPNSILEGTDSNIEVPLSKIVTFNQSEMKRRPSNATTTL
FT                   SSTTGSENSKKKIKNAKILNRLQFWKKNKNNNGLETARENTTKPTEPQYGNGEKIPLIS
FT                   NGSSPSPKTNLNEINRNIVPIIETQDTTLVNENSIPNNENEIEAKNDLIQEMDNNMEDS
FT                   VFESPNRQATPTSENYPMSSKYLKTRPSSVVSQASQLSHLSQLSTMMSETDLLGETDTM
FT                   DEEEYDEDGIYESSLDNFQQDFPQRHSSVMTPTSGSSVTKKRPSYRRTLSSDISIMSTS
FT                   TAATGSNSAPAKSHHQKRSLSRLSSNSSEESYSQSRKNATMNGHLFASPVPTVPMTDLA
FT                   SDINSSLSPVPNRPSSPDGTPPPKKMTFVNSKLLRHSRNTASQNSIPSINKINSVPQPY
FT                   QFLNDNEATTRSHSPPIPNKFNKLKSKNKPINNIQEQPYSSKFSVKTTWPSKANQQENN
FT                   DVNYRNMQSIDDNSVWNKNNNTAIGPMNGKNMYQANFIINEEEEDEN"
FT   gene            <745742..>747973
FT                   /locus_tag="DEHA2F08624g"
FT                   /old_locus_tag="DEHA0F09515g"
FT                   /old_locus_tag="DEHA-IPF8381"
FT                   /old_locus_tag="DEHA-CDS1110.1"
FT   CDS_pept        745742..747973
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08624g"
FT                   /old_locus_tag="DEHA0F09515g"
FT                   /old_locus_tag="DEHA-IPF8381"
FT                   /old_locus_tag="DEHA-CDS1110.1"
FT                   /product="DEHA2F08624p"
FT                   /note="weakly similar to uniprot|P32580 Saccharomyces
FT                   cerevisiae YPL029W SUV3 ATP-dependent RNA helicase
FT                   component of the mitochondrial degradosome along with the
FT                   RNase Msu1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89077"
FT                   /db_xref="GOA:Q6BM34"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM34"
FT                   /protein_id="CAG89077.2"
FT                   /translation="MSSRLATIRSIGIAPKILGRCIKQFSTSYLLKNANVSNNLNKSSN
FT                   AWENIFKQINQTKPPNTNITNDLEPFDQLKEVVKKPLWQIYWKLVNREFEPPFSNMNNL
FT                   DNDRVNSLIWTFTEKLMLQFEIYLHNPLNCRPIPDIKLVDYINPKICNITQIIYSINND
FT                   MMPSQLPRFYGYNTKIECLNNILSKLIYKEYVESSLTHIKQQDSLVDLSNPAEWFPEAR
FT                   KMKRKFIMHVGPTNSGKTYNSLRKLAKAKSGYYAGPLRLLAREIYERFHDQGIKCNLIT
FT                   GEEVIPSIDSFGKISEISSGTIEMIPSHKKMDICIIDEIQMIADPRRGEAWTNAVLGVQ
FT                   AKEIHMCGEESAVPLILKLAKITGDEVEINKYNRLGKLTVSDKEVSNFKNLQKGDCVIA
FT                   FSKRKILELKCEIERSTNLKVGVIYGALPPEIRSKEANGFNSGQYDVLVASDAVGMGLN
FT                   LKIKRIVFFATKKFNGNETIPLTASETKQIAGRAGRFSKDEGESEGFVTAMYKKDLIFL
FT                   KKMMNEPIQNLSKACTWPTDKVWTYYMSKFPKYTSFYDILAQFEKETSSLEMENFFLTA
FT                   LDSRYEILNLFLRNDLYKKTTIEDQLRLSLAPVNINMSSPLVVDTAFKFFQNITKCETK
FT                   NIFDFNFLHTEILKRRPKFTATTESTVQTLQSLEENHKLVLIFLWLSQRWPTLFVDKES
FT                   ATETKTLIEKRISEELLNLRRLIKHSRSAGVEPRRSNPKGFKFRANQQK"
FT   gene            <748135..>748701
FT                   /locus_tag="DEHA2F08646g"
FT                   /old_locus_tag="DEHA0F09537g"
FT                   /old_locus_tag="DEHA-IPF8380"
FT                   /old_locus_tag="DEHA-CDS5495.1"
FT   CDS_pept        748135..748701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08646g"
FT                   /old_locus_tag="DEHA0F09537g"
FT                   /old_locus_tag="DEHA-IPF8380"
FT                   /old_locus_tag="DEHA-CDS5495.1"
FT                   /product="DEHA2F08646p"
FT                   /note="weakly similar to uniprot|Q03786 Saccharomyces
FT                   cerevisiae YDR248C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89078"
FT                   /db_xref="GOA:Q6BM33"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM33"
FT                   /protein_id="CAG89078.2"
FT                   /translation="MTTTPNTVIVVGGPAGTGKTTIAELLATHFQCPFIEGDALHPPQN
FT                   ISKMSEGIPLTDEDRWDWLKELTRASVGQCIDSTNKSNIAIVSCSILKKIYREYIKQCS
FT                   GESSAGEIQFKFVFLHTTLEHLFERVQNRPGHFMKSDMVSSQYSIMEIPCDDELLENGG
FT                   EALPVDTTNKSPQEIYKEVVSSLKL"
FT   gene            <748984..>749994
FT                   /locus_tag="DEHA2F08668g"
FT                   /old_locus_tag="DEHA0F09559g"
FT                   /old_locus_tag="DEHA-IPF8379"
FT                   /old_locus_tag="DEHA-CDS3841.1"
FT   CDS_pept        748984..749994
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08668g"
FT                   /old_locus_tag="DEHA0F09559g"
FT                   /old_locus_tag="DEHA-IPF8379"
FT                   /old_locus_tag="DEHA-CDS3841.1"
FT                   /product="DEHA2F08668p"
FT                   /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
FT                   YOR246C Protein with similarity to oxidoreductases found in
FT                   lipid particles"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89079"
FT                   /db_xref="GOA:Q6BM32"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM32"
FT                   /protein_id="CAG89079.2"
FT                   /translation="MTSFDPESISYFNPNVDRRVALITGGNSGVGWYTVLHLYLHGYIV
FT                   YIAARSKTRVNTSINELKEEAMVIRSKYTSQQSSNERFLGELYFLDIDLLSLSSVLNAV
FT                   KTFKSREKHLNILINNASVMALPYSITKDGFEIQMQTNYISPFLLTTKLLPLLESSSEL
FT                   FPKSGPPKIIYLSSIGHQLAFKYFNLNSTFNYRPNIVFTWFRYGLAKTCGIHFMKMLAL
FT                   RNPKILCMSVHPGFVMNTNLFSYWTRLPIIGILFWCLFQIFGFLFGVSSEQGSYATVRC
FT                   CLDPKLSLEEDNGKYFATNGAEAEPSKIARNMNFAARTWIWTVQELSERKISIPN"
FT   gene            complement(<750055..>751668)
FT                   /locus_tag="DEHA2F08690g"
FT                   /old_locus_tag="DEHA0F09581g"
FT                   /old_locus_tag="DEHA-IPF8378"
FT                   /old_locus_tag="DEHA-CDS2060.1"
FT   CDS_pept        complement(750055..751668)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08690g"
FT                   /old_locus_tag="DEHA0F09581g"
FT                   /old_locus_tag="DEHA-IPF8378"
FT                   /old_locus_tag="DEHA-CDS2060.1"
FT                   /product="DEHA2F08690p"
FT                   /note="similar to CA0289|IPF13333 Candida albicans IPF13333
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89080"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM31"
FT                   /protein_id="CAG89080.2"
FT                   /translation="MTSLDPSYIWDSYNLDELNNQLIFEKETLSFTLLNVNFDEIEKIH
FT                   AHLKEFLDPFVEYYPWFHSPPVFQQYKHKQISYIYGEFIYQECLNDEWLLTNLLWEFST
FT                   FYPDLYIHLWDSSDFEFILVESSDLIPTWLEPNNSLNRAWINDKTVLIINPNQELNNLT
FT                   LEEALEELLDGNFRKYPAVADHLKDKLSKINESFLIDTIYDLETSLPSQVIQIFADKPY
FT                   LISQSINEFVKESLSPSQNLKSIQNDSFIPTKIGIPFLSLNLMKFKQLELQTTNASDYD
FT                   FGLLVSKILTIGVDNIMRSSDCLPRQASKRSNLSRSVIQDILIECGRLADRVPENTEIF
FT                   QQFENMNEADVSSDFNESALIDRFNEFFKDTTAGLDGIDNASSNEETADRGQDEPENSK
FT                   INDIEIDEDDFFEFFLKDALKLSDKDIDGFRNTDLPTNTKRKFKDFKEYSNDSDYQTDT
FT                   STEYDDGEENDEIDAEYGDEDGDVDDEEEKYIKQFLQKLNGNNNIDGLTNLFKSINTDI
FT                   GPGSVLLQQVISQQQNKRKE"
FT   gene            complement(<751782..>752987)
FT                   /locus_tag="DEHA2F08712g"
FT                   /old_locus_tag="DEHA0F09603g"
FT                   /old_locus_tag="DEHA-IPF8377"
FT                   /old_locus_tag="DEHA-CDS3172.1"
FT   CDS_pept        complement(751782..752987)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08712g"
FT                   /old_locus_tag="DEHA0F09603g"
FT                   /old_locus_tag="DEHA-IPF8377"
FT                   /old_locus_tag="DEHA-CDS3172.1"
FT                   /product="DEHA2F08712p"
FT                   /note="similar to uniprot|P41338 Saccharomyces cerevisiae
FT                   YPL028W ERG10 Acetyl-CoA C-acetyltransferase (acetoacetyl-
FT                   CoA thiolase) cytosolic enzyme that transfers an acetyl
FT                   group from one acetyl-CoA molecule to another forming
FT                   acetoacetyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89081"
FT                   /db_xref="GOA:Q6BM30"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM30"
FT                   /protein_id="CAG89081.1"
FT                   /translation="MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQIK
FT                   AEDVEEIIFGGVLQANVGQAPARQVALKAGLPESIVATTVNKVCASGMKSIILGAQTIL
FT                   TGTADIVVAGGAESMSNTPYYVPSARGGARYGDAVMVDGVQKDGLLDVYENKLMGVAAE
FT                   KCAKDHSFTRDDQDNFAIGSYTKAADAQNAGKFDNEIAPVTIPGKRGKPDVVVANDEEI
FT                   KNFDEPRLRSARAVFQKENGTVTAPNASSLNDGGAAVILVSEKKLKELNLKPLAKISGW
FT                   GEAARAPIDFTIAPSLAIPKALKHANLSMDDIDFFELNEAFSVVGLANAKICNIPSKKL
FT                   NVYGGAVALGHPLGCSGARIVVTLLSVLAQEGGKIGVAGVCNGGGGASSIIIERFDHDS
FT                   KL"
FT   gene            <753317..>753973
FT                   /locus_tag="DEHA2F08734g"
FT                   /old_locus_tag="DEHA0F09625g"
FT                   /old_locus_tag="DEHA-IPF8373"
FT                   /old_locus_tag="DEHA-CDS5177.1"
FT   CDS_pept        753317..753973
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08734g"
FT                   /old_locus_tag="DEHA0F09625g"
FT                   /old_locus_tag="DEHA-IPF8373"
FT                   /old_locus_tag="DEHA-CDS5177.1"
FT                   /product="DEHA2F08734p"
FT                   /note="weakly similar to uniprot|Q6LE92 Saccharomyces
FT                   cerevisiae YPL041C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89082"
FT                   /db_xref="GOA:Q6BM29"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM29"
FT                   /protein_id="CAG89082.2"
FT                   /translation="MHQSPVVSLFRKNKKVEKVISGGSSVGGGVGDGLSGSVSHNQVSN
FT                   GNENMSVEKHPILKRMPKFMLPYTKNFIHAPVSHVTAFLILHELSAIVPLVGIWYVFHK
FT                   YQWSIPLDLPSWAIDKGTHIIDKSMAQFDFRNFSFQEKANFIMEGAYAYVIVKGLFPVR
FT                   IIFSVLSMPWFAKYFVIPFTRMFSFRKKKQPKVPEVESKKEGSEITQKKVTKPRL"
FT   gene            complement(<754259..>755488)
FT                   /locus_tag="DEHA2F08756g"
FT                   /old_locus_tag="DEHA0F09647g"
FT                   /old_locus_tag="DEHA-IPF8371"
FT                   /old_locus_tag="DEHA-CDS3197.1"
FT   CDS_pept        complement(754259..755488)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08756g"
FT                   /old_locus_tag="DEHA0F09647g"
FT                   /old_locus_tag="DEHA-IPF8371"
FT                   /old_locus_tag="DEHA-CDS3197.1"
FT                   /product="DEHA2F08756p"
FT                   /note="weakly similar to uniprot|P38615 Saccharomyces
FT                   cerevisiae YMR139W RIM11 Protein kinase required for signal
FT                   transduction during entry into meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89083"
FT                   /db_xref="GOA:Q6BM28"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM28"
FT                   /protein_id="CAG89083.2"
FT                   /translation="MSKIEVITENVNNGHTGELQTIQYTQSQMVGHGSFGVVFETQILP
FT                   SNEIAAIKRVLQDKRFKNRELQIMKLVHHRNIVDLKYYFYTNNDKSELYLNLILEFVPE
FT                   TLYKASHYYVSKRLSMPSLEVKLYTYQMLRALNYIHSQGICHRDIKPQNLLINPETGEL
FT                   KLCDFGSAKILNPAEPNVSYICSRYYRAPELIFGATNYTTKIDVWSAGCVMAELILGQP
FT                   LFPGESGIDQLVEIIKILGTPSKDQIKNMNPNYMEHKFPQIKPIPLQKIFKKMSNDCIQ
FT                   FLIKVLQYSPHERISCITALADPYFNELRNQTTKLPNYRKLFSKQYHQNSTGGNLNHHN
FT                   NANYQLFNNQPDIRDLPQLFDFDDRELSVDPSLNHILIPEFALDSLKLSSGDLQSFRPL
FT                   TSEELKVTLD"
FT   gene            <755829..>755933
FT                   /locus_tag="DEHA2F08778g"
FT                   /old_locus_tag="DEHA0F09669g"
FT                   /old_locus_tag="DEHA-IPF12592"
FT   CDS_pept        755829..755933
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08778g"
FT                   /old_locus_tag="DEHA0F09669g"
FT                   /old_locus_tag="DEHA-IPF12592"
FT                   /product="DEHA2F08778p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89084"
FT                   /db_xref="UniProtKB/TrEMBL:W0TYT2"
FT                   /protein_id="CAG89084.2"
FT                   /translation="MLLAIGHCSALHHQDRPPMCADSWTDGKSRFIPR"
FT   gene            complement(<756398..>757249)
FT                   /locus_tag="DEHA2F08800g"
FT                   /old_locus_tag="IPF_8366"
FT   CDS_pept        complement(756398..757249)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08800g"
FT                   /old_locus_tag="IPF_8366"
FT                   /product="DEHA2F08800p"
FT                   /note="weakly similar to CA1466|IPF13324 Candida albicans
FT                   IPF13324 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66305"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC7"
FT                   /protein_id="CAR66305.1"
FT                   /translation="MTSTIISKGINKLSLNSLGPPTDEDFIRNIDYDELEKKFHVRKYY
FT                   PQFIHNELATPNLKEMIADKPIYAKANDHLTKEQKREQIKELKRAYMREQKQIREQENL
FT                   QRKREPVANRWCNGAATQRRASRPEQGTEDTRRPRQMPYEDVGVMNGQGPHDTTQHEYK
FT                   STIGNLKGYSRHHSKHDMGFRNPFDSNQSTLIENDPTTSAVKTHRQNSIAGKLMNFIKG
FT                   RSDDESSDDNNLTLSKSYDQTKSSMTTTRKKPKSHSFKTKINELTNKKYTDNLGMYFLR
FT                   IF"
FT   gene            complement(<757376..>758347)
FT                   /locus_tag="DEHA2F08822g"
FT                   /old_locus_tag="IPF_8364"
FT   CDS_pept        complement(757376..758347)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08822g"
FT                   /old_locus_tag="IPF_8364"
FT                   /product="DEHA2F08822p"
FT                   /note="weakly similar to uniprot|P43568 Saccharomyces
FT                   cerevisiae YFL029C CAK1 Cyclin-dependent kinase-activating
FT                   kinase required for passage through the cell cycle
FT                   phosphorylates and activates Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66306"
FT                   /db_xref="GOA:B5RUC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC8"
FT                   /protein_id="CAR66306.1"
FT                   /translation="MNQYGTKETIYSGPNAIVYKAIDRESQNIVALKVVDVDLCMKPHD
FT                   IRREITTLQRIHNKGVLQFINSYTHGDDIVLVTPCYSFDLDQWIKMCTKKRVKFNLDDP
FT                   TNNIIHYRNEFPTSKVENIISTLASTLRYLHDDEGIIHRDIKPSNVYFESEDSPPVLGD
FT                   FGIIYNTRDPPSDEPMDSKYTDVSTGIFKAPELCFGMADYTQAIDIWSLGIMLTLLYSA
FT                   TGKSCIDEEGNFHDLTLISSIFSNFGTPSTSDASDKRLYWPDANRPSSHFNSFKFTEKP
FT                   RVPSDKLLPRCDNPNMLRIFDRMMVYQGNERITAKEILTCIE"
FT   gene            complement(<758720..>760138)
FT                   /locus_tag="DEHA2F08844g"
FT                   /old_locus_tag="DEHA0F09735g"
FT                   /old_locus_tag="DEHA-IPF8362"
FT                   /old_locus_tag="DEHA-CDS2546.1"
FT   CDS_pept        complement(758720..760138)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08844g"
FT                   /old_locus_tag="DEHA0F09735g"
FT                   /old_locus_tag="DEHA-IPF8362"
FT                   /old_locus_tag="DEHA-CDS2546.1"
FT                   /product="DEHA2F08844p"
FT                   /note="similar to uniprot|P39073 Saccharomyces cerevisiae
FT                   YPL042C SSN3 Component of RNA polymerase II holoenzyme
FT                   involved in RNA pol II carboxy-terminal domain
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89087"
FT                   /db_xref="GOA:Q6BM25"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM25"
FT                   /protein_id="CAG89087.2"
FT                   /translation="MNSGYNPGNANHITSHSNRTKNGVPTIPQPALMASNAILTIGPYK
FT                   HRKDLIRESVLTKYQIIGYIAAGTYGKVYKAKSKTNGNSNSNSALMNDNVISIGNGQKE
FT                   AGLQKTNNESMEDKNQLFAIKKFKSDNHSNKNNHDINGNEVIHYTGISQSAIREMSLCR
FT                   ELSNKNITKVVDILLENKSIYMVFEYCEHDLLQIIQYHSHPDVKPIPDFTIKSITWQIL
FT                   NGVTFLHKNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWY
FT                   RAPELLLGARHYTPSIDLWAVGCILAELLSLRPIFKGEEAKIDMNNKKSVPFQKNQLQK
FT                   IVEVLGTPTTKNWPTITKYPEYSAFQQHFSNTYPPNLISWYKLIGRTSKQCLNLLRCLL
FT                   EYDPTIRITADDALTHAFFLELPKMSENSFEGLSQKYPKRRIYTHENDIVSNSQHVNNK
FT                   RHGYDDNMTRKRQR"
FT   gene            complement(<760373..>761512)
FT                   /locus_tag="DEHA2F08866g"
FT                   /old_locus_tag="IPF_8361"
FT   CDS_pept        complement(760373..761512)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08866g"
FT                   /old_locus_tag="IPF_8361"
FT                   /product="DEHA2F08866p"
FT                   /note="similar to uniprot|P32353 Saccharomyces cerevisiae
FT                   YLR056W ERG3 C-5 sterol desaturase catalyzes the
FT                   introduction of a C-5(6) double bond into episterol a
FT                   precursor in ergosterol biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66307"
FT                   /db_xref="GOA:B5RUC9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC9"
FT                   /protein_id="CAR66307.1"
FT                   /translation="MDIVLEIFDYYLLDKTYSSLLPKSLNTTISDSIGKLGVNELTSSF
FT                   YKNYNENHNSTLASASAASNLNVPLRALMNKLQTFQNTDEVYGEVPKLFPLNDYTNDSL
FT                   LLRTNMFRQAFSIFIITAIFGWLLYFSVAYVSYLTVFDKKIFNHPRYLKNQIWLEIHRA
FT                   STAIPVMVLLTVPFFLMELQGFSKLYMEVNASTGGWKAILLQVPSFILFTDCGIYFIHR
FT                   WLHWPSVYKILHKPHHKWIVCTPFASHAFHPVDGWAQSLPYHIYPMIFPLHKVSYLLLF
FT                   TFVNFWTVMIHDGQYLSNDPIVNGTACHTIHHLYFNYNYGQFTTLWDRLGRSYRRPDDN
FT                   LFVRDNKKEEEVKVWNEQTQKMEEIRGKLEGKGDDRVYH"
FT   gene            complement(<761958..>763043)
FT                   /locus_tag="DEHA2F08888g"
FT                   /old_locus_tag="DEHA0F09779g"
FT                   /old_locus_tag="DEHA-IPF8360"
FT                   /old_locus_tag="DEHA-CDS3559.1"
FT   CDS_pept        complement(761958..763043)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08888g"
FT                   /old_locus_tag="DEHA0F09779g"
FT                   /old_locus_tag="DEHA-IPF8360"
FT                   /old_locus_tag="DEHA-CDS3559.1"
FT                   /product="DEHA2F08888p"
FT                   /note="similar to uniprot|P28789 Saccharomyces cerevisiae
FT                   YDL205C HEM3 Phorphobilinogen deaminase catalyzes the
FT                   conversion of 4-porphobilinogen to hydroxymethylbilane the
FT                   third step in the heme biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89089"
FT                   /db_xref="GOA:Q6BM23"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM23"
FT                   /protein_id="CAG89089.1"
FT                   /translation="MPHNTKSMDNTLNIKDNHVQIGGRKSKLAVVQSEIVKECIVEKFP
FT                   ELSCSVLALSTLGDKVQSKPLYSFGGKALWTKELEILLLEQVEEYPRLDLIVHSLKDIP
FT                   TNLPEEFELGCILNREDARDALVMKSGSSYKSLADLPDGSLVGTSSVRRSSQLLKNHPK
FT                   LRFDSVRGNLQTRLNKLDDENSPFECLLLASAGLIRIGLGDRITAHLDAPEMYYAVGQG
FT                   ALGIEIRKGDEKMLQLLKTIEDLPTTYCCLAERSLMRHLEGGCSVPIGVQSHYNESTNE
FT                   LSLKAIIVSPDGIHFVEDEYKGVVNNKDDADAIGIKVGDLLSAKGGREILNSINFERIN
FT                   LPPSSNTPTPQPITPITTNNS"
FT   gene            complement(<763548..>766193)
FT                   /locus_tag="DEHA2F08910g"
FT                   /old_locus_tag="DEHA0F09801g"
FT                   /old_locus_tag="DEHA-IPF8358"
FT                   /old_locus_tag="DEHA-CDS0642.1"
FT   CDS_pept        complement(763548..766193)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08910g"
FT                   /old_locus_tag="DEHA0F09801g"
FT                   /old_locus_tag="DEHA-IPF8358"
FT                   /old_locus_tag="DEHA-CDS0642.1"
FT                   /product="DEHA2F08910p"
FT                   /note="similar to ca|CA5483|IPF817 Candida albicans IPF817
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89090"
FT                   /db_xref="GOA:Q6BM22"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM22"
FT                   /protein_id="CAG89090.2"
FT                   /translation="MRGRIPSTLAQNNAHPSLNQQNSTSTSKTKAKHLEFKYLYFKIQK
FT                   LIHKRVVLSLKYEQLKSPGVHSTLMKPLASKIVEIASISNLSKKINRVINSLPTVSPYQ
FT                   TPRFGPQTNANYNHDVNGDSKLSINLVCILLLLRFEFTIQAENNLIKYDILNTKATICE
FT                   ILAIKMLREYKAYDRINLLFTNPMRDDHFQNKFPSRISSYNTLELAVLSKSKKFLSQPV
FT                   IEQILDRFYDGELIVKRNNDLINESIVQSLLDVNSMFKNLEEQTSLLNDKSDNAVINYT
FT                   FKKLSLHKITTRANIVPKYQSLVMNMKLIFFAALHFILILKQKHTKWYTDPSNTFMKIT
FT                   ELLYWLLAFNFNFELFIKLRNINFKFLRKIIWTYADLILILLIDSAFFLRIFSLLNKVG
FT                   TEDYHDAFSLISIVLLPRILSVFNNYEFFNMITQSLKKMLWKLIGLFFLFISLISGFYL
FT                   TFISLAIDRNSYEIAFDMLKVFFGFTPAVWSNWDSYNNLGRAIQMGYLFLSQFIIATIL
FT                   AIVLSQVFSKVSLSNKEEFAYFKSTNLVVYFQTSDIFYENGFYGKSNRFTTVGILYMFM
FT                   NLFKFPIILIIFIYELIVANINSKKGHNNLKQFTFLNKEQDYYQDQDLVNMDSIDDDTD
FT                   VSLMLVKTRNNSMFQAVPGRKISSVDNVNHATSHLFNNLAPTKSIGNLRSASTDSFIID
FT                   EILSKKYGGTGNLIAQTPVHQGLELVKASNNEMSTKLSASQQSKWLTDRRSLMSMNNPT
FT                   SNANFKATSGKKIKKRKKNVNNEIMTKLNKLETLVDMLVNQQHDQDETVHAFPQQLYDD
FT                   QSIIQEVEENDSSSVIRGDTQDTNFGEIYRINEVSLDDMDSINMSHEEADAGEDDEVDT
FT                   STEVESDDTY"
FT   gene            complement(<766396..>769665)
FT                   /locus_tag="DEHA2F08932g"
FT                   /old_locus_tag="DEHA0F09823g"
FT                   /old_locus_tag="DEHA-IPF8357"
FT                   /old_locus_tag="DEHA-CDS0332.1"
FT   CDS_pept        complement(766396..769665)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08932g"
FT                   /old_locus_tag="DEHA0F09823g"
FT                   /old_locus_tag="DEHA-IPF8357"
FT                   /old_locus_tag="DEHA-CDS0332.1"
FT                   /product="DEHA2F08932p"
FT                   /note="similar to uniprot|P06777 Saccharomyces cerevisiae
FT                   YPL022W RAD1 Single-stranded DNA endonuclease (with Rad10p)
FT                   cleaves single-stranded DNA during nucleotide excision
FT                   repair and double-strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89091"
FT                   /db_xref="GOA:Q6BM21"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM21"
FT                   /protein_id="CAG89091.2"
FT                   /translation="MSSLFVGDEDGEEEYTSYDNRDESIIVQNPIVSEEENKDDSKSEP
FT                   SIPINVQEDSNTAIYQTREICCSLPLRFHQEIVEDMLSKDGLLILGRGLGWELVTANLL
FT                   HALSAPTVVLQRNGQEKHTKKSLLILLNSREEEIFKLGEDLTELRWIDKRNEIANTSGF
FT                   DTPPLITIGGDSMTVDKRKRVYENGGIVSVTSRILVVDLLSGVVEPNDITGLFILHAEK
FT                   VKETSNESFIINLYRDGNDWGFVKAVSDEPESFTGFTPLATKLKVLRVSNVFLWPRFHV
FT                   EVSSSLNFRGRNLPTRQKQELERRRFVTEINTKLSYKMNKIQSAILSCIQACLSELKRH
FT                   NPSLVTEYWDMENIHDSDFVPRIRLSLDSSWHRISWTSKQLVYDLTTLKDLLNYLLTLD
FT                   SLSFYQVVQEIIDSNIKTTGNDTMNVASMSPWLNLDEANTIISYAKERALGKVMVSKSK
FT                   ITIGDESEVDEGNETDAHIHESEIQTEEYNLEELPKWDQLGILIDDIMYEKSQNIANHG
FT                   PIVIMCSDSKTVKQLSYLISNMKDITISSSRRKRFSGRKFMVTKLNDYLEWKEFTSLTR
FT                   KLNSELDMKKHEEVSEDNETERAATPEEELQTSKTFSRGKGHPLSKRRRTRGASSVANV
FT                   GRLYSGSTKGRNNEAVELDTAIVNKLKEDVNENQLEDNTESGDFNSDDNAGGFLIDEEQ
FT                   DQGKPVDISDLDDLNNVFECRPSEVIFENIDKDDQIIIETYNDKTNDSLLQEVSPAYII
FT                   MYEPNLSFIRRVEIYQAVNKESPAKTYFMYYGTSVEEQKHLMRIKKEKDAFTKLIREKA
FT                   TLGKHFESAEDNNKFQLKRNQVANTRIAGGARFRTEEDEMRVVVDVREFRSSLPNLLYR
FT                   VGIKVVPCMITVGDYIVSPKICIERKAIPDLISSFKSGRLYSQCEQMFRHYELPTLLIE
FT                   FDESKSFSFEPFSDLRNYKVNATNPIATKLQQQDIQSKLIMLLISFPKLKIIWSSSPYE
FT                   TAQIFLELKANQEEPDISAAVSKGVNQSIKISSGEPPLYNDNAIDLIQNIPGINNINYS
FT                   QIIEKVQSIEQLVNLSEDELTDIIGIENGKKAYKFIHHWVK"
FT   gene            <769783..>770382
FT                   /locus_tag="DEHA2F08954g"
FT                   /old_locus_tag="DEHA0F09845g"
FT                   /old_locus_tag="DEHA-IPF8354"
FT                   /old_locus_tag="DEHA-CDS5370.1"
FT   CDS_pept        769783..770382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08954g"
FT                   /old_locus_tag="DEHA0F09845g"
FT                   /old_locus_tag="DEHA-IPF8354"
FT                   /old_locus_tag="DEHA-CDS5370.1"
FT                   /product="DEHA2F08954p"
FT                   /note="weakly similar to uniprot|Q02685 Saccharomyces
FT                   cerevisiae YPL024W RMI1 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89092"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM20"
FT                   /protein_id="CAG89092.2"
FT                   /translation="MDNLQQATRNSFEPQQYLQAKATYTQHPILFHIIQVADISRSRLN
FT                   QLDEWQEYEDPNSVSVDRVSKFNNKKYSGNRIIREVDMNTDNGMNRDNSKHFGGIYKLT
FT                   LKDNFENYCFAYEYNDCLQFLRSNSSTGTPLGIPLGGRLLVKKGTLVMNGAIMLKKIQC
FT                   QYLGIDENDKTLSEKLNSGIVKKHIDLLNEELTSNP"
FT   gene            complement(<770497..>772425)
FT                   /locus_tag="DEHA2F08976g"
FT                   /old_locus_tag="DEHA0F09867g"
FT                   /old_locus_tag="DEHA-IPF8353"
FT                   /old_locus_tag="DEHA-CDS1395.1"
FT   CDS_pept        complement(770497..772425)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08976g"
FT                   /old_locus_tag="DEHA0F09867g"
FT                   /old_locus_tag="DEHA-IPF8353"
FT                   /old_locus_tag="DEHA-CDS1395.1"
FT                   /product="DEHA2F08976p"
FT                   /note="weakly similar to uniprot|P46151 Saccharomyces
FT                   cerevisiae YPL023C MET12 Isozyme of
FT                   methylenetetrahydrofolate reductase catalyzes the reduction
FT                   of 5 10-methylenetetrahydrofolate to 5-
FT                   methyltetrahydrofolate in the methionine biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89093"
FT                   /db_xref="GOA:Q6BM19"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM19"
FT                   /protein_id="CAG89093.2"
FT                   /translation="MPTVKDRVQALKPHERFVSFEFFPPKTDTGFRNLLARLNRMSALN
FT                   PLFITVTWGAGGSTSEKSLDLAATCQKEIGLTTVLHLTCTNTNKEIIDNALEKAKEQGI
FT                   RNILALRGDPPRTEEYWIPDCDFNNAVDLVKYIKQQYGDYFCIGVAGYPEGHVDGSDSS
FT                   NQDPRNDMPYLVEKVEAGADYIITQLFFDVDKFLNYEAMIRSYPQLKDIILIPGLMPIT
FT                   TYKVFTRATKLSHASIPLEIQSSLHSSSYDDDLVKNIGIDVINNIINKIDSNTDNRIKG
FT                   YHFYCLNLEKAVASIINDSDVLKSVMDLPDETNNNEDAIASDSDEDLPAVTISNRRRKS
FT                   SIINDNELADKSNAQKSLVGKALIGDKRTLVDISTGKGALGKDATWDDFPNGRFGDSNS
FT                   PAYGEIDGYGPTLKIYSPEEAIHKWGAPESVNEIIKVFVSYLSGKIDSLPWVDAALSPE
FT                   TALIQEELFEVNNKGWFSLASQPAVNGCLSSDKIFGWGPGNGIIYQKAFIEIFIPKDTW
FT                   TNKLLPGLQKYLDDQTITYYCGDAEGRLTSNLNIDQEHYNSKNAITWGVFPSKEVLQPT
FT                   IIDLESFKAWNEEAFILWLEWARCYKKTSKTYELLNSIYKDYYLVSLISHDFKDEYALW
FT                   NILLENK"
FT   gene            complement(<772680..>773528)
FT                   /locus_tag="DEHA2F08998g"
FT                   /old_locus_tag="DEHA0F09889g"
FT                   /old_locus_tag="DEHA-IPF8351"
FT                   /old_locus_tag="DEHA-CDS4905.1"
FT   CDS_pept        complement(772680..773528)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08998g"
FT                   /old_locus_tag="DEHA0F09889g"
FT                   /old_locus_tag="DEHA-IPF8351"
FT                   /old_locus_tag="DEHA-CDS4905.1"
FT                   /product="DEHA2F08998p"
FT                   /note="similar to CA5488|IPF810 Candida albicans IPF810
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89094"
FT                   /db_xref="GOA:Q6BM18"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR018939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM18"
FT                   /protein_id="CAG89094.2"
FT                   /translation="MNYIYLISAALGLIGGVSGIDCGVKELKEYDFESIKGIHSVTTLK
FT                   DTPPTQTNVTWYIGICDTISEKIDHCPKNSDLCGITSINLEKNSNKDAVVSEIVGFNTN
FT                   LQKQYKPFTKDGDNNEDGITIVYKGANWGDNLVDAELRFVCASSSDKDKDLDKFQLHQW
FT                   DDKRLKVSVKTKAACITDKKDKKKPDNKKDNKKGNDKDDNGESWGWFTWIFIFLVLFLS
FT                   IYIVGGAWFQYSKGNAIDFQSALREVLENFVSLLKGLPSFVREIIEKFTGNSNRGEYSA
FT                   V"
FT   gene            <773828..>774868
FT                   /locus_tag="DEHA2F09020g"
FT                   /old_locus_tag="DEHA0F09911g"
FT                   /old_locus_tag="DEHA-IPF8349"
FT                   /old_locus_tag="DEHA-CDS3724.1"
FT   CDS_pept        773828..774868
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09020g"
FT                   /old_locus_tag="DEHA0F09911g"
FT                   /old_locus_tag="DEHA-IPF8349"
FT                   /old_locus_tag="DEHA-CDS3724.1"
FT                   /product="DEHA2F09020p"
FT                   /note="highly similar to uniprot|P32419 Saccharomyces
FT                   cerevisiae YDL078C MDH3 Cytoplasmic malate dehydrogenase
FT                   catalyzes interconversion of malate and oxaloacetate"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89095"
FT                   /db_xref="GOA:Q6BM17"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM17"
FT                   /protein_id="CAG89095.2"
FT                   /translation="MVKVTVCGAAGGIGQPLSLLLKLNPQVSELSLFDVVNANGVAADL
FT                   SHICSPAKVTGYQPSSKEDRDTIQKALVNSDLVVIPAGVPRKPGMTRADLFNINASIIR
FT                   DIVGSIGKACPNAAILIISNPVNSTVPIAAEVLKKLGVFNPKKLFGVTTLDSVRAETFL
FT                   GELIKETPTSLKGQISVIGGHSGDTIVPLVHATASVAKKVSGLSKSQYNEFIHRVQFGG
FT                   DEVVKAKNGAGSATLSMAYAGYRFAEKVIGSLNGQSESSSEIPDSSYIYLAGVPNGKEL
FT                   SQKYLKNSEFFSVPVILEKGQIKAFVNPFDKLNVTSEESKLVDIALGGLQNSIDQGTTF
FT                   VTGSKL"
FT   gene            complement(<774995..>775086)
FT                   /locus_tag="DEHA2F09042r"
FT                   /old_locus_tag="Deha0F.27"
FT   tRNA            complement(join(774995..775031,775049..775086))
FT                   /locus_tag="DEHA2F09042r"
FT                   /old_locus_tag="Deha0F.27"
FT                   /note="tRNA Val (TAC) cove"
FT   gene            <775255..>776520
FT                   /locus_tag="DEHA2F09064g"
FT                   /old_locus_tag="DEHA0F09977g"
FT                   /old_locus_tag="DEHA-IPF8346"
FT                   /old_locus_tag="DEHA-CDS2985.1"
FT   CDS_pept        775255..776520
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09064g"
FT                   /old_locus_tag="DEHA0F09977g"
FT                   /old_locus_tag="DEHA-IPF8346"
FT                   /old_locus_tag="DEHA-CDS2985.1"
FT                   /product="DEHA2F09064p"
FT                   /note="weakly similar to uniprot|Q9WXD6 Brevibacterium
FT                   linens BDA1 1 4-butanediol diacrylate esterase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89096"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM16"
FT                   /protein_id="CAG89096.2"
FT                   /translation="MSFTVHQKKELATELNDLIGELTTPEEDSKSAKINGVIAGVTDDK
FT                   ETVYLNAKGVKNIETGEKMVIDNVVSFFSCTKSITCMGLLKLYEQGKVDLDAPVKNYVP
FT                   QISSIGVIDADSVDLESGTFIKPPRKPLTDVTLRHLLNHTAGFSYGFLDSQYVALSMKR
FT                   DPHINSISPTNALFTNDKMPLLHEPGKKWTYGHSTDWVGKVIEKVTGKRLGDYLKVSIF
FT                   EPIGMSSCTFHVNNTDNMVDTHIPDRNKNLKVMKKRPLNVDPEIDMGGQGCYGTVSDYL
FT                   KFIRVWLNEGMCVETNKQILKPETVNYATQNHLPPGVVVDVEDQFGVKIPSQYEADGFT
FT                   LAGCAYSMNNLPTGRPKGAIYWFGLANLYFWMDLENKIGGFWACQLLPVMNMASITGFM
FT                   RMEFNVYEALNNSREESTKSKL"
FT   gene            complement(<776652..>779237)
FT                   /locus_tag="DEHA2F09086g"
FT                   /old_locus_tag="DEHA0F09999g"
FT                   /old_locus_tag="DEHA-IPF8344"
FT                   /old_locus_tag="DEHA-CDS0672.1"
FT   CDS_pept        complement(776652..779237)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09086g"
FT                   /old_locus_tag="DEHA0F09999g"
FT                   /old_locus_tag="DEHA-IPF8344"
FT                   /old_locus_tag="DEHA-CDS0672.1"
FT                   /product="DEHA2F09086p"
FT                   /note="similar to uniprot|P00815 Saccharomyces cerevisiae
FT                   YCL030C HIS4 Multifunctional enzyme containing
FT                   phosphoribosyl-ATP pyrophosphatase phosphoribosyl-AMP
FT                   cyclohydrolase and histidinol dehydrogenase activities"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89097"
FT                   /db_xref="GOA:Q6BM15"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016298"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM15"
FT                   /protein_id="CAG89097.1"
FT                   /translation="MTFPILPIISSSNKEAIAEFSVVGQILLPLESVSISKHFLHQFPN
FT                   YIDVNVDTTSSKVDIDQIVELLNSGIKQVFIKESQIEEFILSGGLPSSRFAIKFDSSKV
FT                   SDTALETDSAFVFNCELAKDDAKKYSQSGNRGLYYENPSITQELANKLATEDIYPIIAS
FT                   ESLTTASSESGKISISSLFTAGLTTDRPDGLFTTLITTPAPSYTALGIVYSSVESIHAS
FT                   IAEKQGVYQSRKRRDELWYKGKTSGATQKLVKLEKDCDSDVVKFIVEPREGYGFCHLDK
FT                   NFTCFHDGELKQKGESFGKGLARLDNTLQDRFQSAPEGSYTKRLFNDEPLLIAKLKEEL
FT                   DELIEAGQSSSKDTNEVAWECADLFYFAMVWCIKNGVRLADVERNLDIKSGKVTRRKGD
FT                   AKPAYLKTDNEKSEQSNEEYKMETIYVNDKTTDPKDIAKALNRPVQKTADIMKLVLPII
FT                   DKVKKDGDKALLELTSKFDGVKLKSPVLSAPFPADLMDISEEMKEAIDLSMTNIEKFHA
FT                   AQLPKEKIMTVETAPGVYCSRFAKAIENVGLYVPGGTAVLPSTAMMLGVPAKVAGCSNI
FT                   IVATPPSRSTGKLTPEVVYVAHKLGAKCIVMAGGAQAVTAMAYGTESVLKCDKILGPGN
FT                   QFVTAAKMHVQNDTQALCSIDMPAGPSEVLVIADSEADADFVASDLLSQAEHGVDSQVI
FT                   LVGVGLTKEKLNEFESAVKKQAQVLPRKDIVAKCLSHSYTLLVDTYDEAFKLSNKYAPE
FT                   HLILQVENARSFVPDYIENAGSVFVGGLSPESCGDYSSGTNHTLPTYGYARQYSGVNTA
FT                   TFQKFITSQDVTEEGLKSIGKAVMTLAEVEGLEAHRNAVHVRMEKLGLL"
FT   gene            complement(<779420..>781231)
FT                   /locus_tag="DEHA2F09108g"
FT                   /old_locus_tag="DEHA0F10021g"
FT                   /old_locus_tag="DEHA-IPF8343"
FT                   /old_locus_tag="DEHA-CDS1614.1"
FT   CDS_pept        complement(779420..781231)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09108g"
FT                   /old_locus_tag="DEHA0F10021g"
FT                   /old_locus_tag="DEHA-IPF8343"
FT                   /old_locus_tag="DEHA-CDS1614.1"
FT                   /product="DEHA2F09108p"
FT                   /note="similar to uniprot|P35056 Saccharomyces cerevisiae
FT                   YDR244W PEX5 Essential for import of proteins with SKL-
FT                   like import signal into peroxisomal matrix"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89098"
FT                   /db_xref="GOA:Q6BM14"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM14"
FT                   /protein_id="CAG89098.2"
FT                   /translation="MSFVGGGADCSANSNAIAQFNKHTQQDRSLQRQAANQQGIVQNGQ
FT                   GFKKDSMMNERERQNMDQFMNNGPSQSNFQFQPMRHELNMIQQNHKQPNVQNNWTNEFQ
FT                   TNSPSPVQRNTPLAKTGSPANAQWATEFQQPMDQTFNQSNQQQFNNMPNMRMGGYRPMM
FT                   GMSMMGGGMHQQQNQMQHQEQNQDHQVDWDNQFKEIEQLTNETKDAEAEQVKGEEEPEI
FT                   VIDDKYQATFQEVWDSLNSEEVENDFINQQYEEFKNTQRDSMPADMAQWEKDFAKYAST
FT                   RAHFGDYQFEDNQHNQFLDLPKESDPYEIGLQLMENGAKLSEAALAFEAAIQRNEGHIN
FT                   AWLKLGEVQTQNEKEIAGISALEKCLELHPENSEALMTLAISYINEGYDNAAFATLERW
FT                   ISTKYPQVADQARQQNPAIDDEDRFSLNKRVTELFLNAAQLSPNSANMDPDVQMGLGVL
FT                   FYANEDFDKTIDCFKAALSIKPDDAVLWNRLGASLANSNRSEEAVDAYFKALELKPTFV
FT                   RARYNLGVSCINIGCYKEAAEHLLSGLSMHQVEGVQTDASSTLNHNQSTSLTETLKRAF
FT                   IALDRRDLLEKVKPDMDINQFRGEFSF"
FT   gene            complement(<781879..>785787)
FT                   /locus_tag="DEHA2F09130g"
FT                   /old_locus_tag="DEHA0F10043g"
FT                   /old_locus_tag="DEHA-IPF8340"
FT                   /old_locus_tag="DEHA-CDS0177.1"
FT   CDS_pept        complement(781879..785787)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09130g"
FT                   /old_locus_tag="DEHA0F10043g"
FT                   /old_locus_tag="DEHA-IPF8340"
FT                   /old_locus_tag="DEHA-CDS0177.1"
FT                   /product="DEHA2F09130p"
FT                   /note="weakly similar to uniprot|P09547 Saccharomyces
FT                   cerevisiae YPL016W SWI1 Global transcription activator that
FT                   acts in complex with Snf2p Snf5p Snf6p and Swi3p to assist
FT                   gene-specific activators"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89099"
FT                   /db_xref="GOA:Q6BM13"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM13"
FT                   /protein_id="CAG89099.2"
FT                   /translation="MSDNFWFNDDAFSGSNQNDNSNASNNDDFLNNIFDQNAEQQQAQQ
FT                   NVRPAANQSSSNNTPSAPQDISPAAILGQQQSINPQMFMRQQQQQQQQQLQEQQRSQQL
FT                   QQTRQSQQPQQFQQPQQSQQPQQSQQPQQTQQPGQNSQQALNQGRKEQLLRMRQQIMQQ
FT                   QMLHAQQKQQQFQQPQSLAGSANNNNSNLTTQAQGAMRLKNMELQETSSPKTFSRSQIP
FT                   NVSQPAPSMSNIGQPQGRPQPQMTQPQSVSNSYSNSPVNNMVSPQVQSNMPQSQQQTPR
FT                   FSNPQISQPSIPPQGQQGNKPPPAQIAQLQIELFLTTLNDFMNRRGSPISQPPVVNNKR
FT                   VNLFFLYILSHKLGGPQALIKALQQPSQQPSPWSTICQKLGLYDGVNIQQDIASKTRIE
FT                   KEVGNCYVQYLLPYEQYNSTPDGQKDIQQKRLHFQKQLLSRFQQQQQQQQQSQQQQQSQ
FT                   SHQGSPAPNIAQAPQPPHQVSPPQASNIASPVVNMHSNMMQSAQSPVISQAPTPQQQRK
FT                   LSRVSSNQNSPNVQSPYMQQSISRSGSIVQQAQMNSQHQAQMQQQQQTQMQQQQQPQQA
FT                   QMNSQQQAQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQHQQQAQMQQQ
FT                   QQAQMQQQQLQRQQQVPSARSSNVDILGQGSASEPPRITDQKSLQSVARPAATTSEHNV
FT                   KSKPQEPNVVKNYVPIRKVIESHAGYDIKSLSTVAGEIEITKPVYLFAPELGSINIHAL
FT                   IMALKNYSYSNRGEVFSALNTLLVTTSDSNYAFKISDCPELLDSLATLGLTVLDQLIED
FT                   KVNRRKEEEYTEKFSSNNNIENVFNRYVNNKDTNDMVEEDITYVVDSLTGQLVEDEDSD
FT                   MEIDEVFSPSEWNSTSCTSESNSPSVNRPDDETEFYISDYMSTLLNFRKENKYHFSKIQ
FT                   TKNAMDNQIMLVDQLITITMILRNISFSEANRTKMSKNEIFKNLIFKIVKAIATTSKSF
FT                   VFHRKRLCLLKDCLLMLDNIAFTVELTSLEEAFLAFVLVSSFGPKLEDGFDIPKVNLDV
FT                   YSYLPFGIDALTKLLVREPHNRSLMQAVLTGSLNISPSTYSSNTLNITPEDQSETKRLM
FT                   LAFLDGDEEGLKSGKLLTKSFQLFLCLIPYESSTYEFSKFIFTRSSTVSQALFGAKLII
FT                   DMIPVEDSTSPLSNISVLWILHNKELILSNLSRMSMSLIVEASKLHPTTNEYKTLSLVL
FT                   VRSFIMVNSLVNDAINTYELLSHDDKLKGAIKDLAKLSRVIPDPSSALDCLLSPAVDAG
FT                   LSKEVIRLLALLRRLSKD"
FT   gene            complement(<786006..>787106)
FT                   /locus_tag="DEHA2F09152g"
FT                   /old_locus_tag="DEHA0F10065g"
FT                   /old_locus_tag="DEHA-IPF8334"
FT                   /old_locus_tag="DEHA-CDS3507.1"
FT   CDS_pept        complement(786006..787106)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09152g"
FT                   /old_locus_tag="DEHA0F10065g"
FT                   /old_locus_tag="DEHA-IPF8334"
FT                   /old_locus_tag="DEHA-CDS3507.1"
FT                   /product="DEHA2F09152p"
FT                   /note="similar to uniprot|P50108 Saccharomyces cerevisiae
FT                   YDR245W MNN10 Subunit of a Golgi mannosyltransferase
FT                   complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
FT                   mediates elongation of the polysaccharide mannan backbone"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89100"
FT                   /db_xref="GOA:Q6BM12"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM12"
FT                   /protein_id="CAG89100.2"
FT                   /translation="MSSNQRHTSPKGSVDEDYLEKLESNIHDNNHDNYHKSFKPNKHKS
FT                   LYSRTESLFRSTLKVIQEVCVRHKKIVIVLITLICLSLFTSTPFIPHLRSKDPKVVIIL
FT                   AANEGGGVLKWKGPQEWSVERSSIANKKHYAKVHGYGLTIKDMTLKKRYSHEWRESWEK
FT                   VDIMKQVMRQYPETEWFWWLDLHTYIMEPETSLEQHFLDNLENATYRSLEAFNPLNLPV
FT                   DLPYVDYNSPIDMVITQDCGGFNLGSFMLRRSAWSEMLLDFWWDPAMYEQMHMAWEHNE
FT                   QDALETLYTTQSWIRERIGFLPLRKINAFPPGACSEFSNDPRYFYKERDFVINMAGCEW
FT                   GRDCWGEMEHYKALSKRLHKRWWKFW"
FT   gene            complement(<787337..>788428)
FT                   /locus_tag="DEHA2F09174g"
FT                   /old_locus_tag="DEHA0F10087g"
FT   CDS_pept        complement(join(787337..788286,788377..788428))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09174g"
FT                   /old_locus_tag="DEHA0F10087g"
FT                   /product="DEHA2F09174p"
FT                   /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
FT                   YDR265W PEX10 RING finger peroxisomal membrane peroxin"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89101"
FT                   /db_xref="GOA:Q6BM11"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM11"
FT                   /protein_id="CAG89101.2"
FT                   /translation="MSKVNDNALPFADASTIVRAHQKDTYFESSYRSQVQDVLHLFKGQ
FT                   RFINTHPEEITVAAKSLYLMLTTLIGARTLGEEYVDLIYVNRSGKRFPQLLSKLGFILS
FT                   YALLPYLFTRLVRKYKPKDGDESSKPKDGTKDWLVQFFSSYPKVLDTLMNLHIAIFYFK
FT                   GEFYSLSKRIFGLRYAFGHNKDPKKLRLARGDYSLLGGIILLQFFVKSLIKFKSYIDDK
FT                   NKVNQPENEENEKNVNAIFKISQLENFRDKVTTNNKLYKQINVDLSNPDHLPYLPENSR
FT                   ACMLCLSPMTNPSAASCGHLFCWECIVDWVRDHPECPLCRQQCLEQNLLPLK"
FT   gene            complement(<788595..>790907)
FT                   /locus_tag="DEHA2F09196g"
FT                   /old_locus_tag="DEHA0F10109g"
FT                   /old_locus_tag="DEHA-IPF8332"
FT                   /old_locus_tag="DEHA-CDS0916.1"
FT   CDS_pept        complement(788595..790907)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09196g"
FT                   /old_locus_tag="DEHA0F10109g"
FT                   /old_locus_tag="DEHA-IPF8332"
FT                   /old_locus_tag="DEHA-CDS0916.1"
FT                   /product="DEHA2F09196p"
FT                   /note="similar to uniprot|Q04049 Saccharomyces cerevisiae
FT                   YDR419W RAD30 DNA polymerase eta involved in the
FT                   predominantly error-free bypass replication of DNA lesions
FT                   catalyzes the efficient and accurate synthesis of DNA
FT                   opposite cyclobutane pyrimidine dimers"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89102"
FT                   /db_xref="GOA:Q6BM10"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM10"
FT                   /protein_id="CAG89102.2"
FT                   /translation="MSVKRDEFENKSLTTFPNHASTFTYKDLKLLENPIVAYQSPLAVV
FT                   AHVDLNAFFAQVEQVRLNLTADDPVVCAQWQSLIAVSYAARKFGIGRMDTIQSARQKCP
FT                   NIIIAHAAVFKKGDSYWSYIRGLPDRSVHKVSLDPYRRESRKIMNIFREYCDLVEKASV
FT                   DECFLDFGRMIYYTLLQLFPDLGDEVENINSNLPSIPSTLPDSLYWVGEIIKSEDEVPR
FT                   NSDNDQDLKANDPRIRDWDDVCMLIGSQLLYEVRQQVFEELGYTTSGGLGKNKIIAKIA
FT                   GGFLKPDNQTIIRTCSMNNFLKNFQLIDFNGMGGKTGDVIMQRLEVPPDVNSISFIRNN
FT                   FSLEDIQKEFANDPPLAQKTYQMVRGNYRQELSLRTEIKSMMSRKNFLSKNPVNNIHDA
FT                   YDWIKVFAGDLYGRLIELDDESLNLSMSQESRRGKGYIRRPKTISIQISSTSYVKHSKQ
FT                   MQLTIVRSLEKLKENMEVTGLRLLMDILDNSTNVHKLNNGISLKELDKKIDKDYSKINI
FT                   IPLANMSLVISNFVKNTDSSLIDSYTDNKSDISTQENIRRMFDEVNQETRIKREKLEDV
FT                   TPKPEASKSKSRSISKEEVEYVNKLFTDFNSEQTLASNTRNPSKSTRGPRDLKTNNSQE
FT                   DKKYIRSLFDKFESDSNVMNVPSKSQPERKEEKKYNILKDLKAKSSSHSVKSSKAVAND
FT                   QTFFDDLVSNNYCSHCNLEVKDVFEHRDFHVALELSSKINGREITPETTNKRSGSPYSE
FT                   REPKSSKVDKGQSKLPF"
FT   gene            <791049..>791120
FT                   /locus_tag="DEHA2F09218r"
FT                   /old_locus_tag="Deha0F.11"
FT   tRNA            791049..791120
FT                   /locus_tag="DEHA2F09218r"
FT                   /old_locus_tag="Deha0F.11"
FT                   /note="tRNA Cys (GCA) cove score=75.04"
FT   gene            complement(<791199..>792737)
FT                   /locus_tag="DEHA2F09240g"
FT                   /old_locus_tag="DEHA0F10153g"
FT                   /old_locus_tag="DEHA-IPF8331"
FT                   /old_locus_tag="DEHA-CDS2252.1"
FT   CDS_pept        complement(791199..792737)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09240g"
FT                   /old_locus_tag="DEHA0F10153g"
FT                   /old_locus_tag="DEHA-IPF8331"
FT                   /old_locus_tag="DEHA-CDS2252.1"
FT                   /product="DEHA2F09240p"
FT                   /note="weakly similar to uniprot|P53109 Saccharomyces
FT                   cerevisiae YGL160W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89103"
FT                   /db_xref="GOA:Q6BM09"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM09"
FT                   /protein_id="CAG89103.2"
FT                   /translation="MNELESFSPRHEGHHHAANIKYGYIVLGFSVVHIIGILICKSVFK
FT                   LRWTTSTKGIDFVKSPLFISIIAWTLILIGLGVFHVQLPENYVTSIKRFGRMSYALLPF
FT                   DIFLVLRPNSIGLRYLELMDLHKWMSRVIIAGAIIHGVGYFIKWILEGSLFTKSVRLWN
FT                   FLGIVVFMLNLILIIISLRYFRRRIYQYFYVVHNITVWLFVGLICLHARPGVGKYAIAC
FT                   ASLLGLQIFERYAKSHSISDLKVISYEGSNLIVVRIQRDSKIADWPSGSHIRLTYPLTN
FT                   YRSWIFPTHPYTIASLESDEMLDLIISKSNRFILHPQMPYSWTGPFTSFSKELLQTIDN
FT                   VDIICGGSGISFALPVFRNLKQKASHVKLIWCVRSNNDLHVLRTLNFNEEIIIHITGNL
FT                   QDSTSNTIFDEEDYGLLDYDNNENFELESLPSSETPSRTVNDDSLSQDTRPKKESKFII
FT                   VQGRPDFGNTFESLVQVNSSNKWIIACGPRSLVNSAQEWASENKVNFVSEIYEM"
FT   gene            <795459..>797096
FT                   /locus_tag="DEHA2F09262g"
FT                   /old_locus_tag="DEHA0F10175g"
FT                   /old_locus_tag="DEHA-IPF8330"
FT                   /old_locus_tag="DEHA-CDS2001.1"
FT   CDS_pept        795459..797096
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09262g"
FT                   /old_locus_tag="DEHA0F10175g"
FT                   /old_locus_tag="DEHA-IPF8330"
FT                   /old_locus_tag="DEHA-CDS2001.1"
FT                   /product="DEHA2F09262p"
FT                   /note="similar to CA1203|IPF3937 Candida albicans IPF3937
FT                   Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89104"
FT                   /db_xref="GOA:Q6BM08"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM08"
FT                   /protein_id="CAG89104.2"
FT                   /translation="MTNLDMSYSSEGTKWKAYQFSDPFAAKSFFVCNKINKFFCRPDCD
FT                   ARPITNLKSEIKFVNSVSDAINYGYVACNSCDPLSLPPIDVDLLVDCVASINKQIGFLP
FT                   PLLDEDEDRNNEKIKENIIESKKTNEEQIMQAIGGRRSSVPVINFEGKYSKDFENTSLS
FT                   KNDFDHYRLVDLACRHLALAAATNIFQPQSSKGSRSVESSPSSSSSNSKKRRRRGGVLG
FT                   FKELAAKSKLSAWHFHRVFKSVTGLTPKTYGDKCWEYIKNYLNSSEYSSNKQQETQQSQ
FT                   LCEYQTPVTNSSESASSIPTSPNDLVSNKRIKLEPTQEVKFEISSPPQNEETLLKELVL
FT                   PNQVPSDNSNTRMPTMNMIPSPMEGDDNFNKMNPMKYSVPQQATFDITVNQPITDNNFN
FT                   MFNDAQGLNQDFSSTTRAFSAPDLSHYNTRPTTLFSHLRSNERTPEESYSSNRSSQSPV
FT                   LNDGIPTIDEVVPANQYMKGPEGAQDVLNDVPELNTLLYDSGVNSLNPLNDEGNLDLNL
FT                   NNSYFDQNQNAFNLGFASDLLSTNNDNF"
FT   gene            complement(<798665..>799975)
FT                   /locus_tag="DEHA2F09284g"
FT                   /old_locus_tag="DEHA0F10197g"
FT                   /old_locus_tag="DEHA-IPF8329"
FT                   /old_locus_tag="DEHA-CDS2942.1"
FT   CDS_pept        complement(798665..799975)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09284g"
FT                   /old_locus_tag="DEHA0F10197g"
FT                   /old_locus_tag="DEHA-IPF8329"
FT                   /old_locus_tag="DEHA-CDS2942.1"
FT                   /product="DEHA2F09284p"
FT                   /note="similar to uniprot|P27466 Saccharomyces cerevisiae
FT                   YFR014C CMK1 Calmodulin-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89105"
FT                   /db_xref="GOA:Q6BM07"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM07"
FT                   /protein_id="CAG89105.2"
FT                   /translation="MAQQQSESNNLKKIFNKLSGQPSSYSRKSLYTFGKTLGAGSFGIV
FT                   RYARNNETNEEVAVKIILKKALKGKVETITDELNLLQELSHPNIVGFRDWFESKDKFYI
FT                   VTQLATGGELFDRIIEKGRFTEFDASLVIVAMLEAIKYLHNKNIVHRDLKPENILYLTP
FT                   ADNSNVVLADFGIAKRLESPDEKLTSSAGSFGYAAPEVILGTGHGKPCDIWSLGVITYT
FT                   LLCGYSPFRSENVSDFIEEVKHNNAVIFHADYWKDVSKDARRFIIKALQFDPNNRPDAE
FT                   TLLNDKWLVSIASEHKELDLLPNLKENFNAKQKFKQAIEMVKLNNKIKKLKELQGDDDD
FT                   DPNEINLFGDEGALISSDVSSKQGAGSEGGLGSWKALSSALNSIDDRSSAASVSSTSAP
FT                   KKKSDLASDAFVQLVHAATNNKERVANYKEGDNSSAN"
FT   gene            <800609..>802108
FT                   /locus_tag="DEHA2F09306g"
FT                   /old_locus_tag="DEHA0F10219g"
FT                   /old_locus_tag="DEHA-IPF8326"
FT                   /old_locus_tag="DEHA-CDS2345.1"
FT   CDS_pept        800609..802108
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09306g"
FT                   /old_locus_tag="DEHA0F10219g"
FT                   /old_locus_tag="DEHA-IPF8326"
FT                   /old_locus_tag="DEHA-CDS2345.1"
FT                   /product="DEHA2F09306p"
FT                   /note="similar to uniprot|P17649 Saccharomyces cerevisiae
FT                   YGR019W UGA1 Gamma-aminobutyrate (GABA) transaminase (4-
FT                   aminobutyrate aminotransferase) involved in the 4-
FT                   aminobutyrate and glutamate degradation pathways"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89106"
FT                   /db_xref="GOA:Q6BM06"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM06"
FT                   /protein_id="CAG89106.2"
FT                   /translation="MLRVSRLYPKSRVGRALATTKRYQSSVCGAYFPDEPSRPELITER
FT                   IPGPSGIKLNEDLGKVFDNRASNFVTDYFNSIGNYISDADGNKLLDVYCQISSIALGYN
FT                   NPALIEMAKSDSMINALVNRPALACFPSIDYGKILNEGILAAAPPGMDKVWTALSGSCA
FT                   NETAYKAAFMYQEAKRRGSIDFTSEELTSVMENKAPGASEKVILSFDKGFHGRLFGSLS
FT                   TTRSKAIHKLDIPAFPWPKAPFPQLKYPLDEFVNENHSEEERCLAILEDIITKKHPPHN
FT                   IAAIVVEPVQSEGGDVHATPFFFQGLRDLTKKHEILMIVDEVQTGIGATGKFWAHEHWN
FT                   LSEPPDMVSFSKKFQAAGFYFTDPELQPNKPFRQFNTWCGDPSKALIAKSIYQEISKNN
FT                   LVQKTAQVGDYLYKSLSSVFSKYPDRIKNLRGENMGTFIAWDCVSPEERNKLLLACRTK
FT                   GVNIGGCGEVTVRLRPTLVFENKHADVLANILEDSLKDLYK"
FT   gene            <802607..>805984
FT                   /locus_tag="DEHA2F09328g"
FT                   /old_locus_tag="DEHA0F10241g"
FT                   /old_locus_tag="DEHA-IPF8324"
FT                   /old_locus_tag="DEHA-CDS0297.1"
FT   CDS_pept        802607..805984
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09328g"
FT                   /old_locus_tag="DEHA0F10241g"
FT                   /old_locus_tag="DEHA-IPF8324"
FT                   /old_locus_tag="DEHA-CDS0297.1"
FT                   /product="DEHA2F09328p"
FT                   /note="similar to CA4694|IPF3950 Candida albicans IPF3950
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89107"
FT                   /db_xref="InterPro:IPR037545"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM05"
FT                   /protein_id="CAG89107.2"
FT                   /translation="MLGRLFKQNQSGPNVPNSNGNGNYINPNGNGNSYTNSYGANHQPK
FT                   NGPIINPNTNPYQNVNTFEDSYSREILYGTSDTLQLKPYQLNNKFFRIIISQDGGNLRS
FT                   KQVLYDSAAQNNDNPGVIARPPPMSRNNSSNNVNSKNILTSKIYHNASELNDYMFGCGL
FT                   PSNETYSTTKIHILPTLNNSTYGSNQSILITRLFSISDNNDSQIFNESFQSHWMPRPAL
FT                   PIKETSIKNDAFNIAHAKANNPDTGSTSKSSNSINSRFSIGLIIPLESVNDHLNDVIFN
FT                   NWDVISHYILVLQKLIIKKLILTLNNSVNDLSLSNLSLQNNSPNHTHIYCPYIVNKRIQ
FT                   FPSYILQNELDLNNQLIKLIKLMHYNSNVPKLINSNSLMRYSMSDSSKVNPMLLSWISE
FT                   VVNWLQFKDGRSMSNDINSQTHSSFNNNSQFQYNNTTNISSSLSVQSSPNINNLNFSPN
FT                   TDTAVTKTFLASLLALLIPLRKSLTMKPFSISNDCDNTREITRVVVMTGNPVVAKKLIF
FT                   IINGLIPDNEMLSILDDYEDEKSDISESSNDTKPMKHSIGKIPENKSCEELLDNNSFSN
FT                   DSVSTPSSIQHKLFGSTGDMNNVNTLGAAKPVPTRPIPIKSSTASSYSSSDNSPTHNTS
FT                   VKGWEIPHKSSASTTTTPLKSRVEVGTSVIPIAEKTPTRSSLSKSSSMAYLSSSLTSSL
FT                   SSSASNYSLSKLGGSFMEKWKNSFSNTQHTNPNMNPANNQTNSSLGFNTENHDLLPPSL
FT                   GNLSKRNSVHSLRTPSPAVEIDESSPYHNNSSNVGNIPHNSSSSTKMARANSVFDLYNN
FT                   NSSYKRNAIGIIQEEGKCPGMKRSNTSIYTPALRDTYKLKNINDFNRNIIKSKCSLIMK
FT                   ARISVGDSVDKTLNINSIIEKNEDESDSCYGDESTITSSTKINEIAPLIKHRPLFPNVA
FT                   FAEEFRPEFILQSCPINSKLESQVMTSMKNDLLFYQNNCQFEKVTSRSVFVSLRAREIK
FT                   VIEMNVGESVSGQVETSPNSQASSNSGTPVGSLQESQKPSLQSALTKGIRNNKSDQSEH
FT                   TSRNSMPSNSTSSYKTMIKKIFSPTRNSGDKEVIFAIENTLDEIAKLFQSNSNCQKSST
FT                   TNQDFNEKLTMLMSNILD"
FT   gene            <806287..>808482
FT                   /locus_tag="DEHA2F09350g"
FT                   /old_locus_tag="DEHA0F10263g"
FT                   /old_locus_tag="DEHA-IPF8323"
FT                   /old_locus_tag="DEHA-CDS1027.1"
FT   CDS_pept        806287..808482
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09350g"
FT                   /old_locus_tag="DEHA0F10263g"
FT                   /old_locus_tag="DEHA-IPF8323"
FT                   /old_locus_tag="DEHA-CDS1027.1"
FT                   /product="DEHA2F09350p"
FT                   /note="similar to uniprot|P46995 Saccharomyces cerevisiae
FT                   YJL168C SET2 Histone methyltransferase with a role in
FT                   transcriptional elongation methylates a lysine residue of
FT                   histone H3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89108"
FT                   /db_xref="GOA:Q6BM04"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR013257"
FT                   /db_xref="InterPro:IPR025788"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR038190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM04"
FT                   /protein_id="CAG89108.2"
FT                   /translation="MSDMEELDVKAKQYTPQLFLESEDKTDEARSTFNELQECTYSSKS
FT                   TGSSGQHEHMTCDCYEDWDSDKQQNMACGEDSDCINRVTSVECSNKFCTCGNDCQNQRF
FT                   QKKQYANVTVIQTELKGYGLRANEDISESSFIYEYIGEVIDEESFRKRMIDYDTKKLIH
FT                   FYFMMLKKDSFIDATMKGSLARFCNHSCNPNAYVDKWVVGEKLRMGIFSKRNIQKGEEI
FT                   TFDYNVDRYGAQSQPCYCGEPNCIKWMGGKTQTDAALLLPDGISEALGVTHKQERQWLK
FT                   ENKHLRSKQQSDESIINEAFVKSIEVSALTESDVSKVMGALMRVQDLNITQKLIERIYL
FT                   TSDDSINSSIIRVHGYKTLSQTIKAFKDEDKELISKILIILAKWPKVTRNKISSSQIED
FT                   VVKDINTNSNDDNLKKLSSDLLAEWGKLQMAYRIPKNIGNDKESNSPALYGRNARSRSR
FT                   SRSPDRGKSAEPQHVETDEALPDGWQTAFDPNTQTNYYYHAELGISKWERPIKEVPKGP
FT                   KGPKALPVSEPIQRPNSNSNGRSYNEEELTRREEERLKREKEEQFKEIQQKERLLQELI
FT                   LQSQKELEEKKSFEEKMKLEKLEKEKERQALKRKKLKKSKSSIPPAPPVPIDGQWTKTF
FT                   AKHVPNFLKKYEAEIGRDNIKGCAKELVKTLVAKEMKKNPDTKPPKELDNAKLKKIKEY
FT                   SKMFMDKFLIKYRSKHDKKRSHNEENGGTKRVKPDVE"
FT   gene            complement(<808686..>809855)
FT                   /locus_tag="DEHA2F09372g"
FT                   /old_locus_tag="DEHA0F10285g"
FT                   /old_locus_tag="DEHA-IPF8320"
FT                   /old_locus_tag="DEHA-CDS3273.1"
FT   CDS_pept        complement(808686..809855)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09372g"
FT                   /old_locus_tag="DEHA0F10285g"
FT                   /old_locus_tag="DEHA-IPF8320"
FT                   /old_locus_tag="DEHA-CDS3273.1"
FT                   /product="DEHA2F09372p"
FT                   /note="similar to uniprot|Q00055 Saccharomyces cerevisiae
FT                   YDL022W GPD1 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase key enzyme of glycerol synthesis essential
FT                   for growth under osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89109"
FT                   /db_xref="GOA:Q6BM03"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM03"
FT                   /protein_id="CAG89109.1"
FT                   /translation="MSQYRANQRLQQLSNILRPNQLSAEKSLKPETPFKVAVIGSGNWG
FT                   TTIAKVLAENTAEKPDTFAKQVDMWVFQEKIDGTNLTEIINNKHENVKYLPGVKLPENL
FT                   HAEPDIVKAAQGADLLVFNLPHQFLPKICKQLKGTLKPTTRAISCLKGLEVTPDGCKLL
FT                   STYITENLGIECGALSGANLAPEVARCKWSETTVAYNIPADFKGPGKDIDSAVLKEAFH
FT                   RPYFHVNVIEDVAGVSVAGALKNIVAIAVGFVEGLGWGDNAKSAIMRVGLIETINFSNM
FT                   FFPNSKPTTFTHESAGVADLITTCSGGRNVKVGRHMSKTGESAEEAEKKLLNGQSSQGI
FT                   ITAKEVHELLSNVGKTDQFPLFEATYQIIYGDESIQNLPNLLEDHSLFK"
FT   gene            complement(<810828..>811964)
FT                   /locus_tag="DEHA2F09394g"
FT                   /old_locus_tag="DEHA0F10307g"
FT                   /old_locus_tag="DEHA-IPF8317"
FT                   /old_locus_tag="DEHA-CDS3373.1"
FT   CDS_pept        complement(810828..811964)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09394g"
FT                   /old_locus_tag="DEHA0F10307g"
FT                   /old_locus_tag="DEHA-IPF8317"
FT                   /old_locus_tag="DEHA-CDS3373.1"
FT                   /product="DEHA2F09394p"
FT                   /note="weakly similar to CA2262|IPF6857 Candida albicans
FT                   IPF6857 putative transcriptional regulator (unknown
FT                   function)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89110"
FT                   /db_xref="GOA:Q6BM02"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM02"
FT                   /protein_id="CAG89110.2"
FT                   /translation="MDQYRYRRSKSTQSLQNASGRTTSTLPDPVNGNSQSEGYNSDMSY
FT                   SMYAQQPSAHIVGASPPTKKLKNSNLESQLYMPGSRSSSGAVEQNLSYTRSYSVSNDRQ
FT                   LGSKNDNPISMSRSHSHNESDEDERFLRLAREALVATATAAKNHSDSLLVDPTIQNLLT
FT                   RLQYVSSPHGNPIRRSDKIRANENGQLMIQDFYQDFPNLSNDIFSENRFGGNNSLDHDQ
FT                   QRPENQSTRSEDWNFLIGEPQHLESKESRSTHDQGHTMSHPMNENTTTVLSDNSQSDKS
FT                   GKEDEDRKFLCSKCTMSFRRSSDLKRHEKQHLSIPPNICELCGKGFARKDALKRHSGTL
FT                   TCKRNADRKLYIENLDYLHRPNNSSMPIQPNYNSGSDW"
FT   gene            <812758..>813798
FT                   /locus_tag="DEHA2F09416g"
FT                   /old_locus_tag="DEHA0F10329g"
FT                   /old_locus_tag="DEHA-IPF8316"
FT                   /old_locus_tag="DEHA-CDS3723.1"
FT   CDS_pept        812758..813798
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09416g"
FT                   /old_locus_tag="DEHA0F10329g"
FT                   /old_locus_tag="DEHA-IPF8316"
FT                   /old_locus_tag="DEHA-CDS3723.1"
FT                   /product="DEHA2F09416p"
FT                   /note="similar to uniprot|P50947 Saccharomyces cerevisiae
FT                   YNL097C PHO23 Probable component of the Rpd3 histone
FT                   deacetylase complex involved in transcriptional regulation
FT                   of PHO5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89111"
FT                   /db_xref="GOA:Q6BM01"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM01"
FT                   /protein_id="CAG89111.2"
FT                   /translation="MRSQQQQFQQYKQKAKNISNANELLPGLNDISDAFEALPLDLIKY
FT                   FTLLKEIDAKYINTVPVINRNIKSYIDRLHITKNSPPGMKEMNKPTKIDKLTVIRDKIH
FT                   EIIPCLEEKMHVTSVATDLLHKHLYRINADYKLIVNNNEIPESIRIGPLNHPAMIMDSA
FT                   GPVDANGNLSAQSQRSESRREALAAKKAHKDHYDDDEPKKRKAMGNKEVSPSSDVPSAS
FT                   KSASNSKKRSRKDPEEMSSRSDTPSMSTVLNGPNKKRNTTKPKKDDKDVSNDVVHPGPS
FT                   HTSANSSEPTYCYCNQVSFGEMVGCDGDDCKREWFHLPCIGFKNPPKGKWYCDDCLMKM
FT                   KKLRKV"
FT   gene            <814492..>815259
FT                   /locus_tag="DEHA2F09438g"
FT                   /old_locus_tag="DEHA0F10351g"
FT                   /old_locus_tag="DEHA-IPF8312"
FT                   /old_locus_tag="DEHA-CDS4747.1"
FT   CDS_pept        814492..815259
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09438g"
FT                   /old_locus_tag="DEHA0F10351g"
FT                   /old_locus_tag="DEHA-IPF8312"
FT                   /old_locus_tag="DEHA-CDS4747.1"
FT                   /product="DEHA2F09438p"
FT                   /note="similar to uniprot|P01119 Saccharomyces cerevisiae
FT                   YOR101W RAS1 GTPase involved in G-protein signaling in the
FT                   adenylate cyclase activating pathway plays a role in cell
FT                   proliferation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89112"
FT                   /db_xref="GOA:Q6BM00"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM00"
FT                   /protein_id="CAG89112.2"
FT                   /translation="MLKEYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIENSYRKQC
FT                   TLDGESVLLDILDTAGQEEYSAMREQYMRTGEGFLLVYSINSRTSLEELQSFYEQIQRV
FT                   KDSDFVPVLVVGNKCDLEIERQVSYEEGLSLAKSFNCPFLETSAKQRINVEEAFYGLVR
FT                   SIRDGENGAKKLETGNNDAAGVAGGSAGAGNTANQTDVAAQDNAAAAGASNKQKQASNN
FT                   VSSVANSGKRQQQQSSAAGGKEEKEKSGCCVIV"
FT   gene            complement(<815455..>815964)
FT                   /locus_tag="DEHA2F09460g"
FT                   /old_locus_tag="DEHA0F10373g"
FT                   /old_locus_tag="DEHA-IPF8311"
FT                   /old_locus_tag="DEHA-CDS5760.1"
FT   CDS_pept        complement(815455..815964)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09460g"
FT                   /old_locus_tag="DEHA0F10373g"
FT                   /old_locus_tag="DEHA-IPF8311"
FT                   /old_locus_tag="DEHA-CDS5760.1"
FT                   /product="DEHA2F09460p"
FT                   /note="weakly similar to uniprot|P46964 Saccharomyces
FT                   cerevisiae YOR103C OST2 Epsilon subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89113"
FT                   /db_xref="GOA:Q6BLZ9"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ9"
FT                   /protein_id="CAG89113.1"
FT                   /translation="MAKKDSIKKSVTHTTSNKIGHPINELISAVTTTYKDYINSLTPRL
FT                   KLIDIFLTFLVLLGILQFAYVLLVGNFPFNAFLGGFISCVGQFVLTVSLRLQYNYENNS
FT                   NNTRENIDQEIKEKNIEDVNETKVDIETAEASDMKPFKFVTPERAFGDFIFASLILHFV
FT                   VFHFIN"
FT   gene            <816165..>816755
FT                   /locus_tag="DEHA2F09482g"
FT                   /old_locus_tag="DEHA0F10395g"
FT                   /old_locus_tag="DEHA-IPF8310"
FT                   /old_locus_tag="DEHA-CDS5404.1"
FT   CDS_pept        816165..816755
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09482g"
FT                   /old_locus_tag="DEHA0F10395g"
FT                   /old_locus_tag="DEHA-IPF8310"
FT                   /old_locus_tag="DEHA-CDS5404.1"
FT                   /product="DEHA2F09482p"
FT                   /note="similar to uniprot|P50946 Saccharomyces cerevisiae
FT                   YNL099C OCA1 Putative protein tyrosine phosphatase required
FT                   for cell cycle arrest in response to oxidative damage of
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89114"
FT                   /db_xref="GOA:Q6BLZ8"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLZ8"
FT                   /protein_id="CAG89114.1"
FT                   /translation="MSESQSEIEHNNNNSKLTKISQPPTVRIIPPLNFCPVEKQLYRSG
FT                   QPSIINQSFLQDLNLKTILWLASEEPQEDFLDYCSMNNIAVEFVGLMNEYSYQNVNPWD
FT                   ALSEDTIKKALELICNKENYPLLVCCGMGRHRTGTVIGCLRRLQGWNLASVSEEYRRFT
FT                   GSRGGRIMVELLIESFDINSVQIDPTKMPGWLT"
FT   gene            <817433..>818167
FT                   /locus_tag="DEHA2F09504g"
FT                   /old_locus_tag="DEHA0F10417g"
FT                   /old_locus_tag="DEHA-IPF8309"
FT                   /old_locus_tag="DEHA-CDS4880.1"
FT   CDS_pept        817433..818167
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09504g"
FT                   /old_locus_tag="DEHA0F10417g"
FT                   /old_locus_tag="DEHA-IPF8309"
FT                   /old_locus_tag="DEHA-CDS4880.1"
FT                   /product="DEHA2F09504p"
FT                   /note="weakly similar to uniprot|P32564 Saccharomyces
FT                   cerevisiae YGR049W SCM4 Suppressor of CDC4 mutation 4"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89115"
FT                   /db_xref="GOA:Q6BLZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ7"
FT                   /protein_id="CAG89115.2"
FT                   /translation="MAGTCIATVKIVGVSSLGLLTSSLTYQTIQGIPALINELNTKVNG
FT                   LSKSNALASIRNLINFSRIGYISLSGLATAMLTMAFIYSPPSEKHPYLIYSAVGAPLAL
FT                   ISMYYRGFGLETKLLRKADHLHTHNANETTKNTENVNDSENVKSDEDSQLGKSYIHVSD
FT                   EESSSTTSTPTSTIPNSPQTKTVDSLQEELSLEEEVDIALTKKEIVNDLNKVKSNYVVG
FT                   SSIVGLSFFIATIGLIGDYYIL"
FT   gene            <818927..>819409
FT                   /locus_tag="DEHA2F09526g"
FT                   /old_locus_tag="DEHA0F10439g"
FT                   /old_locus_tag="DEHA-IPF8308"
FT                   /old_locus_tag="DEHA-CDS5888.1"
FT   CDS_pept        818927..819409
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09526g"
FT                   /old_locus_tag="DEHA0F10439g"
FT                   /old_locus_tag="DEHA-IPF8308"
FT                   /old_locus_tag="DEHA-CDS5888.1"
FT                   /product="DEHA2F09526p"
FT                   /note="similar to uniprot|P40581 Saccharomyces cerevisiae
FT                   YIR037W HYR1 Thiol peroxidase that functions as a
FT                   hydroperoxide receptor to sense intracellular hydroperoxide
FT                   levels and transduce a redox signal to the Yap1p
FT                   transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89116"
FT                   /db_xref="GOA:Q6BLZ6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ6"
FT                   /protein_id="CAG89116.2"
FT                   /translation="MSFYDLSPLDTNDKPFPFEELKGKVVLVVNVASKCGFTPQYKELE
FT                   ELNKKYQDKGLQIIGFPCNQFGGQEPGSSEEIASFCSLNYGVSFPVLKKVDVNGDKTDP
FT                   VYKYLKGEKSGLLGLNRIKWNFEKFLIDKNGKVIERYSSLTKPASLSSTIEELLKK"
FT   gene            <820967..>822394
FT                   /locus_tag="DEHA2F09548g"
FT                   /old_locus_tag="DEHA0F10461g"
FT                   /old_locus_tag="DEHA-IPF8306"
FT                   /old_locus_tag="DEHA-CDS2518.1"
FT   CDS_pept        820967..822394
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09548g"
FT                   /old_locus_tag="DEHA0F10461g"
FT                   /old_locus_tag="DEHA-IPF8306"
FT                   /old_locus_tag="DEHA-CDS2518.1"
FT                   /product="DEHA2F09548p"
FT                   /note="some similarities with uniprot|P38691 Saccharomyces
FT                   cerevisiae YHR082C KSP1 Nonessential putative
FT                   serine/threonine protein kinase of unknown cellular role"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89117"
FT                   /db_xref="GOA:Q6BLZ5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ5"
FT                   /protein_id="CAG89117.2"
FT                   /translation="MTMTNTATISANSTASVRGNEAFNEYGAYEKKQYLLKDKYKFITP
FT                   IQEGAFGKVTLAVNVQTKEKVAMKAMYKSHENTRRIANHEIDVLSKIGRNNDNICQLLD
FT                   HFETSEFIILILEYCSNGDLYDLIHSSINISAVDIWNIAKELANALKYAHSLGIYHRDI
FT                   KPENVLFNCFGRVKLCDWGLATTKRMNREFSVGTEKYMAPEVFIEKPELTEYDCKYVDY
FT                   WSFGITLITAIFGTCPFKPVGESSNIHSDYNFKKFVYYGNSQILYDIYPTMNETCFNIF
FT                   MNLLRIGGNEDNLLEFNDKINSRNLDNFIQDLQDNWKFGLTIDEEYELEQFDDDAESDN
FT                   SNDLFNMDHDDLSSESQDEQLSFDTSVESESDSDEYLTNYDTSMKIRMNQESDHHNVIP
FT                   SLIESSIQSSSSKSWCDLDDDEEFNQIFNAMSLNRTKKPQLDIVKDDFTKSNLGNDDID
FT                   ILKVEWNLYNNNHQAYN"
FT   gene            <823183..>824382
FT                   /locus_tag="DEHA2F09570g"
FT                   /old_locus_tag="DEHA0F10483g"
FT                   /old_locus_tag="DEHA-IPF8304"
FT                   /old_locus_tag="DEHA-CDS3195.1"
FT   CDS_pept        823183..824382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09570g"
FT                   /old_locus_tag="DEHA0F10483g"
FT                   /old_locus_tag="DEHA-IPF8304"
FT                   /old_locus_tag="DEHA-CDS3195.1"
FT                   /product="DEHA2F09570p"
FT                   /note="similar to uniprot|P06168 Saccharomyces cerevisiae
FT                   YLR355C ILV5 Acetohydroxyacid reductoisomerase
FT                   mitochondrial protein involved in branched-chain amino acid
FT                   biosynthesis also required for maintenance of wild- type
FT                   mitochondrial DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89118"
FT                   /db_xref="GOA:Q6BLZ4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ4"
FT                   /protein_id="CAG89118.1"
FT                   /translation="MSIRNASIRMARMASNNAAKQVASKRALSALANAARPVVARKSIA
FT                   PAAARGVKTINFGGMDEIVHERADWPREKLLEYFKNDTLALIGYGSQGYGQGLNLRDNG
FT                   LNVIIGVRKDGASWKAAIEDGWVPGENLFDVNEAIGKGTYIMNLLSDAAQSETWESIKP
FT                   QLTEGKTLYFSHGFSPVFKELTHVEPPTNIDVILAAPKGSGRTVRTLFKEGRGINSSYA
FT                   VWNDVTGKAEEKAIALAVAIGSGYVYQTTFEREVNSDLYGERGCLMGGIHGMFLAQYEV
FT                   LRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPRFKDALK
FT                   PVFNDLYESVKNGTETQRSLDFNSQSDYRARLEEELETIRSMEIWRVGKEVRKLRPENQ
FT                   "
FT   gene            <825133..>827319
FT                   /locus_tag="DEHA2F09592g"
FT                   /old_locus_tag="DEHA0F10505g"
FT                   /old_locus_tag="DEHA-IPF8303"
FT                   /old_locus_tag="DEHA-CDS1037.1"
FT   CDS_pept        825133..827319
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09592g"
FT                   /old_locus_tag="DEHA0F10505g"
FT                   /old_locus_tag="DEHA-IPF8303"
FT                   /old_locus_tag="DEHA-CDS1037.1"
FT                   /product="DEHA2F09592p"
FT                   /note="weakly similar to uniprot|P35995 Saccharomyces
FT                   cerevisiae YKL222C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89119"
FT                   /db_xref="GOA:Q6BLZ3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ3"
FT                   /protein_id="CAG89119.2"
FT                   /translation="MELFTKDDFNQIGGIQKKRRRPIKSCSRCRERKSKCDMKKPICTS
FT                   CLVKGLESCKYEESSSYSVKIDSNEVDLLKKENERLLSTIKQLRGQINTVYPSPIPDSS
FT                   NEIEADKYRIVFSKPNRTMFCGPTSFRIVFQNQLVWNYYMSIKNSLKSQRNDWKLKNRP
FT                   KPVIFDNLYSTSNGLLADLQRFLPQYSVLLEYLLQFFDGFWYKYLPIVDRDDILQIFKV
FT                   QFKQSDNDSNIEILSPQNSVEFANIAVIITILKYSVNSEACSPGMVSNKFKDEHDILLK
FT                   FATKLLAKADYLEKASLPSLQAVFMLRIFKKFNFKDGDGGDGSNGNILFAICLEMGFTL
FT                   GLNQNVDTLYNRESAKYRTVLKNLWKYLLYFDTINSFDLGVPLHISDNNVRKDLLDLDD
FT                   IFIKTILKKREIMDVFLSPKMSHDGIGNVINEIRNFINQNFKTVFELIKDFENSSNLED
FT                   SYKIIHQFVLSISLIGMIQHGCLLLYNELRDSSSKLGTRSHNLAMKYTILMIISTVELT
FT                   KRIYLSSMELLSIPSTNQIHFFIAGMQNQWFSRAFLFYFFSLLTYVKSSKNQGTRNITD
FT                   SHIVLRLSELADLYNDVDNIHDDGFTETKTLVSLNIIVSRYMNMRIFLETNGGEREQKK
FT                   LVTKIHNYGLFIMNASLCHFKQLIAQDNDFKSIVRFNEDNLDIVYDSIQDSFPSQLYVT
FT                   QNFSSVPNLDIFDEIELNGTVENFNKDIYDFLSI"
FT   gene            <828016..>828786
FT                   /locus_tag="DEHA2F09614g"
FT                   /old_locus_tag="DEHA0F10527g"
FT                   /old_locus_tag="DEHA-IPF8302"
FT                   /old_locus_tag="DEHA-CDS4730.1"
FT   CDS_pept        828016..828786
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09614g"
FT                   /old_locus_tag="DEHA0F10527g"
FT                   /old_locus_tag="DEHA-IPF8302"
FT                   /old_locus_tag="DEHA-CDS4730.1"
FT                   /product="DEHA2F09614p"
FT                   /note="highly similar to uniprot|P23248 Saccharomyces
FT                   cerevisiae YML063W RPS1B Ribosomal protein 10 (rp10) of the
FT                   small (40S) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89120"
FT                   /db_xref="GOA:Q6BLZ2"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLZ2"
FT                   /protein_id="CAG89120.1"
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTKKEWFDIKAPSTFENRAVGK
FT                   TLINRSTGLKNAADGLKGRVVEVCLADLQGSEDHSSRKVKLRVDEVQGKNLLTNFHGID
FT                   FTTDKLRSLVRKWQSLVEANVTVKTSDDYVLRIFAIAFTKRQANQIRKTTYAQSSKLRE
FT                   VRKKMIEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTILPLQNIHIRKVKLLKQPK
FT                   FDLGSLLALHGEGSTEEKGKKVSAGFKDVVLEAV"
FT   gene            <829139..>831817
FT                   /locus_tag="DEHA2F09636g"
FT                   /old_locus_tag="DEHA0F10549g"
FT                   /old_locus_tag="DEHA-IPF8300"
FT                   /old_locus_tag="DEHA-CDS0622.1"
FT   CDS_pept        829139..831817
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09636g"
FT                   /old_locus_tag="DEHA0F10549g"
FT                   /old_locus_tag="DEHA-IPF8300"
FT                   /old_locus_tag="DEHA-CDS0622.1"
FT                   /product="DEHA2F09636p"
FT                   /note="similar to CA1984|IPF9592 Candida albicans IPF9592
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89121"
FT                   /db_xref="GOA:Q6BLZ1"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ1"
FT                   /protein_id="CAG89121.2"
FT                   /translation="MSDNSFDDNDDAWSYSFPPSTESLTLSKKNDDNSKLDKELKSATQ
FT                   RGDKDKDVFIDSDDSRNHTIAQNRSNINALSNKSASKKGRLSRTSSTSSVGRSEEPKED
FT                   KKDHVQTNGNGSHASSLTSLSLQSPYFVKSTPANPHTTKEDANSIISREGAQASGFSLD
FT                   SNFNSQSTPITSSARSNLSNNVAHDMGELPSSYGSRDENSDIDKSKSAKFDNEGSLDSS
FT                   SPKIIAYRKSKRTISEGNFQNILDQSVKATPKEKYDPKLYVEEKFSDTDYRFATTRRTA
FT                   EFHQLFRSLDLTDRLLDDFSCALSREILLQGRIYISENNVCFSSNLLGWVTSLIIPQEE
FT                   IIRIEKKTTAGLFPNGISIETASGKHNFASFISRDATFDFMKAVWQGTTGRKMEIIEEK
FT                   PMEKPGYSLDSDGIVSVENECLDSPAKLESYILSIDGDEERHGDNEYASDHSDSEDTSD
FT                   DAVSLKKTNSNKSNKRKKIDTVDLKVLKFKPDSKYINMGPEFHPPTKVKDYAKENNETE
FT                   LCNEVINAPLGIVFDLLFGSSNTTFHRSFLESHNASEISDYDKFHPKKDDPSKLERKIS
FT                   YRRALGYSIGPKSTRCEVKETIENLNFAENVVLISSTVTPDVPSGNSFSVKTRYCLSWG
FT                   ANNSTILKMSYNIKWTGSSWIKSVIEKQTLAGQQEATKDLIEALKKGIDENTYYAEGPS
FT                   VPKNVAEFVAENKPTSEMAEEAITLNREESEKKITLSLSSRFIKNNIVPIVYFFFSFLV
FT                   ILSILQMKIISGVNEANEIARSQLVVNSYLVFTVQALANDKSISKAGYRERIKAMENDN
FT                   SPLWKWVNDKYDTKLNNLEKIEYLTYQLNSLYQKQIDPENNEFVAAIEENLLDLKRSVK
FT                   DFNYQELLNADNLRNMLGDLI"
FT   gene            complement(<831973..>832965)
FT                   /locus_tag="DEHA2F09658g"
FT                   /old_locus_tag="DEHA0F10571g"
FT                   /old_locus_tag="DEHA-IPF8299"
FT                   /old_locus_tag="DEHA-CDS4538.1"
FT   CDS_pept        complement(831973..832965)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09658g"
FT                   /old_locus_tag="DEHA0F10571g"
FT                   /old_locus_tag="DEHA-IPF8299"
FT                   /old_locus_tag="DEHA-CDS4538.1"
FT                   /product="DEHA2F09658p"
FT                   /note="weakly similar to uniprot|P53234 Saccharomyces
FT                   cerevisiae YGR053C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89122"
FT                   /db_xref="InterPro:IPR031342"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ0"
FT                   /protein_id="CAG89122.1"
FT                   /translation="MIYRRGSKVLLRHSRLKYSSCKKQYVSSLRNIKLESPVPSLIAPP
FT                   LFYNRTILSPNNVKNLDNFKFSDSVPTRSDLSSEDLKPNPKDQLRKANLGTMTDELRAL
FT                   IPNILNKSLPKKIVSNNVHLRICPTHFQEFNAYFPTLKGHVSYYTTCKTLQFILTSIVL
FT                   NPKVKLHIQSIKTNAAKGDLGPEIQSVYSGSTKIYIRWNTCLEGCDHLSPNEIMEGQHS
FT                   GNISNYHSTSDAKLGSHKWSKLDTKKLVNNSNGQPIKSSPSVTTTLSHLTSGLIGLTKE
FT                   HNKLERVISGIFIFELNENNDKIIVHTVEDVNVIEKTETQDIDGELRVC"
FT   gene            complement(<833251..>833931)
FT                   /locus_tag="DEHA2F09680g"
FT                   /old_locus_tag="DEHA0F10593g"
FT                   /old_locus_tag="DEHA-IPF8298"
FT                   /old_locus_tag="DEHA-CDS5092.1"
FT   CDS_pept        complement(833251..833931)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09680g"
FT                   /old_locus_tag="DEHA0F10593g"
FT                   /old_locus_tag="DEHA-IPF8298"
FT                   /old_locus_tag="DEHA-CDS5092.1"
FT                   /product="DEHA2F09680p"
FT                   /note="similar to uniprot|P34227 Saccharomyces cerevisiae
FT                   YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with
FT                   thioredoxin peroxidase activity has a role in reduction of
FT                   hydroperoxides"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89123"
FT                   /db_xref="GOA:Q6BLY9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY9"
FT                   /protein_id="CAG89123.1"
FT                   /translation="MASQEHTTLRLGSTAPNFEAETSNGKISFHDFIGDSWAVLFSHPD
FT                   DFTPVCTTELGAFAKLEPEFTKRNVKLIGLSANGTESHKAWIKDIDEVTGSKLTFPIIA
FT                   DSERKVAHLYDMIDYQDATNVDDKGLQFTIRSVFVIDPAKKIRLILAYPASTGRNTAEV
FT                   LRVVDSLQTGDKYKVTTPINWVPGDDVIVHPTISNEDAKTLFPKFRIIKPYLRLTPLDV
FT                   KEEK"
FT   gene            complement(<834319..>835467)
FT                   /locus_tag="DEHA2F09702g"
FT   CDS_pept        complement(834319..835467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09702g"
FT                   /product="DEHA2F09702p"
FT                   /note="similar to uniprot|Q12006 Saccharomyces cerevisiae
FT                   YOL003C DHHC-CRD protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66308"
FT                   /db_xref="GOA:Q6BLY8"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLY8"
FT                   /protein_id="CAR66308.1"
FT                   /translation="MVAYGSHYFVFRTNLSRTEQILYEVYVCIVWLSYYLAIVVDPGSP
FT                   PKNFTPKAGEWRRWCKKCQNYKPERSHHCKTCNKCVLKMDHHCPWTYNCVGHNNLPHFL
FT                   RFVFFLIVGMTYVLFQLGKQVLHYYDSSKLPSYLIDKKEMCAVIFLLPVTFFVFVSIII
FT                   LFVRCMINLLFRGMTQIEVWEMERIGSQFHTERLWLQIRKNYFKLHGKEMPHLVSWNRT
FT                   TRYYEVDENSNNDNSNENNIVPKDFTSDDIVFPYDLGVSSNMINACDYPWMWLLPWGGP
FT                   RENGYHFQKNEFMEDDQLGLPWPPDGGHQEPMAPVDDDFDISDSELQDMPSLRRRLDPR
FT                   NNMTRSEWMNDLGETLDDFGVDLDAEDIEHDDLVSKDEISNN"
FT   gene            <835802..>836726
FT                   /locus_tag="DEHA2F09724g"
FT                   /old_locus_tag="DEHA0F10637g"
FT                   /old_locus_tag="DEHA-IPF8294"
FT                   /old_locus_tag="DEHA-CDS5010.1"
FT   CDS_pept        join(835802..835804,835868..835916,835999..836726)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09724g"
FT                   /old_locus_tag="DEHA0F10637g"
FT                   /old_locus_tag="DEHA-IPF8294"
FT                   /old_locus_tag="DEHA-CDS5010.1"
FT                   /product="DEHA2F09724p"
FT                   /note="highly similar to uniprot|P21242 Saccharomyces
FT                   cerevisiae YOR362C PRE10 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89125"
FT                   /db_xref="GOA:Q6BLY7"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY7"
FT                   /protein_id="CAG89125.2"
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAMKAVENGGTSIGIKCKDG
FT                   IVLAVEKIINSKLLVPGKNKRIQTIDRHIGVAYSGLLPDGRHFVNRGRDEAQNFKNIYK
FT                   TPISVPHLMDRLGIYIQNYTCYNSVRPFGIVSIVGGVDENGPHLYMIEPSGTCWGYTGA
FT                   ATGKGRQTAKSELEKLNFEELTVKEAVKVAAKIIHQAHEDNKDKDYELEISWCSKEETS
FT                   CRHESVPDALLQEAIKLAQEEDEEEEDDDEEDAEMES"
FT   gene            <836997..>839627
FT                   /locus_tag="DEHA2F09746g"
FT                   /old_locus_tag="DEHA0F10659g"
FT                   /old_locus_tag="DEHA-IPF8293"
FT                   /old_locus_tag="DEHA-CDS0647.1"
FT   CDS_pept        836997..839627
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09746g"
FT                   /old_locus_tag="DEHA0F10659g"
FT                   /old_locus_tag="DEHA-IPF8293"
FT                   /old_locus_tag="DEHA-CDS0647.1"
FT                   /product="DEHA2F09746p"
FT                   /note="similar to CA4891|IPF1627 Candida albicans IPF1627
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89126"
FT                   /db_xref="InterPro:IPR024545"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY6"
FT                   /protein_id="CAG89126.2"
FT                   /translation="MSSEFEGSNSSYVSDGSDSSVVVALSQNINNDSNSGFEHDDRNDI
FT                   DADSTRSSSPFLSNPELSYKEKFSPVASSFDDEEDISRRVQDMDTSIASLRETLGDLNV
FT                   GDKDKNNQSIIVDESFHNSTMDTTRYNETQAQFDRDLDFDQNSNDGKTESPRHKKAISP
FT                   WKQLRSTSTAAPGHMGEIPKLHFNQSNFFNNDTKQSLTHDTTAVAKINELNKQVTGYRI
FT                   QIKLFKQFLQHLIDKTRYSNTDNVFDISELNHFQNNLNGLSPSRSTGIRSGSINTNAEI
FT                   EDNLSQNYDELLKLNEDLYLNLEDFQNQLHDKEVQLNNANVYMNDCSRIINEILELLIN
FT                   DPSTDDPSRQALVKCLDGAASDAKLSKSLETKLYVVRLELRKKMERKDHSYPSPPPSNP
FT                   EKEQIELSGYITIIQGLIASLDKVQKEFLAHKQDTSKIQEDLKKEVESTQTIRANYESL
FT                   YNKFNQLCASLERSRSDDADSEMQKLRIENQKLRTINNTVDNKFNEYQKVIDKLQSEVN
FT                   DLQKHYSNSSIGETSEWLKSSNDGFHHNDLLLSHKEVNQLQEQLNNLTERYRKLQDDSS
FT                   NTISTLTNQLNNKKQESLSLGANQRITDQLKNDLELAVEKQRVLKAEKIRLSYSLESLA
FT                   KDKVSLQTTIRSLTEKITSLTVEAPHYKKDEMNEGLKKLNVLEYQLSELLSRDVHEFQK
FT                   FLKSFIKIADDSSLKEPKRKIDTLAKKISQERNSDRTDEMTSWDISELNTIREYHKSVF
FT                   DYFARAVDIIVNDHVKLLLKEGENTSQTNEYVNKLHKRIDELNNVNDNLTRQLDSYYTD
FT                   DSHNDTTQNTSITSTGSKMRITELTNRWKAEREARVYENQEAKKRLKELDRENARLRQE
FT                   LDQVS"
FT   gene            <839775..>841934
FT                   /locus_tag="DEHA2F09768g"
FT                   /old_locus_tag="DEHA0F10681g"
FT                   /old_locus_tag="DEHA-IPF8292"
FT                   /old_locus_tag="DEHA-CDS1078.1"
FT   CDS_pept        839775..841934
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09768g"
FT                   /old_locus_tag="DEHA0F10681g"
FT                   /old_locus_tag="DEHA-IPF8292"
FT                   /old_locus_tag="DEHA-CDS1078.1"
FT                   /product="DEHA2F09768p"
FT                   /note="weakly similar to uniprot|P06103 Saccharomyces
FT                   cerevisiae YOR361C PRT1 Subunit of the core complex of
FT                   translation initiation factor 3(eIF3) essential for
FT                   translation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89127"
FT                   /db_xref="GOA:Q6BLY5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLY5"
FT                   /protein_id="CAG89127.2"
FT                   /translation="MNDNMSEQEYRSLEKEVQLDDLDFSDLEAKYAVNSDFGMDNYVVV
FT                   DGAPIAPEAKVPILIKVLKKLFNTVGEVVEGDEGIHMPLQDGKSKGYLFVQFKTPQMAE
FT                   AAIQQLHGKKLDQKHRLLVNKLSDIEKFGAEGNVEIDFHEPEIPPFKSHGYLRSWLQDE
FT                   QGRDQMALHFSETVGVYYNKKKNDPEPVIEPRKGFTSKYAKFSPLGTYLFSVHPQGVQS
FT                   WGGDGFQSITKFIHNQVRLIDFSPNEKYMVTLSPLPIALPDDPAERSIFPFGPESNGHK
FT                   LVIWDMATGEPARTFALPPHLEGQKDMPWPLVKWSHDDKYCARQGPGALAIYETPSFQL
FT                   LDKKLVKVDDVVDFEWAPAAVHLSDSKVKEGEYILSYWTPESSNQTARVALMQIPSRKV
FT                   IRTINLFQVSDCKMHWHGEGKFLCVKVDRHTKSRKTFFSNLEFFKVTEKDIPVEKLELK
FT                   DVVFNFAWEPRSERFITISRLDDGNQNPSIAKNTISFYAPQVSSKGRVTSSKYTCFKEI
FT                   HDKHSNTVCWSPKGRFVVVATISKSSGELEFYDCSYEEDKPANSKVNGNVKLLKAEKYS
FT                   GMTNLAWDPSGRFVAAWSSSWAHSIENGYRLFEFTGNMLKDNSIDHFKEFIWRPRPASL
FT                   LNAADRKKVRKNLREYSAQFDEADAMEADAASREAILLRRKLLEQWRSYRAKHAANGSK
FT                   KNEVQAEIIEEIKEEIIEEKEEVVE"
FT   gene            complement(<842075..>842425)
FT                   /locus_tag="DEHA2F09790g"
FT                   /old_locus_tag="DEHA0F10703g"
FT                   /old_locus_tag="DEHA-IPF8291"
FT                   /old_locus_tag="DEHA-CDS6850.1"
FT   CDS_pept        complement(842075..842425)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09790g"
FT                   /old_locus_tag="DEHA0F10703g"
FT                   /old_locus_tag="DEHA-IPF8291"
FT                   /old_locus_tag="DEHA-CDS6850.1"
FT                   /product="DEHA2F09790p"
FT                   /note="similar to YALI0F16071g Yarrowia lipolytica"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89128"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY4"
FT                   /protein_id="CAG89128.1"
FT                   /translation="MLRNVISKQAYLAKPYAGIRLPITKAQTGLRLMSTVEEQLMDDYE
FT                   KKIFGILKDNFQPKTLQVKDVSGGCGSMFAILVESEKFKGIPMIKQHRLVNEVLKDEIS
FT                   KWHGIQLKTKSA"
FT   gene            <842590..>844650
FT                   /locus_tag="DEHA2F09812g"
FT                   /old_locus_tag="IPF_8287"
FT   CDS_pept        842590..844650
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09812g"
FT                   /old_locus_tag="IPF_8287"
FT                   /product="DEHA2F09812p"
FT                   /note="similar to uniprot|P39722 Saccharomyces cerevisiae
FT                   YAL048C GEM1 Evolutionarily-conserved tail-anchored outer
FT                   mitochondrial membrane GTPase which regulates mitochondrial
FT                   morphology"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66309"
FT                   /db_xref="GOA:B5RUD1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD1"
FT                   /protein_id="CAR66309.1"
FT                   /translation="MSQDTIRIVVCGDEFVGKSSLIASLIKEKFVSNIQRVIPPVTISR
FT                   DDYTNSLSEYVSKAGNSNKADVNRSEGKYTKNGFKDNDNGNQKVSKYVPRTTTIIDTTS
FT                   SDKTILQKELKRADVIWLVYSDHYTYERISLHWMTMFRSMGVNLPIVLCANKSDLLTQD
FT                   SSISIKTQNSDEFVSLINEFKEIEACVRCSAKENYNVVEAFYLCQRAITHPISPIFDSK
FT                   EGNLRPAAVAALKRVFFLCDKDQDGYLSFSEFSILHQKCFNHASSEQEYQNILSAINRI
FT                   IYPDVNSKGETIGISVDGFIILNKMYAERGRHETIWGILRTFHYTNSLSLNDKFLFPQL
FT                   NVNPISSVELGPIGYKFLVDLFLKFDKDNDGGLNEEELANLFLPTPGIPRLWKESQFPS
FT                   SIVCNEEGYVSLQGWLAQWNLTTFLDYKTTLEYLAYLGFDDNSLVSAVKVTKPRKRRQK
FT                   QGKFYRQPVNDRNVFNCFILGAPKSGKTSLLESFLRGSYSDVYSPTIKPRLCVKDIELR
FT                   GGKQCYLILEELGELEPAILENKRRLDQCDVICYTYDSSDPESFQYLVDLREKYSALLD
FT                   EVPSVFVALKADLDKQEQRSDVQPENYTRDLFLSSPLHISSTWTTSLHELFIQLVDAAK
FT                   MPSSFTPGLEREPENPNNENVKHIVMAGGAISLMAIVSIWIWKSSLQSSRA"
FT   gene            <844784..>845386
FT                   /locus_tag="DEHA2F09834g"
FT                   /old_locus_tag="DEHA0F10758g"
FT                   /old_locus_tag="DEHA-IPF8285"
FT                   /old_locus_tag="DEHA-CDS5362.1"
FT   CDS_pept        844784..845386
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09834g"
FT                   /old_locus_tag="DEHA0F10758g"
FT                   /old_locus_tag="DEHA-IPF8285"
FT                   /old_locus_tag="DEHA-CDS5362.1"
FT                   /product="DEHA2F09834p"
FT                   /note="similar to uniprot|Q08746 Saccharomyces cerevisiae
FT                   YOR294W RRS1 Essential protein that binds ribosomal protein
FT                   L11 and is required for nuclear export of the 60S
FT                   pre-ribosomal subunit during ribosome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89131"
FT                   /db_xref="GOA:Q6BLY1"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY1"
FT                   /protein_id="CAG89131.1"
FT                   /translation="MSEQQFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKEE
FT                   YLTSVTRDNVQLLINQILSLPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAIPK
FT                   TKAPTKWEQFAARKGIKAKAKDGKMVFDEATGEWVPKWGYKGKNKELDDQWLVEVDDKV
FT                   KGTEDELIDPRTLNRAERKRLVKKNELQHKRNLKNQS"
FT   gene            <845781..>846803
FT                   /locus_tag="DEHA2F09856g"
FT   CDS_pept        join(845781..845825,845900..845995,846077..846479,
FT                   846604..846803)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09856g"
FT                   /product="DEHA2F09856p"
FT                   /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
FT                   YMR233W"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66310"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD2"
FT                   /protein_id="CAR66310.1"
FT                   /translation="MSDGYKPDEYLSTIDAILSVANLEQVTVKKIRNALQELFGVNLKP
FT                   HKKEINEVILERYYDLVNKRKEDTRTEEERKKEVEKQDALMAVRLSKSNLKTPVKRQKK
FT                   ASPKKTKEKDPAKNRNSAFFQEQHLSNELADVLGVEKCSRPQVVKQLWTYIKDNNLQNP
FT                   DDKRQIICDTKLQALFKKKSVGAFEMNKFLSHHIFKPEEVHQPTNEPDQNSDSSVNNEK
FT                   PKPVKSKTTKSESKAQDSSPESEEQ"
FT   gene            <847079..>851083
FT                   /locus_tag="DEHA2F09878g"
FT                   /old_locus_tag="DEHA0F10824g"
FT                   /old_locus_tag="DEHA-IPF8282"
FT                   /old_locus_tag="DEHA-CDS0158.1"
FT   CDS_pept        847079..851083
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09878g"
FT                   /old_locus_tag="DEHA0F10824g"
FT                   /old_locus_tag="DEHA-IPF8282"
FT                   /old_locus_tag="DEHA-CDS0158.1"
FT                   /product="DEHA2F09878p"
FT                   /note="similar to uniprot|Q08748 Saccharomyces cerevisiae
FT                   YOR296W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89134"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX8"
FT                   /protein_id="CAG89134.2"
FT                   /translation="MSTRSKEPSSRSQSIASSMLMAEDKAYDNVDITKLYEAVLKITIL
FT                   EYCNEARFRTPIIEAPQPNSSNVSVNSSSTNSKLSKSSKSSEISDPKLPTYLLASLETR
FT                   LNLIAMKKSGTHLDEMTRRSLLRLYSELLDPKFKADVASVNKPEYLVMKFVSCANKELV
FT                   KVGTIPSSEMSSVIFKQAGSFVQILISLIQKDKNSDVIIAKLQEHKESLKPSNKSKPTQ
FT                   STASSSTAGSIVKYPQPSFRITDIDQGYINLLTELFSIDQVKLQQDIFKFKDLSQPKAL
FT                   HKDINQILFYLDKDLGQFTSKSFSNEKAYDEWKEREKYGCEQLMSKYHIPSNMKLLPVP
FT                   PLPSGEDFYVFPTSSSTKPFFVILAKLCLEYEYKTNSAELSSFDKPFFSKQVQNLVGIC
FT                   ARFWRIDYPTRAVSLYTASHLSGILKDPFFESSNAKELGPIDIEMSTKMFFACKRIIEE
FT                   QGKLDWDEKANWSFKDQDEWIKNSSYSYNETLFGIKESLVQIFNKSSKPKFGPYLAFLG
FT                   DFLESDVLFPSVEDMGLHRKWEKKLSKTLLRTSEIRYAELLSNLPRDNTLDIIHILDIS
FT                   DSIVNDIRMLQKRYKNPLLGFLNVSRTVAAVITGMFAADAKNILKHIDAYAKTKNQVLP
FT                   YGDILEAYKSLYEIRDIHNQVSSTGSIFKFNLEGFFYPFLQDWITESGEKISSIIHRAM
FT                   TNDDFQPIDLNRDDKKFSSSVLDIFTLIKEFLKILNSLNWSNEFQLAKMYTTLLKSISD
FT                   GVLYYANTTSDKIIKDLDEEEQAKLAAEANNDSLEKRKSANWFDEVKNVVSNIQNNTNK
FT                   FEIAESYNFKPELCIALNNLDAMMQQLTKLEDMLDPEMISNTVAAFDPSLQKNYTSHIF
FT                   SLRIIKAENLKSATSSSSVHPYITMIDTKVRKTIGKTRTISNNCNPEWDEEFELTIPAN
FT                   SSLTISTTVWDERFGTHSICGRALLQLDPRRFKHDGIPQEVYLDLDSQGRVLIEIAVES
FT                   ERVDAIFVMGRAHRCLKRCQERCIKLIVEKFSRFIHYCFSRANLKSICGSNGNIKPTQE
FT                   QMDNAMMPLYNYLNSNLQVLAEYLSKHLLMKVMLATWAVVVSSADELLLPKLASATTFH
FT                   LSNIGSKLKPNNATNSNSGWQSAVSSAMANVTNSIGISGFGKSLTNTELETVFGWLHFL
FT                   CFDFFHNDGNGPPVKDLKNEQYQALLLVPVYYDGDVNYLTSEVDRLSPAFVMMLRGRNN
FT                   FDDSPSSETKKTKNGQRSMSRAGTIVRNKTIVANATAKARAKADKEAQEAKSDPIAAQT
FT                   LTEDIILRLLLIKDEKAFVARRLEQREKMAHSIATERLAKAAAEGRFARP"
FT   gene            complement(<851273..>855926)
FT                   /locus_tag="DEHA2F09900g"
FT                   /old_locus_tag="DEHA0F10846g"
FT                   /old_locus_tag="DEHA-IPF8278"
FT                   /old_locus_tag="DEHA-CDS0175.1"
FT   CDS_pept        complement(join(851273..855376,855445..855572,
FT                   855672..855718,855868..855926))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09900g"
FT                   /old_locus_tag="DEHA0F10846g"
FT                   /old_locus_tag="DEHA-IPF8278"
FT                   /old_locus_tag="DEHA-CDS0175.1"
FT                   /product="DEHA2F09900p"
FT                   /note="similar to uniprot|P22579 Saccharomyces cerevisiae
FT                   YOL004W SIN3 DNA binding protein involved in
FT                   transcriptional regulation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89135"
FT                   /db_xref="GOA:Q6BLX7"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX7"
FT                   /protein_id="CAG89135.2"
FT                   /translation="MTNQQDPWNNQQRPLSQPFNRQQPPVLPPPATLETGGQPFYPLPS
FT                   LPSLGNGAGHPQPGHGFSIPSINPGHEGIPFNQPPPEQPKPPQELRRPSNAALNNPPSQ
FT                   LPPPATIAAGNEQHVNNGPPNMPQGVPNRSTTSSVYRPLNVKDALSYLDQVKIQFYNQA
FT                   DVYNNFLDIMKDFKSQSIDTPGVIDRVSTLFRGHPNLIQGFNTFLPPGYRIECSLDPSD
FT                   PNPIRVTTPTGTTTRPNIGYGQSWNNDANQEQSGQMQHANQPPIPGSSPGRFIPSHEQQ
FT                   QQQQQQQQQQNGGQIEFNHAISYVNKIKTRFANQPDIYKQFLEILQTYQREQKPIGEVY
FT                   EQVTVLFSNSPDLLDDFKQFLPDTSNQGYLQQQQENLFYGANNGTSQLPPVGNFQPPTG
FT                   STGLSPNGSQGQFQQHGYPMVPGAPGKQDVAAILEANEDPSMMRRKKSSVSEAYPYDYN
FT                   YNSESQYSSLRSGAQPSKSNRIGSTINKSGAVVTNPTLVPGIPEPVPPSAAAKSSMSEE
FT                   ISFFDKVKKAIGNKQTYNEFLKILNLFSQDIIDKETLVERVDSFIGDNHPDLLNWFKMF
FT                   VGYEVKPQNIESITFKKHQLELSLCRAYGPSYRQLPKAETYMPCSGRDEMCWEVLNDEW
FT                   VGHPTWASEDSGFIAHRKNQYEEILFKIEEERHEFDFIMESNLRTIQTLETIANRIANM
FT                   TPEQKASFKLPPGLGHTSMTIYKKVLRKIYDKDRGFEVIDALHENPAIAVPIVLKRLKQ
FT                   KDEEWKRSQREWNKVWREMEQKVFYKSLDHLGLTFKQADKKLLTTRQLVSEISTVKVEQ
FT                   QNKRLHPLTPKPQEQLNYKFEDYEILVDILKLADVFINRSSNYSANDREKLSQFFQFFL
FT                   SRFFNISTEQIKESLSEREKVDKPEEKNNVDGSVSDSSEGQIDNTSAKKRHRENDLLRD
FT                   VLKKQSKSRKDDRAESPSQVSSESEDQEGAEDVNKLSELWIKATSSQPDLANNTTNNEE
FT                   KRDKYNLFCNTIIYVFFRHLRTLYERLKEIKAMNATVGKEIRSRKSPQFAKDLNLLSHQ
FT                   LEDMGIQISGSKDCYVQVLNLSEKLIEDEIEHQWFEETLRQGYRNRAYKIYTIDKVVQA
FT                   MVKHMHTIVTDSKTSEMMVLFEADRGNPISTAKDQILYRMQVRSLMTTDENMFKITLKE
FT                   GDNSVNIQFVSLDDLTINDHENAEEKYNYYVTSYVMSHPTEGVSASKINMPFSKPFIES
FT                   VDEDQCDGRVNTGLKVSVCENSYRLFFEADTHDEFTSNFVYNKQSEDSKDKSDKVEKLK
FT                   SLINNEETGWKSTVSEENTDICEEKVKLLFEKGANTYTKFVKEKEAKNDAKEEEQGVGE
FT                   TGDEKKGENYEADNMDIESSNKDEKENSVPTKLLPPPTISGKANHDNDADTTVIQENND
FT                   TTIQQDGNDTTTDETTVNQDDASMLVEGQQSEQTSTSGNDKQG"
FT   gene            complement(<856435..>857649)
FT                   /locus_tag="DEHA2F09922g"
FT                   /old_locus_tag="DEHA0F10879g"
FT                   /old_locus_tag="DEHA-IPF8275"
FT                   /old_locus_tag="DEHA-CDS3137.1"
FT   CDS_pept        complement(856435..857649)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09922g"
FT                   /old_locus_tag="DEHA0F10879g"
FT                   /old_locus_tag="DEHA-IPF8275"
FT                   /old_locus_tag="DEHA-CDS3137.1"
FT                   /product="DEHA2F09922p"
FT                   /note="weakly similar to uniprot|Q12405 Saccharomyces
FT                   cerevisiae YOR084W Putative lipase of the peroxisomal
FT                   matrix"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89137"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX5"
FT                   /protein_id="CAG89137.2"
FT                   /translation="MQPSCSDLYESKLITVPAAFPRYPGSVILSQPSNNPEDYRLDVCY
FT                   RKYKTKSYVSDQPKINIVFLHGNGMNKGIWHYHIDKLYNHFKNKEKSEYQLNSVLAIDV
FT                   ATHGDSAAINKDKLGYVYSWIDGSKDIIDIVKNQESKDFFSKNTINILVGHSMGGFQAL
FT                   YTCYLDPELFDCCIPINPVCYMDNETAELHLFVLNMWHESGKIKSHFDIPEGSNWKDVV
FT                   EHHYKKESFFKKFDSTVMANMLEDEFTDELKNNTNGKYKTIDSNTPSNQEYICYYNAQL
FT                   FIPQGMKVLDKITTPVYHIVGDNDTAGEKAVKSTRTALQSVLKPIDIVDSTHIVIGENP
FT                   DLVVNELIKVIDDNIETHKKNGDTRYKEPKLLEKHGKDYRNSILDKEFDVYMSASKNGT
FT                   KLYKL"
FT   gene            <858158..>858607
FT                   /locus_tag="DEHA2F09944g"
FT   CDS_pept        join(858158..858210,858292..858607)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09944g"
FT                   /product="DEHA2F09944p"
FT                   /note="similar to uniprot|P38902 Saccharomyces cerevisiae
FT                   YOL005C RPB11 RNA polymerase II subunit B12.5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89138"
FT                   /db_xref="GOA:Q6BLX4"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX4"
FT                   /protein_id="CAG89138.1"
FT                   /translation="MNAPDRFELFILPDGVDKIKITPDTKVPNAALIKIEREDHTLGNL
FT                   IRAQLLKDERVLFAAYKVEHPLFANFVLRIQTEDDYSPREALRNACSGLIGELDVIKTR
FT                   FKDEWALKSLLNSNDDDF"
FT   gene            complement(<858949..>860901)
FT                   /locus_tag="DEHA2F09966g"
FT                   /old_locus_tag="DEHA0F10923g"
FT                   /old_locus_tag="DEHA-IPF8273"
FT                   /old_locus_tag="DEHA-CDS1356.1"
FT   CDS_pept        complement(858949..860901)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09966g"
FT                   /old_locus_tag="DEHA0F10923g"
FT                   /old_locus_tag="DEHA-IPF8273"
FT                   /old_locus_tag="DEHA-CDS1356.1"
FT                   /product="DEHA2F09966p"
FT                   /note="similar to uniprot|P32562 Saccharomyces cerevisiae
FT                   YMR001C CDC5 Polo-like kinase with similarity to Xenopus
FT                   Plx1 and S. pombe Plo1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89139"
FT                   /db_xref="GOA:Q6BLX3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="InterPro:IPR036947"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX3"
FT                   /protein_id="CAG89139.1"
FT                   /translation="MSSVRTQPLQPLNNGQLNSRANNITPIKPVRHNKENQEEVKTKKK
FT                   KEKLSALCKTPPSIVRTRNGRDYRRGTFLGEGGFARCFQMKDSSGKIYAAKTVAKASIK
FT                   NEKTKTKLLSEIKIHKSLKHSNIVNFIDCFEDDVNVYILLEICPNQSLMELLKTRKRVS
FT                   EPEVRYFMVQMVGAIKYLHSRRVIHRDLKLGNVFFDPDMNLKIGDFGLASILPSLESRK
FT                   YTICGTPNYIAPEVLGGKNVGHSFEVDIWALGIMLYALLVGKPPFQAKDVQVIYERIKK
FT                   TEYSFPVDKPISEEAKVLIKDLLSLNPLHRPNINEILNYDWFKGSFPDKTHEISLNGTP
FT                   EGIDNISKAQSAINFTNTKASCGIYTPKTKNPVEILRSDLHSEQPRAMLPKSLSPGDTR
FT                   NKYQEVDPAQLGKPRRVNFNSTYSTTIKRLNQICFETYQNMRRLEYSKHDRIDTMELPS
FT                   CENPTLISKWVDYSNKYGFSYQLTNDDIGVLFNDENTFLKLHSSGRFLELIYHEGEGWT
FT                   CIENSSSHPPSQVKRQLEIVDFFAKYMNSNLSKVSENEERKETVFLRRYTRTSEYIMFE
FT                   MTNGNFQFNFKDHHKVCISKSGLAITHISPNRITQTHPLIFILKHGDFPSTEVPNCLEK
FT                   IAIIKEAIKRKAFKE"
FT   gene            <862319..>864688
FT                   /locus_tag="DEHA2F09988g"
FT                   /old_locus_tag="DEHA0F10945g"
FT                   /old_locus_tag="DEHA-IPF8272"
FT                   /old_locus_tag="DEHA-CDS0870.1"
FT   CDS_pept        862319..864688
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09988g"
FT                   /old_locus_tag="DEHA0F10945g"
FT                   /old_locus_tag="DEHA-IPF8272"
FT                   /old_locus_tag="DEHA-CDS0870.1"
FT                   /product="DEHA2F09988p"
FT                   /note="similar to uniprot|P04786 Saccharomyces cerevisiae
FT                   YOL006C TOP1 topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89140"
FT                   /db_xref="GOA:Q6BLX2"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="InterPro:IPR025834"
FT                   /db_xref="InterPro:IPR036202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX2"
FT                   /protein_id="CAG89140.2"
FT                   /translation="MMSSSDDNVALSMIDGNIDQDDDMPLSQISSKSTDTTSVDSNSTE
FT                   GQKSGSKRKASSPTGHKAKKVKRSKNTVKSESDEENTPLASTTAPPPKKTSKKKSESGT
FT                   AKPRNGTKKSKGAKSTGSNKTDAVKKEDEVAKTEKDPSSTREDEEDEEKYKWWEAEDVD
FT                   GEQKWESLEHNGVIFPPDYEPLPSHVKLYYDGKPVDLPLEAEEVAGFFGAMAETDHAKN
FT                   PTFQKNFFEDFCKVLKDAGGCNVNIIDFHRMDFSKMHAHFEMLRDQKKLLSKDEKKAIK
FT                   AEKDKFEEPYKTCLLNGHKEQVGNFRIEPPGLFRGRGAHPKTGKLKRRVMPEDVTLNLS
FT                   EGCKIPEPPQGHKWAEVRHDNTVSWLAMWKENIADSFKYVRFAANSSIKGLSDFKKFET
FT                   SRKLRYHIDEIRKDYTKMLKDPLMQNRQMATACYLIDIFALRAGGEKGDDEADTVGCCS
FT                   LRYEHITLKPPNKVIFDFLGKDSIRFYQEVEVEKQVFKNLRIFKKPPKQPGDDLFDRIS
FT                   PPLLNKQFQNYMKGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKVVKFNAANRTVAIL
FT                   CNHQRTVSKTHGSSVQKIHDKLKELEWHKIRTKKMILQLEPNLKTKDPDYFEELDDLSK
FT                   EDTEHIHRALIERAREAARKRFQRENDKLKIEDKPLLTEKDLEEKMEKVNELEKEYAEE
FT                   LKTGKPQIKKSVTVEKLKSQVDTLTNRILNTTFQLKDKEDNSEVSLGTSKMNYIDPRLT
FT                   VMFSKKFNVPIEKLFTKTLRDKFNWAIESADENWKF"
FT   gene            complement(<864962..>866206)
FT                   /locus_tag="DEHA2F10010g"
FT                   /old_locus_tag="DEHA0F10967g"
FT                   /old_locus_tag="DEHA-IPF8269"
FT                   /old_locus_tag="DEHA-CDS3058.1"
FT   CDS_pept        complement(864962..866206)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10010g"
FT                   /old_locus_tag="DEHA0F10967g"
FT                   /old_locus_tag="DEHA-IPF8269"
FT                   /old_locus_tag="DEHA-CDS3058.1"
FT                   /product="DEHA2F10010p"
FT                   /note="similar to uniprot|O59832 Schizosaccharomyces pombe
FT                   SPCC965 SPCC965.12 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89141"
FT                   /db_xref="GOA:Q6BLX1"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX1"
FT                   /protein_id="CAG89141.2"
FT                   /translation="MVGKHIDEDLIKRFETLSSETPIVDTHNDFPYLLRVQLHNEFETV
FT                   NRFKFDDKLQSHTDLGKFRRGRVGLQFFSCFIECKDDDYLYQDFNNPNSAVRDTMEQID
FT                   VVTRLVSSYSEDLEMVSMSSQVMDVYSNGKIAISMGVEGLHQVDSSLSVLRKYYELGVR
FT                   YITLTHNCDNPFATAASSVVAGLPDNGLSDFGRSCVLEMNRIGMMVDLSHVSYKTMLDA
FT                   LEITKAPVMFSHSSAYTMTPNERNVRDDVLLRLKENNGVICINFFPSFISPHSDENAII
FT                   DDAVNHIKHVVELIGWEHVGLGSDFDGIPEGPKGLEDVSKYPDLIIKVMGNLNASDSQI
FT                   RLLMGDNVLRVWNENEKVAKSLQIAGTQLVNENWQKRDWSFFDYARSFRELYPGAYEEK
FT                   TNTYKDASLDLTKEK"
FT   gene            <867577..>868551
FT                   /locus_tag="DEHA2F10032g"
FT                   /old_locus_tag="DEHA0F10989g"
FT                   /old_locus_tag="DEHA-IPF8266"
FT                   /old_locus_tag="DEHA-CDS4252.1"
FT   CDS_pept        867577..868551
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10032g"
FT                   /old_locus_tag="DEHA0F10989g"
FT                   /old_locus_tag="DEHA-IPF8266"
FT                   /old_locus_tag="DEHA-CDS4252.1"
FT                   /product="DEHA2F10032p"
FT                   /note="weakly similar to uniprot|Q08054 Saccharomyces
FT                   cerevisiae YOL007C Appears to be a structural component of
FT                   the chitin synthase 3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89142"
FT                   /db_xref="GOA:Q6BLX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX0"
FT                   /protein_id="CAG89142.2"
FT                   /translation="MRVFNFILPVVTILTILKGVDADTNVVATTSRKPTNRVHAHHMHR
FT                   ASHTPDGATQVTKGPQTTSVTVVKRADMPSLSESETKSYSYSLAIPNASKTSSSRKDPY
FT                   IYRSNLPENLVFIVVGAIIGFILLSFLGYRITAYILSNQRAKTDREVYTNFGHNSGSGF
FT                   AFGSESSNSSMLEKSSLGSVSSLHMLSRHNSLLQLQHDNDTSTLSNSQQGRSYRNAISD
FT                   NKSNRGSMFISPVLELMNTKSNSQLELPLYHKNASQTFNSSSASLIQNPAMMDSPINDF
FT                   QPTRDHTNGSSPDMSSVQTQLHPQQPQSKLKRPPSMVLDNLIN"
FT   gene            <868862..>869563
FT                   /locus_tag="DEHA2F10054g"
FT                   /old_locus_tag="DEHA0F11011g"
FT                   /old_locus_tag="DEHA-IPF8264"
FT                   /old_locus_tag="DEHA-CDS5108.1"
FT   CDS_pept        868862..869563
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10054g"
FT                   /old_locus_tag="DEHA0F11011g"
FT                   /old_locus_tag="DEHA-IPF8264"
FT                   /old_locus_tag="DEHA-CDS5108.1"
FT                   /product="DEHA2F10054p"
FT                   /note="similar to CA1988|IPF19749 Candida albicans IPF19749
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89143"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW9"
FT                   /protein_id="CAG89143.2"
FT                   /translation="MLTRTINRTVASYSTKRLLHSSLPRFVKNDDSTIDNYRMPSQTSI
FT                   NEWEFKYDFIPKVAEPKIPPVSREAIKQDIANEKKVQVEKEMLNSEVVSVKAEANDAPV
FT                   LHGGEAVKAEPEFLQDRGSTPVDASYATPRESAKPSKPANRGKYLQTSINPQINQSEVV
FT                   NMGANEVDHKSSDVKQERVVDDVEHDNLHTSGQENANKSSTSFGVPLALLGVGAGGYYY
FT                   YKSSDSDSQKK"
FT   gene            complement(<869675..>870109)
FT                   /locus_tag="DEHA2F10076g"
FT                   /old_locus_tag="DEHA0F11033g"
FT                   /old_locus_tag="DEHA-IPF8263"
FT                   /old_locus_tag="DEHA-CDS6215.1"
FT   CDS_pept        complement(869675..870109)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10076g"
FT                   /old_locus_tag="DEHA0F11033g"
FT                   /old_locus_tag="DEHA-IPF8263"
FT                   /old_locus_tag="DEHA-CDS6215.1"
FT                   /product="DEHA2F10076p"
FT                   /note="similar to uniprot|Q03667 Saccharomyces cerevisiae
FT                   YMR002W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW8"
FT                   /protein_id="CAG89144.2"
FT                   /translation="MARQRRSAPTQRSQSRSAHTASAAPYQSAPAASRPVQQSQQGPGL
FT                   FGQMASTAAGVAVGSTIGHTLGAGITSMFGGSSSAAPVEHDQQQLAQAGQQSQYQEQAR
FT                   HCDADARNFTRCLEENSGNMQTCEYYLQQLKACQEAARPY"
FT   gene            <870444..>871313
FT                   /locus_tag="DEHA2F10098g"
FT                   /old_locus_tag="DEHA0F11055g"
FT                   /old_locus_tag="DEHA-IPF8261"
FT                   /old_locus_tag="DEHA-CDS4263.1"
FT   CDS_pept        870444..871313
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10098g"
FT                   /old_locus_tag="DEHA0F11055g"
FT                   /old_locus_tag="DEHA-IPF8261"
FT                   /old_locus_tag="DEHA-CDS4263.1"
FT                   /product="DEHA2F10098p"
FT                   /note="similar to CA4948|IPF5149 Candida albicans IPF5149
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89145"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW7"
FT                   /protein_id="CAG89145.2"
FT                   /translation="MKCGFSTSGLRLQNVQPNYYEVLELPHSASIREIKTQFKKLSKKY
FT                   HPDLNTHLTNDDKKANSDKFVTIVNAYDTLKDMKKKKNYDLSLKSSGQLHNKNGSATRR
FT                   NQEWHNKYYGEAKYYSKSNAYSKSSYSASGLNTKRHKVRHDNDFQNNSSFSGEHRNYGD
FT                   KHGVPHFNYNEHLLKHLKFEQRIINRQLTDDDREAIMRQLSKSGDLKNMSEELITKHLM
FT                   RQVHHTKNRANSAGSGQWGTPGSSTNTQSRNPYMYHGPQDDSEGLKITILCLGAGGSLY
FT                   LLYQAFFS"
FT   gene            complement(<871604..>873052)
FT                   /locus_tag="DEHA2F10120g"
FT                   /old_locus_tag="DEHA0F11077g"
FT                   /old_locus_tag="DEHA-IPF8260"
FT                   /old_locus_tag="DEHA-CDS2466.1"
FT   CDS_pept        complement(871604..873052)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10120g"
FT                   /old_locus_tag="DEHA0F11077g"
FT                   /old_locus_tag="DEHA-IPF8260"
FT                   /old_locus_tag="DEHA-CDS2466.1"
FT                   /product="DEHA2F10120p"
FT                   /note="highly similar to uniprot|Q9UUU1 Yarrowia lipolytica
FT                   YALI0F17248g nucm NUCM protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89146"
FT                   /db_xref="GOA:Q6BLW6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW6"
FT                   /protein_id="CAG89146.1"
FT                   /translation="MLRVKNISNSVRLASRARHGSLSSRAFSNFSRLNAAVNDESNVKP
FT                   FKHALGRDAQRYSDEPGTFGKTTFTESMDEVDMTWGRDDDPKHVEKQNTKIRHFTINFG
FT                   PQHPAAHGVLRLILELHGEEIVRADPHVGLLHRGTEKLIESKTYMQAIPYFDRLDYVSM
FT                   MTNELVFALAVEKLLNIEVPLRAKYIRTLFGEITRILNHCMSVLSHIMDVGGLTPFLWG
FT                   FEEREKLMEFYERVSGARLHSNYVRPGGVSQDMPVGLLDDIYMWATQFGDRIDETEELI
FT                   TDNRIWAARTKDVGVVTAEDALNYSLSGVMLRGSGIPYDIRKAQPYDAYELVDFDVAVG
FT                   MNGDCYDRYLIRMAEFRQSLRIIYQCINDMPNGPIKTEDFKVSAPPRSMMKEDMEALIH
FT                   HFLLYTKGYAVPQGETYTAIEAPKGEMAVYVVSDGSERPYRCKIRAPGFAHLGAFDHIS
FT                   RGNLLADAVAIIGTMDLVFGEVDR"
FT   gene            <873748..>874257
FT                   /locus_tag="DEHA2F10142g"
FT                   /old_locus_tag="DEHA0F11099g"
FT                   /old_locus_tag="DEHA-IPF8256"
FT                   /old_locus_tag="DEHA-CDS5759.1"
FT   CDS_pept        873748..874257
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10142g"
FT                   /old_locus_tag="DEHA0F11099g"
FT                   /old_locus_tag="DEHA-IPF8256"
FT                   /old_locus_tag="DEHA-CDS5759.1"
FT                   /product="DEHA2F10142p"
FT                   /note="similar to CA4888|IPF1631 Candida albicans IPF1631
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89147"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW5"
FT                   /protein_id="CAG89147.2"
FT                   /translation="MNFASKRKREEVEPDTKKVKNFINEKERQEFSSSNEWPVYNHPDG
FT                   GIVKITPWGSVRQYMDASGNTVTKFEDMNFQDISFANSHQTANVYEMPSTPVSMNQNSN
FT                   NYSSPSMYDVDGIKLSPSDEAENYVINGYGRSQGNGAQQQQFQQEHENYFGMEDHDLEY
FT                   DEMVKI"
FT   gene            complement(<875027..>876475)
FT                   /locus_tag="DEHA2F10164g"
FT                   /old_locus_tag="DEHA0F11121g"
FT                   /old_locus_tag="DEHA-IPF8255"
FT                   /old_locus_tag="DEHA-CDS2465.1"
FT   CDS_pept        complement(875027..876475)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10164g"
FT                   /old_locus_tag="DEHA0F11121g"
FT                   /old_locus_tag="DEHA-IPF8255"
FT                   /old_locus_tag="DEHA-CDS2465.1"
FT                   /product="DEHA2F10164p"
FT                   /note="similar to CA4970|IPF4696 Candida albicans IPF4696
FT                   unknown Function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW4"
FT                   /protein_id="CAG89148.2"
FT                   /translation="MTSEVPGYYDQENSEGLPIYTAPSEPLPQYEPSLEYFGLSLIKTE
FT                   FSSPYHYNNGNRSWKPVLLEINSTQLNIYDLKVEKKVLELIVALYNDSNQLNDVMQIVQ
FT                   NEKMNNDGDDDLDEMWNDAYQGEVDDLKQSTSTKWKSSWHKSKYSKVLNKSISQYYELI
FT                   KENRMLFEPTRSATEYSIFKTKFQGNQIASYTLNNMYVGEAPSLNHLVSSMYKEDKSHI
FT                   NKHNISTLVKYKNTLRVRIELKQMLLQFWSFYGMLHWFRALSIAKDLSSPLENRSVTKL
FT                   KSIPSRNSRNNNLLAATEAAAMLGMASEDHDLTYFTDPFNSHSPKHIISENSDYADVST
FT                   VSSGSNTPYSVFSNERRESVGSTSTDISTIPNNRYNKNINKFSLVSYDKVFATTVEKQY
FT                   ISNCIPDLNSFDKWCGLDVTVSNYKQYLSPSQQNASSKNIFISSSALDNASWGISKVLK
FT                   KQPQQSNCSKNFVIDSKGLVSLAH"
FT   gene            <877778..>877850
FT                   /locus_tag="DEHA2F10186r"
FT                   /old_locus_tag="Deha0F.12"
FT   tRNA            877778..877850
FT                   /locus_tag="DEHA2F10186r"
FT                   /old_locus_tag="Deha0F.12"
FT                   /note="tRNA Ala (TGC) cove score=80.01"
FT   gene            complement(<877992..>880208)
FT                   /locus_tag="DEHA2F10208g"
FT                   /old_locus_tag="DEHA0F11165g"
FT                   /old_locus_tag="DEHA-IPF8254"
FT                   /old_locus_tag="DEHA-CDS1004.1"
FT   CDS_pept        complement(877992..880208)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10208g"
FT                   /old_locus_tag="DEHA0F11165g"
FT                   /old_locus_tag="DEHA-IPF8254"
FT                   /old_locus_tag="DEHA-CDS1004.1"
FT                   /product="DEHA2F10208p"
FT                   /note="weakly similar to uniprot|P32807 Saccharomyces
FT                   cerevisiae YMR284W YKU70 Forms heterodimer with Yku80p
FT                   known as Ku binds chromosome ends and is involved in
FT                   maintaining normal telomere length and structure in
FT                   addition to participating in the formation of silent
FT                   chromatin at telomere-proximal genes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89149"
FT                   /db_xref="GOA:Q6BLW3"
FT                   /db_xref="InterPro:IPR005160"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR006165"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW3"
FT                   /protein_id="CAG89149.2"
FT                   /translation="MSFSDDENESYKQFEIHEGIAFLIELTPDIFLPLKELDNKSQFIE
FT                   ILSSINELVSELIITLPNTGIGIYFYNCQKTNKKFTKDCGLNRLFKLNDLNSFNMKILN
FT                   DAVNDDANGISLLKDKFPYIEHGYNEDNLPAVLNTMLNEFHNKKNYNNKKLIWFTNNDK
FT                   PFNNDKSKHNLWKIINDYDEFRIQITPFFLDSYTDEKQSKKKVFDPSLYQDIFLNTNYL
FT                   NNRKSNDKNDDDEERIDIKSEFDPDRLNDIVFDGISKSTPRFKETTLSTQIKSMIFRLK
FT                   EVKRILFSCDLILGDGEGVSGNFGCSVKGYTIYNHEKLKKFNKIYNSGEELKIVHTRSK
FT                   ILNDRTGEKVEVETKGNQSVTERNEDANIRKGFPIGNDHVLYLNSKQINFLKNYAFDHN
FT                   SDNRAGGNSEDEDDDEFDNQNEDLDDHGFSKPPYLKLLGFRSLSTYQPHYNSSAPIFVT
FT                   PDMNDGLKTASAEGGYKNSFKTFSSLYQSCIKLQKYGVLFGCLKKNSMPNLYALYPTKA
FT                   TNSNKSGLNFPEGFFLIRLPWLDDVRSLPEYSFLNNVNLNELSGESVPPEILLNFKHII
FT                   SQFFLREYRPSDFPNPSINYFYKIINNELLQEELSPESKTVANNDTTTQKLIELRGYLQ
FT                   QEELQTMLKTLNVRLNKLSNESLKREMESSDGADNKKRKKEVPELNEEAVLTAWKSNEW
FT                   NHFNVSQLKQFVSKYKGLIKSGTKKQDIINNIISFLNKKYETEK"
FT   gene            <880434..>880871
FT                   /locus_tag="DEHA2F10230g"
FT                   /old_locus_tag="DEHA0F11187g"
FT                   /old_locus_tag="DEHA-IPF8252"
FT                   /old_locus_tag="DEHA-CDS6190.1"
FT   CDS_pept        880434..880871
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10230g"
FT                   /old_locus_tag="DEHA0F11187g"
FT                   /old_locus_tag="DEHA-IPF8252"
FT                   /old_locus_tag="DEHA-CDS6190.1"
FT                   /product="DEHA2F10230p"
FT                   /note="similar to uniprot|Q00381 Saccharomyces cerevisiae
FT                   YJR058C APS2 Small subunit of the clathrin-associated
FT                   adaptor complex AP-2 which is involved in protein sorting
FT                   at the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89150"
FT                   /db_xref="GOA:Q6BLW2"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW2"
FT                   /protein_id="CAG89150.2"
FT                   /translation="MAIHFILVLNRQGKTRLAKWFDNNYTTQDKQRYTTEIHRLISSRD
FT                   SKYQSNFIEYQQNKLVYRRYAGLYFISSIDLIDSELDSLESLHFLVEVLDVYFDNVCEL
FT                   DLIFNFYKLYSILDEIFLGGEFQEISKDKILERLAYLDKLD"
FT   gene            complement(<880906..>881562)
FT                   /locus_tag="DEHA2F10252g"
FT                   /old_locus_tag="DEHA0F11209g"
FT                   /old_locus_tag="DEHA-IPF8251"
FT                   /old_locus_tag="DEHA-CDS5176.1"
FT   CDS_pept        complement(880906..881562)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10252g"
FT                   /old_locus_tag="DEHA0F11209g"
FT                   /old_locus_tag="DEHA-IPF8251"
FT                   /old_locus_tag="DEHA-CDS5176.1"
FT                   /product="DEHA2F10252p"
FT                   /note="similar to uniprot|P00572 Saccharomyces cerevisiae
FT                   YJR057W CDC8 Thymidylate and uridylate kinase functions in
FT                   de novo biosynthesis of pyrimidine deoxyribonucleotides"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89151"
FT                   /db_xref="GOA:Q6BLW1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW1"
FT                   /protein_id="CAG89151.2"
FT                   /translation="MGRGQLILIEGLDRSGKSTQSGILSERLPGGKLIKFPDRSTKVGS
FT                   IINEYLTNSELNLSDQTAHLLFSANRWELADSIVNDLNKGHFIVMDRYIYSGIAYSLAK
FT                   SRFSNDSSPEMASIDWLYSPDKGLPKPDLTIFLTLSLEELSNRKGWGEERYEKENFQKS
FT                   VKNCFLEVLNADNDASVHIIDVNNLNIDQVTAKIWDLIEQKNLNKQTENSIERFT"
FT   gene            <882909..>885944
FT                   /locus_tag="DEHA2F10274g"
FT                   /old_locus_tag="DEHA0F11231g"
FT   CDS_pept        join(882909..882933,883057..885944)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10274g"
FT                   /old_locus_tag="DEHA0F11231g"
FT                   /product="DEHA2F10274p"
FT                   /note="similar to Candida albicans Q59TV6 Hypothetical
FT                   protein SVL3"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89152"
FT                   /db_xref="GOA:Q6BLW0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW0"
FT                   /protein_id="CAG89152.2"
FT                   /translation="MSSIEILTVGSNPNVAFYAWRLHETQSCNVSVVNSRIKGDSINWR
FT                   SPVLGTSTFKPYEIYQDLSQISPGSNKYDIVFISCTSLQDFQTVCADLVPFLHKKSAIV
FT                   VESTGYVNLEPFVQLSFPSMKDITICCIMNESDVRQIDGDNFTHILRNNDNRIYLGTSL
FT                   TNSNISSTSNPSFQKVYKLMQLVQQDSSNSISLLKSIVPKEFMTYQWKLALPRIVFNPL
FT                   SVIFEAEVPANLSNQILCKPLITGMINEIFKIIKKMDCKLVKGSENENNLFKNWCSSFP
FT                   EAPKNQNYLNSPPLFYEFYRQYDLNIDLLLLQPILLADDHGIRTPYLENIYSTMCQYIK
FT                   INDADTNSIFFTRKSNSNMNKGKVNQINADHEFKLNQLNIISSDLARMESNKNQLDSYL
FT                   REKEILKGQVGEDINKQELNLRKLNINVDHQQQKLSQIEQRLEQLQLQEQKIGNNQMKS
FT                   IQPSELEERTLPQSETNRTFRDSVAPNDNLEDLADIALYGAALGSPVPNQNASHNGEAD
FT                   MNGSSVPNRALNMNGGNDQVHSNGNAHSNGNIQLLNGDLPQHLHEKELELQKRERVLIN
FT                   RELSLPNDNQMNGYYDNEQHRQPQHPQQQPHQQTPPALHLDTQQKNMNMPPNQQQYYNQ
FT                   RQYNNNHGYMPSPMDQQLPHGLPSNGLPPNALPPNLRVNSMNSNMNRYNMPPPQMVNGN
FT                   PHQANGYGGKTQRLSSFPSSSHNYQDLHQQQYMQNPPQQQYYNNTYQNGPPVDPGVESR
FT                   FKAQPRKSNRRSAFPQMNGDLSGLDMGGRGGMPMPGGTNPAATKANKHRSAMPMNANGN
FT                   RTSPPQHKKSASNYAIPQGQGQGQGQGQGQGQGQGQGQAQAQAQAQAQAQAQGHAQGHA
FT                   QAQGTRINVLGQGQPSSEPQQYNHAQPQQQYLQLPNGSNASSNSSNSVNTNDTPQTNDE
FT                   GVQIHVPIADPNTNAKPLGGISNPNKEVETKKKRGLFRKH"
FT   gene            <886228..>886866
FT                   /locus_tag="DEHA2F10296g"
FT                   /old_locus_tag="DEHA0F11253g"
FT                   /old_locus_tag="DEHA-IPF8244"
FT                   /old_locus_tag="DEHA-CDS5184.1"
FT   CDS_pept        886228..886866
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10296g"
FT                   /old_locus_tag="DEHA0F11253g"
FT                   /old_locus_tag="DEHA-IPF8244"
FT                   /old_locus_tag="DEHA-CDS5184.1"
FT                   /product="DEHA2F10296p"
FT                   /note="similar to CA0955|IPF13160 Candida albicans IPF13160
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89153"
FT                   /db_xref="GOA:Q6BLV9"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV9"
FT                   /protein_id="CAG89153.1"
FT                   /translation="MAPKRLFYEDDEVIITKPGFNVEISDDLKEQESSHGNISFIKGMG
FT                   IRTAPVLEEYVNKTRLILHEKLSYYGAELGTQQSALCNEYRTIKNEVQSSIKEPVLPNL
FT                   IYILTSSLTGSILVNKRSLPLRFITPVIFGGVAFNYFMPRSYNVVQEKFTTYEKENLPD
FT                   AYKNQITLAEKYQDFKKGLFEGLDNTSTQIENSVHDARLYLADIFSDKK"
FT   gene            complement(<886941..>888929)
FT                   /locus_tag="DEHA2F10318g"
FT                   /old_locus_tag="IPF_8243"
FT   CDS_pept        complement(886941..888929)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10318g"
FT                   /old_locus_tag="IPF_8243"
FT                   /product="DEHA2F10318p"
FT                   /note="similar to uniprot|P50944 Saccharomyces cerevisiae
FT                   YNL101W AVT4 Vacuolar transporter exports large neutral
FT                   amino acids from the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66311"
FT                   /db_xref="GOA:B5RUD3"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD3"
FT                   /protein_id="CAR66311.1"
FT                   /translation="MSGPRKIQESTGSSSRRLSIAKLARSPISESPITSPSIRNGIHSH
FT                   SFTANSPFLKEDSSRNYNECIESSSSKSSSKYNGSEVFHSGNEVADIPTSNGVETDFST
FT                   GMDDPKIIKQVHKHLKDQKVNALQMEGGDITRDLYKIADQEYRPKAPKRSRSLSSSEME
FT                   TRRRGSTASSLNVPGGFRRQFIMNNTLRTRNPNFLTKNFVEFLSIYGHFAGEDLEDQND
FT                   LIACHYKAHIPNFDDSIDEESLLLPNQESVKINAKGTATDKKAYFLLLKAFIGTGVLFL
FT                   PKAFSNGGLMFSSLVLAFFGLLSFWCYLILIHAKLATKVSSFGDIGLKLYGKWLQQLIL
FT                   TSIIISQIGFVAAYIVFTSENLKAFVGSVTSINTSDIHIMYFILIQLIIFLPLSLIRDI
FT                   TKLSLSALLANIFILIGLVTILYYSFYELLFLNHGAFGKDIEFFFNKESFSLFIGVSIF
FT                   AFEGIGLIIPIQESMIYPNNFPRVLFSVIATISTIFIGIGSLGYLTFGKYVKTVIILNL
FT                   PQDSPFVIMVQLLYAFAILLSTPLQLFPAIRLVESKLFTKTGKYSLRVKWLKNFFRFGF
FT                   VLLTAVVALVGGQNLDRFVSFVGCFACIPLVYMYPPILHLKSCCKYSDTFNQAENRKRF
FT                   WLGCLDCILVVIGGVAMIYTTYQIVVG"
FT   gene            complement(<889092..>892670)
FT                   /locus_tag="DEHA2F10340g"
FT                   /old_locus_tag="IPF_8242"
FT   CDS_pept        complement(889092..892670)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10340g"
FT                   /old_locus_tag="IPF_8242"
FT                   /product="DEHA2F10340p"
FT                   /note="some similarities with ca|CA0953|IPF13166.3eoc
FT                   Candida albicans IPF13166.3eoc unknown function 3-prime
FT                   end"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66312"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD4"
FT                   /protein_id="CAR66312.1"
FT                   /translation="MGISSKLSPEKHPYFNKPKTHRTNLSENSSFSLTGSEFSSTGSHT
FT                   SNSSDETSGIPMNKANNGAPRRVKNMPIALTPNIGGEKFNFATGPPTNKEASSREGARR
FT                   SNERKPPTPPEKEPRSVSKVQRHPYTAQIRNRDHDAHIRMQQPDQAGNAYFRPRSNEQY
FT                   SQSPVSPQQVNQANNDYFKPSSNEKYSHSHASPQQINQSSRKEIPIVQHQNQQMEEHSP
FT                   LPTEQMYSEKRQARKTQEHSSQAQPPTNNKPSMEHNTTNMLMNDGMIQAPQNMSNILSQ
FT                   HEYDKNESTGVNESEDNSDDYSEEDLEADSEEYTDTSEESIRNDNVNASYSTPYVNGAQ
FT                   QHPYYEQWMQYYASLAAQQQQQQMTPNRSSMYGYPMNPHQYSNINTANGQISSASQQEP
FT                   YYSYGSNHLNRESHSRNSIASYSDNNNNDFLTHYKRRSGQNSISDTSNELISNSRRSTI
FT                   KSNRYPSVPSSILESESKVPEKSKAARVSSLDLNFKPKEYQNYNDDYNEDQQGQTSLRN
FT                   NEDAYEPTQSQDSTMSVAFGLSDMALDDKTEKRHISDYSKFLFEGDSQVEEEEEEEEQE
FT                   EEEKEYGTGNENKLLYQQPSHEMSRHESLESNNSLGSIRSEASNNFKVKSPPPAKKLQE
FT                   RNSNIEEKNRQNKGKRKERHERKSSSFNPNSSISSQNDLLNMNNTAQAYQQQANMMPYL
FT                   GHSQLPSMESMPFNQNAIPFNQPMMAYNTEYQGVVPPMAHSRRQSIATAESKRQSMMFA
FT                   GNGMPPYGPQPMNNNRMSMPVMGMHTSNKPAQIRTNDSKIKKKVEEFVELRKVIASGNK
FT                   SLEYRLKWIKMLINATNYRLYAFVNIKGEPAPQEFSQHNKALFLKSSINHLLKLIKEYE
FT                   VGKKNDNIHSQVCYIYGCLLKHDYAASYNQDFGIEKDIQESISYFEKSLELNPNNFKSL
FT                   YKLGEIFEYEFPDQFDQALRRYKEAAKLGYNQAIYKMALLYLNVPSIRSTKFFNYFVEL
FT                   SNIDLSSKDVELTGEDRDELEEIIGLTFYQLGKIYEGIYPGDLHAEDEFISKSLERAPV
FT                   NYAKALTYCNKSAKLDCLLAQVKLGSVYEKGELNRQQNPSKSIQWYMKAVSSPLSFKRH
FT                   PDAMLGLSRWNLKGSDGLSKYIPSPDPEKAVMWCDRAIKEFNSPDAYFAMAQLNEIGLG
FT                   DRNPQHWYFKAHELGHHEASFKLGYA"
FT   gene            <893492..>894628
FT                   /locus_tag="DEHA2F10362g"
FT                   /old_locus_tag="IPF_8240"
FT   CDS_pept        893492..894628
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10362g"
FT                   /old_locus_tag="IPF_8240"
FT                   /product="DEHA2F10362p"
FT                   /note="similar to uniprot|P38071 Saccharomyces cerevisiae
FT                   YBR026C ETR1 2-enoyl thioester reductase member of the
FT                   medium chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66313"
FT                   /db_xref="GOA:Q6BLV6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLV6"
FT                   /protein_id="CAR66313.1"
FT                   /translation="MVKINASAITYTKGGEISKILSGTGFSIDTETLGPKQVVIQALAT
FT                   PINPSDLNQLAGTYASKPNFTSELDTPVPVAIGGNEGLYKVIEVGSDVTSYKNGDWVIP
FT                   KMPSFGTWRTHALVTLDKPENPDPFIKVSSEDDKSIDLTQAATVSINPSTAYQLIDQFI
FT                   KDWDPKGNDWIIQNGGNSQVGKFVVQIAKIRNIKTISVIRDGKPDQDQIVKELLDLGAT
FT                   KVITDKEAESEEYINKIVPGWVNEGKVILALNCVCGKSGSALVSHLTGNHLADYRSPHL
FT                   VTYGGMSGQPLMYSSSESLFKNVTSKAYWLTANTKRNPQSKVDTVKKVLALYKSGDIKP
FT                   VPFNGKEFNIKSTSDDYIKLFLKGIAESKTGKQVIVYN"
FT   gene            complement(<894717..>896144)
FT                   /locus_tag="DEHA2F10384g"
FT                   /old_locus_tag="IPF_8239"
FT   CDS_pept        complement(894717..896144)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10384g"
FT                   /old_locus_tag="IPF_8239"
FT                   /product="DEHA2F10384p"
FT                   /note="weakly similar to ca|CA1332|IPF11716 Candida
FT                   albicans IPF11716 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66314"
FT                   /db_xref="GOA:B5RUD6"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD6"
FT                   /protein_id="CAR66314.1"
FT                   /translation="MGPISHTPTLSKIPNIYNRRSSLGSVNDANKPVSHVQPQKRKILY
FT                   KAKNEKPLNVAELIEDNDDSSLDVFKMYQHKYYLPHNKRISNIAWRIQNKKILALDRQK
FT                   KREDRDIQDKKQDQKSSNDKSDEFDYISQIRKMSQEQEGEGGMATLFENKKHSPYTNSL
FT                   TSDSSLFSGNRSASASTANPSTGDKSNENLLTSYINSLESTFKDDYKLPEKLSKSTKNT
FT                   KFLQCTNCNTKTTPLWRKSNKGDLLCNACGLFYKLHGVLRPLSQPDRKSSVSNDTLTST
FT                   NKTESSKPNSNMGGNSKYDLSPSMISHHHHHHYVDPAEDESRRQANQDQNDDMNIDQFL
FT                   EMDPPGRHTSMSNDNHSGLEMNPPQNRNSTSNNIDEIDMLLNMNLFQSESFVIGNGKSK
FT                   TGVNEQENRNNNSNTNDNSVTNDGYNFDAQGMFYDMQHVGEVGIGDEILADQPSEQGPN
FT                   WNWLDFVSNGDNEMNSS"
FT   gene            <896686..>896943
FT                   /locus_tag="DEHA2F10406g"
FT                   /old_locus_tag="DEHA0F11363g"
FT                   /old_locus_tag="DEHA-IPF8237"
FT                   /old_locus_tag="DEHA-CDS7679.1"
FT   CDS_pept        896686..896943
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10406g"
FT                   /old_locus_tag="DEHA0F11363g"
FT                   /old_locus_tag="DEHA-IPF8237"
FT                   /old_locus_tag="DEHA-CDS7679.1"
FT                   /product="DEHA2F10406p"
FT                   /note="similar to uniprot|Q6MVW1 Neurospora crassa B15B3
FT                   Hypothetical protein B15B3.030"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89158"
FT                   /db_xref="GOA:Q6BLV4"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV4"
FT                   /protein_id="CAG89158.1"
FT                   /translation="MADKVKDINQYNQLKSKYIGLGNADITREEFMTNVNRDIYSSLAQ
FT                   HDNILYYNSVIINEPMELLRQKMIKKMASPIQNNAKKPEN"
FT   gene            complement(<897253..>898083)
FT                   /locus_tag="DEHA2F10428g"
FT                   /old_locus_tag="DEHA0F11385g"
FT                   /old_locus_tag="DEHA-IPF8236"
FT                   /old_locus_tag="DEHA-CDS4509.1"
FT   CDS_pept        complement(897253..898083)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10428g"
FT                   /old_locus_tag="DEHA0F11385g"
FT                   /old_locus_tag="DEHA-IPF8236"
FT                   /old_locus_tag="DEHA-CDS4509.1"
FT                   /product="DEHA2F10428p"
FT                   /note="similar to uniprot|Q7SAH3 Neurospora crassa NCU06977
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89159"
FT                   /db_xref="GOA:Q6BLV3"
FT                   /db_xref="InterPro:IPR013920"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV3"
FT                   /protein_id="CAG89159.2"
FT                   /translation="MAINQPEQLITHKVTTIVSLVLSIYGNLRYLVGRSPFDSDSPFNV
FT                   SNTPFSSNILVTLIYWGILYLLQIIFVSQIFIPAQESARARVEYSQLVGWHFTIFNFAQ
FT                   FIWSMLFARRHFILSEIVLLINFFNILSLYYSHKTYSIKPLSNWILIHLPTTALPLSWL
FT                   FYAIFWNGAVMFHIHKFVGRVVCNVLIWDFLIVPAMFILFYNDYGVGLSSSVLMFGLGL
FT                   GQLLTKAFALQWIFAFVIASILLVLSLTAAVAGSYYVKQDTRITDSEAAPLLSN"
FT   gene            complement(<898315..>900024)
FT                   /locus_tag="DEHA2F10450g"
FT                   /old_locus_tag="IPF_8232"
FT   CDS_pept        complement(898315..900024)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10450g"
FT                   /old_locus_tag="IPF_8232"
FT                   /product="DEHA2F10450p"
FT                   /note="similar to uniprot|Q04792 Saccharomyces cerevisiae
FT                   YMR250W GAD1 Glutamate decarboxylase converts glutamate
FT                   into gamma-aminobutyric acid (GABA) during glutamate
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66315"
FT                   /db_xref="GOA:B5RUD7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD7"
FT                   /protein_id="CAR66315.1"
FT                   /translation="MTLSKHINAEDLESKLLKQTKKTVLDNHEEYIFKYSANATVPKYE
FT                   IPEKSSNSELVYKYISEELSLDGIPTLNLASFVNTNIDDIPLRLASENITKNLADNDEY
FT                   PSLIDIQGRCVTILSNLWNAPSTTDKESGKKVINSIGSATTGSSEAIMMAGLAMKKSWQ
FT                   ARQKANGKSIAEPNILMASCAQVALEKFARYFDVENRIIHINEKSGHLIDTTKIKENID
FT                   ENTIGIFVILGSTFTGAFEPVEEISKLLDEVEKERGIDVKIHVDGASGGFVAPFVYPHL
FT                   KWDFSIDRVISINTSGHKFGLTSAGLGWIIWKDNKYLPDDVRFKLDYLGGVEETFTFNF
FT                   SRPGFPVLFQYYNFLTLGREGYTKIFNSCIQNARLLSNFLEESGYFECLSVIHKGIDKE
FT                   RQAKIFTREHNDSSKHSKKAVVNEEYEPGLPVVAFRFSKEIREKYPDIPQSILSLLLRN
FT                   KGYIIPNYKLSPDEQDIEILRVVVRDTLGLNLLDKLMNEIVSTIELLINATDTITNLST
FT                   KEQSSEKNEMIYSMLLSIASNGGEDLKEIKQQILKDNNEQHRKHAKSYRGTC"
FT   gene            <901293..>901619
FT                   /locus_tag="DEHA2F10472g"
FT                   /old_locus_tag="DEHA0F11440g"
FT                   /old_locus_tag="DEHA-IPF8226"
FT                   /old_locus_tag="DEHA-CDS7084.1"
FT   CDS_pept        901293..901619
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10472g"
FT                   /old_locus_tag="DEHA0F11440g"
FT                   /old_locus_tag="DEHA-IPF8226"
FT                   /old_locus_tag="DEHA-CDS7084.1"
FT                   /product="DEHA2F10472p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV2"
FT                   /protein_id="CAG89162.2"
FT                   /translation="MHSKHPNKAQSLSVIEIALTSVNEINVGCGFTFKLFKVNKKGVEA
FT                   LFKKPINGHDQLIVKVFDPVKAKRDHKNYRAERTDMFNTCRKAYLCEKSAYEILSSSGL
FT                   LNNV"
FT   gene            complement(<902448..>902912)
FT                   /locus_tag="DEHA2F10494g"
FT                   /old_locus_tag="DEHA0F11462g"
FT                   /old_locus_tag="DEHA-IPF8225"
FT                   /old_locus_tag="DEHA-CDS6000.1"
FT   CDS_pept        complement(902448..902912)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10494g"
FT                   /old_locus_tag="DEHA0F11462g"
FT                   /old_locus_tag="DEHA-IPF8225"
FT                   /old_locus_tag="DEHA-CDS6000.1"
FT                   /product="DEHA2F10494p"
FT                   /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
FT                   YPL037C EGD1 Subunit beta1 of the nascent polypeptide-
FT                   associated complex (NAC) involved in protein targeting
FT                   associated with cytoplasmic ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89163"
FT                   /db_xref="GOA:Q6BLV1"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLV1"
FT                   /protein_id="CAG89163.1"
FT                   /translation="MPVDPEKLAKLQKASVAKKVGGSRVKAKKNVKTEQDDTKLIEALG
FT                   KLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQILP
FT                   QLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEEDIPDLIEGQKFDDVE"
FT   gene            <903170..>904648
FT                   /locus_tag="DEHA2F10516g"
FT                   /old_locus_tag="DEHA0F11484g"
FT                   /old_locus_tag="DEHA-IPF8223"
FT                   /old_locus_tag="DEHA-CDS2376.1"
FT   CDS_pept        903170..904648
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10516g"
FT                   /old_locus_tag="DEHA0F11484g"
FT                   /old_locus_tag="DEHA-IPF8223"
FT                   /old_locus_tag="DEHA-CDS2376.1"
FT                   /product="DEHA2F10516p"
FT                   /note="similar to uniprot|Q03795 Saccharomyces cerevisiae
FT                   YMR155W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89164"
FT                   /db_xref="GOA:Q6BLV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV0"
FT                   /protein_id="CAG89164.2"
FT                   /translation="MYIIHRGIKKVNEFLPVTNHWLILFASIPVALSTGTIFVYSVYST
FT                   ELAQRCQLDASQTGSLNISATIGTAFGGLLGGLITDTYGTQLPILVSCVSISLGYKWLY
FT                   DSYRSGPNSNMVLLLFSMFLVGVGSVSGYFSAIKAVTLNFPNYKSSAQSVTIASFAISS
FT                   LLFSFISSRVLKGDIGAFLYFMHVACGLLIMLGFLFIRVDGHFDDKKQYHEGQVECDEM
FT                   TGLLISNQSECEDNSDYLEDNKDLKSMSLKKSLVHPIFWYHYFILSLIQGFGQMYIYSI
FT                   GFILKAIHYYYDNEVSQKSGTSSLQSHQALHVSLIAISSFIGRLSSGPQSDFLVRKLHC
FT                   QRHWILILGLSLMFAGHSINCIDLTYLCSDLRRANKILSLASCIIGYAYGFSFTCYPAI
FT                   ISDLFNMRNYSFLWGTMYTSTTFGLALMTTIFGYYYDLNSTEWDHHVEKYVCDKGSGCY
FT                   KSTFQITSGLCVFTAILVLGYIYTKRSNKPPITL"
FT   gene            <904776..>906518
FT                   /locus_tag="DEHA2F10538g"
FT                   /old_locus_tag="DEHA0F11506g"
FT                   /old_locus_tag="DEHA-IPF8222"
FT                   /old_locus_tag="DEHA-CDS1744.1"
FT   CDS_pept        904776..906518
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10538g"
FT                   /old_locus_tag="DEHA0F11506g"
FT                   /old_locus_tag="DEHA-IPF8222"
FT                   /old_locus_tag="DEHA-CDS1744.1"
FT                   /product="DEHA2F10538p"
FT                   /note="similar to uniprot|P23394 Saccharomyces cerevisiae
FT                   YDR243C PRP28 RNA helicase in the DEAD-box family involved
FT                   in RNA isomerization at the 5' splice site"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89165"
FT                   /db_xref="GOA:Q6BLU9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLU9"
FT                   /protein_id="CAG89165.2"
FT                   /translation="MSKRPISVEELIGKSQSAEVISKPKFLSKSERQKLSLQRNQEIQD
FT                   KKRQQSTVNNGAKKRYNNSIEDNPEPKKINKKLKKGRNFNFDWDEEEDTSNNYQPLVRY
FT                   DNRTNPPDLGLSDMHWSEKQIDDMTTRDWRIFKEDYNITSKGGDIENPLRCWAESKLPA
FT                   KLLNILIKNLGYDSPTPIQRASIPLALNGRDIVGIAETGSGKTLAFLLPLFSYILSVDS
FT                   NYLLYEHQQESNFNKPLGLILAPTRELALQITKEAKLFGDKLNLNVVTIIGGHQYEETV
FT                   HSVRNGVHIVVATPGRLIDSLERGIINLSNCYFFTMDEADKMIDMGFEKSLQSILNYLP
FT                   ASEKLETTIDGKIFNIKKRITLMFTATISPPIEKITKNYLMKPGYLFIGNVGEAVDNIN
FT                   QQFEYFGARQSSDEILDPKKLDKLFSILRFHKDENRNYSIIIFANFKKACEELAYELSR
FT                   KGFSDNTVIHGSKSQEARERAIDSFREGKDKILIATDVAARGIDIPNVSLVVNYQMTKK
FT                   FDEYIHRIGRTGRAGNKGTSCTFIDDGDSEVFLDLKKFLNKGKKKCPEWLLKHSSTQSQ
FT                   ILRD"
FT   gene            complement(<906543..>907562)
FT                   /locus_tag="DEHA2F10560g"
FT                   /old_locus_tag="DEHA0F11528g"
FT                   /old_locus_tag="DEHA-IPF8221"
FT                   /old_locus_tag="DEHA-CDS3811.1"
FT   CDS_pept        complement(906543..907562)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10560g"
FT                   /old_locus_tag="DEHA0F11528g"
FT                   /old_locus_tag="DEHA-IPF8221"
FT                   /old_locus_tag="DEHA-CDS3811.1"
FT                   /product="DEHA2F10560p"
FT                   /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
FT                   YDL209C CWC2 Protein involved in pre-mRNA splicing
FT                   component of a complex containing Cef1p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89166"
FT                   /db_xref="GOA:Q6BLU8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR032297"
FT                   /db_xref="InterPro:IPR034181"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="InterPro:IPR039173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLU8"
FT                   /protein_id="CAG89166.2"
FT                   /translation="MSYREPLGEYDCHIDNTRNMPPDTTIVSKSKKGKPARLQVDPESI
FT                   PDDDRPPQTGNVFNIWFLKWSGGDSSTKNYTKSKFRVNIKKDSGYTKAPSNAPLCLFFA
FT                   RGCCYLGKKCSYYHRLPSDTDYFIPTQDCFGRDKTSDYKDDMNGVGSFSKSNRTLYIGG
FT                   LHMDDKMENTLTKHFQEFGSIDKIRVLHSKACAFVTFRTENEAQFAKEAMQNQSLDGNE
FT                   VLNIRWANEDPNPEAQRQEKRRLEEVTVNTVKNLLDSVSQTERKTKKVTVEVPDEIEET
FT                   ESSSEIKALPSSETSSGLFNNSSLNALKQFQSKKRKIDKPQPKENLPTMLGYSSSDEE"
FT   gene            complement(<911192..>912649)
FT                   /locus_tag="DEHA2F10582g"
FT                   /old_locus_tag="DEHA0F11550g"
FT                   /old_locus_tag="DEHA-IPF8217"
FT                   /old_locus_tag="DEHA-CDS2446.1"
FT   CDS_pept        complement(911192..912649)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10582g"
FT                   /old_locus_tag="DEHA0F11550g"
FT                   /old_locus_tag="DEHA-IPF8217"
FT                   /old_locus_tag="DEHA-CDS2446.1"
FT                   /product="DEHA2F10582p"
FT                   /note="similar to uniprot|P15202 Saccharomyces cerevisiae
FT                   YDR256C CTA1 Catalase A breaks down hydrogen peroxide in
FT                   the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p)
FT                   during fatty acid beta-oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89167"
FT                   /db_xref="GOA:Q6BLU7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU7"
FT                   /protein_id="CAG89167.1"
FT                   /translation="MAPVYTNSNGCPIPEPFATQRVGQHGPLLLQDFNLIDSLAHFDRE
FT                   RIPERVVHAKGSGAYGYFEVTDDISDVCSAAFLDTIGKKTKVLTRFSTVGGESGSADSA
FT                   RDPRGFSTKLYTEEGNLDLVYNNTPVFFIRDPSKFPHFIHTQKRNPETHLKDPTMFWDY
FT                   LTSNQESIHQVMTLFSDRGTPASYREMNGYSGHTYKWSNKKGEWYYVQVHFISDQGVKT
FT                   LTNEEAGELAGSNPDFAQEDLFKEIAKGNAPSWTCYIQTMTQEQAKKAPFSVFDLTKVW
FT                   PHKDYPMRRFGKLVLNENPKNYFAEIEQAAFAPAHTVPYMEASADPVLQSRLFSYADTH
FT                   RHRLGTNYTQIPVNCPITGRVFNPHMRDGGMNVNGNLGSHPNYLATSKPVEFKNFSIQE
FT                   EQEVWEGAACPFHWKCTDKDYSQATALYNVLAKYPNQQKNLAHNVAVHVSGAETHIQDK
FT                   VFDMFAKVHPELSANIKKEALQLSPRK"
FT   gene            <912939..>913037
FT                   /locus_tag="DEHA2F10604g"
FT                   /old_locus_tag="IPF_42390"
FT   CDS_pept        912939..913037
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10604g"
FT                   /old_locus_tag="IPF_42390"
FT                   /product="DEHA2F10604p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66316"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUD8"
FT                   /protein_id="CAR66316.1"
FT                   /translation="MRGALEHHQSRSRRIIEQTLKCGLSSSKTSVS"
FT   gene            complement(<913723..>914880)
FT                   /locus_tag="DEHA2F10626g"
FT                   /old_locus_tag="IPF_8214"
FT   CDS_pept        complement(913723..914880)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10626g"
FT                   /old_locus_tag="IPF_8214"
FT                   /product="DEHA2F10626p"
FT                   /note="similar to uniprot|P53063 Saccharomyces cerevisiae
FT                   YGL246C RAI1 Nuclear protein that binds to and stabilizes
FT                   the exoribonuclease Rat1p required for pre-rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66317"
FT                   /db_xref="GOA:Q6BLU6"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="InterPro:IPR039039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLU6"
FT                   /protein_id="CAR66317.1"
FT                   /translation="MIKTFPLNSRAKTTALKQPKELFSFARDIDGEYIFDSTKVQDENL
FT                   SYYYLPDASVDKQIDLGAGYSNFKKIPEEENLGDFPALLKGVMNYEQSTGTKINSDIIT
FT                   FRGLMTKILTLPYNLKDPLDLHVIVYDGQLFIKNNDEIELKRRQQNNQHEDPSKQEMMK
FT                   KFEYSGYKFEAVSTLPKPWGDCSRQLIEKRNKKVVNNYEQYISVVKTGIGKVKLLLAGE
FT                   VDCLWDYIPEDGKDILPHYVELKTSKVIEAPGQVVNFEKKLFRTWAQSFLIGIRKIVYG
FT                   FRDDNLILRNVEVYNTEEIPIMLKDTINVNTKIVCMNALKWYGAVIEWINNEIPKDADK
FT                   SWSLTYDPGSKSFSIVELMQDSELRNSVITEDFKEWRISLHKTES"
FT   gene            <915047..>917050
FT                   /locus_tag="DEHA2F10648g"
FT                   /old_locus_tag="IPF_8213"
FT   CDS_pept        915047..917050
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10648g"
FT                   /old_locus_tag="IPF_8213"
FT                   /product="DEHA2F10648p"
FT                   /note="some similarities with uniprot|Q12232 Saccharomyces
FT                   cerevisiae YOR154W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89169"
FT                   /db_xref="GOA:Q6BLU5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU5"
FT                   /protein_id="CAG89169.1"
FT                   /translation="MIINDNRLTFLAIHLFITFQITRAELLQTSQSSCLTKSVCNVDSC
FT                   LLDAGNIFKPQTSLSKIDSLNYTTPSAPKSTQISTSTPPSTSISTSISTVLSTLTSIIS
FT                   TTSAEVISSLPENSVVSSSEDLFTEISKSDSGIITDDLNNAHFEVTSDVNSTNSTNTTE
FT                   PFIPVQNYTNKNIQLNQSNETIDECHFLSFEEWKRQKAVDNKQINDSQPQAETIANELV
FT                   PTTSGIDNSTQIPVSLDEDQGKIYKDRFNYASVGCAATIVKTNSHAKGASAILVENKDS
FT                   YLLNQCSSSQKFVVIELCQDILVDTVVIGNFEFFSSNFRKIRISVSDRFPVGSSGMKVL
FT                   GEFEAENIRDVQSFNIENPLIWARYLKLEILSHYGDEFYCPISLIRVYGKTMMEEFKMA
FT                   EGHESFIGGEPEIKNEELVINNSMKDISNFTGINIQNEECRVALPHLGLTEFLKDINST
FT                   ASDYCDAMYPLINEPETTQTIETKTTQESIYKNIMKRLSLLESNASLSLLYIEEQSKLL
FT                   SQAFTNLEKRQSSNFESLINSFNDTMHNQISYFKNAYFSIQVEASKLFKAQENNHQSLL
FT                   EESHHKMTILGNQLKFQKRLSILNTMIIICILSYVVLTRDVYIEDHMYDHFQQPLRTSQ
FT                   NTSGYSNLLDKYKRKNSKRNNRSKRRKPKSTN"
FT   gene            complement(<917129..>919147)
FT                   /locus_tag="DEHA2F10670g"
FT                   /old_locus_tag="IPF_8209"
FT   CDS_pept        complement(917129..919147)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10670g"
FT                   /old_locus_tag="IPF_8209"
FT                   /product="DEHA2F10670p"
FT                   /note="similar to uniprot|P15424 Saccharomyces cerevisiae
FT                   YDR194C MSS116 DEAD-box protein required for efficient
FT                   splicing of mitochondrial Group I and II introns"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66318"
FT                   /db_xref="GOA:B5RUE0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUE0"
FT                   /protein_id="CAR66318.1"
FT                   /translation="MFKLRPVARFLVFRTTSVSRGFTRGFTYSKVQYNEFAKLDNANEH
FT                   ANQVKKVADEVKIENKTESISTQDLAEDGPATFDGLAKTGHVHKDILKAIKLAKFTTLT
FT                   PVQEKSLVPILEENGVVCRAKTGTGKTLAFVIPTLQCALENYDATRGARGKVHALVIAP
FT                   TRDLALQIESEYKKIIQNMPNQAKNKIHMEVHMGGRKTRTGNVAPAIVIATPGRLNDNL
FT                   RHSRFANMFTDLKYRVYDEADRLLDEGFSVTLDDIDDQLKQARSMATNPSASFKSVLFS
FT                   ATVDKSVSKFAKSVMGEDYKFINCVDENEPEAHENIEQTLVKTNNIGESFNGALAYIIN
FT                   NMNNAGFKAMVFLPTVTATDWFYSMLMNAKDKEMYDTQQTRKYGSKLLRLHGKMSQAAR
FT                   DRTVRDYRRLSHGILVCTDVAARGLDFSDVSDVVQMGPSSEVADYIHKIGRTARAGASG
FT                   RSILFLSSSEKNYSKALQSKRGVKFEHEIQYETAEEDKKLVKEIGADVENVESFIPTFL
FT                   GFYKQVGSAYKIAQHDSLSQIIDYYRFLINDPEAKLSVGKGFLRNVISVPPREASLYFD
FT                   VPGGFNFSATNNRSSKRTFMDTSGDKRKNFKRGGFNKNYDDHGSRGYSDKGNYSRQSFG
FT                   TSRNTRNDYSKNNSRDFKKTNNKRDNRWSSGNDEGGW"
FT   gene            <919702..>920445
FT                   /locus_tag="DEHA2F10692g"
FT                   /old_locus_tag="DEHA0F11682g"
FT                   /old_locus_tag="DEHA-IPF8208"
FT                   /old_locus_tag="DEHA-CDS4841.1"
FT   CDS_pept        919702..920445
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10692g"
FT                   /old_locus_tag="DEHA0F11682g"
FT                   /old_locus_tag="DEHA-IPF8208"
FT                   /old_locus_tag="DEHA-CDS4841.1"
FT                   /product="DEHA2F10692p"
FT                   /note="similar to CA4999|IPF2024 Candida albicans IPF2024
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89173"
FT                   /db_xref="InterPro:IPR028095"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU3"
FT                   /protein_id="CAG89173.1"
FT                   /translation="MNPNQQENESGIQKNFLSKIKQNYSNKFSNISLSSSIQNMSIHSD
FT                   HDGNSEDDTLIHNAFVKYFDSKGEPYPEWLGVKTKEQNSRPSNSNSNSHYRSEYQPVYS
FT                   SYNSGGQGASQNQQNQNSGTRSQAPSYFQPQHTPHNASQNTSQHAPQHVPEAEPQRPTY
FT                   TPRSSSRLQDMYNKSRQQSIPGSGYNTQSYPSGPLRTNSSTTGSRLRERMLNTSPSMNG
FT                   LNQATKNNNPNTDSSGNSKATWGRR"
FT   gene            complement(<920477..>921949)
FT                   /locus_tag="DEHA2F10714g"
FT                   /old_locus_tag="DEHA0F11704g"
FT                   /old_locus_tag="DEHA-IPF8207"
FT                   /old_locus_tag="DEHA-CDS2417.1"
FT   CDS_pept        complement(920477..921949)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10714g"
FT                   /old_locus_tag="DEHA0F11704g"
FT                   /old_locus_tag="DEHA-IPF8207"
FT                   /old_locus_tag="DEHA-CDS2417.1"
FT                   /product="DEHA2F10714p"
FT                   /note="some similarities with uniprot|P25366 Saccharomyces
FT                   cerevisiae YCR095C Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts AND similar to
FT                   CA5000|IPF2023 Candida albicans IPF2023 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89174"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU2"
FT                   /protein_id="CAG89174.2"
FT                   /translation="MLVPPDNFGLVEPGIYRCSKLEPEHFPFLETLQLKSLVVLDAEKP
FT                   PRLLKNFIEANNIEIHNLGGLKISNHNHTGANSSSNKDDNEDDANTETSSVSSKTETGV
FT                   YNLGKSEIETVKLTSKSKNDQWMLIERNIIAGAFELLLNKSKHNILLIDSTSTLVGILR
FT                   KIQKWNFNSIINEYRIYSGNSNKSNYYAENFLELLQTELIPFEIDRLNALLKQQEQREE
FT                   QYQQEQRTQAPPYQYGSSKARSIFRSPDFQISGSRKNSIDSSQLEHQFDDENDNESIDD
FT                   EDIDDELLSASPQIPANLLKLAEMRKQDNPRKESIDSTGSDDDKFTPGTSPKYVRSNRN
FT                   NSLNNDMIQYASRGSYERRYSLADHKFSRPGSFSNGNHKFRNQSISSSSPSIRCSFEGS
FT                   SSLVKRLREREDIEKLKDSKHSKSIDIIPEEARLLRENYDYKFYKKLDKYPISFENVSI
FT                   IKLKLPPDNKLPDWFIKNRDCWEENFRILNKV"
FT   gene            complement(<922151..>924700)
FT                   /locus_tag="DEHA2F10736g"
FT                   /old_locus_tag="DEHA0F11726g"
FT                   /old_locus_tag="DEHA-IPF8206"
FT                   /old_locus_tag="DEHA-CDS0709.1"
FT   CDS_pept        complement(922151..924700)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10736g"
FT                   /old_locus_tag="DEHA0F11726g"
FT                   /old_locus_tag="DEHA-IPF8206"
FT                   /old_locus_tag="DEHA-CDS0709.1"
FT                   /product="DEHA2F10736p"
FT                   /note="similar to uniprot|Q01217 Saccharomyces cerevisiae
FT                   YER069W ARG5 6 Bifunctional enzyme with acetylglutamate
FT                   kinase and N-acetyl-gamma-glutamyl-phosphate reductase
FT                   activities catalyzes the second and third steps in the
FT                   biosynthesis of the arginine precursor ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89175"
FT                   /db_xref="GOA:Q6BLU1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041734"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU1"
FT                   /protein_id="CAG89175.2"
FT                   /translation="MLRQVVGRSVVKRLSSVANKEIVGSVSLSNRLRSTKTTTRFYSTR
FT                   STVVQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIITQQLPELASCLAFLYHVG
FT                   LYPIVLHGTGPQINELLENEGVEPEYSDGIRITNPKTMEVVRKCFLEQNLRLVTALEKM
FT                   GVHARPITAGVFGADYLDKDKYQLVGKVNSVNKSPVESAIEAGYLPILTSLAETPSGQL
FT                   LNVNADVAAGELAREFEPLKIVYLNEKGGIINGNTGEKVSMINLDEEYDDLMKESWVKY
FT                   GTKLKIKEIHDLLQHLPRSSSVAIIDVDDLQKELFTDSGAGTLIRRGYKLISRNSLKEF
FT                   GNPDLLRAALLRDPEIKSGKLSVASYLKHLESIEFKSYGDEPLEVLAIVTKNGSRFPKL
FT                   DKFLSSRTGWLNNVTDNIFNSIKKDYKSLYWIVSENDSNLSWYFSKSDGSFSKNGEILF
FT                   WYGLNTEEVSQLINQFDSSSIGSALSSSSESGIFSSPTQKKGLHTMARRSYSSNPNPPI
FT                   REGKNTQKAKVALIGARGYTGQNLINMIDSHPFLELSHVSSRELKGQKLKGYNKDNIVY
FT                   SNLQVEDIKELEKNNEVDVWVMALPNGVCKPFVEAIESIPNNKSKIIDLSADYRFDTTG
FT                   EWVYGLPELNDRNAIASAKKISNPGCYATAAQCAIAPLVSYINGTPSIFGVSGYSGAGT
FT                   KPSPKNDVKFLANNIIPYSLTDHIHEKEISSQLGLDVAFTPHVAQWFQGISHTISIPIK
FT                   PKSLSSREIRNIYQDRYQGEQLITISGEAPLVKDISGKHGVVVGGFAVNSKQDRVVIVA
FT                   TIDNLLKGASTQCLQNINLTMGYGEFEGIPDDLVIRG"
FT   gene            complement(<924904..>927702)
FT                   /locus_tag="DEHA2F10758g"
FT                   /old_locus_tag="DEHA0F11748g"
FT                   /old_locus_tag="DEHA-IPF8205"
FT                   /old_locus_tag="DEHA-CDS0549.1"
FT   CDS_pept        complement(924904..927702)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10758g"
FT                   /old_locus_tag="DEHA0F11748g"
FT                   /old_locus_tag="DEHA-IPF8205"
FT                   /old_locus_tag="DEHA-CDS0549.1"
FT                   /product="DEHA2F10758p"
FT                   /note="weakly similar to CA2838|IPF8339 Candida albicans
FT                   IPF8339 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLU0"
FT                   /protein_id="CAG89176.2"
FT                   /translation="MQESSEEANDSISTSSTSTSLELPEYILRNLTPTKRSNSKDKNHR
FT                   IRKSQIIQSKTLKLKKRSQTIHQKIQNLKLHQEIISNKIAEDLSDNLYRANERRMAFLA
FT                   KRRERARKLQLTSLKLPIVLPLSEEPIACPKNGGNRKEFVVGDIQSIIIIQKRIKKHIL
FT                   LRNINHFKAFQVSTRLTQMTYNETLSLLKPSTEFTKTTVAILRNLNLPDILPQQKYKSF
FT                   LYSLIMIADYKDSLIYHTHSGFNTNISDRNINNLANSVSLLLFKSAETVIHKFSEFIYS
FT                   DLNEIEDPWSLPKLKLCKSWKVYHFLFQIFRSLHFNNCMVIINDALEIVQKQLLASQAI
FT                   EIEMQREKYADNHKYLYKLSQVFKFSGTEWAYFGEDPRSFVNNIKLQVFDKALPERPKV
FT                   KASIEVLEGLDNITESPSNHSIIFERLIFNVPPKIPINKWRKYWVQQYRAEKRMNINNR
FT                   YGIPNTLKSGFFNLNYQNTSSNIYVENVFRDLDMASTHSKYESLRGEKDLHLFSTDFDF
FT                   IVSDIFLILYEYCIKFENINNSEGFDIAITQFRTLKNSYQVAKSSTHKELLQYFKLHFF
FT                   CLSHLASIGPFVLDFVPNACSGFIDILNHLQQVSPNEFEVFINFYEELEILGMNLWVNK
FT                   CKNDSIKKTKSFENVCLFISRKNFKIENGTNSPHLRFPLFYNFLSRYDNDFDRHFLSYS
FT                   SIIDSTFEYPDFESFSVNALSLRYFRHIYINSILGNLWNRNSKYDPDYLTNEFNVFFKE
FT                   EMKVLSIKCRVLLISDCVLHLILNFYSKAEISLNGQHYMKFKGVSIQKMADIIIRYFSE
FT                   NINPPDIGVFISNLIGAHTEEDSNLNIDHLISYVYKEYNTLIEQDGYSLLKRTLTDKFV
FT                   KLINTGPISTEFECLLKGNFTYFTIPTRQIIDEINEILEEIYDLYSPLLNWIYKDIGEP
FT                   TI"
FT   gene            complement(<927958..>929253)
FT                   /locus_tag="DEHA2F10780g"
FT                   /old_locus_tag="DEHA0F11770g"
FT                   /old_locus_tag="DEHA-IPF8204"
FT                   /old_locus_tag="DEHA-CDS2686.1"
FT   CDS_pept        complement(927958..929253)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10780g"
FT                   /old_locus_tag="DEHA0F11770g"
FT                   /old_locus_tag="DEHA-IPF8204"
FT                   /old_locus_tag="DEHA-CDS2686.1"
FT                   /product="DEHA2F10780p"
FT                   /note="similar to CA2839|IPF8336 Candida albicans IPF8336
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89177"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLT9"
FT                   /protein_id="CAG89177.2"
FT                   /translation="MSSTGRYQGPIPTKVSNLNSQYGCACVTKVAPLEELVDDCFKHSI
FT                   DQLNDPHKVYVVKSFARYIVEAHCHENLSFLIEIFKYEYYFDKIINRKENSKTGMREKE
FT                   NCYLNSSLGRSIGDLPYPTKRIEPMFVRKKSSAGVSVRSEDHEPMSVFVSTIDDLDEAP
FT                   EGNEMYNVWDNLMEKNVGDSDTENDSDDEVEEQKSVDQGDAQSEEDLIADQWDLVMGRY
FT                   VHHNSPEQINLSNLSYKKIVEEDRIPNIFHSPQVLLPAKNEVLRLLEENVYHSFVNSYK
FT                   EKDSTTASPLIQPRRAQESPSSLSIDDCDKSRSITKSESNNVSPILTPTNSNVPKLFHK
FT                   MNKSRLLHLSSSTNNLPVDSGSNSSSSSASSLSNILDHLRLNTNHVSSPLNASPIQTPN
FT                   HSQPHSLSTSPLYLKEDKLSKFGKIWRSKKST"
FT   gene            <930343..>930471
FT                   /locus_tag="DEHA2F10802g"
FT                   /old_locus_tag="DEHA0F11792g"
FT                   /old_locus_tag="DEHA-IPF8201"
FT                   /old_locus_tag="DEHA-CDS8402.1"
FT   CDS_pept        930343..930471
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10802g"
FT                   /old_locus_tag="DEHA0F11792g"
FT                   /old_locus_tag="DEHA-IPF8201"
FT                   /old_locus_tag="DEHA-CDS8402.1"
FT                   /product="DEHA2F10802p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89178"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLT8"
FT                   /protein_id="CAG89178.1"
FT                   /translation="MVSSSVTFSDMYFTIRVHAQVAGVGFSGFGCEHTILRSYRIS"
FT   gene            <930802..>935136
FT                   /locus_tag="DEHA2F10824g"
FT   CDS_pept        930802..935136
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10824g"
FT                   /product="DEHA2F10824p"
FT                   /note="some similarities with CA0501|IPF16501 Candida
FT                   albicans IPF16501 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66319"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUE1"
FT                   /protein_id="CAR66319.1"
FT                   /translation="MLSRYFIKPSVPLRYQSCCIRSFACSFATSTTFERAIEYEIDLIS
FT                   LKKTTGGKRDPSCAKFKFNPFNLTRLESKLINPDIVTRCVNDVRKDPLDYKNYPSNDSK
FT                   GHLEFIERYNVELRKFLQFVQQTCEREIKTFDQLTSQEIFSSLNVFRGHCQKGKIEGVN
FT                   KYNYTSYSYMFERLSKYLRYDSSFPTFLQSNLFNDFENNKIIMDLYKFGIGNFMNELES
FT                   LSKEFSLEKMTKAEISSAIESTIKQYDDFIQLSEASNDYSETFFKGCIQIQRYRHLKSI
FT                   LDSLPIESSHLLYVLNNENSKLIIGKIKDLSGEKESFKKIIKRHQAELNFIRFLSKGSF
FT                   ESFARLASFLYKLSISTDDELTQTISLTLLEKLTPFFTNGTLQDSDLRIIELEGIPPAT
FT                   ISSGLRENYEFSVLAKIELFNFVDELKLLRAFSYKKFGDLVVADTFEELDKLIGTFKGS
FT                   SVILDNLQVLELELCTLSRYITWDLSVLDKLVDNPSWVSYLTEVYEAEFENSGIQFDFT
FT                   KRVPTVPQYTQIPDDLFLHEFVNELKTLRTDLLGGFNFKLFSPSGVLSILEHAIEEAQT
FT                   GYILSPSLTSDTVDDFIKLNSKLWKLFQINGGNTGILDTLIHSQSIFESVAKKSKSVQR
FT                   KEDYTQIPEDIELHKYCKELDILRYELGCPYKDCTVSQIKSFLNDKIDGVLNNSKIQSS
FT                   ISKENIENFIELEERLNKLFRISNYPAILDTLLHSQSVFEGFEKKKKQPNIYTQIPDDL
FT                   DLHKFSNELEIFREDELKGSYSEYSADQIESLMNKRMAEINNGTENFNVTSRMNKANLH
FT                   EFMRLGRRLARLFDINGGNTEILDTLIQSQSIFDKFEKSKTTSNKFTSPYKQIPDTFIL
FT                   EEYMLELIQLRTELGGSDFKSFDCKIILETLKKMLTNKKKFNLDKRITYSKLYRNISYL
FT                   FKHNGNRSFILDNVLVSGEVFAKFEADKAFNKSQNPENLIISQITKFVNEFDVSLNQLF
FT                   NQLRLNGASDFIGIDESGFDKYISEFLLSNKDNYQYSVYLDMIDKIKFFNSKINNYPFF
FT                   LYNLVQKRNAGEIINDRLVKSVHEESERVMHNEVNLNESKRKISVPISEAANRFDIHDF
FT                   TEENTKPRQEYTNSASLLASLSKQKSAANLESNGMPKAKNSTDDLLESELEIKDAVAFA
FT                   LNNNQNENRDENAQLQDLTTEKVRETFKHYRPPSPSPIPTSQIDKSSIESFLNNAKKEK
FT                   DLAKERKFRESKAYEWSKSMYNTRRSLESHNFFDPIVPISKMSKESKELFFPILNNGEA
FT                   EYLLLTIGGQTISSKENPLGKNSSPQNMFTILNKFSEEDLGRFIKNVNKLQKNNWRLIG
FT                   GGSGSENEKMLVLTRNKTAKKDVYLARIKTIFATTGAVFLVLVSLNLWLDDGSANPIDV
FT                   STPMESHTPNNDVAKETDNKLDIRNTSQEDPSTWKKLLWCIK"
FT   gene            complement(<935356..>935895)
FT                   /locus_tag="DEHA2F10846g"
FT                   /old_locus_tag="DEHA0F11836g"
FT                   /old_locus_tag="DEHA-IPF8198"
FT                   /old_locus_tag="DEHA-CDS5610.1"
FT   CDS_pept        complement(935356..935895)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10846g"
FT                   /old_locus_tag="DEHA0F11836g"
FT                   /old_locus_tag="DEHA-IPF8198"
FT                   /old_locus_tag="DEHA-CDS5610.1"
FT                   /product="DEHA2F10846p"
FT                   /note="weakly similar to uniprot|Q7S484 Neurospora crassa
FT                   NCU06088 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89180"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="InterPro:IPR038356"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLT6"
FT                   /protein_id="CAG89180.2"
FT                   /translation="MPLAHNLNKVTKNLSKSTGQMHVKGRKFKQLNRATLRDQKITTKK
FT                   LKYQEQKDRELAGIQFMKDRVYEYSDQEVFSLEQMKSFIEDYIGRNDEELKQLKDERRP
FT                   GRPATSRQSHLEVVIGDEKQVYSTGFKIPDLSNKETVERVKLWNGTSGGTTVMKFIHVS
FT                   KDMKELPVKEEVMKDN"
FT   gene            <936199..>936714
FT                   /locus_tag="DEHA2F10868g"
FT                   /old_locus_tag="DEHA0F11858g"
FT                   /old_locus_tag="DEHA-IPF8196"
FT                   /old_locus_tag="DEHA-CDS5726.1"
FT   CDS_pept        936199..936714
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10868g"
FT                   /old_locus_tag="DEHA0F11858g"
FT                   /old_locus_tag="DEHA-IPF8196"
FT                   /old_locus_tag="DEHA-CDS5726.1"
FT                   /product="DEHA2F10868p"
FT                   /note="weakly similar to uniprot|P12962 Saccharomyces
FT                   cerevisiae YOR276W CAF20 Phosphoprotein of the mRNA cap-
FT                   binding complex involved in translational control repressor
FT                   of cap-dependent translation initiation competes with eIF4G
FT                   for binding to eIF4E"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89181"
FT                   /db_xref="GOA:Q6BLT5"
FT                   /db_xref="InterPro:IPR031456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT5"
FT                   /protein_id="CAG89181.1"
FT                   /translation="MAKYTEEQLYEIKEEAYTPQPDVLDAFNKMVDHVKEHAAAEFEKH
FT                   KNLKWSNGDTYIDENGNERPYHHMNKRRGSRSGNKPNLRKKSTDGIKVDDDGWATLTKP
FT                   KKSFGAEDGVEERNKFRESVKDIKVKPNNKNLGSSKAVDPRDAIAEKHTNTFNAFEALG
FT                   DGDDSDDE"
FT   gene            complement(<936927..>939593)
FT                   /locus_tag="DEHA2F10890g"
FT                   /old_locus_tag="IPF_8194"
FT   CDS_pept        complement(936927..939593)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10890g"
FT                   /old_locus_tag="IPF_8194"
FT                   /product="DEHA2F10890p"
FT                   /note="weakly similar to uniprot|Q7SHX8 Neurospora crassa
FT                   NCU00675 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66320"
FT                   /db_xref="GOA:Q6BLT4"
FT                   /db_xref="InterPro:IPR039786"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT4"
FT                   /protein_id="CAR66320.1"
FT                   /translation="MPIFRPKHQKLILQCYPPGKGVDKKPNPSELSYLLYYASTRRVKL
FT                   EKVVTFLDRKTTSDAKHNRAGNLQVTLTIISSLIEECSENLNVFASFVCSILKSVLQSK
FT                   DLSLCKHAIQTYGVLCSKLDGGLFSGDKVFVDSFGSLSQNLINIGSENSKKRGPNNLEW
FT                   QMISLMTCRYISNCLGYNSKFSKKFIEICIPILTETVHANNKQSNLLTILKSNVNIEDE
FT                   NHHLGRIASTKTNQTSRKAQQDLDNDAVKDSDLNEEALRGLKALFSTSLTSQISEATRA
FT                   IVKNNYATTIDPIWGCTFLEMCTTWIPVQLRFITLSTVLSSLTSLSNKSTKKTSNYPIQ
FT                   LLYANYCLGLVSSDVNMIGLSISDVIQQILFLQANLLLSQSHYFQEEDVKKLSMIYSNC
FT                   ICNLSTHIYYFDQVPDSIREILIKVVSILENSVISGNANSSGVYRFIITLLEDISIIFD
FT                   LLQTKPSNISRNHVSLEDWDLSLILLSSEIGLNPTKDQKPLFSYEQITDIQFKYLRVFG
FT                   YFLNNELVTRNENMETGAINSIESFNVGGDHLQPDYNNYISDPGNFIAHFLGYVDKFFS
FT                   GQSLINIDNASLLQKVLKNMILILGINFINNFVPFFFYWQLPLNPNLVDDNTRIKDTLG
FT                   YTLIYHSLIKMDKIYELNYVRESEFFNSLLGDINYRKLNKLWVNGLQSKEEDAVLDNHH
FT                   ALGHRDENGTLRFNPTKKNLEDFVIGNAFTLSWINPHRPLILDIVNNYIPKKENNQNVL
FT                   SDMSDESSIIENSSYHTSARQNGFGLGLGNANDISSIHSGLLFHQSQNVNMKNAFSNGN
FT                   ETSNGSIYTSDRQYNTPRVSDLKDSVLMKKKPGVAFNEHYNSDTTPGSILSKQMVTSDI
FT                   DSILEGLDIDDDSEIIV"
FT   gene            <939764..>941786
FT                   /pseudo
FT                   /locus_tag="DEHA2F10901g"
FT                   /old_locus_tag="IPF_8192"
FT                   /old_locus_tag="IPF_42377"
FT                   /note="similar to uniprot|Q03654 Saccharomyces cerevisiae
FT                   YMR213W CEF1 Essential splicing factor"
FT   gene            <941905..>944205
FT                   /locus_tag="DEHA2F10912g"
FT                   /old_locus_tag="DEHA0F11924g"
FT                   /old_locus_tag="DEHA-IPF8191"
FT                   /old_locus_tag="DEHA-CDS0926.1"
FT   CDS_pept        941905..944205
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10912g"
FT                   /old_locus_tag="DEHA0F11924g"
FT                   /old_locus_tag="DEHA-IPF8191"
FT                   /old_locus_tag="DEHA-CDS0926.1"
FT                   /product="DEHA2F10912p"
FT                   /note="weakly similar to uniprot|Q12033 Saccharomyces
FT                   cerevisiae YOR275C RIM20 Protein involved in proteolytic
FT                   activation of Rim101p in response to alkaline pH"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89184"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT2"
FT                   /protein_id="CAG89184.2"
FT                   /translation="MNTNLLYIPYRETDIIDLGNELRNIIKMEYFQPSSNFDRDLQAVR
FT                   NLRNNISNLKNEQVNNNDETVCVQYYHQLSNVIKKFPDECVEFSWYGTLGYGRSGPTRS
FT                   RSLRIEQLNILYQLGSYFSQAALMESRYSDEGLKKSCSYLQAAAGCFNSMILQIQKENE
FT                   KETGMIRIPRDLQPETLQFLKSLMIAQAQETIWQKSLASGMKDSVIARLSIQTSEYYST
FT                   AAKYGNSSEFIKLEWINHVTVKQFHFKAAAHYRVSILNHEGFKYGEQVASLQVALSSCD
FT                   SAFRKKKYVNDFVIEDLQGLTETIKSTLRVAEKDNDLVYLKPVPKENDLAPIPGASLVK
FT                   PILPPAIESFDDSSVLFKELLPYLIVQVGQAYRERQDSFIRDSFIDPIQSLNKIMYKFI
FT                   TERNLPASIDTIQKPENLPESIIQHSQEIISYGGTKLIEDSLNEIAKLTLESRHILEGC
FT                   QERLKIEADEDDIMRERQGSQRWARPKSSEASSEFINKINKMEQYLDQAKEGDQFIISQ
FT                   YHEIEPYLQLYCGGYKELIQFIPNSTYVKLDTKINEIIIKLRELINEVSRIENQRKQFL
FT                   TRIEIKARNNNILPSIIDSFKKKQRKLYEENAAIDERSFEDVYAKHITMFNSDLRFLED
FT                   SKHAQIALEGNIDDLNQEFESEYQHTNNESQYKRQEVLQTLENVYTKYLELISNLNEGS
FT                   KFYSDFIIKSNSVLKECDEYVYHRRVEGRELEMFLNNQAVPVESVGSQQSAPDFPPQPM
FT                   GGTWNPNNGIKFG"
FT   gene            <944309..>945793
FT                   /locus_tag="DEHA2F10934g"
FT                   /old_locus_tag="DEHA0F11946g"
FT   CDS_pept        join(944309..944410,944468..945793)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10934g"
FT                   /old_locus_tag="DEHA0F11946g"
FT                   /product="DEHA2F10934p"
FT                   /note="similar to uniprot|P07884 Saccharomyces cerevisiae
FT                   YOR274W MOD5 Delta 2-isopentenyl pyrophosphate:tRNA
FT                   isopentenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89185"
FT                   /db_xref="GOA:Q6BLT1"
FT                   /db_xref="InterPro:IPR001177"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030666"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLT1"
FT                   /protein_id="CAG89185.2"
FT                   /translation="MIIRYLRYFKNLMMTTPKKNIVTIVGTTGVGKSQFSIELAKAING
FT                   EIINADSMQVYKRLDIITNKHPVEEREGITHHVMDHVNWNEEYFIHRFSKEANNAIEDI
FT                   HNRGKIPIIIGGTHYYLQNLLFKNKTVGESSSSSKLTKELTNEDIELLDGPVNEIFNKL
FT                   QQIDPIIAEKFHPEDKRKLRRALEIYITTGQKPSEIYHEQKLDELEDTSLKYNTLLFWV
FT                   YSDPDILKDRLDKRVDRMMEIGALNEINELYGVYKSQVQVPDCTTGIWQVIGFKEFLPW
FT                   LEFAGSSNKQEASRLFNEGIDRMKIRTRQYAKYQVKWIKKLLAVELNKETRFNFKYGGK
FT                   LYLLDATDLGSWDEKVREVGLNIASQFLTTGPTSVTHPEAPAHLQDIFPSNSFLDNFNS
FT                   NKKLGSEKNWKHYECSVCKDKQGKNLIAVGEESWQIHLKSRRHKRQLGSGERKRKHEQM
FT                   INQYKQKTPTEEDNSSI"
FT   gene            <946306..>946485
FT                   /locus_tag="DEHA2F10956g"
FT                   /old_locus_tag="DEHA0F11968g"
FT                   /old_locus_tag="DEHA-IPF8188"
FT   CDS_pept        946306..946485
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10956g"
FT                   /old_locus_tag="DEHA0F11968g"
FT                   /old_locus_tag="DEHA-IPF8188"
FT                   /product="DEHA2F10956p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89186"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLT0"
FT                   /protein_id="CAG89186.2"
FT                   /translation="MLKFLYPELRSLEQPSASGIIPELITQEKPRNFVLNNCMAKKICR
FT                   CSSRCLRLQFTYSL"
FT   gene            complement(<946787..>947920)
FT                   /locus_tag="DEHA2F10978g"
FT                   /old_locus_tag="DEHA0F11990g"
FT                   /old_locus_tag="DEHA-IPF8187"
FT                   /old_locus_tag="DEHA-CDS3385.1"
FT   CDS_pept        complement(946787..947920)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10978g"
FT                   /old_locus_tag="DEHA0F11990g"
FT                   /old_locus_tag="DEHA-IPF8187"
FT                   /old_locus_tag="DEHA-CDS3385.1"
FT                   /product="DEHA2F10978p"
FT                   /note="similar to CA1081|IPF14797.3 Candida albicans
FT                   IPF14797.3 unknown function 3-prime end"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLS9"
FT                   /protein_id="CAG89187.2"
FT                   /translation="MANVETKKNSYSEMAPMPMVTPESESEILLPPLPNDETGTVPSSI
FT                   MSDHKASVATSMSNESCVSLELDTTGKESSFNEFVQNPKYELNSPSLNIDPLFANLALN
FT                   EAPQMADQTTTQSNNTSPLKRLKNLKKGIRKLSLSKMNAPSLNVSVSNTSSSVRPGVSP
FT                   LTTTEDTIDSFSSASTIDSLHSAAKVRKSSLITPMTTPIGSPVGSPIITLSENLSGSSK
FT                   NIDDFERNFFRNLNSNDSTTEVSSMADLTKLEDLINYSNFLNHSKVQVIDAFELTKERL
FT                   IKFGWCSDDDLNNLQFQKDSSLSQIDTRILQLEKKLNKQYNTSILLCSNNKVQKKTNSI
FT                   SSSISSIDNLNYASENSKASSISLKNLESRCFSYPDF"
FT   gene            <948550..>948870
FT                   /locus_tag="DEHA2F11000g"
FT                   /old_locus_tag="DEHA0F12012g"
FT                   /old_locus_tag="DEHA-IPF8185"
FT                   /old_locus_tag="DEHA-CDS7142.1"
FT   CDS_pept        948550..948870
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F11000g"
FT                   /old_locus_tag="DEHA0F12012g"
FT                   /old_locus_tag="DEHA-IPF8185"
FT                   /old_locus_tag="DEHA-CDS7142.1"
FT                   /product="DEHA2F11000p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLS8"
FT                   /protein_id="CAG89188.2"
FT                   /translation="MYCLAGFTEDPIRRSTGRGTQKYNSDERATGWQVERRSPSVVEPG
FT                   SPQIVSATVDEIDSVGDYRCLGHYRWYSRRSQYVAMLTLIKFKMVSADRETAASLEYRL
FT                   EA"
FT   gene            complement(<950024..>950965)
FT                   /locus_tag="DEHA2F11022g"
FT                   /old_locus_tag="DEHA0F12034g"
FT                   /old_locus_tag="DEHA-IPF8184"
FT                   /old_locus_tag="DEHA-CDS4089.1"
FT   CDS_