(data stored in ACNUC31108 zone)

EMBL: CR457108

ID   CR457108; SV 1; linear; mRNA; STD; HUM; 717 BP.
XX
AC   CR457108;
XX
DT   03-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834E077D for gene
DE   TM4SF7, transmembrane 4 superfamily member 7; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-717
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-717
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   ;
RL   Submitted (03-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 53aedae5036e2d9395a76df4e453fdf2.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   RZPD; RZPDo834E077D, ORFNo 1836
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E077D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC (ATG).
CC   The last base of the last coding triplett has been changed to T,
CC   which might lead to an amino acid change at the C terminus of the
CC   polypeptide.
CC   The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att.
CC   Compared to the reference sequence NM_003271 we did not find any
CC   amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..717
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834E077D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..717
FT                   /codon_start=1
FT                   /gene="TM4SF7"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000267958.12"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="CAG33389.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 717 BP; 116 A; 230 C; 211 G; 160 T; 0 other;
     atggcgcgcg cctgcctcca ggccgtcaag tacctcatgt tcgccttcaa cctgctcttc        60
     tggctgggag gctgtggcgt gctgggtgtc ggcatctggc tggccgccac acaggggagc       120
     ttcgccacgc tgtcctcttc cttcccgtcc ctgtcggctg ccaacctgct catcatcacc       180
     ggcgcctttg tcatggccat cggcttcgtg ggctgcctgg gtgccatcaa ggagaacaag       240
     tgcctcctgc tcactttctt cctgctgctg ctgctggtgt tcctgctgga ggccaccatc       300
     gccatcctct tcttcgccta cacggacaag attgacaggt atgcccagca agacctgaag       360
     aaaggcttgc acctgtacgg cacgcagggc aacgtgggcc tcaccaacgc ctggagcatc       420
     atccagaccg acttccgctg ctgtggcgtc tccaactaca ctgactggtt cgaggtgtac       480
     aacgccacgc gggtacctga ctcctgctgc ttggagttca gtgagagctg tgggctgcac       540
     gcccccggca cctggtggaa ggcgccgtgc tacgagacgg tgaaggtgtg gcttcaggag       600
     aacctgctgg ctgtgggcat ctttgggctg tgcacggcgc tggtgcagat cctgggcctg       660
     accttcgcca tgaccatgta ctgccaagtg gtcaaggcag acacctactg cgcttaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page