(data stored in ACNUC8465 zone)

EMBL: CR536514

ID   CR536514; SV 1; linear; mRNA; STD; HUM; 1044 BP.
XX
AC   CR536514;
XX
DT   23-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834D0920D for gene
DE   MAP2K3, mitogen-activated protein kinase kinase 3; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1044
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1044
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 53cbc0e94943c053b37534d29383940f.
DR   Ensembl-Gn; ENSG00000034152; homo_sapiens.
DR   Ensembl-Tr; ENST00000342679; homo_sapiens.
XX
CC   RZPD; RZPDo834D0920D, ORFNo 3078
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0920D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is a part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att
CC   Compared to the reference sequence NM_145109 (gi21618348)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1044
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834D0920D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1044
FT                   /codon_start=1
FT                   /gene="MAP2K3"
FT                   /db_xref="GOA:Q6FI23"
FT                   /db_xref="H-InvDB:HIT000268451.14"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FI23"
FT                   /protein_id="CAG38752.1"
FT                   /translation="MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLD
FT                   SRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQ
FT                   KRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPE
FT                   DILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKT
FT                   MDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQV
FT                   VEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVK
FT                   EILGEDS"
XX
SQ   Sequence 1044 BP; 249 A; 298 C; 300 G; 197 T; 0 other;
     atggagtcgc ccgcctcgag ccagcccgcc agcatgcccc agtccaaagg aaaatccaag        60
     aggaagaagg atctacggat atcctgcatg tccaagccac ccgcacccaa ccccacaccc       120
     ccccggaacc tggactcccg gaccttcatc accattggag acagaaactt tgaggtggag       180
     gctgatgact tggtgaccat ctcagaactg ggccgtggag cctatggggt ggtagagaag       240
     gtgcggcacg cccagagcgg caccatcatg gccgtgaagc ggatccgggc caccgtgaac       300
     tcacaggagc agaagcggct gctcatggac ctggacatca acatgcgcac ggtcgactgt       360
     ttctacactg tcaccttcta cggggcacta ttcagagagg gagacgtgtg gatctgcatg       420
     gagctcatgg acacatcctt ggacaagttc taccggaagg tgctggataa aaacatgaca       480
     attccagagg acatccttgg ggagattgct gtgtctatcg tgcgggccct ggagcatctg       540
     cacagcaagc tgtcggtgat ccacagagat gtgaagccct ccaatgtcct tatcaacaag       600
     gagggccatg tgaagatgtg tgactttggc atcagtggct acttggtgga ctctgtggcc       660
     aagacgatgg atgccggctg caagccctac atggcccctg agaggatcaa cccagagctg       720
     aaccagaagg gctacaatgt caagtccgac gtctggagcc tgggcatcac catgattgag       780
     atggccatcc tgcggttccc ttacgagtcc tgggggaccc cgttccagca gctgaagcag       840
     gtggtggagg agccgtcccc ccagctccca gccgaccgtt tctcccccga gtttgtggac       900
     ttcactgctc agtgcctgag gaagaacccc gcagagcgta tgagctacct ggagctgatg       960
     gagcacccct tcttcacctt gcacaaaacc aagaagacgg acattgctgc cttcgtgaag      1020
     gagatcctgg gagaagactc atag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page