(data stored in ACNUC8465 zone)

EMBL: CR536564

ID   CR536564; SV 1; linear; mRNA; STD; HUM; 1200 BP.
XX
AC   CR536564;
XX
DT   23-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834E1022D for gene
DE   MAP2K4, mitogen-activated protein kinase kinase 4; complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1200
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-1200
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; ad2580c2e6416b9b44ffd6e5f7338bc2.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   RZPD; RZPDo834E1022D, ORFNo 3171
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1022D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is a part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: (stop)GACCCAGCTTTCTT..att
CC   Compared to the reference sequence NM_003010 (gi24497520)
CC   we found AA exchange(s) at position (first base of changed triplet):
CC   352(lys->arg)
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1200
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834E1022D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1200
FT                   /codon_start=1
FT                   /gene="MAP2K4"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000268500.13"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="CAG38801.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNRMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 1200 BP; 362 A; 259 C; 284 G; 295 T; 0 other;
     atggcggctc cgagcccgag cggcggcggc ggctccgggg gcggcagcgg cagcggcacc        60
     cccggccccg tagggtcccc ggcgccaggc cacccggccg tcagcagcat gcagggtaaa       120
     cgcaaagcac tgaagttgaa ttttgcaaat ccacctttca aatctacagc aaggtttact       180
     ctgaatccca atcctacagg agttcaaaac ccacacatag agagactgag aacacacagc       240
     attgagtcat caggaaaact gaagatctcc cctgaacaac actgggattt cactgcagag       300
     gacttgaaag accttggaga aattggacga ggagcttatg gttctgtcaa cagaatggtc       360
     cacaaaccaa gtgggcaaat aatggcagtt aaaagaattc ggtcaacagt ggatgaaaaa       420
     gaacaaaaac aacttcttat ggatttggat gtagtaatgc ggagtagtga ttgcccatac       480
     attgttcagt tttatggtgc actcttcaga gagggtgact gttggatctg tatggaactc       540
     atgtctacct cgtttgataa gttttacaaa tatgtatata gtgtattaga tgatgttatt       600
     ccagaagaaa ttttaggcaa aatcacttta gcaactgtga aagcactaaa ccacttaaaa       660
     gaaaacttga aaattattca cagagatatc aaaccttcca atattcttct ggacagaagt       720
     ggaaatatta agctctgtga cttcggcatc agtggacagc ttgtggactc tattgccaag       780
     acaagagatg ctggctgtag gccatacatg gcacctgaaa gaatagaccc aagcgcatca       840
     cgacaaggat atgatgtccg ctctgatgtc tggagtttgg ggatcacatt gtatgagttg       900
     gccacaggcc gatttcctta tccaaagtgg aatagtgtat ttgatcaact aacacaagtc       960
     gtgaaaggag atcctccgca gctgagtaat tctgaggaaa gggaattctc cccgagtttc      1020
     atcaactttg tcaacttgtg ccttacgaag gatgaatcca aaaggccaaa gtataaagag      1080
     cttctgaaac atccctttat tttgatgtat gaagaacgtg ccgttgaggt cgcatgctat      1140
     gtttgtaaaa tcctggatca aatgccagct actcccagct ctcccatgta tgtcgattga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page