(data stored in ACNUC31108 zone)

EMBL: CR541877

ID   CR541877; SV 1; linear; mRNA; STD; HUM; 843 BP.
XX
AC   CR541877;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834B0333D for gene
DE   CD37, CD37 antigen; complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-843
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-843
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 25dfe3e8636c8267b5380e6d55e25c4e.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
XX
CC   RZPD; RZPDo834B0333D, ORFNo 3853
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0333D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu):
CC   FLH130845.01L
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_001774 (GI:4502662)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..843
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834B0333D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>843
FT                   /codon_start=1
FT                   /gene="CD37"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000268747.12"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="CAG46675.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
FT                   "
XX
SQ   Sequence 843 BP; 156 A; 273 C; 226 G; 188 T; 0 other;
     atgtcagccc aggagagctg cctcagcctc atcaagtact tcctcttcgt tttcaacctc        60
     ttcttcttcg tcctcggcag cctgatcttc tgcttcggca tctggatcct catcgacaag       120
     accagcttcg tgtcctttgt gggcttggcc ttcgtgcctc tgcagatctg gtccaaagtc       180
     ctggccatct caggaatctt caccatgggc atcgccctcc tgggttgtgt gggggccctc       240
     aaggagctcc gctgcctcct gggcctgtat tttgggatgc tgctgctcct gtttgccaca       300
     cagatcaccc tgggaatcct catctccact cagcgggccc agctggagcg aagcttgcgg       360
     gacgtcgtag agaaaaccat ccaaaagtac ggcaccaacc ccgaggagac cgcggccgag       420
     gagagctggg actatgtgca gttccagctg cgctgctgcg gctggcacta cccgcaggac       480
     tggttccaag tcctcatcct gagaggtaac gggtcggagg cgcaccgcgt gccctgctcc       540
     tgctacaact tgtcggcgac caacgactcc acaatcctag ataaggtgat cttgccccag       600
     ctcagcaggc ttggacacct ggcgcggtcc agacacagtg cagacatctg cgctgtccct       660
     gcagagagcc acatctaccg cgagggctgc gcgcagggcc tccagaagtg gctgcacaac       720
     aaccttattt ccatagtggg catttgcctg ggcgtcggcc tactcgagct cgggttcatg       780
     acgctctcga tattcctgtg cagaaacctg gaccacgtct acaaccggct cgctcgatac       840
     cgt                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page