(data stored in ACNUC31108 zone)

EMBL: CR542096

ID   CR542096; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   CR542096;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834C0837D for gene
DE   CD63, CD63 antigen (melanoma 1 antigen); complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-714
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; b70bd10356a517ae1ac3942eb5bc235c.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
DR   EuropePMC; PMC6442110; 30949308.
XX
CC   RZPD; RZPDo834C0837D, ORFNo 4473
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0837D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu):
CC   FLH131186.01L
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_001780 (GI:34328936)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834C0837D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>714
FT                   /codon_start=1
FT                   /gene="CD63"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000268965.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="CAG46893.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
XX
SQ   Sequence 714 BP; 147 A; 149 C; 220 G; 198 T; 0 other;
     atggcggtgg aaggaggaat gaaatgtgtg aagttcttgc tctacgtcct cctgctggcc        60
     ttttgcgcct gtgcagtggg actgattgcc gtgggtgtcg gggcacagct tgtcctgagt       120
     cagaccataa tccagggggc tacccctggc tctctgttgc cagtggtcat catcgcagtg       180
     ggtgtcttcc tcttcctggt ggcttttgtg ggctgctgcg gggcctgcaa ggagaactat       240
     tgtcttatga tcacgtttgc catctttctg tctcttatca tgttggtgga ggtggccgca       300
     gccattgctg gctatgtgtt tagagataag gtgatgtcag agtttaataa caacttccgg       360
     cagcagatgg agaattaccc gaaaaacaac cacactgctt cgatcctgga caggatgcag       420
     gcagatttta agtgctgtgg ggctgctaac tacacagatt gggagaaaat cccttccatg       480
     tcgaagaacc gagtccccga ctcctgctgc attaatgtta ctgtgggctg tgggattaat       540
     ttcaacgaga aggcgatcca taaggagggc tgtgtggaga agattggggg ctggctgagg       600
     aaaaatgtgc tggtggtagc tgcagcagcc cttggaattg cttttgtcga ggttttggga       660
     attgtctttg cctgctgcct cgtgaagagt atcagaagtg gctacgaggt gatg             714
//

If you have problems or comments...

PBIL Back to PBIL home page