(data stored in ACNUC1829 zone)

EMBL: CR542098

ID   CR542098; SV 1; linear; mRNA; STD; HUM; 759 BP.
XX
AC   CR542098;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834A1037D for gene
DE   CD151, CD151 antigen; complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-759
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-759
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 25b54dfe346948a437391a9674279b5c.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
XX
CC   RZPD; RZPDo834A1037D, ORFNo 4479
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1037D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu):
CC   FLH131194.01L
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_004357 (GI:34328913)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..759
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834A1037D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>759
FT                   /codon_start=1
FT                   /gene="CD151"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000268967.12"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="CAG46895.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
XX
SQ   Sequence 759 BP; 151 A; 217 C; 229 G; 162 T; 0 other;
     atgggtgagt tcaacgagaa gaagacaaca tgtggcaccg tttgcctcaa gtacctgctg        60
     tttacctaca attgctgctt ctggctggct ggcctggctg tcatggcagt gggcatctgg       120
     acgctggccc tcaagagtga ctacatcagc ctgctggcct caggcaccta cctggccaca       180
     gcctacatcc tggtggtggc gggcactgtc gtcatggtga ctggggtctt gggctgctgc       240
     gccaccttca aggagcgtcg gaacctgctg cgcctgtact tcatcctgct cctcatcatc       300
     tttctgctgg agatcatcgc tggtatcctc gcctacgcct actaccagca gctgaacacg       360
     gagctcaagg agaacctgaa ggacaccatg accaagcgct accaccagcc gggccatgag       420
     gctgtgacca gcgctgtgga ccagctgcag caggagttcc actgctgtgg cagcaacaac       480
     tcacaggact ggcgagacag tgagtggatc cgctcacagg aggccggtgg ccgtgtggtc       540
     ccagacagct gctgcaagac ggtggtggct ctttgtggac agcgagacca tgcctccaac       600
     atctacaagg tggagggcgg ctgcatcacc aagttggaga ccttcatcca ggagcacctg       660
     agggtcattg gggctgtggg gatcggcatt gcctgtgtgc aggtctttgg catgatcttc       720
     acgtgctgcc tgtacaggag tctcaagctg gagcactac                              759
//

If you have problems or comments...

PBIL Back to PBIL home page