(data stored in SCRATCH zone)

EMBL: CR542164

ID   CR542164; SV 1; linear; mRNA; STD; HUM; 306 BP.
XX
AC   CR542164;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834C0524D for gene
DE   S100A7, S100 calcium binding protein A7 (psoriasin 1); complete cds, incl.
DE   stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-306
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-306
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 2fa6c6440d1889295a14871149c4ef8d.
DR   Ensembl-Gn; ENSG00000143556; homo_sapiens.
DR   Ensembl-Tr; ENST00000368722; homo_sapiens.
DR   Ensembl-Tr; ENST00000368723; homo_sapiens.
XX
CC   RZPD; RZPDo834C0524D, ORFNo 4820
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0524D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned incl. stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence BC034687
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834C0524D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..306
FT                   /codon_start=1
FT                   /gene="S100A7"
FT                   /db_xref="GOA:P31151"
FT                   /db_xref="H-InvDB:HIT000269033.13"
FT                   /db_xref="HGNC:HGNC:10497"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028477"
FT                   /db_xref="InterPro:IPR034325"
FT                   /db_xref="PDB:1PSR"
FT                   /db_xref="PDB:2PSR"
FT                   /db_xref="PDB:2WND"
FT                   /db_xref="PDB:2WOR"
FT                   /db_xref="PDB:2WOS"
FT                   /db_xref="PDB:3PSR"
FT                   /db_xref="PDB:4AQJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31151"
FT                   /protein_id="CAG46961.1"
FT                   /translation="MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLS
FT                   ACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ"
XX
SQ   Sequence 306 BP; 97 A; 70 C; 76 G; 63 T; 0 other;
     atgagcaaca ctcaagctga gaggtccata ataggcatga tcgacatgtt tcacaaatac        60
     accagacgtg atgacaagat tgacaagcca agcctgctga cgatgatgaa ggagaacttc       120
     cccaacttcc ttagtgcctg tgacaaaaag ggcacaaatt acctcgccga tgtctttgag       180
     aaaaaggaca agaatgagga taagaagatt gatttttctg agtttctgtc cttgctggga       240
     gacatagcca cagactacca caagcagagc catggagcag cgccctgttc cgggggcagc       300
     cagtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page