(data stored in ACNUC15465 zone)

EMBL: CR542236

ID   CR542236; SV 1; linear; mRNA; STD; HUM; 351 BP.
XX
AC   CR542236;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834H0625D for gene
DE   GAGE5, G antigen 5; complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-351
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-351
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; 6753168f5c1b8217b2c757c314f068a5.
XX
CC   RZPD; RZPDo834H0625D, ORFNo 4981
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0625D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu):
CC   FLH131144.01L
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_001474 (GI:4503882)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..351
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834H0625D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>351
FT                   /codon_start=1
FT                   /gene="GAGE5"
FT                   /db_xref="GOA:Q13069"
FT                   /db_xref="H-InvDB:HIT000269104_10.4"
FT                   /db_xref="HGNC:HGNC:4102"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13069"
FT                   /protein_id="CAG47032.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 351 BP; 103 A; 76 C; 115 G; 57 T; 0 other;
     atgagttggc gaggaagatc gacctattat tggcctagac caaggcgcta tgtacagcct        60
     cctgaaatga ttgggcctat gcggcccgag cagttcagtg atgaagtgga accagcaaca       120
     cctgaagaag gggaaccagc aactcaacgt caggatcctg cagctgctca ggagggagag       180
     gatgagggag catctgcagg tcaagggccg aagcctgaag ctgatagcca ggaacagggt       240
     cacccacaga ctgggtgtga gtgtgaagat ggtcctgatg ggcaggagat ggacccgcca       300
     aatccagagg aggtgaaaac gcctgaagaa ggtgaaaagc aatcacagtg t                351
//

If you have problems or comments...

PBIL Back to PBIL home page