(data stored in ACNUC8465 zone)

EMBL: CR542272

ID   CR542272; SV 1; linear; mRNA; STD; HUM; 588 BP.
XX
AC   CR542272;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   29-JUN-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Homo sapiens full open reading frame cDNA clone RZPDo834E0626D for gene
DE   ARHB, ras homolog gene family, member B; complete cds, without stopcodon.
XX
KW   Full ORF shuttle clone, Gateway(TM), complete cds.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-588
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201)";
RL   Unpublished.
XX
RN   [2]
RP   1-588
RA   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P.,
RA   Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y.,
RA   LaBaer J.;
RT   ;
RL   Submitted (28-JUN-2004) to the INSDC.
RL   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer
RL   Feld 580, D-69120 Heidelberg, Germany
XX
DR   MD5; df1d1548c8b7246357efcbc6d524c3e7.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
CC   RZPD; RZPDo834E0626D, ORFNo 5089
CC   www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0626D
CC   RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
CC   RZPD LIB No. 834
CC   www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
CC   www.rzpd.de/products/orfclones/
CC   Contact: Inge Arlart
CC   RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
CC   Heubnerweg 6, D-14059 Berlin, Germany
CC   Tel: +49 30 32639 100
CC   Fax: +49 30 32639 111
CC   www.rzpd.de
CC   This clone is available from RZPD;
CC   Contact RZPD (customer.service@rzpd.de) for further information.
CC   Clone name at Harvard Institute of Proteomics (www.hip.harvard.edu):
CC   FLH131101.01L
CC
CC   This CDS clone is part of a collection of human full ORF clones
CC   jointly established and verified by the Harvard Institute of
CC   Proteomics (HIP) and RZPD.
CC   This CDS has been cloned without stopcodon.
CC   The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction.
CC   Additional sequence has been added in front of the start codon:
CC   att..AAAAAA GCA GGC TCC ACC (ATG).
CC   The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
CC   The clone is validated by full sequence check.
CC   Compared to the reference sequence NM_004040 (GI:42716309)
CC   we did not find any amino acid exchanges.
CC   Clone distribution: http://www.rzpd.de/products/orfclones/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..588
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5Alpha"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
FT                   /clone="RZPDo834E0626D"
FT                   /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..>588
FT                   /codon_start=1
FT                   /gene="ARHB"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000269140.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="CAG47068.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 588 BP; 119 A; 182 C; 193 G; 94 T; 0 other;
     atggcggcca tccgcaagaa gctggtggtg gtgggcgacg gcgcgtgtgg caagacgtgc        60
     ctgctgatcg tgttcagtaa ggacgagttc cccgaggtgt acgtgcccac cgtcttcgag       120
     aactatgtgg ccgacattga ggtggacggc aagcaggtgg agctggcgct gtgggacacg       180
     gcgggccagg aggactacga ccgcctgcgg ccgctctcct acccggacac cgacgtcatt       240
     ctcatgtgct tctcggtgga cagcccggac tcgctggaga acatccccga gaagtgggtc       300
     cccgaggtga agcacttctg tcccaatgtg cccatcatcc tggtggccaa caaaaaagac       360
     ctgcgcagcg acgagcatgt ccgcacagag ctggcccgca tgaagcagga acccgtgcgc       420
     acggatgacg gccgcgccat ggccgtgcgc atccaagcct acgactacct cgagtgctct       480
     gccaagacca aggaaggcgt gcgcgaggtc ttcgagacgg ccacgcgcgc cgcgctgcag       540
     aagcgctacg gctcccagaa cggctgcatc aactgctgca aggtgcta                    588
//

If you have problems or comments...

PBIL Back to PBIL home page