(data stored in ACNUC7421 zone)

EMBL: CR626927

ID   CR626927; SV 1; circular; genomic DNA; STD; PRO; 5205140 BP.
XX
AC   CR626927;
XX
PR   Project:PRJNA46;
XX
DT   03-MAR-2005 (Rel. 83, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Bacteroides fragilis NCTC 9343, complete genome
XX
KW   complete genome.
XX
OS   Bacteroides fragilis NCTC 9343
OC   Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae;
OC   Bacteroides.
XX
RN   [1]
RP   1-5205140
RX   DOI; 10.1126/science.1107008.
RX   PUBMED; 15746427.
RA   Cerdeno-Tarraga A.M., Patrick S., Crosmann L., Blakely G., Abratt V.,
RA   Lennard N., Duerden B., Poxton I., Harris B., Quail M.A., Barron A.,
RA   Clarck L., Corton C., Doggett J., Holden M.T.G., Larke N., Line A.,
RA   Lord A., Norbertczak H., Ormond D., Price C., Rabbinowitsch E.,
RA   Woodward J., Barrel B.G., Parkhill J.;
RT   "Extensive DNA inversions in the B. fragilis genome control variable gene
RT   expression";
RL   Science, e1252229 307(5714):1463-1465(2005).
XX
RN   [2]
RP   1-5205140
RA   Cerdeno-Tarraga A.M.;
RT   ;
RL   Submitted (29-JUL-2004) to the INSDC.
RL   Cerdeno-Tarraga A.M., submitted on behalf of the Pathogen Sequencing Unit,
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA
RL   E-mail: amct@sanger.ac.uk
XX
DR   MD5; dc85fdc1cc5d6927f915b4573d0f0be1.
DR   BioSample; SAMEA1705957.
DR   EnsemblGenomes-Gn; BF9343_0365.
DR   EnsemblGenomes-Gn; BF9343_0394.
DR   EnsemblGenomes-Gn; BF9343_0441.
DR   EnsemblGenomes-Gn; BF9343_0442.
DR   EnsemblGenomes-Gn; BF9343_0686.
DR   EnsemblGenomes-Gn; BF9343_0689.
DR   EnsemblGenomes-Gn; BF9343_0710.
DR   EnsemblGenomes-Gn; BF9343_0730.
DR   EnsemblGenomes-Gn; BF9343_0853.
DR   EnsemblGenomes-Gn; BF9343_0906.
DR   EnsemblGenomes-Gn; BF9343_0928.
DR   EnsemblGenomes-Gn; BF9343_0996.
DR   EnsemblGenomes-Gn; BF9343_1051.
DR   EnsemblGenomes-Gn; BF9343_1166.
DR   EnsemblGenomes-Gn; BF9343_1167.
DR   EnsemblGenomes-Gn; BF9343_1323.
DR   EnsemblGenomes-Gn; BF9343_1368.
DR   EnsemblGenomes-Gn; BF9343_1376.
DR   EnsemblGenomes-Gn; BF9343_1381.
DR   EnsemblGenomes-Gn; BF9343_1387.
DR   EnsemblGenomes-Gn; BF9343_1499.
DR   EnsemblGenomes-Gn; BF9343_1553.
DR   EnsemblGenomes-Gn; BF9343_1635.
DR   EnsemblGenomes-Gn; BF9343_1753.
DR   EnsemblGenomes-Gn; BF9343_1833.
DR   EnsemblGenomes-Gn; BF9343_1885.
DR   EnsemblGenomes-Gn; BF9343_1950.
DR   EnsemblGenomes-Gn; BF9343_1958.
DR   EnsemblGenomes-Gn; BF9343_1973.
DR   EnsemblGenomes-Gn; BF9343_2006.
DR   EnsemblGenomes-Gn; BF9343_2043.
DR   EnsemblGenomes-Gn; BF9343_2190.
DR   EnsemblGenomes-Gn; BF9343_2247.
DR   EnsemblGenomes-Gn; BF9343_2248.
DR   EnsemblGenomes-Gn; BF9343_2318.
DR   EnsemblGenomes-Gn; BF9343_2365.
DR   EnsemblGenomes-Gn; BF9343_2493.
DR   EnsemblGenomes-Gn; BF9343_2564.
DR   EnsemblGenomes-Gn; BF9343_2578.
DR   EnsemblGenomes-Gn; BF9343_2747.
DR   EnsemblGenomes-Gn; BF9343_2827.
DR   EnsemblGenomes-Gn; BF9343_2965.
DR   EnsemblGenomes-Gn; BF9343_3191.
DR   EnsemblGenomes-Gn; BF9343_3270.
DR   EnsemblGenomes-Gn; BF9343_3289.
DR   EnsemblGenomes-Gn; BF9343_3346.
DR   EnsemblGenomes-Gn; BF9343_3489.
DR   EnsemblGenomes-Gn; BF9343_3545.
DR   EnsemblGenomes-Gn; BF9343_3553.
DR   EnsemblGenomes-Gn; BF9343_3579.
DR   EnsemblGenomes-Gn; BF9343_3581.
DR   EnsemblGenomes-Gn; BF9343_3716.
DR   EnsemblGenomes-Gn; BF9343_3765.
DR   EnsemblGenomes-Gn; BF9343_3766.
DR   EnsemblGenomes-Gn; BF9343_3770.
DR   EnsemblGenomes-Gn; BF9343_3771.
DR   EnsemblGenomes-Gn; BF9343_3848.
DR   EnsemblGenomes-Gn; BF9343_3937.
DR   EnsemblGenomes-Gn; BF9343_3938.
DR   EnsemblGenomes-Gn; BF9343_3939.
DR   EnsemblGenomes-Gn; BF9343_3940.
DR   EnsemblGenomes-Gn; BF9343_3943.
DR   EnsemblGenomes-Gn; BF9343_3959.
DR   EnsemblGenomes-Gn; BF9343_3960.
DR   EnsemblGenomes-Gn; BF9343_3961.
DR   EnsemblGenomes-Gn; BF9343_3965.
DR   EnsemblGenomes-Gn; BF9343_4014.
DR   EnsemblGenomes-Gn; BF9343_4015.
DR   EnsemblGenomes-Gn; BF9343_4104.
DR   EnsemblGenomes-Gn; BF9343_4158.
DR   EnsemblGenomes-Gn; BF9343_4161.
DR   EnsemblGenomes-Gn; EBG00000032483.
DR   EnsemblGenomes-Gn; EBG00000032484.
DR   EnsemblGenomes-Gn; EBG00000032485.
DR   EnsemblGenomes-Gn; EBG00000032486.
DR   EnsemblGenomes-Gn; EBG00000032487.
DR   EnsemblGenomes-Gn; EBG00000032488.
DR   EnsemblGenomes-Gn; EBG00000032489.
DR   EnsemblGenomes-Gn; EBG00000032490.
DR   EnsemblGenomes-Gn; EBG00000032491.
DR   EnsemblGenomes-Gn; EBG00000032492.
DR   EnsemblGenomes-Gn; EBG00000032493.
DR   EnsemblGenomes-Gn; EBG00000032494.
DR   EnsemblGenomes-Gn; EBG00000032495.
DR   EnsemblGenomes-Gn; EBG00000032496.
DR   EnsemblGenomes-Gn; EBG00000032497.
DR   EnsemblGenomes-Gn; EBG00000032498.
DR   EnsemblGenomes-Gn; EBG00000032499.
DR   EnsemblGenomes-Gn; EBG00000032500.
DR   EnsemblGenomes-Gn; EBG00000032501.
DR   EnsemblGenomes-Gn; EBG00000032502.
DR   EnsemblGenomes-Gn; EBG00000032503.
DR   EnsemblGenomes-Gn; EBG00000032504.
DR   EnsemblGenomes-Gn; EBG00000032505.
DR   EnsemblGenomes-Gn; EBG00000032506.
DR   EnsemblGenomes-Gn; EBG00000032507.
DR   EnsemblGenomes-Gn; EBG00000032508.
DR   EnsemblGenomes-Gn; EBG00000032509.
DR   EnsemblGenomes-Gn; EBG00000032510.
DR   EnsemblGenomes-Gn; EBG00000032511.
DR   EnsemblGenomes-Gn; EBG00000032512.
DR   EnsemblGenomes-Gn; EBG00000032513.
DR   EnsemblGenomes-Gn; EBG00000032514.
DR   EnsemblGenomes-Gn; EBG00000032515.
DR   EnsemblGenomes-Gn; EBG00000032516.
DR   EnsemblGenomes-Gn; EBG00000032517.
DR   EnsemblGenomes-Gn; EBG00000032518.
DR   EnsemblGenomes-Gn; EBG00000032519.
DR   EnsemblGenomes-Gn; EBG00000032520.
DR   EnsemblGenomes-Gn; EBG00000032521.
DR   EnsemblGenomes-Gn; EBG00000032522.
DR   EnsemblGenomes-Gn; EBG00000032523.
DR   EnsemblGenomes-Gn; EBG00000032524.
DR   EnsemblGenomes-Gn; EBG00000032525.
DR   EnsemblGenomes-Gn; EBG00000032526.
DR   EnsemblGenomes-Gn; EBG00000032527.
DR   EnsemblGenomes-Gn; EBG00000032528.
DR   EnsemblGenomes-Gn; EBG00000032529.
DR   EnsemblGenomes-Gn; EBG00000032530.
DR   EnsemblGenomes-Gn; EBG00000032531.
DR   EnsemblGenomes-Gn; EBG00000032532.
DR   EnsemblGenomes-Gn; EBG00000032533.
DR   EnsemblGenomes-Gn; EBG00000032534.
DR   EnsemblGenomes-Gn; EBG00000032535.
DR   EnsemblGenomes-Gn; EBG00000032536.
DR   EnsemblGenomes-Gn; EBG00000032537.
DR   EnsemblGenomes-Gn; EBG00000032538.
DR   EnsemblGenomes-Gn; EBG00000032539.
DR   EnsemblGenomes-Gn; EBG00000032540.
DR   EnsemblGenomes-Gn; EBG00000032541.
DR   EnsemblGenomes-Gn; EBG00000032542.
DR   EnsemblGenomes-Gn; EBG00000032543.
DR   EnsemblGenomes-Gn; EBG00000032544.
DR   EnsemblGenomes-Gn; EBG00000032545.
DR   EnsemblGenomes-Gn; EBG00000032546.
DR   EnsemblGenomes-Gn; EBG00000032547.
DR   EnsemblGenomes-Gn; EBG00000032548.
DR   EnsemblGenomes-Gn; EBG00000032549.
DR   EnsemblGenomes-Gn; EBG00000032550.
DR   EnsemblGenomes-Gn; EBG00000032551.
DR   EnsemblGenomes-Gn; EBG00000032552.
DR   EnsemblGenomes-Gn; EBG00000032553.
DR   EnsemblGenomes-Gn; EBG00000032554.
DR   EnsemblGenomes-Gn; EBG00000032555.
DR   EnsemblGenomes-Gn; EBG00000032556.
DR   EnsemblGenomes-Gn; EBG00000032557.
DR   EnsemblGenomes-Gn; EBG00000032558.
DR   EnsemblGenomes-Gn; EBG00000032559.
DR   EnsemblGenomes-Gn; EBG00000032560.
DR   EnsemblGenomes-Gn; EBG00000032561.
DR   EnsemblGenomes-Gn; EBG00000032562.
DR   EnsemblGenomes-Gn; EBG00000032563.
DR   EnsemblGenomes-Gn; EBG00000032564.
DR   EnsemblGenomes-Gn; EBG00000032565.
DR   EnsemblGenomes-Gn; EBG00000032566.
DR   EnsemblGenomes-Gn; EBG00000032567.
DR   EnsemblGenomes-Gn; EBG00000032568.
DR   EnsemblGenomes-Gn; EBG00000032569.
DR   EnsemblGenomes-Gn; EBG00000032570.
DR   EnsemblGenomes-Gn; EBG00000032571.
DR   EnsemblGenomes-Gn; EBG00000032572.
DR   EnsemblGenomes-Gn; EBG00000032573.
DR   EnsemblGenomes-Gn; EBG00000032574.
DR   EnsemblGenomes-Gn; EBG00001231245.
DR   EnsemblGenomes-Gn; EBG00001231246.
DR   EnsemblGenomes-Gn; EBG00001231247.
DR   EnsemblGenomes-Gn; EBG00001231248.
DR   EnsemblGenomes-Gn; EBG00001231250.
DR   EnsemblGenomes-Gn; EBG00001231251.
DR   EnsemblGenomes-Gn; EBG00001231252.
DR   EnsemblGenomes-Gn; EBG00001231253.
DR   EnsemblGenomes-Gn; EBG00001231254.
DR   EnsemblGenomes-Gn; EBG00001231255.
DR   EnsemblGenomes-Gn; EBG00001231256.
DR   EnsemblGenomes-Gn; EBG00001231257.
DR   EnsemblGenomes-Gn; EBG00001231258.
DR   EnsemblGenomes-Gn; EBG00001231259.
DR   EnsemblGenomes-Gn; EBG00001231260.
DR   EnsemblGenomes-Gn; EBG00001231261.
DR   EnsemblGenomes-Gn; EBG00001231262.
DR   EnsemblGenomes-Gn; EBG00001231264.
DR   EnsemblGenomes-Gn; EBG00001231265.
DR   EnsemblGenomes-Gn; EBG00001231266.
DR   EnsemblGenomes-Gn; EBG00001231267.
DR   EnsemblGenomes-Gn; EBG00001231268.
DR   EnsemblGenomes-Gn; EBG00001231269.
DR   EnsemblGenomes-Gn; EBG00001231270.
DR   EnsemblGenomes-Gn; EBG00001231271.
DR   EnsemblGenomes-Gn; EBG00001231272.
DR   EnsemblGenomes-Gn; EBG00001231273.
DR   EnsemblGenomes-Gn; EBG00001231274.
DR   EnsemblGenomes-Gn; EBG00001231275.
DR   EnsemblGenomes-Gn; EBG00001231276.
DR   EnsemblGenomes-Gn; EBG00001231277.
DR   EnsemblGenomes-Gn; EBG00001231278.
DR   EnsemblGenomes-Gn; EBG00001231279.
DR   EnsemblGenomes-Gn; EBG00001231280.
DR   EnsemblGenomes-Gn; EBG00001231281.
DR   EnsemblGenomes-Gn; EBG00001231282.
DR   EnsemblGenomes-Gn; EBG00001231283.
DR   EnsemblGenomes-Gn; EBG00001231284.
DR   EnsemblGenomes-Gn; EBG00001231285.
DR   EnsemblGenomes-Gn; EBG00001231286.
DR   EnsemblGenomes-Gn; EBG00001231287.
DR   EnsemblGenomes-Gn; EBG00001231288.
DR   EnsemblGenomes-Gn; EBG00001231289.
DR   EnsemblGenomes-Gn; EBG00001231290.
DR   EnsemblGenomes-Gn; EBG00001231291.
DR   EnsemblGenomes-Gn; EBG00001231292.
DR   EnsemblGenomes-Gn; EBG00001231293.
DR   EnsemblGenomes-Gn; EBG00001231294.
DR   EnsemblGenomes-Gn; EBG00001231295.
DR   EnsemblGenomes-Gn; EBG00001231296.
DR   EnsemblGenomes-Gn; EBG00001231297.
DR   EnsemblGenomes-Gn; EBG00001231298.
DR   EnsemblGenomes-Gn; EBG00001231299.
DR   EnsemblGenomes-Gn; EBG00001231300.
DR   EnsemblGenomes-Gn; EBG00001231301.
DR   EnsemblGenomes-Gn; EBG00001231303.
DR   EnsemblGenomes-Gn; EBG00001231304.
DR   EnsemblGenomes-Gn; EBG00001231305.
DR   EnsemblGenomes-Gn; EBG00001231306.
DR   EnsemblGenomes-Gn; EBG00001231307.
DR   EnsemblGenomes-Gn; EBG00001231308.
DR   EnsemblGenomes-Gn; EBG00001231309.
DR   EnsemblGenomes-Gn; EBG00001231310.
DR   EnsemblGenomes-Gn; EBG00001231311.
DR   EnsemblGenomes-Gn; EBG00001231312.
DR   EnsemblGenomes-Gn; EBG00001231313.
DR   EnsemblGenomes-Gn; EBG00001231314.
DR   EnsemblGenomes-Gn; EBG00001231315.
DR   EnsemblGenomes-Gn; EBG00001231316.
DR   EnsemblGenomes-Gn; EBG00001231317.
DR   EnsemblGenomes-Gn; EBG00001231318.
DR   EnsemblGenomes-Gn; EBG00001231319.
DR   EnsemblGenomes-Gn; EBG00001231320.
DR   EnsemblGenomes-Gn; EBG00001231321.
DR   EnsemblGenomes-Gn; EBG00001231322.
DR   EnsemblGenomes-Gn; EBG00001231323.
DR   EnsemblGenomes-Gn; EBG00001231324.
DR   EnsemblGenomes-Gn; EBG00001231325.
DR   EnsemblGenomes-Gn; EBG00001231326.
DR   EnsemblGenomes-Gn; EBG00001231327.
DR   EnsemblGenomes-Gn; EBG00001231328.
DR   EnsemblGenomes-Gn; EBG00001231329.
DR   EnsemblGenomes-Gn; EBG00001231330.
DR   EnsemblGenomes-Gn; EBG00001231331.
DR   EnsemblGenomes-Gn; EBG00001231332.
DR   EnsemblGenomes-Gn; EBG00001231333.
DR   EnsemblGenomes-Gn; EBG00001231334.
DR   EnsemblGenomes-Gn; EBG00001231335.
DR   EnsemblGenomes-Gn; EBG00001231336.
DR   EnsemblGenomes-Gn; EBG00001231337.
DR   EnsemblGenomes-Gn; EBG00001231338.
DR   EnsemblGenomes-Gn; EBG00001231339.
DR   EnsemblGenomes-Gn; EBG00001231340.
DR   EnsemblGenomes-Gn; EBG00001231341.
DR   EnsemblGenomes-Gn; EBG00001231342.
DR   EnsemblGenomes-Gn; EBG00001231343.
DR   EnsemblGenomes-Gn; EBG00001231344.
DR   EnsemblGenomes-Gn; EBG00001231345.
DR   EnsemblGenomes-Gn; EBG00001231346.
DR   EnsemblGenomes-Gn; EBG00001231347.
DR   EnsemblGenomes-Gn; EBG00001231349.
DR   EnsemblGenomes-Gn; EBG00001231350.
DR   EnsemblGenomes-Gn; EBG00001231351.
DR   EnsemblGenomes-Gn; EBG00001231352.
DR   EnsemblGenomes-Gn; EBG00001231353.
DR   EnsemblGenomes-Gn; EBG00001231354.
DR   EnsemblGenomes-Gn; EBG00001231355.
DR   EnsemblGenomes-Gn; EBG00001231356.
DR   EnsemblGenomes-Gn; EBG00001231357.
DR   EnsemblGenomes-Gn; EBG00001231359.
DR   EnsemblGenomes-Gn; EBG00001231360.
DR   EnsemblGenomes-Gn; EBG00001231361.
DR   EnsemblGenomes-Gn; EBG00001231362.
DR   EnsemblGenomes-Gn; EBG00001231363.
DR   EnsemblGenomes-Gn; EBG00001231364.
DR   EnsemblGenomes-Gn; EBG00001231365.
DR   EnsemblGenomes-Gn; EBG00001231366.
DR   EnsemblGenomes-Gn; EBG00001231367.
DR   EnsemblGenomes-Gn; EBG00001231368.
DR   EnsemblGenomes-Gn; EBG00001231369.
DR   EnsemblGenomes-Gn; EBG00001231370.
DR   EnsemblGenomes-Gn; EBG00001231371.
DR   EnsemblGenomes-Gn; EBG00001231372.
DR   EnsemblGenomes-Gn; EBG00001231373.
DR   EnsemblGenomes-Gn; EBG00001231374.
DR   EnsemblGenomes-Gn; EBG00001231375.
DR   EnsemblGenomes-Gn; EBG00001231376.
DR   EnsemblGenomes-Gn; EBG00001231377.
DR   EnsemblGenomes-Gn; EBG00001231378.
DR   EnsemblGenomes-Gn; EBG00001231379.
DR   EnsemblGenomes-Gn; EBG00001231380.
DR   EnsemblGenomes-Gn; EBG00001231381.
DR   EnsemblGenomes-Gn; EBG00001231382.
DR   EnsemblGenomes-Gn; EBG00001231383.
DR   EnsemblGenomes-Gn; EBG00001231384.
DR   EnsemblGenomes-Gn; EBG00001231385.
DR   EnsemblGenomes-Gn; EBG00001231386.
DR   EnsemblGenomes-Gn; EBG00001231387.
DR   EnsemblGenomes-Gn; EBG00001231388.
DR   EnsemblGenomes-Gn; EBG00001231389.
DR   EnsemblGenomes-Gn; EBG00001231390.
DR   EnsemblGenomes-Gn; EBG00001231391.
DR   EnsemblGenomes-Gn; EBG00001231392.
DR   EnsemblGenomes-Gn; EBG00001231393.
DR   EnsemblGenomes-Gn; EBG00001231394.
DR   EnsemblGenomes-Gn; EBG00001231395.
DR   EnsemblGenomes-Gn; EBG00001231396.
DR   EnsemblGenomes-Gn; EBG00001231397.
DR   EnsemblGenomes-Gn; EBG00001231398.
DR   EnsemblGenomes-Tr; BF9343_0365.
DR   EnsemblGenomes-Tr; BF9343_0394.
DR   EnsemblGenomes-Tr; BF9343_0441.
DR   EnsemblGenomes-Tr; BF9343_0442.
DR   EnsemblGenomes-Tr; BF9343_0686.
DR   EnsemblGenomes-Tr; BF9343_0689.
DR   EnsemblGenomes-Tr; BF9343_0710.
DR   EnsemblGenomes-Tr; BF9343_0730.
DR   EnsemblGenomes-Tr; BF9343_0853.
DR   EnsemblGenomes-Tr; BF9343_0906.
DR   EnsemblGenomes-Tr; BF9343_0928.
DR   EnsemblGenomes-Tr; BF9343_0996.
DR   EnsemblGenomes-Tr; BF9343_1051.
DR   EnsemblGenomes-Tr; BF9343_1166.
DR   EnsemblGenomes-Tr; BF9343_1167.
DR   EnsemblGenomes-Tr; BF9343_1323.
DR   EnsemblGenomes-Tr; BF9343_1368.
DR   EnsemblGenomes-Tr; BF9343_1376.
DR   EnsemblGenomes-Tr; BF9343_1381.
DR   EnsemblGenomes-Tr; BF9343_1387.
DR   EnsemblGenomes-Tr; BF9343_1499.
DR   EnsemblGenomes-Tr; BF9343_1553.
DR   EnsemblGenomes-Tr; BF9343_1635.
DR   EnsemblGenomes-Tr; BF9343_1753.
DR   EnsemblGenomes-Tr; BF9343_1833.
DR   EnsemblGenomes-Tr; BF9343_1885.
DR   EnsemblGenomes-Tr; BF9343_1950.
DR   EnsemblGenomes-Tr; BF9343_1958.
DR   EnsemblGenomes-Tr; BF9343_1973.
DR   EnsemblGenomes-Tr; BF9343_2006.
DR   EnsemblGenomes-Tr; BF9343_2043.
DR   EnsemblGenomes-Tr; BF9343_2190.
DR   EnsemblGenomes-Tr; BF9343_2247.
DR   EnsemblGenomes-Tr; BF9343_2248.
DR   EnsemblGenomes-Tr; BF9343_2318.
DR   EnsemblGenomes-Tr; BF9343_2365.
DR   EnsemblGenomes-Tr; BF9343_2493.
DR   EnsemblGenomes-Tr; BF9343_2564.
DR   EnsemblGenomes-Tr; BF9343_2578.
DR   EnsemblGenomes-Tr; BF9343_2747.
DR   EnsemblGenomes-Tr; BF9343_2827.
DR   EnsemblGenomes-Tr; BF9343_2965.
DR   EnsemblGenomes-Tr; BF9343_3191.
DR   EnsemblGenomes-Tr; BF9343_3270.
DR   EnsemblGenomes-Tr; BF9343_3289.
DR   EnsemblGenomes-Tr; BF9343_3346.
DR   EnsemblGenomes-Tr; BF9343_3489.
DR   EnsemblGenomes-Tr; BF9343_3545.
DR   EnsemblGenomes-Tr; BF9343_3553.
DR   EnsemblGenomes-Tr; BF9343_3579.
DR   EnsemblGenomes-Tr; BF9343_3581.
DR   EnsemblGenomes-Tr; BF9343_3716.
DR   EnsemblGenomes-Tr; BF9343_3765.
DR   EnsemblGenomes-Tr; BF9343_3766.
DR   EnsemblGenomes-Tr; BF9343_3770.
DR   EnsemblGenomes-Tr; BF9343_3771.
DR   EnsemblGenomes-Tr; BF9343_3848.
DR   EnsemblGenomes-Tr; BF9343_3937.
DR   EnsemblGenomes-Tr; BF9343_3938.
DR   EnsemblGenomes-Tr; BF9343_3939.
DR   EnsemblGenomes-Tr; BF9343_3940.
DR   EnsemblGenomes-Tr; BF9343_3943.
DR   EnsemblGenomes-Tr; BF9343_3959.
DR   EnsemblGenomes-Tr; BF9343_3960.
DR   EnsemblGenomes-Tr; BF9343_3961.
DR   EnsemblGenomes-Tr; BF9343_3965.
DR   EnsemblGenomes-Tr; BF9343_4014.
DR   EnsemblGenomes-Tr; BF9343_4015.
DR   EnsemblGenomes-Tr; BF9343_4104.
DR   EnsemblGenomes-Tr; BF9343_4158.
DR   EnsemblGenomes-Tr; BF9343_4161.
DR   EnsemblGenomes-Tr; EBG00000032483-1.
DR   EnsemblGenomes-Tr; EBG00000032484-1.
DR   EnsemblGenomes-Tr; EBG00000032485-1.
DR   EnsemblGenomes-Tr; EBG00000032486-1.
DR   EnsemblGenomes-Tr; EBG00000032487-1.
DR   EnsemblGenomes-Tr; EBG00000032488-1.
DR   EnsemblGenomes-Tr; EBG00000032489-1.
DR   EnsemblGenomes-Tr; EBG00000032490-1.
DR   EnsemblGenomes-Tr; EBG00000032491-1.
DR   EnsemblGenomes-Tr; EBG00000032492-1.
DR   EnsemblGenomes-Tr; EBG00000032493-1.
DR   EnsemblGenomes-Tr; EBG00000032494-1.
DR   EnsemblGenomes-Tr; EBG00000032495-1.
DR   EnsemblGenomes-Tr; EBG00000032496-1.
DR   EnsemblGenomes-Tr; EBG00000032497-1.
DR   EnsemblGenomes-Tr; EBG00000032498-1.
DR   EnsemblGenomes-Tr; EBG00000032499-1.
DR   EnsemblGenomes-Tr; EBG00000032500-1.
DR   EnsemblGenomes-Tr; EBG00000032501-1.
DR   EnsemblGenomes-Tr; EBG00000032502-1.
DR   EnsemblGenomes-Tr; EBG00000032503-1.
DR   EnsemblGenomes-Tr; EBG00000032504-1.
DR   EnsemblGenomes-Tr; EBG00000032505-1.
DR   EnsemblGenomes-Tr; EBG00000032506-1.
DR   EnsemblGenomes-Tr; EBG00000032507-1.
DR   EnsemblGenomes-Tr; EBG00000032508-1.
DR   EnsemblGenomes-Tr; EBG00000032509-1.
DR   EnsemblGenomes-Tr; EBG00000032510-1.
DR   EnsemblGenomes-Tr; EBG00000032511-1.
DR   EnsemblGenomes-Tr; EBG00000032512-1.
DR   EnsemblGenomes-Tr; EBG00000032513-1.
DR   EnsemblGenomes-Tr; EBG00000032514-1.
DR   EnsemblGenomes-Tr; EBG00000032515-1.
DR   EnsemblGenomes-Tr; EBG00000032516-1.
DR   EnsemblGenomes-Tr; EBG00000032517-1.
DR   EnsemblGenomes-Tr; EBG00000032518-1.
DR   EnsemblGenomes-Tr; EBG00000032519-1.
DR   EnsemblGenomes-Tr; EBG00000032520-1.
DR   EnsemblGenomes-Tr; EBG00000032521-1.
DR   EnsemblGenomes-Tr; EBG00000032522-1.
DR   EnsemblGenomes-Tr; EBG00000032523-1.
DR   EnsemblGenomes-Tr; EBG00000032524-1.
DR   EnsemblGenomes-Tr; EBG00000032525-1.
DR   EnsemblGenomes-Tr; EBG00000032526-1.
DR   EnsemblGenomes-Tr; EBG00000032527-1.
DR   EnsemblGenomes-Tr; EBG00000032528-1.
DR   EnsemblGenomes-Tr; EBG00000032529-1.
DR   EnsemblGenomes-Tr; EBG00000032530-1.
DR   EnsemblGenomes-Tr; EBG00000032531-1.
DR   EnsemblGenomes-Tr; EBG00000032532-1.
DR   EnsemblGenomes-Tr; EBG00000032533-1.
DR   EnsemblGenomes-Tr; EBG00000032534-1.
DR   EnsemblGenomes-Tr; EBG00000032535-1.
DR   EnsemblGenomes-Tr; EBG00000032536-1.
DR   EnsemblGenomes-Tr; EBG00000032537-1.
DR   EnsemblGenomes-Tr; EBG00000032538-1.
DR   EnsemblGenomes-Tr; EBG00000032539-1.
DR   EnsemblGenomes-Tr; EBG00000032540-1.
DR   EnsemblGenomes-Tr; EBG00000032541-1.
DR   EnsemblGenomes-Tr; EBG00000032542-1.
DR   EnsemblGenomes-Tr; EBG00000032543-1.
DR   EnsemblGenomes-Tr; EBG00000032544-1.
DR   EnsemblGenomes-Tr; EBG00000032545-1.
DR   EnsemblGenomes-Tr; EBG00000032546-1.
DR   EnsemblGenomes-Tr; EBG00000032547-1.
DR   EnsemblGenomes-Tr; EBG00000032548-1.
DR   EnsemblGenomes-Tr; EBG00000032549-1.
DR   EnsemblGenomes-Tr; EBG00000032550-1.
DR   EnsemblGenomes-Tr; EBG00000032551-1.
DR   EnsemblGenomes-Tr; EBG00000032552-1.
DR   EnsemblGenomes-Tr; EBG00000032553-1.
DR   EnsemblGenomes-Tr; EBG00000032554-1.
DR   EnsemblGenomes-Tr; EBG00000032555-1.
DR   EnsemblGenomes-Tr; EBG00000032556-1.
DR   EnsemblGenomes-Tr; EBG00000032557-1.
DR   EnsemblGenomes-Tr; EBG00000032558-1.
DR   EnsemblGenomes-Tr; EBG00000032559-1.
DR   EnsemblGenomes-Tr; EBG00000032560-1.
DR   EnsemblGenomes-Tr; EBG00000032561-1.
DR   EnsemblGenomes-Tr; EBG00000032562-1.
DR   EnsemblGenomes-Tr; EBG00000032563-1.
DR   EnsemblGenomes-Tr; EBG00000032564-1.
DR   EnsemblGenomes-Tr; EBG00000032565-1.
DR   EnsemblGenomes-Tr; EBG00000032566-1.
DR   EnsemblGenomes-Tr; EBG00000032567-1.
DR   EnsemblGenomes-Tr; EBG00000032568-1.
DR   EnsemblGenomes-Tr; EBG00000032569-1.
DR   EnsemblGenomes-Tr; EBG00000032570-1.
DR   EnsemblGenomes-Tr; EBG00000032571-1.
DR   EnsemblGenomes-Tr; EBG00000032572-1.
DR   EnsemblGenomes-Tr; EBG00000032573-1.
DR   EnsemblGenomes-Tr; EBG00000032574-1.
DR   EnsemblGenomes-Tr; EBT00001576873.
DR   EnsemblGenomes-Tr; EBT00001576874.
DR   EnsemblGenomes-Tr; EBT00001576875.
DR   EnsemblGenomes-Tr; EBT00001576876.
DR   EnsemblGenomes-Tr; EBT00001576877.
DR   EnsemblGenomes-Tr; EBT00001576878.
DR   EnsemblGenomes-Tr; EBT00001576879.
DR   EnsemblGenomes-Tr; EBT00001576880.
DR   EnsemblGenomes-Tr; EBT00001576881.
DR   EnsemblGenomes-Tr; EBT00001576882.
DR   EnsemblGenomes-Tr; EBT00001576883.
DR   EnsemblGenomes-Tr; EBT00001576884.
DR   EnsemblGenomes-Tr; EBT00001576885.
DR   EnsemblGenomes-Tr; EBT00001576886.
DR   EnsemblGenomes-Tr; EBT00001576887.
DR   EnsemblGenomes-Tr; EBT00001576888.
DR   EnsemblGenomes-Tr; EBT00001576890.
DR   EnsemblGenomes-Tr; EBT00001576891.
DR   EnsemblGenomes-Tr; EBT00001576892.
DR   EnsemblGenomes-Tr; EBT00001576893.
DR   EnsemblGenomes-Tr; EBT00001576894.
DR   EnsemblGenomes-Tr; EBT00001576895.
DR   EnsemblGenomes-Tr; EBT00001576896.
DR   EnsemblGenomes-Tr; EBT00001576897.
DR   EnsemblGenomes-Tr; EBT00001576898.
DR   EnsemblGenomes-Tr; EBT00001576899.
DR   EnsemblGenomes-Tr; EBT00001576900.
DR   EnsemblGenomes-Tr; EBT00001576901.
DR   EnsemblGenomes-Tr; EBT00001576902.
DR   EnsemblGenomes-Tr; EBT00001576903.
DR   EnsemblGenomes-Tr; EBT00001576905.
DR   EnsemblGenomes-Tr; EBT00001576906.
DR   EnsemblGenomes-Tr; EBT00001576907.
DR   EnsemblGenomes-Tr; EBT00001576908.
DR   EnsemblGenomes-Tr; EBT00001576909.
DR   EnsemblGenomes-Tr; EBT00001576910.
DR   EnsemblGenomes-Tr; EBT00001576911.
DR   EnsemblGenomes-Tr; EBT00001576912.
DR   EnsemblGenomes-Tr; EBT00001576913.
DR   EnsemblGenomes-Tr; EBT00001576914.
DR   EnsemblGenomes-Tr; EBT00001576915.
DR   EnsemblGenomes-Tr; EBT00001576916.
DR   EnsemblGenomes-Tr; EBT00001576917.
DR   EnsemblGenomes-Tr; EBT00001576918.
DR   EnsemblGenomes-Tr; EBT00001576920.
DR   EnsemblGenomes-Tr; EBT00001576921.
DR   EnsemblGenomes-Tr; EBT00001576922.
DR   EnsemblGenomes-Tr; EBT00001576923.
DR   EnsemblGenomes-Tr; EBT00001576924.
DR   EnsemblGenomes-Tr; EBT00001576925.
DR   EnsemblGenomes-Tr; EBT00001576926.
DR   EnsemblGenomes-Tr; EBT00001576927.
DR   EnsemblGenomes-Tr; EBT00001576928.
DR   EnsemblGenomes-Tr; EBT00001576929.
DR   EnsemblGenomes-Tr; EBT00001576930.
DR   EnsemblGenomes-Tr; EBT00001576931.
DR   EnsemblGenomes-Tr; EBT00001576932.
DR   EnsemblGenomes-Tr; EBT00001576933.
DR   EnsemblGenomes-Tr; EBT00001576934.
DR   EnsemblGenomes-Tr; EBT00001576936.
DR   EnsemblGenomes-Tr; EBT00001576937.
DR   EnsemblGenomes-Tr; EBT00001576938.
DR   EnsemblGenomes-Tr; EBT00001576939.
DR   EnsemblGenomes-Tr; EBT00001576940.
DR   EnsemblGenomes-Tr; EBT00001576941.
DR   EnsemblGenomes-Tr; EBT00001576942.
DR   EnsemblGenomes-Tr; EBT00001576943.
DR   EnsemblGenomes-Tr; EBT00001576944.
DR   EnsemblGenomes-Tr; EBT00001576945.
DR   EnsemblGenomes-Tr; EBT00001576946.
DR   EnsemblGenomes-Tr; EBT00001576947.
DR   EnsemblGenomes-Tr; EBT00001576948.
DR   EnsemblGenomes-Tr; EBT00001576949.
DR   EnsemblGenomes-Tr; EBT00001576950.
DR   EnsemblGenomes-Tr; EBT00001576951.
DR   EnsemblGenomes-Tr; EBT00001576952.
DR   EnsemblGenomes-Tr; EBT00001576953.
DR   EnsemblGenomes-Tr; EBT00001576954.
DR   EnsemblGenomes-Tr; EBT00001576955.
DR   EnsemblGenomes-Tr; EBT00001576956.
DR   EnsemblGenomes-Tr; EBT00001576957.
DR   EnsemblGenomes-Tr; EBT00001576958.
DR   EnsemblGenomes-Tr; EBT00001576959.
DR   EnsemblGenomes-Tr; EBT00001576960.
DR   EnsemblGenomes-Tr; EBT00001576961.
DR   EnsemblGenomes-Tr; EBT00001576962.
DR   EnsemblGenomes-Tr; EBT00001576963.
DR   EnsemblGenomes-Tr; EBT00001576964.
DR   EnsemblGenomes-Tr; EBT00001576966.
DR   EnsemblGenomes-Tr; EBT00001576967.
DR   EnsemblGenomes-Tr; EBT00001576968.
DR   EnsemblGenomes-Tr; EBT00001576969.
DR   EnsemblGenomes-Tr; EBT00001576970.
DR   EnsemblGenomes-Tr; EBT00001576971.
DR   EnsemblGenomes-Tr; EBT00001576972.
DR   EnsemblGenomes-Tr; EBT00001576973.
DR   EnsemblGenomes-Tr; EBT00001576974.
DR   EnsemblGenomes-Tr; EBT00001576975.
DR   EnsemblGenomes-Tr; EBT00001576976.
DR   EnsemblGenomes-Tr; EBT00001576977.
DR   EnsemblGenomes-Tr; EBT00001576978.
DR   EnsemblGenomes-Tr; EBT00001576979.
DR   EnsemblGenomes-Tr; EBT00001576980.
DR   EnsemblGenomes-Tr; EBT00001576981.
DR   EnsemblGenomes-Tr; EBT00001576982.
DR   EnsemblGenomes-Tr; EBT00001576983.
DR   EnsemblGenomes-Tr; EBT00001576984.
DR   EnsemblGenomes-Tr; EBT00001576985.
DR   EnsemblGenomes-Tr; EBT00001576986.
DR   EnsemblGenomes-Tr; EBT00001576987.
DR   EnsemblGenomes-Tr; EBT00001576988.
DR   EnsemblGenomes-Tr; EBT00001576989.
DR   EnsemblGenomes-Tr; EBT00001576990.
DR   EnsemblGenomes-Tr; EBT00001576991.
DR   EnsemblGenomes-Tr; EBT00001576992.
DR   EnsemblGenomes-Tr; EBT00001576993.
DR   EnsemblGenomes-Tr; EBT00001576994.
DR   EnsemblGenomes-Tr; EBT00001576995.
DR   EnsemblGenomes-Tr; EBT00001576996.
DR   EnsemblGenomes-Tr; EBT00001576997.
DR   EnsemblGenomes-Tr; EBT00001576998.
DR   EnsemblGenomes-Tr; EBT00001576999.
DR   EnsemblGenomes-Tr; EBT00001577000.
DR   EnsemblGenomes-Tr; EBT00001577001.
DR   EnsemblGenomes-Tr; EBT00001577002.
DR   EnsemblGenomes-Tr; EBT00001577003.
DR   EnsemblGenomes-Tr; EBT00001577004.
DR   EnsemblGenomes-Tr; EBT00001577005.
DR   EnsemblGenomes-Tr; EBT00001577006.
DR   EnsemblGenomes-Tr; EBT00001577007.
DR   EnsemblGenomes-Tr; EBT00001577008.
DR   EnsemblGenomes-Tr; EBT00001577009.
DR   EnsemblGenomes-Tr; EBT00001577010.
DR   EnsemblGenomes-Tr; EBT00001577011.
DR   EnsemblGenomes-Tr; EBT00001577012.
DR   EnsemblGenomes-Tr; EBT00001577013.
DR   EnsemblGenomes-Tr; EBT00001577014.
DR   EnsemblGenomes-Tr; EBT00001577015.
DR   EnsemblGenomes-Tr; EBT00001577016.
DR   EnsemblGenomes-Tr; EBT00001577017.
DR   EnsemblGenomes-Tr; EBT00001577018.
DR   EnsemblGenomes-Tr; EBT00001577019.
DR   EnsemblGenomes-Tr; EBT00001577020.
DR   EnsemblGenomes-Tr; EBT00001577021.
DR   EnsemblGenomes-Tr; EBT00001577023.
DR   EnsemblGenomes-Tr; EBT00001577024.
DR   EnsemblGenomes-Tr; EBT00001577025.
DR   EnsemblGenomes-Tr; EBT00001577026.
DR   EnsemblGenomes-Tr; EBT00001577027.
DR   EuropePMC; PMC2148300; 18048332.
DR   EuropePMC; PMC2628385; 19014434.
DR   EuropePMC; PMC3318803; 22307287.
DR   EuropePMC; PMC3364422; 22113306.
DR   EuropePMC; PMC3409759; 22778399.
DR   EuropePMC; PMC3463246; 23066504.
DR   EuropePMC; PMC3647933; 23447634.
DR   EuropePMC; PMC3969230; 24351045.
DR   EuropePMC; PMC4403768; 25887695.
DR   EuropePMC; PMC5007783; 27422836.
DR   EuropePMC; PMC5028390; 27703449.
DR   EuropePMC; PMC5609589; 28971068.
DR   EuropePMC; PMC5704556; 29218031.
DR   EuropePMC; PMC5997789; 29928268.
DR   EuropePMC; PMC6007111; 29678922.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01362; CRISPR-DR49.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01693; Bacteroidales-1.
DR   RFAM; RF01694; Bacteroides-1.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CR626927.
DR   SILVA-SSU; CR626927.
DR   StrainInfo; 5232; 1.
XX
CC   Accession number for plasmid pBF9343 in this genome project: CR626928
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5205140
FT                   /organism="Bacteroides fragilis NCTC 9343"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272559"
FT                   /culture_collection="NCTC:9343"
FT                   /culture_collection="ATCC:25285"
FT   CDS_pept        67..594
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0001"
FT                   /old_locus_tag="BF0001"
FT                   /product="putative SpoU rRNA methylase family protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron tRNA/rRNA
FT                   methyltransferase BT3165 SWALL:AAO78271 (EMBL:AE016939)
FT                   (175 aa) fasta scores: E(): 4.1e-62, 90.85% id in 175 aa,
FT                   and to Chlorobium tepidum SpoU rRNA methylase family
FT                   protein CT1255 SWALL:Q8KD02 (EMBL:AE012885) (169 aa) fasta
FT                   scores: E(): 1.3e-21, 41.66% id in 168 aa, and to
FT                   Fusobacterium nucleatum 23S rRNA methyltransferase FN1519
FT                   SWALL:Q8R6H6 (EMBL:AE010460) (234 aa) fasta scores: E():
FT                   5.6e-11, 35.29% id in 153 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05780"
FT                   /db_xref="GOA:Q5LJ96"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ96"
FT                   /protein_id="CAH05780.1"
FT                   /translation="MRKLKITELNRISIEEFKEADKLPLVVVLDDIRSLHNIGSVFRTA
FT                   DAFRIECIYLCGITATPPHPEMHKTALGAEFTVDWKYVNNAVETVDNLRSEGYVVYSVE
FT                   QAEGSIMLDELTLDRSKKYAVVMGNEVKGVQQEVIDHSDGCIEIPQYGTKHSLNVSVTA
FT                   GIVIWDLFKKLK"
FT   misc_feature    136..570
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 75.5, E-value 9.7e-20"
FT   CDS_pept        749..2218
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0002"
FT                   /old_locus_tag="BF0002"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron outer
FT                   membrane protein TolC, putative BT0857 SWALL:AAO75964
FT                   (EMBL:AE016929) (490 aa) fasta scores: E(): 4.6e-35, 27.45%
FT                   id in 488 aa, and to Bacteroides thetaiotaomicron outer
FT                   membrane protein TolC, putative BT0671 SWALL:AAO75778
FT                   (EMBL:AE016928) (499 aa) fasta scores: E(): 2.3e-31, 24.54%
FT                   id in 493 aa, and to Bacteroides thetaiotaomicron putative
FT                   outer membrane protein OprM precursor BT1530 SWALL:AAO76637
FT                   (EMBL:AE016932) (492 aa) fasta scores: E(): 6.2e-28, 24.74%
FT                   id in 489 aa, and to Neisseria meningitidis putative outer
FT                   membrane lipoprotein MtrE or NMA1968 SWALL:Q9JT52
FT                   (EMBL:AL162757) (467 aa) fasta scores: E(): 4.8e-05, 20.21%
FT                   id in 371 aa, and to Acinetobacter baumannii AdeC outer
FT                   membrane protein SWALL:Q93E18 (EMBL:AF370885) (465 aa)
FT                   fasta scores: E(): 6.3e-05, 20.53% id in 414 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05781"
FT                   /db_xref="GOA:Q5LJ95"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ95"
FT                   /protein_id="CAH05781.1"
FT                   /translation="MKTLLVYILVFSLCYTNAYCQSIPREVTLDEVINRLSLESSSAKI
FT                   ELLNFQNDLLQYENYKKSFLPAFVLNFNPINFNRSLRLLQQPIDGSYSYVEDNSNNTNF
FT                   GTTVRQKISITGGELSIGSNINYLNEFSRKQNSFSTNPFFISYSQQLWGGGKLQRLENK
FT                   IERAKNEVAVKQYCSNIAQIQQQALTLYLSAILSKMDSELAIDIKQSNDTLLHIAEIKL
FT                   RNGSITEYDYKQMELQSLNLQYMYENAVRHYAESRQKLFTFLGIENNAEITIPDFDLPL
FT                   TIDARLAIYYVKKNNPISNQQEIQQLEEEKNLFSIKLKNRFNGNISLNYGINQYAETLA
FT                   DAYRHGNTRQSVIIEFQIPIFQWGINKNNIRIAKNNYDASRLRIEKKIFEFENEVKEKI
FT                   NAYDHSVKLWLTASRAYALSKEQYKMLTKKFSLGKVSVYELATAQKERNDAMQRYYSAI
FT                   KDSYESFFTLRNLALYDFKKNVELEKILFND"
FT   misc_feature    1721..2110
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 32.3, E-value 2.1e-09"
FT   CDS_pept        2211..3182
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0003"
FT                   /old_locus_tag="BF0003"
FT                   /product="hypothetical protein"
FT                   /note="Limited similarity to Bacteroides thetaiotaomicron
FT                   hypothetical protein BT4283 SWALL:AAO79388 (EMBL:AE016944)
FT                   (329 aa) fasta scores: E(): 1.5e-08, 29.44% id in 180 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05782"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ94"
FT                   /protein_id="CAH05782.1"
FT                   /translation="MISDTTIRKLVDYISLNACSVNSSGLYNGKSGISLALFETAKCLQ
FT                   DTEIEDKAFSLFQESLIRKTNDYGFENGMSGIGYVLIYLITNKLIDADFEDLFGDQREA
FT                   IIKHFENIDKQPDKLLVSYKIIYFLFVLDKLQKQDERIYSIIEKIFQGLELYLSLQFFD
FT                   WKNIYYINSKDYVLQMYEAYLKLVDFCNYKYFSKSLMDSYVTLYSEGRIASSLVRGYYL
FT                   HSIITKNNMVGFNDVIRDHIRYGQKNINPAILFLDQKINLTGIIENADENRVKIQRIEM
FT                   DLFEESLERIKRMVRPNCIHVGYQYGLARYLGFCANKKFPLL"
FT   CDS_pept        3196..4035
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0004"
FT                   /old_locus_tag="BF0004"
FT                   /product="putative sugar transferase"
FT                   /note="Similar to Vibrio cholerae sugar transferase
FT                   SWALL:O34234 (EMBL:Y07786) (337 aa) fasta scores: E():
FT                   1.7e-22, 40.16% id in 239 aa, and to Bacteroides
FT                   thetaiotaomicron putative glycosyltransferase BT4281
FT                   SWALL:AAO79386 (EMBL:AE016944) (277 aa) fasta scores: E():
FT                   4.5e-42, 41.45% id in 275 aa, and to Vibrio cholerae
FT                   ORF139-19 protein SWALL:P74947 (EMBL:AB012956) (337 aa)
FT                   fasta scores: E(): 1.5e-22, 39.75% id in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05783"
FT                   /db_xref="GOA:Q5LJ93"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ93"
FT                   /protein_id="CAH05783.1"
FT                   /translation="MCEISVVMPVYNAEMHIKDAIESVLEQSFVDFEFILIDDGSTDHT
FT                   SSIIQSYNDKRVRLIQNSHNFIESLNLGIENSLGKYMARMDGDDIMHIDRLKIQYAIMQ
FT                   EYPDVTVCGTWMNSIGTYSQTNGLLSTLSGWVEQPLLKFTKGNFLFHPTTMIRMDFLKK
FT                   NALKYENYPYAEDFKFWVEIAKSGGRFYIDSQPLLYYRISDSQVSSQKSSEQRATTESI
FT                   INEVLEYLMELNKNEYPELAAAYGDLCKLYEKQLLTKCEVLTLFQTLFSKNEKKLNL"
FT   misc_feature    3208..3690
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 121.9, E-value 1e-33"
FT   CDS_pept        4069..4602
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0005"
FT                   /old_locus_tag="BF0005"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ92"
FT                   /protein_id="CAH05784.1"
FT                   /translation="MKKLTRKSLNELAKTMPVIEESLQMSYVGGGNGTSANPYTQAEFD
FT                   NMLSNDNWNGGYVEGMGYVATNTYIYGSSVYSGSVSQMYYTFPDYVTSISSTGWDRFLS
FT                   EAVGLTPLGSLVSHVSQDITNMELSILRELLEKGYNASSSFNFVKTNIPYGGTQISVYD
FT                   AATGQFVTSRTVGE"
FT   CDS_pept        4663..6468
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0006"
FT                   /old_locus_tag="BF0006"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4273 SWALL:AAO79378 (EMBL:AE016944)
FT                   (519 aa) fasta scores: E(): 6e-13, 23.65% id in 503 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05785"
FT                   /db_xref="GOA:Q5LJ91"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ91"
FT                   /protein_id="CAH05785.1"
FT                   /translation="MKYLILLASVIFLAQSCSVAPSMRESARSYDWATYTNFSWQSKID
FT                   SAISSYPLLLYPSYEAKGSAGFTVPLFYHMDKKKRADIEVRIKYKTENCNDLYLKLSGI
FT                   SECREVTSVDTFRLSAANTWRVARRSVDIASPLLLGVALEAQGEKPWKKDFPVDPLGSA
FT                   DNSFKPGEYSKIWIDSLDILIDGKYAVEPPSLNNGATASVRELDVIPVNGDDLKSLSFS
FT                   DKRILAIGESVHGTGTMNDMGVEIIKNRIEHGKCRLVLLEMPLTLSFHINRYLEGDERF
FT                   KPDSIASSFDKVLFSSSSFVSLMRWIKEYNRHSEEKVSFFGIDRNIYRLQSSIDLFYFF
FT                   YTLRRGKGDEGLKAICNSLLLSDEKFPFKGADSVLHANHGFKGILTRREAEIMSYCLNA
FT                   EEEATVDELNRFRGRDSGMYENAKFLMKTMLKKDETTTVYCHLGHANYTSIAGWLGSDM
FT                   RPFGEYMKGSYGDDYSAVGLLAGGGSYLTWVFPGKMGIRRLQSSSSAGLEYCIERSGIS
FT                   PCYLSMDKLSDADVLKMRYIGNTESKIGQFQWVFPKCMMDGVLFTKNASAINKREEFFK
FT                   MNLDYHVQTLFALMYLYEKKRKWIP"
FT   misc_feature    4663..4719
FT                   /note="Signal peptide predicted for BF0006 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.647 between residues 19 and 20"
FT   misc_feature    4681..4713
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        6658..8469
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0007"
FT                   /old_locus_tag="BF0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4273 SWALL:AAO79378 (EMBL:AE016944)
FT                   (519 aa) fasta scores: E(): 1.1e-15, 26.02% id in 488 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05786"
FT                   /db_xref="GOA:Q5LJ90"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ90"
FT                   /protein_id="CAH05786.1"
FT                   /translation="MNSITKLHVLFFFVFIFYAVSCTAKLEKQTYTNVYDLHFAMRFDS
FT                   AVVYPWRENGAYSNYTIPAYIQDSNRNLFAKKYFKGFPFSKRLRSEYEQRILLPNNNIK
FT                   EAVIGFEGKGDNIKLVSIILDAIGKQENILFSDTLRFRPDSILSLVTQNINLNNAEMLN
FT                   VRINVEGEIDKNAYIAFSRLDILIDGKPIDEFPVRTLSPLIVDKKINYTGINVDRKIGL
FT                   EQINEINDKKIIGLGESVHGNDGIKNLAYQLIIQAVERLNCKLVLQEMPLEQSFAYNRF
FT                   IQDDNYELDSSLVINHATINFLKRLRSFNSGKTKDSKVKLYGMDYNSILSSTQSSAMDI
FT                   FDFITGLNKKSQIPEVDQLSLLLMKKDRNCAINFLDIHRDKIKKLLTAEEIECILHILR
FT                   VSKQAGDGGIERFIRRDSIMFVNARFLIDKFAKDENVKTVIYGHAGHINPISSYPAVPC
FT                   IPFGRYMRKAYGESYSPLLFLIGSGEAMAYDEHYNRKDNWLSSPPENSMEYFLSLIDDN
FT                   VFYTPLTVDFNELTLSRLQGSHHIPQEFYPFNLYQRFKGVFFIKSTDCTHKDEKEISFE
FT                   KASDRLIMKIKQRQEKIKEIQKRIENL"
FT   misc_feature    6658..6729
FT                   /note="Signal peptide predicted for BF0007 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.940) with cleavage site
FT                   probability 0.683 between residues 24 and 25"
FT   CDS_pept        8625..9743
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0008"
FT                   /old_locus_tag="BF0008"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to N-terminus of Bacteroides
FT                   thetaiotaomicron putative glycosyltransferase BT4280
FT                   SWALL:Q89ZU4 (EMBL:AE016944) (577 aa) fasta scores: E():
FT                   8.8e-59, 43.73% id in 375 aa, and to entire protein of
FT                   Streptococcus thermophilus EPS10P SWALL:Q8GP63
FT                   (EMBL:AF454500) (376 aa) fasta scores: E(): 4.2e-21, 27.48%
FT                   id in 382 aa, and to Thermoanaerobacter tengcongensis
FT                   predicted glycosyltransferases RfaG2 or TTE0275
FT                   SWALL:Q8RCY0 (EMBL:AE013000) (404 aa) fasta scores: E():
FT                   5.7e-09, 25.66% id in 300 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05787"
FT                   /db_xref="GOA:Q5LJ89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ89"
FT                   /protein_id="CAH05787.1"
FT                   /translation="MNIAFLTTLNPADINNWSGTTFHLFHALSRKHHVKVIGQNTLPQA
FT                   AYFTKDNCIKKNPLENYVSVFGKLCTEQLTNYDLVFFGDLYLAPFLDVNVPVVHLSDVT
FT                   YHSFQSYLNPLKNEEQIKKIEMMEKKLLNKYTAIIYSSEWAKQSTINYYDIEPGKIHVV
FT                   EFGANIPTPSDYKIDIQTDICNLVFIGKNWQKKGGDKVLGAYRKLKSDGFRCTLTIIGS
FT                   IIREPYDEDENLVIIPYLDKSQPEHLERFCNILQEAHFLVLPTEFDAFGIVFCEASAYA
FT                   VPSIAANVGGVSQPVREGKNGYLLMPDATAEDYAEKIKSVFADKENYLKLRMSSRQEFE
FT                   TRLNWEVWSEKVNKILEEIVEEHHKNNGNKQQ"
FT   misc_feature    9129..9638
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 38.2, E-value 1.6e-08"
FT   CDS_pept        9724..10392
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0009"
FT                   /old_locus_tag="BF0009"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to C-terminus of Bacteroides
FT                   thetaiotaomicron putative glycosyltransferase BT4280
FT                   SWALL:Q89ZU4 (EMBL:AE016944) (577 aa) fasta scores: E():
FT                   1.4e-45, 57.35% id in 204 aa, and to entire Yersinia pestis
FT                   hypothetical protein YPO1382 or Y2791 SWALL:Q8ZGC1
FT                   (EMBL:AJ414148) (224 aa) fasta scores: E(): 0.48, 25.78% id
FT                   in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05788"
FT                   /db_xref="GOA:Q5LJ88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ88"
FT                   /protein_id="CAH05788.1"
FT                   /translation="MGTNNSDFYLPVYVINLKERTERRQHIEEQFQGKVEFALHWIEAI
FT                   EHSIGAVGLWQSMLKAVQTAIDKRDDIMIICEDDHIFTPAYNKDYLFANIIGANAQGSE
FT                   LLSGGVGGFGTAVPVDTNRYWMDWFWSTQFIIIFKPLFQKILDYDFKDTDTADGVLSVL
FT                   AKDKMTIYPFISVQKDFGYSDVTVYNGTPGMISNYFSQANYRLRMIHHVSHKFKEQAKR
FT                   "
FT   CDS_pept        10512..11747
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0010"
FT                   /old_locus_tag="BF0010"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   hemolysin secretion protein BT4289 SWALL:AAO79394
FT                   (EMBL:AE016944) (416 aa) fasta scores: E(): 1.2e-35, 30.69%
FT                   id in 417 aa, and to Anabaena sp. hypothetical protein
FT                   ALR1928 SWALL:Q8YVP6 (EMBL:AP003587) (512 aa) fasta scores:
FT                   E(): 8.4e-09, 24.47% id in 286 aa, and to Xylella
FT                   fastidiosa colicin V secretion protein XF1216 SWALL:Q9PE12
FT                   (EMBL:AE003955) (420 aa) fasta scores: E(): 7.7e-08, 21.15%
FT                   id in 416 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05789"
FT                   /db_xref="GOA:Q5LJ87"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ87"
FT                   /protein_id="CAH05789.1"
FT                   /translation="MPTYWAKWVILCVGVLMGMIILLGFLIQYPDTVDGQISVTANAAP
FT                   VRLVANSNGRITLFQPNKALLHKNDVISCIESGADYKHILWIDSFLKTLSDKSTIRVAL
FT                   PDTLLLGEVSSAYNSFLLSFLQYERLLTSDIYSTMRQKLQQQIISDEAVIANFNNELRL
FT                   KKQILDNSQNQLSKDSILLSMKGISEQEYQQKFSTHLSLKESQLNLQSNRQMKQSEISR
FT                   NQLEIQRICLEETEAKEKAYSDYITRKNELSNAIKLWKEHYLQYAPVEGELEYLGFWRN
FT                   NRFVQSGQELFSIIPDKTNILGEVVIPSFGAGKVEVGQTVNVKMDNYPYDEYGLLKGVV
FT                   KSVSRITNKIKTQNGDMDTYLVIISFPDGTLTNFGKILPLDFETKGTVEIITKRKRLIE
FT                   RLFDNLKSKGEK"
FT   misc_feature    10512..10592
FT                   /note="Signal peptide predicted for BF0010 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.663) with cleavage site
FT                   probability 0.625 between residues 43 and 44"
FT   CDS_pept        11752..13935
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0011"
FT                   /old_locus_tag="BF0011"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Similar to Riemerella anatipestifer ABC transporter
FT                   SWALL:Q9AM85 (EMBL:AF327734) (678 aa) fasta scores: E():
FT                   2.1e-88, 37.46% id in 670 aa, and to Bacteroides
FT                   thetaiotaomicron ABC transporter ATP-binding protein BT4288
FT                   SWALL:AAO79393 (EMBL:AE016944) (741 aa) fasta scores: E():
FT                   1.4e-177, 62.63% id in 728 aa, and to Anabaena sp. ABC
FT                   transporter ATP-binding protein ALR1927 SWALL:Q8YVP7
FT                   (EMBL:AP003587) (1011 aa) fasta scores: E(): 1.6e-58,
FT                   32.69% id in 728 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05790"
FT                   /db_xref="GOA:Q5LJ86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ86"
FT                   /protein_id="CAH05790.1"
FT                   /translation="MLLHRFPVEYQMDSQDCGPASLKIIAKHFGKFYSLQFMRDRCGIT
FT                   KEGVSLLDLSTGAESIGLRTLAIKCTIDDVVNSIPFPAIVFWNDSHFIVVYHSDRKYIW
FT                   VSDPAKGRIKYTHEEFRKGWYQRDESQGVLLAVEPTTDFKNSKAEQEQKRNSFSSILKY
FT                   FFPYKKSFGLIFIIMLVVTVLQGMLPFISKAVIDVGIKTSDRNFINMVLIGNICILLSV
FT                   MIFNVLRDWILLHITARVNIALISDYLIKLMKLPVTFFENKLLGDILQRAQDHERIRSF
FT                   IMNNSLALIFSTLTFAVFSIILLIYNTIIFYIFLSGSVLYACWVLLFLSIRKKLDWEYF
FT                   ELLSKNQSYWVETVSTIQDIKIYNYDKYRRWKWEEIQARLYHVNKRVLAITNAQNLGAQ
FT                   FIENIKNMAIVFFCAMAVIKGEITFGIMISTQFIIGMLNGPLVQFINFVVSAQYAKISF
FT                   LRINEIRQLENEDELLSIGSTTILPERKTILLENIHFQYTPNSPLVLRNIYLQIPENKI
FT                   TAIVGGSGSGKSTLLKLLVRLYKPSHGEIKMDKMNVSAINLRQWRNMCGVVMQDGKIFS
FT                   DTILNNIVLDDEQINYTRLREVCRIAQIEDEINAMPKGFETTIGETGRGLSGGQKQRLL
FT                   IARALYRDPKFLFMDEATNSLDSINERKIVNALNNAFEQRTVVVIAHRLSTIRNADQIV
FT                   VLDKGFIVETGTHEILMEKKGHYFELVSSQVQD"
FT   misc_feature    11776..12177
FT                   /note="Pfam match to entry PF03412 Peptidase_C39, Peptidase
FT                   C39 family, score 123.2, E-value 4.1e-34"
FT   misc_feature    order(12259..12327,12370..12438,12592..12660,12673..12741,
FT                   12973..13041)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BF0011 by TMHMM2.0 at aa 170-192, 207-229, 281-303, 308-330
FT                   and 408-430"
FT   misc_feature    12262..13074
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 74.1, E-value
FT                   2.4e-19"
FT   misc_feature    13294..13848
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 192.2, E-value 6.8e-55"
FT   misc_feature    13315..13338
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    13627..13671
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(14052..14651)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0012"
FT                   /old_locus_tag="BF0012"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3166 SWALL:AAO78272 (EMBL:AE016939)
FT                   (190 aa) fasta scores: E(): 2.9e-56, 77.36% id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05791"
FT                   /db_xref="InterPro:IPR025636"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ85"
FT                   /protein_id="CAH05791.1"
FT                   /translation="MRLTIGLLMLSIALLFSSESLAQEKTNLGGYLVPMCVYNGDTIPA
FT                   FQIPTIHIFKPLKFRNRKEQMEYYKLVRNVKKVYPIAREINRTIIETYEYLQTLPNEKA
FT                   RQRHIKRVEKGLKEQYTPRMKKLSFAQGKLLIKLIDRQSHQSSYELVKAFMGPFKAGFY
FT                   QTFAALFGASLKKQYDPEGEDKLTERVILLVESGQL"
FT   misc_feature    complement(14586..14651)
FT                   /note="Signal peptide predicted for BF0012 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 22 and 23"
FT   CDS_pept        14771..16798
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0013"
FT                   /old_locus_tag="BF0013"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3167 SWALL:AAO78273 (EMBL:AE016939)
FT                   (682 aa) fasta scores: E(): 2.7e-177, 60.05% id in 681 aa,
FT                   and to Chlorobium tepidum hypothetical protein CT0480
FT                   SWALL:Q8KF52 (EMBL:AE012824) (667 aa) fasta scores: E():
FT                   6.7e-19, 26.65% id in 664 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05792"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ84"
FT                   /protein_id="CAH05792.1"
FT                   /translation="MNESISILSIFLLVNMTLITSTCHAQNRSDYPWEEVMENLSISDE
FT                   EGDIRNWENELEELTDLVNNPVNINSATKEQLQRFPFLNDVQIENLLAYIYIHGSMQTV
FT                   YELQLVEELDRQTIQYLLPFVCVEPVDKKESVTLKQILKYGKHEAVTRMDVPLYKRKGY
FT                   EKNYLGPAVYNSVKYGFHYREKVYAGIVAEKDSGEPFGALHNKQGYDYYSFYLLLHDIG
FT                   ILKTGIVGNYRLNFGQGLVLGQGSMFGKTAYSSSFTFRSTGIRRHTSTDEYNYFRGSGI
FT                   ALKWKQWTLSVFYSHRSLDGVIKGGEITSIYKTGLHRSEKEADKMNQLTMQMSGGNISY
FT                   TGNSYQLGITGVYYCFNRSYEPELKDYSKYNLHGRSFYNLGMDYKYRFHRFSIQGEAAL
FT                   GISGMAFMNQVLYSPLQDIRLMLVHRYYSHDYWAMFAHSFSEGSSVQNENGWYLAASVN
FT                   PFNRWTFFVSADLFSFPWWRYRISKASKGVDLLFQADYVPSKTVDMYVNYRYKQKERDV
FT                   TGTQGKVILPTYHHRLRYRLNYLPCSSLSLRTTVDYNHFHSSGKTAGQGYQLTQTAGWK
FT                   LPWLPLTTELQGSYFHTDDYDSRIYIYEKGLLYSFYTPSFQGEGIRLAIHFRYDMNKHW
FT                   TAIAKLGQTTYFDRDEIGSGNDLIRGNKKTDVQMQLRLKF"
FT   misc_feature    14771..14845
FT                   /note="Signal peptide predicted for BF0013 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.995 between residues 25 and 26"
FT   CDS_pept        16856..17629
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0014"
FT                   /old_locus_tag="BF0014"
FT                   /product="putative SAM superfamily protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   Fe-S oxidoreductase BT3168 SWALL:AAO78274 (EMBL:AE016939)
FT                   (257 aa) fasta scores: E(): 8.2e-83, 79.76% id in 257 aa,
FT                   and to Helicobacter pylori hypothetical protein HP0117
FT                   SWALL:Y117_HELPY (SWALL:P56080) (308 aa) fasta scores: E():
FT                   1.5e-13, 31.37% id in 255 aa, and to Thermoplasma
FT                   acidophilum hypothetical protein TA1466 SWALL:Q9HI79
FT                   (EMBL:AL445067) (325 aa) fasta scores: E(): 1.6e-13, 32.97%
FT                   id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05793"
FT                   /db_xref="GOA:Q5LJ83"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ83"
FT                   /protein_id="CAH05793.1"
FT                   /translation="MTIIFPSPIFGPVHSRRLGVSLGINLLPSDGKVCSFDCIYCECGY
FT                   NGEHRPKSSLPTREEVCMALEEKLKEMKSNGPAPDVLTFAGNGEPTAHPHFPEIIEDTL
FT                   ALRDAYFPDAKVSVLSNATFINRPAVFDALNRVDNNILKLDTVDEEYIRTVDRPNGRYD
FT                   LNGTVGLLKAFKGNCIVQTMFMKGKYKGKDVDNTSDKYVLPWLKVVKDIAPRQVMIYTI
FT                   DRETPDQDLQKATHEELDRIVALLTKEGLSASASY"
FT   misc_feature    16937..17458
FT                   /note="Pfam match to entry PF04055 Radical_SAM, Radical SAM
FT                   superfamily, score 27.7, E-value 2.3e-05"
FT   CDS_pept        17671..18180
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0015"
FT                   /old_locus_tag="BF0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT0585 SWALL:AAO75692 (EMBL:AE016928)
FT                   (169 aa) fasta scores: E(): 9.3e-45, 65.08% id in 169 aa,
FT                   and to Clostridium tetani conserved protein CTC01047
FT                   SWALL:AAO35630 (EMBL:AE015939) (164 aa) fasta scores: E():
FT                   1.3e-13, 36.07% id in 158 aa, and to Fusobacterium
FT                   nucleatum hypothetical cytosolic protein FN0320
FT                   SWALL:Q8RGH5 (EMBL:AE010544) (180 aa) fasta scores: E():
FT                   6.1e-09, 30.85% id in 175 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05794"
FT                   /db_xref="GOA:Q5LJ82"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ82"
FT                   /protein_id="CAH05794.1"
FT                   /translation="MMKPIAVSQLSDNFFETISKEWMLVTAGNKNAFNTMTANWGGIGF
FT                   LWNKPVVYVFIRPERYTFGFMEKSDYFTLSFLGEENKSIHKICGSKSGREVDKIKETGL
FT                   KPMITDKGNVLFEQGRLSLECRKLYTDVLRKENFLDPSVYEQWYTTHGGLHHVYVAEIT
FT                   SAWIKD"
FT   CDS_pept        18198..19811
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0016"
FT                   /old_locus_tag="BF0016"
FT                   /product="putative arylsulfatase precursor"
FT                   /EC_number="3.1.6.1"
FT                   /note="Similar to Klebsiella pneumoniae arylsulfatase
FT                   precursor AtsA SWALL:Q9X759 (EMBL:AJ131525) (577 aa) fasta
FT                   scores: E(): 1.2e-37, 32.13% id in 529 aa, and to
FT                   Bacteroides thetaiotaomicron arylsulfatase BT4683
FT                   SWALL:AAO79788 (EMBL:AE016946) (523 aa) fasta scores: E():
FT                   2.8e-145, 66.93% id in 499 aa, and to Bacteroides
FT                   thetaiotaomicron arylsulfatase BT3093 SWALL:AAO78199
FT                   (EMBL:AE016939) (540 aa) fasta scores: E(): 1.1e-45, 39.32%
FT                   id in 534 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05795"
FT                   /db_xref="GOA:Q5LJ81"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ81"
FT                   /protein_id="CAH05795.1"
FT                   /translation="MKNNCLICSLLFASGIQNAWGTQITDRKANPDQAKPNIILIMCDD
FT                   MGFSDLSCYGGEVHTPHIDFLAENGIRFSQFKNTGRSCPSRAALLTGRYQHEVGMGWMT
FT                   AVDEHRPGYRGQISDRYPTIAEVFRENGYHTYMSGKWHVTVEGAFTQPNGSYPVERGFE
FT                   KYYGCLSGGGSYYTPKPVFSGLQRITEFPKDYYYTTAITDSAVSFIRQHPVDEPMFMYL
FT                   AHYAPHLPLQAPKERVEACREKYKAGYDVLRKQRFERIRRNGLIDIERELPVFEKEFGG
FT                   KRPAWNSLTPQQQERWITEMATYAAMIEIMDDGIGEVIKATKEKGIFDNTIFLFLTDNG
FT                   ATNEGDMITQLRADLSNTPFRSYKQWCFQGGTSAPLIIMYGGGQPDGKKGAVRHEFTHI
FT                   IDLFPTCLDMASIEYPREFRNHAIDAPGGRTILPALKGKKLSKRDLFFEHQTSCGIISG
FT                   DWKLVRANGKQPWELFNLLQDPFEQNDLSARYPDRVKTLEKKWNQWAEKQQVFPFEYRP
FT                   WTKRINYYKSLYPDQSGKDL"
FT   misc_feature    18198..18260
FT                   /note="Signal peptide predicted for BF0016 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.517 between residues 21 and 22"
FT   misc_feature    18303..19487
FT                   /note="Pfam match to entry PF00884 Sulfatase, Sulfatase,
FT                   score 161.1, E-value 1.6e-45"
FT   misc_feature    19368..19397
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        complement(19915..20418)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0017"
FT                   /old_locus_tag="BF0017"
FT                   /product="conserved hypothetical iron transport-related
FT                   transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein, putative iron uptake factor BT2063
FT                   SWALL:AAO77170 (EMBL:AE016934) (429 aa) fasta scores: E():
FT                   9e-15, 43.69% id in 119 aa, and to Xanthomonas campestris
FT                   iron-uptake factor PiuB or XCC3955 SWALL:Q8P3W4
FT                   (EMBL:AE012516) (839 aa) fasta scores: E(): 1.9e-09, 38.88%
FT                   id in 108 aa, and to Bradyrhizobium japonicum protein
FT                   BLL7967 SWALL:BAC53232 (EMBL:AP005964) (398 aa) fasta
FT                   scores: E(): 1.9e-09, 38.23% id in 102 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05796"
FT                   /db_xref="GOA:Q5LJ80"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ80"
FT                   /protein_id="CAH05796.1"
FT                   /translation="MGYDSIRESPLMIVMKLHRWLMDDTRTTGKMIVGISTLFFIFILI
FT                   SGLTVYWPRKWKKSRLIIEHQKGRRRLMFDLHSVLGLYAALILLVCALTGLMWSFQWYR
FT                   DIVSFIFDAEVKRGAPIWKIVRALHFGTYAGMFSKIVTFIAALIGTSLPVTGYWMYLKR
FT                   KKLL"
FT   misc_feature    complement(19924..20418)
FT                   /note="Pfam match to entry PF03929 DUF337, Uncharacterized
FT                   iron-regulated membrane protein (DUF337), score -62.7,
FT                   E-value 0.00022"
FT   misc_feature    complement(order(19936..20001,20116..20184,20260..20328))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BF0017 by TMHMM2.0 at aa 31-53, 79-101 and 140-161"
FT   CDS_pept        complement(20542..22956)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0018"
FT                   /old_locus_tag="BF0018"
FT                   /product="putative iron transport receptor protein"
FT                   /note="Similar to Salmonella typhimurium ferrichrome iron
FT                   receptor FhuA SWALL:O86925 (EMBL:Y14025) (729 aa) fasta
FT                   scores: E(): 3.2e-30, 24.85% id in 684 aa, and to Anabaena
FT                   sp. ferrichrome-iron receptor ALR2626 SWALL:Q8YTT7
FT                   (EMBL:AP003590) (872 aa) fasta scores: E(): 1.2e-43, 28.55%
FT                   id in 676 aa, and to Anabaena sp. ferrichrome iron receptor
FT                   ALL4924 SWALL:Q8YMK9 (EMBL:AP003598) (858 aa) fasta scores:
FT                   E(): 1.3e-37, 25.97% id in 716 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05797"
FT                   /db_xref="GOA:Q5LJ79"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ79"
FT                   /protein_id="CAH05797.1"
FT                   /translation="MKQIYSTLLLLVLLIFPSLLFATEPESVDRVPAIRGVVYDETDTP
FT                   LASATVQIEGTTIGTTTNSEGRFILRNLARKVYKINVSFVGYVTQTRTVDLTSRSVAQL
FT                   SFTLLPDDNLLSTVEVFGERYKQPKKLDAITRMPLRPSEQIQSISVISEKSITEQGALT
FT                   VTDVARNVPGVTLFGSYGGVRESMSIRGYRGVPILKNGVRIDSDFRTGSALSEMQGVES
FT                   IQVIKGSAAVTQGIGNDLGSAGGVINVVTKTPKFTNEGEVSLRAGSWGLFRPTFDVQSV
FT                   LDKNQTIAFRMNGAFERSDNYRPVIHSNRVYINPSLEWRPDDKTSVTIEMDYLNDNRTP
FT                   YTSSVNLSKDTEENLYDMPHNKFLGFKNDNVNNKTLTYAARITRQLTDNISVRAAYFGS
FT                   SYKVDNTSTSVKTVVNKEYNMRRRTISRSLRDDRNSTFQLDFIGRDIFTGPVKHTFQLG
FT                   FDYKNTDLSITNYTPVNIDTINVLAPSISNVLPVAVKFVPETPVESNSSSYGIMAQEVM
FT                   TFNKYIKAILGLRYSYISSQDGTSAGPTTGDAWNPMLGIMLTPIKNINLFGSYTTTTSL
FT                   LHAARRMENGDEIGPSKTRQFEVGIKSDWLNNRLRFNLTYFDILTKNLSYSTYHPGTTQ
FT                   PTGYFDKAGSLKRKGIETELSGSILENLQVMMGYAYLDAKYENSPAFKNGSAPMNTPKH
FT                   TANGWIQYRFDKGVLKRLSAGIGVYFVGKRPVNDFAIKPDGHGSMTNEKPFDMPGYTTI
FT                   NAQLAYSIHKFTARVYLNNLFDALGYNSYYRGGYINQIDPRNFSAVISYHF"
FT   misc_feature    complement(20545..22533)
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score 253.8, E-value 2e-73"
FT   misc_feature    complement(21667..21732)
FT                   /note="Predicted helix-turn-helix motif with score 994.000,
FT                   SD 2.57 at aa 409-430, sequence SVKTVVNKEYNMRRRTISRSLR"
FT   misc_feature    complement(22891..22956)
FT                   /note="Signal peptide predicted for BF0018 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS_pept        complement(23157..24836)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0019"
FT                   /old_locus_tag="BF0019"
FT                   /product="putative sulfate permease transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   sulfate transporter, permease BT3181 SWALL:AAO78287
FT                   (EMBL:AE016939) (559 aa) fasta scores: E(): 8.6e-190,
FT                   88.17% id in 558 aa, and to Chlorobium tepidum sulfate
FT                   transporter family protein CT0714 SWALL:Q8KEH5
FT                   (EMBL:AE012842) (618 aa) fasta scores: E(): 6.6e-107,
FT                   52.61% id in 555 aa, and to Clostridium perfringens
FT                   probable sulfate permease CPE1480 SWALL:Q8XKC0
FT                   (EMBL:AP003190) (551 aa) fasta scores: E(): 2.1e-106,
FT                   51.79% id in 558 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05798"
FT                   /db_xref="GOA:Q5LJ78"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ78"
FT                   /protein_id="CAH05798.1"
FT                   /translation="MKVLDFKPRLFSTLKNYSKETFMSDLMAGIIVGIVALPLAIAFGI
FT                   ASGVSPEKGIITAIIAGFIISLLGGSKVQIGGPTGAFIVIIYGIIQQYGEAGLIVATLM
FT                   AGILLILLGVFKLGAIIKFIPYPIIVGFTSGIAVTIFTTQIADIFGLNFGGEKVPGDFI
FT                   GKWMIYFRHFDTVNWWNAVVSILSIIIIAITPRFSKKIPGSLIAIIVVTIGVYVLKTYA
FT                   GIDSIDTIGDRFTIKSELPEAAIPTLNWEAIKDLFPVAITIAVLGAIESLLSATVADGV
FT                   TGDKHDSNTELIAQGTANLITPLFGGIPATGAIARTMTNINNGGKTPVAGIIHAIVLLL
FT                   ILLFLMPLAQYIPMACLAGVLVIVSYNMSEWRTFKALLKNPKSDVTVLLITFFLTIIFD
FT                   LTIAIEVGLVIACILFMRRVMETTEISVIKDEIDPNDELDIAACEEHLIIPAGVEVYEI
FT                   NGPYFFGIATKFEETMAQLGDRPKVRIIRMRKVPFIDSTGIHNLTSLCKMSQKEKITIV
FT                   LSGVNEKVHKTLEKSGFYELLGKQNICPNINVALDRAKEIIN"
FT   misc_feature    complement(23187..23501)
FT                   /note="Pfam match to entry PF01740 STAS, STAS domain, score
FT                   55.1, E-value 1.3e-13"
FT   misc_feature    complement(23580..24503)
FT                   /note="Pfam match to entry PF00916 Sulfate_transp, Sulfate
FT                   transporter family, score 306.8, E-value 2.3e-89"
FT   misc_feature    complement(order(23607..23675,23733..23786,23796..23855,
FT                   23892..23960,24003..24071,24183..24236,24246..24314,
FT                   24414..24482,24492..24551,24570..24674,24702..24761))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BF0019 by TMHMM2.0 at aa 26-45, 55-89, 96-115, 119-141,
FT                   175-197, 201-218, 256-278, 293-315, 328-347, 351-368 and
FT                   388-410"
FT   CDS_pept        25097..25675
FT                   /transl_table=11
FT                   /gene="rbr"
FT                   /gene_synonym="rr"
FT                   /locus_tag="BF9343_0020"
FT                   /old_locus_tag="BF0020"
FT                   /product="putative rubrerythrin"
FT                   /note="Similar to Porphyromonas gingivalis rubrerythrin Rr
FT                   or Rbr SWALL:RUBY_PORGI (SWALL:Q9AGG3) (200 aa) fasta
FT                   scores: E(): 2.7e-49, 66.66% id in 192 aa, and to
FT                   Bacteroides thetaiotaomicron rubrerythrin BT3182
FT                   SWALL:AAO78288 (EMBL:AE016939) (192 aa) fasta scores: E():
FT                   4.8e-71, 94.79% id in 192 aa, and to Moorella thermoacetica
FT                   rubrerythrin Rbr SWALL:Q9RMF8 (EMBL:AF202316) (191 aa)
FT                   fasta scores: E(): 1.9e-46, 67.19% id in 189 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05799"
FT                   /db_xref="GOA:Q5LJ77"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ77"
FT                   /protein_id="CAH05799.1"
FT                   /translation="MTKSIKGTQTEKNLLTSFAGESQARMRYTYFASVAKKEGYEQIAA
FT                   IFTETADQEKEHAKRMFKFLEGGMVEITASYPAGVIGNTLQNLQAAAAGEHEEWSLDYP
FT                   HFADVAEQEGFPMIAAMYRNISIAEKGHEERYLAFVKNIEVASVFAKEGEVVWQCRNCG
FT                   YIEVGKEAPEVCPACLHPQAYFEIKKENY"
FT   misc_feature    25121..25525
FT                   /note="Pfam match to entry PF02915 Rubrerythrin,
FT                   Rubrerythrin, score 209.4, E-value 4.7e-60"
FT   CDS_pept        complement(25759..27330)
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /gene_synonym="nicB"
FT                   /locus_tag="BF9343_0021"
FT                   /old_locus_tag="BF0021"
FT                   /product="putative exported L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="Similar to Escherichia coli L-aspartate oxidase NadB
FT                   or NicB or B2574 SWALL:NADB_ECOLI (SWALL:P10902) (540 aa)
FT                   fasta scores: E(): 6.3e-85, 46.4% id in 528 aa, and to
FT                   Bacteroides thetaiotaomicron L-aspartate oxidase BT3184
FT                   SWALL:AAO78290 (EMBL:AE016939) (523 aa) fasta scores: E():
FT                   1.7e-194, 94.07% id in 523 aa, and to Chlorobium tepidum
FT                   L-aspartate oxidase NadB or CT0561 SWALL:Q8KEX1
FT                   (EMBL:AE012830) (531 aa) fasta scores: E(): 1.2e-100,
FT                   51.83% id in 517 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05800"
FT                   /db_xref="GOA:Q5LJ76"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ76"
FT                   /protein_id="CAH05800.1"
FT                   /translation="MVKKFDFLVIGSGIAGMSFALKVAHKGKVALVCKSGLEEANTYFA
FT                   QGGVASVTNLLVDNFEKHIEDTMIAGDWISDRTAVEKVVREAPAQIQELISWGVNFDKN
FT                   EKGEFDLHREGGHSEFRILHHKDNTGAEIQDSLIRAVQQHPNITVIENHFAIEILTQHH
FT                   LGVTVTRQTPNIKCYGAYILDPKTGKVDTYLAKVTLMATGGVGAVYQTTTNPLVATGDG
FT                   IAMVYRAKGTVKDMEFVQFHPTALYHPGDRPSFLITEAMRGYGGVLRTMDGKEFMQKYD
FT                   PRLSLAPRDIVARAIDNEMKNRGDDHVYLDVTHKDPEETKKHFPNIYEKCLSLGIDITR
FT                   EYIPVAPSAHYLCGGIKVDLNGQSSIERLYAAGECSCTGLHGGNRLASNSLIEAVVYAD
FT                   AAARHCLSVIDQYTYNEEIPEWNDEGTRSPEEMVLITQSMKEVNQIMSTYVGIVRSDLR
FT                   LKRAWDRLDILYEETESLFKRSVASKEICELRNMINVGYLIMRMAMERKESRGLHYTVD
FT                   YPHAGK"
FT   misc_feature    complement(25762..26016)
FT                   /note="Pfam match to entry PF02910 succ_DH_flav_C, Fumarate
FT                   reductase/succinate dehydrogenase flavoprotein C-terminal
FT                   domain, score 4.7, E-value 3.9e-08"
FT   misc_feature    complement(26080..27024)
FT                   /note="Pfam match to entry PF00890 FAD_binding_2, FAD
FT                   binding domain, score 439.8, E-value 2e-129"
FT   misc_feature    complement(27271..27330)
FT                   /note="Signal peptide predicted for BF0021 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.835) with cleavage site
FT                   probability 0.723 between residues 20 and 21"
FT   CDS_pept        27438..27836
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0022"
FT                   /old_locus_tag="BF0022"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3185 SWALL:AAO78291 (EMBL:AE016939) (131 aa)
FT                   fasta scores: E(): 4.7e-38, 77.16% id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05801"
FT                   /db_xref="GOA:Q5LJ75"
FT                   /db_xref="InterPro:IPR009589"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ75"
FT                   /protein_id="CAH05801.1"
FT                   /translation="MNRIFHARIVWYQYFLLVVLGVNAFGFLWCKNIILATLMMLFLIV
FT                   VIEQIIHTVYTVTADGLLLLNHGRFIRKKTIPIAEITSIRKVHSMKFGSFSVTNYLLIE
FT                   YGKGKYASVLPVKEKEFMELIEKTRNLI"
FT   misc_feature    order(27456..27524,27534..27602)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0022 by TMHMM2.0 at aa 7-29 and 33-55"
FT   CDS_pept        27843..29186
FT                   /transl_table=11
FT                   /gene="pdhD"
FT                   /locus_tag="BF9343_0023"
FT                   /old_locus_tag="BF0023"
FT                   /product="putative dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Similar to Bacillus stearothermophilus
FT                   dihydrolipoamide dehydrogenase PdhD SWALL:DLD1_BACST
FT                   (SWALL:P11959) (470 aa) fasta scores: E(): 1.3e-51, 36.94%
FT                   id in 452 aa, and to Bacteroides thetaiotaomicron
FT                   dihydrolipoamide dehydrogenase BT3186 SWALL:AAO78292
FT                   (EMBL:AE016939) (447 aa) fasta scores: E(): 6.7e-141,
FT                   86.13% id in 447 aa, and to Bacteroides thetaiotaomicron
FT                   dihydrolipoamide dehydrogenase BT0309 SWALL:AAO75416
FT                   (EMBL:AE016927) (447 aa) fasta scores: E(): 6.5e-94, 57.87%
FT                   id in 451 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05802"
FT                   /db_xref="GOA:Q5LJ74"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ74"
FT                   /protein_id="CAH05802.1"
FT                   /translation="MKYQVIIIGGGPAGYTAAEAAGKAGLSVLLFEKQNLGGVCLNEGC
FT                   IPTKTLLYSAKTYDGAKHASKYAVTVPEVFFDLPKIIARKSKVVRKLVLGVKSKLTSNN
FT                   VTIISGEATILDKNTVRCGEETYECDNLILCTGSETFIPPIPGIDSVNYWTHREALDNK
FT                   ELPASLAIVGGGVIGMEFASFFNSLGVKVTVIEMMDEILGGMDKELSALLRADYAKRGI
FT                   QFLLSTKVVSLAQTEEGAVVSYENAEGAGSVIAEKLLMSVGRRPVTKGFGLENLNLQRT
FT                   ERGSIVVNGQMESSLPGVYVCGDLTGFSLLAHTAVREAEVAVHAILGKEDRMSYAAIPG
FT                   VVYTNPEIAGVGQTEESLTAKGIAYRAVKLPMAYSGRFVAENEGVNGVCKVLLGEDDTI
FT                   LGAHVLGNPASEIITLAGMAVEMKLKAAEWKKIVFPHPTVAEIFREAL"
FT   misc_feature    27843..27902
FT                   /note="Signal peptide predicted for BF0023 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.622) with cleavage site
FT                   probability 0.431 between residues 20 and 21"
FT   misc_feature    27852..28784
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 327.0, E-value
FT                   1.9e-95"
FT   misc_feature    27951..27983
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   misc_feature    28854..29183
FT                   /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 111.1, E-value 1.8e-30"
FT   CDS_pept        29290..30699
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="BF9343_0024"
FT                   /old_locus_tag="BF0024"
FT                   /product="putative exported D-alanyl-D-alanine
FT                   carboxypeptidase penicillin-binding protein"
FT                   /EC_number="3.4.16.4"
FT                   /note="Similar to Escherichia coli penicillin-binding
FT                   protein 4 precursor DacB or B3182 SWALL:PBP4_ECOLI
FT                   (SWALL:P24228) (477 aa) fasta scores: E(): 2.9e-24, 25.95%
FT                   id in 470 aa, and to Bacteroides thetaiotaomicron
FT                   penicillin-binding protein, D-alanyl-D-alanine
FT                   carboxypeptidase BT3187 SWALL:AAO78293 (EMBL:AE016939) (468
FT                   aa) fasta scores: E(): 3.4e-131, 68.87% id in 469 aa, and
FT                   to Shewanella oneidensis penicillin-binding protein 4 DacB
FT                   or SO2394 SWALL:Q8EEI8 (EMBL:AE015680) (507 aa) fasta
FT                   scores: E(): 8.2e-25, 25.81% id in 461 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05803"
FT                   /db_xref="GOA:Q5LJ73"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ73"
FT                   /protein_id="CAH05803.1"
FT                   /translation="MKKLNLFILFSFCFSIITWGQANFAAIDSLIKKELPQGSEVGISV
FT                   YDLTARKTLYTYRDTKLSRPASTMKLLTTITALARSDADEPFRTEVWYKGTIEHDTLRG
FT                   DIYVVGGFDPEFNDEGMNALVEEVITFPFSVLKGNIYGDISMKDSLYWGSGWAWDDTPS
FT                   SFQPYLSPLMYHKGMVKVTAVPGATRGDSARLSFEPSSSYYTMTNETKTRTSSAGKFSV
FT                   SRGWLENKNNLIVSGNVENRRIGDVNVYSSQDFFMHTFVERLRNKGIEISNHYAFDSFR
FT                   SDSLSICMARWECPAQDVIDQIMKESDNLSAEALLCRLGARATGKKQVSAKDGIEEIYR
FT                   LIQDLGHDPDNYKIADGCGLSNYDYLSPALLVDFLKFAYSRTDIFRKLYKALPVAGIDG
FT                   TLKNRMKQGAAFKNVHAKTGSYTAINTLAGYLKMANGHQVAFAIMNQNILSAAKARNFQ
FT                   NKVCEILANHQ"
FT   misc_feature    29290..29364
FT                   /note="Signal peptide predicted for BF0024 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.994) with cleavage site
FT                   probability 0.745 between residues 25 and 26"
FT   misc_feature    29482..30627
FT                   /note="Pfam match to entry PF02113 Peptidase_S13,
FT                   D-Ala-D-Ala carboxypeptidase 3 (S13) family, score 133.5,
FT                   E-value 3.4e-37"
FT   CDS_pept        complement(30775..32274)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0025"
FT                   /old_locus_tag="BF0025"
FT                   /product="putative CoA transferase"
FT                   /EC_number="2.8.3.-"
FT                   /note="Similar to Clostridium kluyveri
FT                   succinyl-CoA:coenzyme A transferase Cat1 SWALL:CAT1_CLOKL
FT                   (SWALL:P38946) (538 aa) fasta scores: E(): 7.1e-84, 47.03%
FT                   id in 489 aa, and to Bacteroides thetaiotaomicron putative
FT                   coenzyme A transferase BT3193 SWALL:AAO78299
FT                   (EMBL:AE016939) (499 aa) fasta scores: E(): 1.1e-180,
FT                   92.58% id in 499 aa, and to Escherichia coli hypothetical
FT                   protein Ygfh or B2920 SWALL:YGFH_ECOLI (SWALL:P52043) (492
FT                   aa) fasta scores: E(): 3.7e-92, 48.96% id in 484 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05804"
FT                   /db_xref="GOA:Q5LJ72"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ72"
FT                   /protein_id="CAH05804.1"
FT                   /translation="MAFKSISAAEAASLVKHGYNIGLSGFTPAGTAKAVTSEIAKIAEA
FT                   EHAKGNPFQIGIFTGASTGDSCDGILSRVKAIRYRAPYTTNPDFRKAVNNGEIAYNDIH
FT                   LSQMAQEVRYGFMGKVNVAIIEACEVTPDGKIYLTAAGGIAPTVCRLADQIIVELNSAH
FT                   SKNMMGMHDVYEPLDPPYRREIPIYKPSDRIGLPYIQVDPKKIVGIVETNWPDEARSFA
FT                   AADPITDKIGQNVADFLAADMKRGIIPSTFLPLQSGVGNIANAVLGALGRDQTIPAFEM
FT                   YTEVIQNSVIGLIREGRVKFGSACSLTVTNDCLQGIYDDMDFFRDKLILRPSEISNSPE
FT                   VVRRLGIISINTAIEADIYGNVNSTHIGGTKMMNGIGGSGDFTRNAYISIFTCPSVAKE
FT                   GKISSIVPMVSHLDHSEHSVNIVITEQGVADLRGKSPKERAQAIIENCAHPDYKQILWD
FT                   YLKLAGNKSQTPHAIQAALGMHAELAKSGDMKNVNWAEYER"
FT   misc_feature    complement(30808..32274)
FT                   /note="Pfam match to entry PF02550 AcetylCoA_hydro,
FT                   Acetyl-CoA hydrolase/transferase, score 520.5, E-value
FT                   1.1e-153"
FT   CDS_pept        complement(32311..32640)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0026"
FT                   /old_locus_tag="BF0026"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ71"
FT                   /protein_id="CAH05805.1"
FT                   /translation="MDDIVKVLVIMAAFALPLIRQIKKSKTERSAQKPFVPIPDTEEPE
FT                   VLKVTRKYQPLHSQPTSQKVEVKKNKTVSQKIETTPANDPEFTIHSAEEARKAIIWSEI
FT                   LNRKY"
FT   CDS_pept        32971..34344
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0027"
FT                   /old_locus_tag="BF0027"
FT                   /product="putative SAM/TRAM family methylase protein"
FT                   /note="Similar to Salmonella typhimurium protein MiaB
FT                   (methylthiolation of isopentenylated a37 derivatives in
FT                   rRNA) or STM0670 SWALL:Q9RCI2 (EMBL:AJ249116) (474 aa)
FT                   fasta scores: E(): 1.6e-62, 42.15% id in 446 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT3195 SWALL:AAO78301 (EMBL:AE016939) (455 aa) fasta
FT                   scores: E(): 4.1e-173, 95.16% id in 455 aa, and to
FT                   Chlorobium tepidum hypothetical protein CT1993 SWALL:Q8KB05
FT                   (EMBL:AE012950) (444 aa) fasta scores: E(): 8.3e-82, 50% id
FT                   in 438 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05806"
FT                   /db_xref="GOA:Q5LJ70"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ70"
FT                   /protein_id="CAH05806.1"
FT                   /translation="MNELTGADFKSATADDNKKLFIETYGCQMNVADSEVIASVMQMAG
FT                   YSVAETLEEADAVFMNTCSIRDNAEQKILNRLEFFHSMKKKKKHLIVGVLGCMAERVKD
FT                   DLIEHHHVDLVVGPDAYLTLPELIASVEAGEKAMNVELSTTETYRDVIPSRICGNHISG
FT                   FVSIMRGCNNFCTYCIVPYTRGRERSRDVESILNEVADLVSKGYKEITLLGQNVNSYRF
FT                   EKEGGEVVTFPMLLRLVAEAAPGIRVRFTTSHPKDMSDETLEVIAQVPNVCKHIHLPVQ
FT                   SGSSRILKLMNRKYTREWYLDRVAAIKRIVPDCGLTTDIFSGFHSETEEDHRESLSLME
FT                   ACGYDAAFMFKYSERPGTYASKHLEDNVPEEIKVRRLNEIIALQNRLSAESNNRCIGKT
FT                   YEVLVEGVSKRSRDQLFGRTEQNRVVVFDRGTHRIGDFVNVRITEASSATLKGEEVFS"
FT   misc_feature    33025..33321
FT                   /note="Pfam match to entry PF00919 UPF0004, Uncharacterized
FT                   protein family UPF0004, score 153.2, E-value 3.9e-43"
FT   misc_feature    33463..33525
FT                   /note="PS01278 Uncharacterized protein family UPF0004
FT                   signature."
FT   misc_feature    33463..33987
FT                   /note="Pfam match to entry PF04055 Radical_SAM, Radical SAM
FT                   superfamily, score 106.1, E-value 5.9e-29"
FT   misc_feature    34147..34338
FT                   /note="Pfam match to entry PF01938 TRAM, TRAM domain, score
FT                   59.9, E-value 4.7e-15"
FT   CDS_pept        34462..35880
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0028"
FT                   /old_locus_tag="BF0028"
FT                   /product="putative alpha-L-fucosidase protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   alpha-L-fucosidase precursor BT2970 SWALL:AAO78076
FT                   (EMBL:AE016938) (484 aa) fasta scores: E(): 3.1e-164,
FT                   77.94% id in 476 aa, and to Bacteroides thetaiotaomicron
FT                   alpha-L-fucosidase precursor BT1842 SWALL:AAO76949
FT                   (EMBL:AE016933) (438 aa) fasta scores: E(): 5.6e-32, 29.63%
FT                   id in 469 aa, and to Streptomyces coelicolor putative
FT                   glycosyl hydrolase SCO0279 or SCF85.07 SWALL:Q9S2D4
FT                   (EMBL:AL939104) (423 aa) fasta scores: E(): 4.8e-20, 28.46%
FT                   id in 383 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05807"
FT                   /db_xref="GOA:Q5LJ69"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ69"
FT                   /protein_id="CAH05807.1"
FT                   /translation="MKNKLFILFAFCISVHVYAQQPSREIPLKYGATNIGKRQDDAMKR
FT                   FRNNRLGEFIHWGLYAIPGGEWKGKVYNGAAEWLKSWAKVPAADWLELMKQWNPVKFDA
FT                   RQWARMAKEMGVKYVKITTKHHEGFCLWPSQYSQYTVAQTPYRKDILGELVKAYNDEGI
FT                   DVHFYFSVMDWSHPDYRYEITSKEDSIAFSRFLTFTDHQLKELATRYPTVKDFWFDGTW
FT                   DASIKKNGWWTAHAEQMLKELVPGVTVNSRLRADDYGKRHFDSNGRLMGDYESGYERRL
FT                   PDPVKDLQVTKWDWEACMTVPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVN
FT                   FGPQPDGDFRSEEKELAMALGCWMKRYGECIYGCDYAGWDKQDWGYYTRKGQEVYMVVF
FT                   NRPYSGLLKVKVPKGTEIERAVLPDGQVVKVTETARNEYNVAMPSQDPGEPFIIKLQVK
FT                   EASGAADGYRDALT"
FT   misc_feature    34462..34518
FT                   /note="Signal peptide predicted for BF0028 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 19 and 20"
FT   misc_feature    34474..35697
FT                   /note="Pfam match to entry PF01120 Alpha_L_fucos,
FT                   Alpha-L-fucosidase, score -6.0, E-value 2.2e-12"
FT   CDS_pept        35936..38050
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0029"
FT                   /old_locus_tag="BF0029"
FT                   /product="putative beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="Similar to Thermoanaerobacter thermosulfurogenes
FT                   beta-galactosidase LacZ SWALL:BGAL_THETU (SWALL:P26257)
FT                   (716 aa) fasta scores: E(): 5.1e-27, 27.75% id in 490 aa,
FT                   and to Bacteroides thetaiotaomicron beta-galactosidase
FT                   BT2969 SWALL:AAO78075 (EMBL:AE016938) (702 aa) fasta
FT                   scores: E(): 0, 78.77% id in 702 aa, and to Bacteroides
FT                   thetaiotaomicron beta-galactosidase BT0757 SWALL:AAO75864
FT                   (EMBL:AE016929) (682 aa) fasta scores: E(): 5e-77, 38.35%
FT                   id in 691 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05808"
FT                   /db_xref="GOA:Q5LJ68"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="PDB:3FN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ68"
FT                   /protein_id="CAH05808.1"
FT                   /translation="MRKLSYLIIVCLCLCSGVIPLMARQVTAFNTGWQFKKGPFATDPM
FT                   RAASQWDGKWETVEIPHTWNAMDMQVQSGSFYEGAGYYRKTQFFPHDLEGKRVFLRFEG
FT                   VGACAEVYVNGKLAGTHKGGYSAFACEIGTALKLGAENEIIVKADNKARPDVIPVNQNL
FT                   FGVYGGIYRPVWLIVTEQNNITVTDCASPGVYITQKDVSKKSADITVKVKLDNAGLQPA
FT                   AVTLENTIYTQEGQKVGTHSRSFDLSPQGTQTYLSTFKLKNPHLWQGRKDPYLYKVVCR
FT                   LMADGKVIDEVVQPLGVRKYEIVAGKGFFLNGEKYSMYGVTRHQDWWGLGSALKNEHHD
FT                   FDLAAIMDVGATTVRFAHYQQSDYLYSRCDTLGLIIWAEIPCVNRVTGYETENAQSQLR
FT                   ELIRQSFNHPSIYVWGLHNEVYQPHEYTAALTRSLHDLAKTEDPDRYTVSVNGYGHMDH
FT                   PVNLNADIQGMNRYFGWYEKKIQDIKPWVEQLEKDYPYQKLMLTEYGADANLAHQTEYL
FT                   GDALNWGKPFYPETFQTKTHEYQWSIIKDHPYIIASYLWNMFDFAVPMWTRGGVPARNM
FT                   KGLITFDRKTKKDSYFWYKANWSEEPVLYLTQRRNADREKRTTAVTVYSNIGTPKVYLN
FT                   GQELSGIRNGYTDVHYVFDNVSLADGKNILKAVVSTKGKEYTDEIEWNYSGEKNREIDS
FT                   YENKNEHSGF"
FT   misc_feature    35948..36016
FT                   /note="1 probable transmembrane helix predicted for BF0029
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    36029..36475
FT                   /note="Pfam match to entry PF02837 Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2, sugar binding domain, score
FT                   -22.1, E-value 3.8e-06"
FT   misc_feature    36266..36301
FT                   /note="Pfam match to entry PF04566 RNA_pol_Rpb2_4, RNA
FT                   polymerase Rpb2, domain 4, score 13.0, E-value 0.0016"
FT   misc_feature    36515..36832
FT                   /note="Pfam match to entry PF00703 Glyco_hydro_2, Glycosyl
FT                   hydrolases family 2, immunoglobulin-like beta-sandwich
FT                   domain, score 18.2, E-value 8.2e-05"
FT   misc_feature    36845..37744
FT                   /note="Pfam match to entry PF02836 Glyco_hydro_2_C,
FT                   Glycosyl hydrolases family 2, TIM barrel domain, score
FT                   -26.2, E-value 2.4e-10"
FT   CDS_pept        complement(38442..40181)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0030"
FT                   /old_locus_tag="BF0030"
FT                   /product="putative AraC family/two component family
FT                   regulatory protein"
FT                   /note="Similar to C-terminus of Prevotella bryantii two
FT                   component regulatory protein XynR SWALL:Q8GBY6
FT                   (EMBL:AJ428204) (834 aa) fasta scores: E(): 1.6e-17, 22.48%
FT                   id in 627 aa, and to C-terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT3738 SWALL:AAO78843
FT                   (EMBL:AE016942) (1330 aa) fasta scores: E(): 4.8e-21,
FT                   26.69% id in 562 aa, and to C-terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT1734 SWALL:AAO76841
FT                   (EMBL:AE016933) (1346 aa) fasta scores: E(): 5.7e-21,
FT                   26.95% id in 564 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05809"
FT                   /db_xref="GOA:Q5LJ67"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ67"
FT                   /protein_id="CAH05809.1"
FT                   /translation="MKSILTFLLIILMDIQLNYACPCSPTNTFIEMNESFASQFQTATI
FT                   IPMFLWQSSWSYPIEGLAIGLLISLIVYYRMVYSTKLFPHEKLRLILNITHKTQTPLTL
FT                   IHHLLEEIISDSLSESTSQKIKRILGYTSHIMSCYQNIAVFDDKENELHPGSSPIEFEL
FT                   YTFITSIVNQCRAYADTRQIKLNINKDFSYISCRMDEITMTAALQCLLNKMIEATPCKG
FT                   CINMDVSHSIKHWNLQITNGPECRQSHKKILSFISTFMLIHYCGSLQIIKKIIRLHGGK
FT                   LIGSYHGRSITLRVTVPINGYCNTIQCPEVVPPVMKDDKIIRPDKKQHHILLVMADTEL
FT                   SNYLHKAFSILFRITILENPEQILHFSGDRLPDIIVIDETVNGIRGKEICSKIKSNTSM
FT                   VHIPVILLISNNDNGSYLAHADCGVDKLEPRAINICRLKMDIQILINKHERIMKLLEKN
FT                   LSDNLPSPTAKSEEDTLFINKVNKLLEKNLSTESYTVDMLSADMGMCRTKFYTKIKEIT
FT                   DKTPTEYMHYFKMNKAKILLVTQQYTVTEIATFLGFCNAKYFGKRFKKFYKVPPTQYIK
FT                   EVF"
FT   misc_feature    complement(38454..38585)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   33.6, E-value 3.8e-07"
FT   misc_feature    complement(38469..38597)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(38604..38744)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   24.2, E-value 0.00025"
FT   CDS_pept        41125..42360
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0031"
FT                   /old_locus_tag="BF0031"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05810"
FT                   /db_xref="GOA:Q5LJ66"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ66"
FT                   /protein_id="CAH05810.1"
FT                   /translation="MQKQTVMKRSRLFLWILGILMQAFLISMHFYQRNMEAMYTETEYL
FT                   LKEVLNEELHRKQLELNMFYVSRIVVDTVPLTIRVTTSEGVKTYTVDLQKSKKNISQSM
FT                   AERSWHSIVCMKSCLSTDSLQQLWNERLKKSKIFANTDIHISITHLDNTTSYFKCKTCD
FT                   DLCFGTHKITFYVGNRCEIEITAFWSYLWQAIYQYNSTPFEVIGIVAAVLIIIFCSWYL
FT                   TKRYISKIRNDRRRLANDRDRERKVRMQLEKDQKRLEVKQKEYERRIKDLSLKGEEREE
FT                   ERKSMEKILKEYKMQIQKLKELRESGKEPLLYILSSKVTFDSYAKLLICGDQSISLTSQ
FT                   ACQLLDTFLNAPEYILTYEELLECLWKDGSGDMIRLRVAISRLRIVLSVDPEISIFQKD
FT                   INKYQLVLPEKG"
FT   misc_feature    order(41158..41217,41722..41790)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0031 by TMHMM2.0 at aa 12-31 and 200-222"
FT   CDS_pept        42396..42704
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0032"
FT                   /old_locus_tag="BF0032"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05811"
FT                   /db_xref="GOA:Q5LJ65"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ65"
FT                   /protein_id="CAH05811.1"
FT                   /translation="MYYMIFYWLIAFNFGVNNLNLYFMKMKNYLKAAFLLVAIVSVWVL
FT                   KPIEKSQDADPLLLQNVEALASGEDSSQTHCYGRGSVDCPVSHDKVDVVYDSYSLGE"
FT   misc_feature    order(42405..42458,42477..42530)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0032 by TMHMM2.0 at aa 4-21 and 28-45"
FT   CDS_pept        42808..43740
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0033"
FT                   /old_locus_tag="BF0033"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ64"
FT                   /protein_id="CAH05812.1"
FT                   /translation="MGKYISILILIETILLGCHSTKEKIEFSNRVICSDSISRELVVLN
FT                   DTFLFSYPLQIECIDSMLLVLDNVNNNFFHLFTLKGVPIKSFGEKGQGPIDFINVESFN
FT                   LSEDRETMYAYDTSLRKIVKYDVSSFLKDSLKSEVIQVNYDSLPQAEVPTIVYDMLSLK
FT                   DSNFLVKANHKGLRFGLLKDGKITQLYNSFSDCVNTNDDEEVWSVFCSNTKTKLRPDRT
FT                   KMLNATYLGGVLELFDLDDNCSLSLAKILYIYEPKYGIAEGAIPKYVVFNETTQIGRSF
FT                   TCHWSDNPITIGWSLIKHTSMAGFFSKKQ"
FT   CDS_pept        43795..43956
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0034"
FT                   /old_locus_tag="BF0034"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ63"
FT                   /protein_id="CAH05813.1"
FT                   /translation="MFNLCNIFQFIILNAPDYTVSDEDIIKFIWKGETSIQINTFCSAG
FT                   NKLGKRLE"
FT   CDS_pept        44128..44355
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0035"
FT                   /old_locus_tag="BF0035"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05814"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ62"
FT                   /protein_id="CAH05814.1"
FT                   /translation="MKNYMKLIFGLIVLIGYWPTTKIPKRVNSLFLQNVEALAGSEHVT
FT                   NLGCLGDGSVDCPINHIKVEHVVQGFSLGE"
FT   CDS_pept        complement(44481..44669)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0036"
FT                   /old_locus_tag="BF0036"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05815"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ61"
FT                   /protein_id="CAH05815.1"
FT                   /translation="MTTVKMTVSLIIINLVATSYSIRTRMGARIFRVATSAVEKVNATF
FT                   THSNKFFAIFVPGNLLF"
FT   CDS_pept        44820..45938
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0037"
FT                   /old_locus_tag="BF0037"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:AAO75771 (EMBL:AE016928) (382 aa)
FT                   fasta scores: E(): 4.2e-06, 21.51% id in 395 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT0661
FT                   SWALL:AAO75768 (EMBL:AE016928) (408 aa) fasta scores: E():
FT                   0.0011, 21.06% id in 394 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05816"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ60"
FT                   /protein_id="CAH05816.1"
FT                   /translation="MKNILLTLLLFILFSCKSTGDKTDCEVLHVDLVERPVPTEELFSK
FT                   ISVIPLETNDSSFLVRPVKVIIKDNGYYIVDEGVPAVFSFDEEGHLLHKIGKKGQGPGE
FT                   YREIYDAVIKEKENAVYMLSPFGSLYVYSLDGKFIKEIKLPTRSNYQLIEELDSKYFVT
FT                   WTLPASENENCISVISKESFNNVKEFWHVPPVLTTLNSKPFYNYEHKVYFSNPYQNEVY
FT                   EVRTDSLRVAYRWDFGKDNLDLKEYGFTLLEDQKVEEYKLMLQCLRDSTVPYLLRHQFQ
FT                   NKKYYYTMLTFGFRHRINLFYRKDDGKSFFFEKTAEGVLLHPLAFNEDFLTCIVFNEDF
FT                   PNYEKVLPSEEYKKLEERLEDDNPCLIKFYFK"
FT   misc_feature    44820..44879
FT                   /note="Signal peptide predicted for BF0038 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.977 between residues 20 and 21"
FT   CDS_pept        45935..46054
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0038"
FT                   /old_locus_tag="BF0038"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05817"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ59"
FT                   /protein_id="CAH05817.1"
FT                   /translation="MKNLILVLGCFFFLISCQQTEKERLEELVKNWNGKEVLL"
FT   CDS_pept        46027..46185
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0039"
FT                   /old_locus_tag="BF0039"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ58"
FT                   /protein_id="CAH05818.1"
FT                   /translation="MEWEGGTIVKKVILDRWDICISVDSNDERLCLMTKETDGGEERYH
FT                   YYCYQLN"
FT   CDS_pept        46514..47653
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0040"
FT                   /old_locus_tag="BF0040"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05819"
FT                   /db_xref="GOA:Q5LJ57"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ57"
FT                   /protein_id="CAH05819.1"
FT                   /translation="MTKNKLLSCVIGVIILSLLVGAYFYQRNKVAVHQQAERLFVQMLQ
FT                   EEIERKERNLNLFHLFSESSSDTLPLKICIITEEGKKEYEVDSLKSKKNISQNLRNRSI
FT                   HSILCEKSHLLPDSLNEHWQSMLKKDHIDTESTIHVRMENLQGKIISSSSHDGVWDTSS
FT                   GIITSYIGNRCEIEVIGLLAFSWKTILWYHWQPFGWIVICLLLMLLFICFYYKKVNRPP
FT                   ELKEVPYEVVVEKEVVVEKEVIREIIVEKETSPEKKAPLIKQICKVEGQLYGLRYGVVF
FT                   DSQNRVLNCNGKKMSLSPQQCQILKLFLDAPDYTVTDEDIIKFIWKGQSNVQINTFCSA
FT                   GNKLGKRLEQAGCGVCFRRFGSDRYRMLFIDDLVDNDLT"
FT   misc_feature    order(46532..46591,47084..47152)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0040 by TMHMM2.0 at aa 7-26 and 191-213"
FT   CDS_pept        47735..47968
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0041"
FT                   /old_locus_tag="BF0041"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05820"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ56"
FT                   /protein_id="CAH05820.1"
FT                   /translation="MKNYMKLIFGLGLIALVGYWPAAKTPKRVNSLFLQNVEALAGSEH
FT                   VTNLGCLGDGSVDCPINHIKVEYVVQGFSLGE"
FT   misc_feature    47753..47803
FT                   /note="1 probable transmembrane helix predicted for BF0041
FT                   by TMHMM2.0 at aa 7-23"
FT   CDS_pept        47969..48088
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0042"
FT                   /old_locus_tag="BF0042"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05821"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ55"
FT                   /protein_id="CAH05821.1"
FT                   /translation="MLFYINLITLESFIALLTWVRKGVDDLRPGKVLESFTPG"
FT   CDS_pept        48234..48500
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0043"
FT                   /old_locus_tag="BF0043"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05822"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ54"
FT                   /protein_id="CAH05822.1"
FT                   /translation="MSKKIFAALIVAVVATFAGYNIYQSQKTEKIVSDLVIANVEALAG
FT                   DTEGGATITCSRTCSDGVGRCYKVYDKWGNCHFDGSQTYSCTC"
FT   misc_feature    48234..48287
FT                   /note="Signal peptide predicted for BF0043 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.779 between residues 18 and 19"
FT   CDS_pept        48631..49749
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0044"
FT                   /old_locus_tag="BF0044"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:AAO75771 (EMBL:AE016928) (382 aa)
FT                   fasta scores: E(): 1.5e-06, 20.69% id in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05823"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ53"
FT                   /protein_id="CAH05823.1"
FT                   /translation="MKNISLILLLFILFSCKSTGDKTDCEVLHVDLVERPVPTEELFSK
FT                   ISVIPLETNDSSFLVRPVKVIIKDNRYYIVDEGVPAVFSFDEEGHLLHKIGKKGQGPGE
FT                   YREIYDAVIKEKENAVYMLSPFGSLYVYSLDGKFIKEIKLPTRANYQLIEELESKYFVT
FT                   WTLPASENDNCISVISKESSKNVKEFWHVPPVLTTLNSKPFYNYEHKIYFSNPYQNEVY
FT                   EVRTDSLRVAYRWDFGKDNLDLKEYGFTLLEDKKVEEYKLMLQYLRDSTVPYFLCDQYQ
FT                   NDKFYYIMLVFGLKHSKNLFYRKEDSKSFFFEKTTEGIHFEPLAFNEDFLTCIVFNEDF
FT                   PNYEKVLPPEEYKKLEERLEDDNPCLIKFYFK"
FT   misc_feature    48631..48690
FT                   /note="Signal peptide predicted for BF0044 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.976 between residues 20 and 21"
FT   CDS_pept        49746..50615
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0045"
FT                   /old_locus_tag="BF0045"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1085 SWALL:AAO76192 (EMBL:AE016930) (131 aa)
FT                   fasta scores: E(): 6e-08, 40.4% id in 99 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT4048
FT                   SWALL:AAO79153 (EMBL:AE016943) (373 aa) fasta scores: E():
FT                   3.1e-06, 34.48% id in 87 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05824"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ52"
FT                   /protein_id="CAH05824.1"
FT                   /translation="MKNLILVLGCFFFLISCQQTEKEKLEELVKNWNGKEVLFPTNPSF
FT                   TLYGKTPVDFKIPVSDYKIVTYVDSLGCSSCKLQLPKWKEFMKYADSIVGYQIPVLFFL
FT                   HPANVREMRSVLKQNRFDYPVCMDTEDTFNKVNKFPSQLNFQTFLLDKNNHVIAIGNPV
FT                   HNYDVRELYIHLISGGIDGDSLSNMRTVIKIEEDMVDLGSFDWRREQHITFEIHNIGNN
FT                   NLVVYDNKTSCGCTSVEYSKEPVQPGKSLAVKVTYKADHPEHFNKTIILYCNASASPLE
FT                   LKITGNAK"
FT   misc_feature    49746..49808
FT                   /note="Signal peptide predicted for BF0045 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.862) with cleavage site
FT                   probability 0.205 between residues 21 and 22"
FT   misc_feature    49764..49796
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        50660..50902
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0046"
FT                   /old_locus_tag="BF0046"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05825"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ51"
FT                   /protein_id="CAH05825.1"
FT                   /translation="MSYLSLIVAVVATFAGYNIYQSQRVESIMSDLTMANVEALAGSEI
FT                   NDEDCVSASNRYCSVLIVTPNGNYLETYFDQKTKY"
FT   CDS_pept        50970..52025
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0047"
FT                   /old_locus_tag="BF0047"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05826"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ50"
FT                   /protein_id="CAH05826.1"
FT                   /translation="MNKIVSFFILILVCSCSDRKEHIANILSMNSIDIKTNRINKDEVI
FT                   ARGAFPFEMIDSLFFLFNGDPSSGALVLCESNASELGHFLQKGNGFGECITPGYIGHCN
FT                   DTIYVSERSRTRRMTYLLSNHNDSLQYKCLEDVSPKMNSEFYYQICRLQSGLFVGARLF
FT                   GKEHLFTLLDESLDTLTTFARVPIDIEENANNKLAPFIGHLCIDDNTVYYASNDFSYMA
FT                   AYDILSEKEIKPVFERMYISPIIQKSANGISLDKYKHLLGFGDIRVYQNYIFATYIGKP
FT                   DITMDQENDISALVPTHLLVFNKDGVPIVKFKFPFKIRSFVFTKSKMYLLDVDCNIESV
FT                   DLVELWKHLPD"
FT   CDS_pept        52054..53106
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0048"
FT                   /old_locus_tag="BF0048"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0659 SWALL:AAO75766 (EMBL:AE016928) (345 aa)
FT                   fasta scores: E(): 2.9e-14, 22.64% id in 340 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ49"
FT                   /protein_id="CAH05827.1"
FT                   /translation="MNNMRFNLVVLFVILLSFYSCGREEKTVYDFPLEQSLKSDKEVSL
FT                   NKELLAPYLMCSYDSTLCLIDWTANPMVHVYNMNTGKEMVAFGNKGMGPDDFLSISQMY
FT                   VDMGKRSLLLYDQSLQTISSFQIDSLAQGSLSKIDCVSAPKLGMNRVYAYSDSIFYGSG
FT                   TFESGLIAKCNQKEILNQYLPFPHTEQAVNRDVNYLLFQGDLIMKPDKKRFAYLAYECD
FT                   LLSIQKVVNDTCLESVVHLNTYTPVFENQSTNEVSSVNVSTDSPKGFLRGVATENYVYA
FT                   LYSGQIGKNKAIANEVYVFDWEGRAVKKVILDRWGICISVDSNDERLCLMTKETDGGEE
FT                   RYHYYCYQLN"
FT   misc_feature    52054..52119
FT                   /note="Signal peptide predicted for BF0048 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861) with cleavage site
FT                   probability 0.766 between residues 22 and 23"
FT   CDS_pept        complement(53115..53219)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0049"
FT                   /old_locus_tag="BF0049"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ48"
FT                   /protein_id="CAH05828.1"
FT                   /translation="MLLHYLYLHNSRKDPCMKKNLKDKKYISNKPVTP"
FT   CDS_pept        53351..54817
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0050"
FT                   /old_locus_tag="BF0050"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05829"
FT                   /db_xref="GOA:Q5LJ47"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ47"
FT                   /protein_id="CAH05829.1"
FT                   /translation="MFVFLIIFFDVFVLVVNNLIFVSKINRNGKNGFSLKYIDMKYIRL
FT                   LLCILGIVLLAFLVSLYFFQRNRKLMHIKAEKLFTQVLKDEMKKKGEELDLFYSFSGIS
FT                   SDTIPLTISIMTETGSRQYKVDAGKSRKNLSQISRERSLHSVICSEKQLSPMTLSQTWA
FT                   DSLQTRHILARAAIQIVTTDLENNTLYKKSRTVNLSPELKFVVYLGERCEIEVSGFLYY
FT                   TWWSVCRYHFFPFGMIVGIALCLIVYLIYLFRVKNRLFKIQSERWLLAEKLKRREEKLV
FT                   ELASIRDQYAHQIEVQRSDAREKDILLKDLEQKLKECEDQIADLNKSKEKLVELASIRD
FT                   QYAQQVEMQRSDAREKDMLLKDLEQKSKAYEGQIAELKKAKELLGTKSLVYKLSPILTF
FT                   DAYKKILVCNEEIIPLNLQSSTLLLAFLNATDCQLTREEIEKCLSGRSRECLRTAKHRL
FT                   SKVLQIDPSISIVQHNRDLFQLQLPEIEAL"
FT   misc_feature    order(53354..53416,53474..53542,54038..54106)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BF0050 by TMHMM2.0 at aa 2-22, 42-64 and 230-252"
FT   CDS_pept        54894..55127
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0051"
FT                   /old_locus_tag="BF0051"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05830"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ46"
FT                   /protein_id="CAH05830.1"
FT                   /translation="MKKTLKVAILLIAILSMGHWMPVKQVRDLNSLSLQNVEALASGET
FT                   PIYTSCIGTGSVDCPIQHDKVKYVSQGFSLDY"
FT   misc_feature    54894..54947
FT                   /note="Signal peptide predicted for BF0051 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.970) with cleavage site
FT                   probability 0.716 between residues 18 and 19"
FT   CDS_pept        55360..55632
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0052"
FT                   /old_locus_tag="BF0052"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05831"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ45"
FT                   /protein_id="CAH05831.1"
FT                   /translation="MSKKIFAALIVAVVATFAGYNIYQSQRAEMEMSDLAMANIEALAN
FT                   DGESSTETTWSCKGTVGTCGAKCGLCGTTIPKSKGTLTGSHKCSM"
FT   misc_feature    55360..55413
FT                   /note="Signal peptide predicted for BF0052 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.988) with cleavage site
FT                   probability 0.778 between residues 18 and 19"
FT   CDS_pept        55722..56789
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0053"
FT                   /old_locus_tag="BF0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0659 SWALL:AAO75766 (EMBL:AE016928) (345 aa)
FT                   fasta scores: E(): 3.3e-08, 23.49% id in 349 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05832"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ44"
FT                   /protein_id="CAH05832.1"
FT                   /translation="MGKNFSILILIGTILLGCHSTKEKIEFSNRVICSDSISRGLVVLN
FT                   DTFLFSYPLQMECIDSMLLVLDNVNNNFFHLFTLKGVPIKSFGEKGQGPTDFINVESFN
FT                   LSEDRKNMYAYDTSLRKIVKYDVSSFLKDSLKSEVIQVNYDSLPQAEVPTIIYDMLSLK
FT                   DSNFLVKANHKGLRFGLLKDRKVTQLYNSFSDCVNTNDDEEVWSVFCSNTKTKLRPDRT
FT                   KMLNATYLGGVLELFDLDDNCSLSLAKILYIYEPKYGIAEGAIPKYVVFNETTQIGFED
FT                   IYVTNNSIYTLLHSIGSETLPSEITVFNWEGIPITKIKTGCSLSNIAVDEKDNAIYVIA
FT                   ENEQNAYELSCLSLN"
FT   CDS_pept        56949..57383
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0054"
FT                   /old_locus_tag="BF0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0659 SWALL:AAO75766 (EMBL:AE016928) (345 aa)
FT                   fasta scores: E(): 7.2e-05, 26.51% id in 132 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05833"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ43"
FT                   /protein_id="CAH05833.1"
FT                   /translation="MKPDKKRFAYLAYECDLLSIQKVVNDTCLESVVHLNTYTPLFENQ
FT                   STNEVSSVNVSTDSPKGFLRGVATENYVYALYSGQIGKNKAIANEVYVFDWEGRAVKRV
FT                   ILDRWGICISVDSNDERLCLMTKETDGGEERYHYYCYQLN"
FT   CDS_pept        57397..57528
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0055"
FT                   /old_locus_tag="BF0056"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05834"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ42"
FT                   /protein_id="CAH05834.1"
FT                   /translation="MLRVCLIYFKNEIYVVFTFSMEEVALRKRDTTNKRITNHIKNM"
FT   CDS_pept        57532..57783
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0056"
FT                   /old_locus_tag="BF0057"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05835"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ41"
FT                   /protein_id="CAH05835.1"
FT                   /translation="MSKKIFAALIVAVVATFAGYNIYKSQRAEVTMSDLAMANVEALAD
FT                   SRESSADCTFGNVNYDQYSNTLHCSGNGTLCCKKTVAG"
FT   misc_feature    57532..57585
FT                   /note="Signal peptide predicted for BF0057 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.848 between residues 18 and 19"
FT   CDS_pept        57856..59007
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0057"
FT                   /old_locus_tag="BF0058"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:AAO75771 (EMBL:AE016928) (382 aa)
FT                   fasta scores: E(): 1.3e-11, 25.24% id in 404 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT0661
FT                   SWALL:AAO75768 (EMBL:AE016928) (408 aa) fasta scores: E():
FT                   3.3e-05, 22.16% id in 361 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT0666 SWALL:AAO75773
FT                   (EMBL:AE016928) (381 aa) fasta scores: E(): 5.6e-05, 23.24%
FT                   id in 327 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05836"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="PDB:4RAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ40"
FT                   /protein_id="CAH05836.1"
FT                   /translation="MVTKWKITVGLLLILFCGCSQVKELHESSTIISFKEHTDVNADSI
FT                   LELSFLKLQTKDSCLVKNVGLIRELNNCLLILDSANSNLYVFNKSGAFVNQIGQKGSGP
FT                   GEYILLSSFFVDNNKNYIAAIDIAQDKVLYYNATDFSFLYERRLPFSTSCCLQLEDGNL
FT                   LWNSREYTDSKLSDFYFVVTDSLFDIIDYKMNKEFKSGYTTGPSQMIYKVGTNVFAYTP
FT                   FDLTIYRVGTSEIVPAHSFSFEGTDIPSLDFLNKTSNQGNSNYLYDLIQSDYISYYCVE
FT                   ETERDLFVCYMKNKEKYIGLYDKNTDRTYNYPIKIFQDQLKVGELNYFSIGSVDDYHVA
FT                   PLDVLSLKDMAGNGYVFDDKLSELLTISNEEDNSILLFVRIKK"
FT   misc_feature    57856..57921
FT                   /note="Signal peptide predicted for BF0058 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.965 between residues 22 and 23"
FT   CDS_pept        59016..59885
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0058"
FT                   /old_locus_tag="BF0059"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1085 SWALL:AAO76192 (EMBL:AE016930) (131 aa)
FT                   fasta scores: E(): 2.5e-10, 48.95% id in 96 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT4048
FT                   SWALL:AAO79153 (EMBL:AE016943) (373 aa) fasta scores: E():
FT                   6.3e-05, 27.61% id in 105 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05837"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ39"
FT                   /protein_id="CAH05837.1"
FT                   /translation="MKSGLICCLMLCILLVGCEGKKVKGIKNMVDSWMGREILFPNSVS
FT                   CMALKESNLGLIERRTDYTIVSYIDSSGCTACKMQLRKWMEVINCFDSLNTNVKFLFYL
FT                   HPKEPKEITYLLKRDGFEYPVFVDRLDSFNILNHFSTDINFCTFLLDKTNRVIAIGNPL
FT                   YSKKVKDLYKGIVLKRKEVTVSGILQTETTLPKSSIDMGSFSSEKSQSCIFTLYNIGKN
FT                   MLVIDDAVTSCGCTSVEYSKEPVSPGKSLDIIVTYKADHPEHFNKTITVYCNSSVSPLR
FT                   LKIMGNAK"
FT   misc_feature    59016..59066
FT                   /note="Signal peptide predicted for BF0059 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.652) with cleavage site
FT                   probability 0.547 between residues 17 and 18"
FT   misc_feature    59037..59069
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        59928..60293
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0059"
FT                   /old_locus_tag="BF0060"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ38"
FT                   /protein_id="CAH05838.1"
FT                   /translation="MRKKLVLSVMGILLILGTVTNVMFTRAEKSSDRAWLASIEALEAL
FT                   AEDEIGGSPGGCGTAVGTVLEEQECNGRKVLSRYLVKFSCTGSRTGVCQSGTIYYFYDC
FT                   YGAQIAENDFTRSIPCQ"
FT   misc_feature    59928..59990
FT                   /note="Signal peptide predicted for BF0060 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.339 between residues 21 and 22"
FT   CDS_pept        60262..61524
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0060"
FT                   /old_locus_tag="BF0061"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:AAO75771 (EMBL:AE016928) (382 aa)
FT                   fasta scores: E(): 1.2e-05, 22.33% id in 412 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT0661
FT                   SWALL:AAO75768 (EMBL:AE016928) (408 aa) fasta scores: E():
FT                   1.5e-05, 31.28% id in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05839"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ37"
FT                   /protein_id="CAH05839.1"
FT                   /translation="MILRDQYLVNKKIAWYRIVSVLLFLSAFSSCSLVEKSKNEIYIAD
FT                   LDSAIQKDWYLYSDVFKSVRVIPLAMDKSVLLGDVNKMQVYKGHYIVLDEEIARGVYLF
FT                   DSKGRFIRKIGDVGSGPGEYSKPTDFTIDTKKGEIYIFDYSQKKIFKYDIASGKYLGVC
FT                   NVEHRLNRMFFSKGYLYANIDYQLEDEPGQEHYLLQRIDFDNEGNVEMFFKVADYKKGW
FT                   DGIALQGNMFFNLGTESALFVQDFMDTIIYVNGDQVIPYMVVKSQDWVCKTDLEILGTT
FT                   DNPSAKGLAMMKLIQHLGAQRRAYNLSDVFVNDSVIGFSYMQGMMGTDALYDKSTGETM
FT                   VFDRSKDDVLFGEQPSHRQIPTFLYASDRGVFYSLKPSHLPEMKYFISQGLVKDEVIGK
FT                   NDLDSLDGDANPVLLYYEYKD"
FT   misc_feature    60262..60363
FT                   /note="Signal peptide predicted for BF0061 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.893) with cleavage site
FT                   probability 0.450 between residues 34 and 35"
FT   CDS_pept        61508..62083
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0061"
FT                   /old_locus_tag="BF0062"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05840"
FT                   /db_xref="GOA:Q5LJ36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ36"
FT                   /protein_id="CAH05840.1"
FT                   /translation="MNIKIKIVLIGLVISNFFLLWNVVTQRIKVYDGLDRINDLKEKVD
FT                   SCGDSFFNYIDVNSDLTFDIKPIDTLKNVQLVYCFSEYMCEECVRQDLCVLLDIQKRIG
FT                   ADRILILTAYADNRNNHIRLSNLLRKFRYRNIDYSCLVFPKHNRTGMDQRYFYFIDKDG
FT                   NCKYPFYPLKDHLELTQYYLGFIAKKIV"
FT   misc_feature    61526..61579
FT                   /note="1 probable transmembrane helix predicted for BF0062
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        62080..64062
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0062"
FT                   /old_locus_tag="BF0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3542 SWALL:AAO78648 (EMBL:AE016941) (400 aa)
FT                   fasta scores: E(): 9.5e-13, 27.23% id in 426 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT3420
FT                   SWALL:AAO78526 (EMBL:AE016940) (508 aa) fasta scores: E():
FT                   1.3e-10, 26.54% id in 437 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT0668 SWALL:AAO75775
FT                   (EMBL:AE016928) (649 aa) fasta scores: E(): 4.2e-07, 28.76%
FT                   id in 671 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ35"
FT                   /protein_id="CAH05841.1"
FT                   /translation="MKRTEIFIATGLFCLVSSCGGRDRQVEEALSLSGNNRNELEAVLK
FT                   HYEGDGRKLEAARFLIGNMPGSYGANPIVEQDCSAFYEAYDSLGQKYGYRVGTEWGKQV
FT                   DSLWQNFSNRHRVRQELNYDITRMKAEDLIREIDLAFRAWVENVHSRNCSFEDFCEYIL
FT                   PYRRQNGLLIDNARREFNKRHQGKYFVKEGKDWQQEIDSLLYEYKYLTHSGFWGTKIPI
FT                   WNAATLEKMRHGLCAQRCWYNSLLLSSLGIPVAIDFVPAWGNRNNSHTWNVVLINGESH
FT                   AFEAFWDNDRWKYKRIYNNRNDDELWGRFRLPKVYRYTYSNHIEGPLADVEVDKADIPE
FT                   LFRSVKKVDVSSEYFETADVTVELTGEAPQGVKYAYLAVFGYQDWHPVQWGKVENGRAV
FT                   FREIGKDMVYLPVYYKRGGLLPAAEPFRLRNDGTMEKLSGNEGTEEVAVRMVTGAPAYD
FT                   QNREYLGCMKGSRIVGLLDGKSEEELCRWTDSLALQSVVRKVSARLPYRFVRLLLPSDS
FT                   IALGELSFYTEEGRIGNVRIITPMRATGRNEVPGMITDGLGATGYRGRVAERLVDIDLG
FT                   KEYMVSHIGMTSYLKTQLFCPDEFELRYWDNGWKTVERKQADHKGYLVFERVPRGALLM
FT                   LKNCRWKGKTAERIFTYEKGDVKWE"
FT   CDS_pept        64085..64219
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0063"
FT                   /old_locus_tag="BF0064"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ34"
FT                   /protein_id="CAH05842.1"
FT                   /translation="MPLLLNLLKEMPIRHFLFVILHQIRVECVLSFRGTLKYADKTNE"
FT   CDS_pept        64260..65111
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0064"
FT                   /old_locus_tag="BF0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3209 SWALL:AAO78315 (EMBL:AE016939)
FT                   (279 aa) fasta scores: E(): 1.3e-94, 80.64% id in 279 aa,
FT                   and to Chlorobium tepidum hypothetical protein CT0759
FT                   SWALL:Q8KED0 (EMBL:AE012845) (312 aa) fasta scores: E():
FT                   2.4e-17, 30.34% id in 290 aa, and to Shewanella oneidensis
FT                   conserved domain protein SO3267 SWALL:Q8EC77
FT                   (EMBL:AE015763) (303 aa) fasta scores: E(): 5e-10, 28.33%
FT                   id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ33"
FT                   /protein_id="CAH05843.1"
FT                   /translation="MKRAMTCTDFYASGEQFDLYTCEDCGFIFTQGVPVEAEIGRYYET
FT                   PDYISHSDTKKGAMNAIYHHVRQYMLGRKARLVMKESHRKTGRILDIGTGTGYFAHTMQ
FT                   NKGWEVEAVEKSGQARNFAREHFGLNVRPEAALKELVPGTFDVITLWHVMEHLEHLDET
FT                   WELLRELLTEKGVLIVAVPNCSSYDAMKYGKYWAAYDVPRHLWHFTPATIQQFGSKHGF
FT                   ILAARHPMPFDAFYVSMLTEKHKGSAYSFVKGMWTGTAAWLSAQAKKERSSSMIYVFRK
FT                   KR"
FT   CDS_pept        65111..65992
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="BF9343_0065"
FT                   /old_locus_tag="BF0066"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Cytophaga johnsonae cell division protein
FT                   FtsX SWALL:Q9RB39 (EMBL:AF169967) (291 aa) fasta scores:
FT                   E(): 1.2e-30, 34.82% id in 290 aa, and to Bacteroides
FT                   thetaiotaomicron cell division protein FtsX BT3210
FT                   SWALL:AAO78316 (EMBL:AE016939) (293 aa) fasta scores: E():
FT                   5.4e-91, 83.61% id in 293 aa, and to Chlorobium tepidum
FT                   cell division protein, putative CT0315 SWALL:Q8KFL1
FT                   (EMBL:AE012810) (284 aa) fasta scores: E(): 2.6e-16, 29.3%
FT                   id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05844"
FT                   /db_xref="GOA:Q5LJ32"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ32"
FT                   /protein_id="CAH05844.1"
FT                   /translation="MKSKSRNNAVSYFDMQFITSSISTTLVLLLLGLVVFFVLAANNLS
FT                   VYVRENINFSVLISDDMKETDILKLQKRLNNEPFVKETEYISKKQALKEQTEAMGTDPQ
FT                   EFLGYNPFTASIEIKLHSDYANSDSIAKIEKLIKRNTNIQDVLYQKDLIDAVNENIRNI
FT                   SLVLLALAVMLTFISFALINNTIRLAIYSKRFLIHTMKLVGASWGFIRRPFLKRNIWSG
FT                   VLAAFIADTILMGAAYWLVSYEPELIRVITPEVMLLVSGAVLVFGVVITFLCAYLSINK
FT                   YLRMKASTLYYV"
FT   misc_feature    order(65159..65227,65588..65656,65765..65833,65876..65944)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BF0066 by TMHMM2.0 at aa 17-39, 160-182, 219-241 and
FT                   256-278"
FT   misc_feature    65585..65971
FT                   /note="Pfam match to entry PF02687 FtsX, Predicted
FT                   permease, score 51.0, E-value 2.2e-12"
FT   CDS_pept        66033..66266
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0066"
FT                   /old_locus_tag="BF0067"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3211 SWALL:AAO78317 (EMBL:AE016939)
FT                   (77 aa) fasta scores: E(): 1.9e-24, 83.11% id in 77 aa, and
FT                   to Cytophaga johnsonae FJO13 SWALL:Q9RB38 (EMBL:AF169967)
FT                   (85 aa) fasta scores: E(): 2.8e-10, 48.61% id in 72 aa, and
FT                   to Bacteroides thetaiotaomicron hypothetical protein BT0967
FT                   SWALL:AAO76074 (EMBL:AE016929) (73 aa) fasta scores: E():
FT                   5.3e-08, 38.8% id in 67 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05845"
FT                   /db_xref="GOA:Q5LJ31"
FT                   /db_xref="InterPro:IPR021448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ31"
FT                   /protein_id="CAH05845.1"
FT                   /translation="MGDKQKFAFDKTNFILLAIGMAVVILGFILMTGPSSSETVFQADI
FT                   FSVRRIKVAPVVCFLGFIFMIYGVMRKPKTKE"
FT   misc_feature    order(66069..66128,66171..66239)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0067 by TMHMM2.0 at aa 13-32 and 47-69"
FT   CDS_pept        66273..67073
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0067"
FT                   /old_locus_tag="BF0068"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="2.7.1.66"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 putative undecaprenol kinase Upk or BacA or B3057
FT                   or Z4410 or ECS3940 SWALL:UPK_ECOLI (SWALL:P31054) (273 aa)
FT                   fasta scores: E(): 1.7e-26, 36.56% id in 268 aa, and to
FT                   Bacteroides thetaiotaomicron putative bacitracin resistance
FT                   protein BT3212 SWALL:AAO78318 (EMBL:AE016939) (264 aa)
FT                   fasta scores: E(): 2.9e-91, 88.3% id in 265 aa, and to
FT                   Oceanobacillus iheyensis bacitracin resistance protein
FT                   OB1199 SWALL:Q8CXK0 (EMBL:AP004597) (275 aa) fasta scores:
FT                   E(): 2.3e-33, 41.72% id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05846"
FT                   /db_xref="GOA:Q5LJ30"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ30"
FT                   /protein_id="CAH05846.1"
FT                   /translation="MEWFEALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFT
FT                   IVVHVATVFSTLVILWKEIDWIFRGLFKFEMNSETRYVINILISMIPIGIVGVFFKDEV
FT                   EAIFGSGLLIVGCMLLLTAALLSFSYYAKPRQKENISMKDAFIIGLAQACAVLPGLSRS
FT                   GSTIATGLLLGDNKAKLAQFSFLMVIPPILGEALLDGMKMIKGEAIAGDIPTLSLIVGF
FT                   IAAFVSGCLACKWMINIVKKGKLIYFAIYCAIVGVVTIVVSQLQ"
FT   misc_feature    66285..67049
FT                   /note="Pfam match to entry PF02673 BacA, Bacitracin
FT                   resistance protein BacA, score 272.7, E-value 4.2e-79"
FT   misc_feature    order(66396..66455,66516..66572,66600..66668,66705..66773,
FT                   66894..66962,66999..67067)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BF0068 by TMHMM2.0 at aa 42-61, 82-100, 110-132, 145-167,
FT                   208-230 and 243-265"
FT   CDS_pept        67081..67782
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0068"
FT                   /old_locus_tag="BF0069"
FT                   /product="putative tRNA pseudouridine synthase"
FT                   /note="Similar to Bacteroides thetaiotaomicron tRNA
FT                   pseudouridine synthase B BT3213 SWALL:AAO78319
FT                   (EMBL:AE016939) (240 aa) fasta scores: E(): 1.6e-76, 83.33%
FT                   id in 234 aa, and to Cytophaga johnsonae tRNA pseudouridine
FT                   synthase B TruB SWALL:TRUB_CYTJO (SWALL:Q9RB36) (229 aa)
FT                   fasta scores: E(): 2.7e-43, 52.94% id in 221 aa, and to
FT                   Oryza sativa putative tRNA synthase SWALL:Q94HL3
FT                   (EMBL:AC079022) (525 aa) fasta scores: E(): 5.1e-31, 45.17%
FT                   id in 228 aa. Although the similarities are to the entire
FT                   proteins, only the N-terminal domain of the TruB family
FT                   pseudouridylate synthase is present"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05847"
FT                   /db_xref="GOA:Q5LJ29"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ29"
FT                   /protein_id="CAH05847.1"
FT                   /translation="MNFKEGEVLYFNKPLGWTSFKVVGHARYHMCRRMKVKKLKVGHAG
FT                   TLDPLATGVMIVCTGKATKRIEEFQYHTKEYVATIQLGATTPSYDLEHEIDATYPTEHI
FT                   TRELVEKTLKTFVGEIQQIPPAFSACKVDGARAYDLARKGQEVELKPKLLVIDEIELLE
FT                   CNLPEIKIRVVCSKGTYIRALARDIGEALQSGAHLTGLIRTRVGDVKLEQCLDPAKFAE
FT                   WIDQQDVEISD"
FT   misc_feature    67180..67623
FT                   /note="Pfam match to entry PF01509 TruB_N, TruB family
FT                   pseudouridylate synthase (N terminal domain), score 177.8,
FT                   E-value 1.5e-50"
FT   CDS_pept        67830..68888
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0069"
FT                   /old_locus_tag="BF0070"
FT                   /product="putative S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="Similar to Escherichia coli, Escherichia coli
FT                   O157:H7, and Shigella flexneri S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase QueA or B0405 or Z0504 or
FT                   ECS0456 or SF0342 SWALL:QUEA_ECOLI (SWALL:P21516) (356 aa)
FT                   fasta scores: E(): 5.2e-44, 38.46% id in 351 aa, and to
FT                   Bacteroides thetaiotaomicron S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase BT3214 SWALL:AAO78320
FT                   (EMBL:AE016939) (352 aa) fasta scores: E(): 5.1e-132,
FT                   93.46% id in 352 aa, and to Chlorobium tepidum
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase
FT                   QueA-2 or CT1316 SWALL:Q8KCU4 (EMBL:AE012891) (346 aa)
FT                   fasta scores: E(): 7.2e-65, 49% id in 351 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05848"
FT                   /db_xref="GOA:Q5LJ28"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ28"
FT                   /protein_id="CAH05848.1"
FT                   /translation="MKLSQFKFKLPEEKIALHPTKYRDESRLMVLHKRTGEIEHKMFKD
FT                   ILNYFDDKDVFVFNDTKVFPARLYGNKEKTGARIEVFLLRELNEELRLWDVLVDPARKI
FT                   RIGNKLYFGDDDSMVAEVIDNTTSRGRTLRFLYDGPHDEFKKALYALGETPLPHTILNR
FT                   PVEEEDAERFQSIFAKNEGAVTAPTASLHFSRELMKRMEIKGIDFAYITLHAGLGNFRD
FT                   IDVEDLTKHKMDSEQMFVTEEAVKIVNRAKDLGKNVCAVGTTVMRAIESTVSTDGHLKE
FT                   YEGWTNKFIFPPYDFTVANAMVSNFHMPLSTLLMIVAAFGGYDQVMDAYHIALKEGYRF
FT                   GTYGDAMLILDK"
FT   misc_feature    67830..68504
FT                   /note="Pfam match to entry PF02547 Queuosine_synth,
FT                   Queuosine biosynthesis protein, score 241.2, E-value
FT                   1.2e-69"
FT   CDS_pept        68888..69349
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0070"
FT                   /old_locus_tag="BF0071"
FT                   /product="putative
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase (HPPK)"
FT                   /EC_number="2.7.6.3"
FT                   /note="Similar to Porphyromonas gingivalis
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase FolK SWALL:HPPK_PORGI (SWALL:O83019) (147
FT                   aa) fasta scores: E(): 3e-21, 49.64% id in 139 aa, and to
FT                   Bacteroides thetaiotaomicron 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine BT3216 SWALL:AAO78322
FT                   (EMBL:AE016939) (160 aa) fasta scores: E(): 3.1e-35, 66.01%
FT                   id in 153 aa, and to the C-terminus of Streptococcus
FT                   pneumoniae bifunctional folate synthesis protein [includes:
FT                   dihydroneopterin aldolase suld or spr0269 SWALL:AAK99073
FT                   (EMBL:AE008408) (270 aa) fasta scores: E(): 3.6e-19, 42.38%
FT                   id in 151 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05849"
FT                   /db_xref="GOA:Q5LJ27"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ27"
FT                   /protein_id="CAH05849.1"
FT                   /translation="MKVYLGLGTNLGDKELNLRVALQKIEERIGKIISLSAFYATAPWG
FT                   FQSENNFLNAAVGVETVLSPVGILESTQRIEQEIGRLHKSRDGVYSDRLIDIDLLLYGD
FT                   KILQDESLIVPHPLMTDRKFVLEPLAEIAPDVVHPVFHKTIKELFLALS"
FT   misc_feature    68891..69286
FT                   /note="Pfam match to entry PF01288 HPPK,
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK),
FT                   score 186.4, E-value 4e-53"
FT   CDS_pept        69732..71024
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /gene_synonym="metX"
FT                   /locus_tag="BF9343_0071"
FT                   /old_locus_tag="BF0072"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, and Shigella flexneri
FT                   S-adenosylmethionine synthetase MetK or MetX or B2942 or
FT                   c3528 or Z4287 or ECS3818 or SF2933 SWALL:METK_ECOLI
FT                   (SWALL:P04384) (383 aa) fasta scores: E(): 1.5e-37, 52.33%
FT                   id in 428 aa, and to Bacteroides thetaiotaomicron
FT                   S-adenosylmethionine synthetase BT3219 SWALL:AAO78325
FT                   (EMBL:AE016939) (430 aa) fasta scores: E(): 2.4e-144,
FT                   90.93% id in 430 aa, and to Deinococcus radiodurans
FT                   s-adenosylmethionine synthetase MetK or dr0640
FT                   SWALL:METK_DEIRA (SWALL:Q9RWM6) (408 aa) fasta scores: E():
FT                   3.4e-50, 51.47% id in 408 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05850"
FT                   /db_xref="GOA:Q5LJ26"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ26"
FT                   /protein_id="CAH05850.1"
FT                   /translation="MGYLFTSESVSEGHPDKVADQISDAVLDKLLAYDPSSKVACETLV
FT                   TTGQVVLAGEVKTGAYVDLQLIAREVIQKIGYTKGEYMFESNSCGVLSAIHEQSADINR
FT                   GVEREDPMNQGAGDQGMMFGYATNETENYMPLSLDLAHRILLVLADIRREGKEMTYLRP
FT                   DAKSQVTIEYDDNGTPVRIDTIVVSTQHDEFILPADNSAAAQLKADEEMLAVIRKDVIE
FT                   VLMPRVIASINHPKVLALFNDHIIYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGA
FT                   HGGGAFSGKDPSKVDRSAAYAARHIAKNLVAAGVADEMLVQVSYAIGVARPINIYVNTY
FT                   GRSNVKMSDGEIARKIDELFDLRPKAIEDRLKLRYPIYSETAAYGHMGREPQMVTKHFQ
FT                   SRYEGDRTMEVELFTWEKLDYVDKVKAAFGL"
FT   misc_feature    69732..70034
FT                   /note="Pfam match to entry PF00438 S-AdoMet_synt,
FT                   S-adenosylmethionine synthetase, N-terminal domain, score
FT                   167.5, E-value 1.9e-47"
FT   misc_feature    70065..70496
FT                   /note="Pfam match to entry PF02772 S-AdoMet_syntD2,
FT                   S-adenosylmethionine synthetase, central domain, score
FT                   170.0, E-value 3.3e-48"
FT   misc_feature    70074..70106
FT                   /note="PS00376 S-adenosylmethionine synthetase signature
FT                   1."
FT   misc_feature    70500..70955
FT                   /note="Pfam match to entry PF02773 S-AdoMet_syntD3,
FT                   S-adenosylmethionine synthetase, C-terminal domain, score
FT                   237.3, E-value 1.8e-68"
FT   misc_feature    70578..70604
FT                   /note="PS00377 S-adenosylmethionine synthetase signature
FT                   2."
FT   CDS_pept        71156..71752
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0072"
FT                   /old_locus_tag="BF0073"
FT                   /product="putative lysine decarboxylase"
FT                   /note="Similar to Eikenella corrodens lysine decarboxylase
FT                   (fragment) SWALL:Q9Z4R8 (EMBL:U89166) (183 aa) fasta
FT                   scores: E(): 1.8e-19, 47.48% id in 139 aa, and to
FT                   Bacteroides thetaiotaomicron putative lysine decarboxylase
FT                   BT3224 SWALL:AAO78330 (EMBL:AE016939) (195 aa) fasta
FT                   scores: E(): 1.3e-61, 81.53% id in 195 aa, and to Ralstonia
FT                   solanacearum hypothetical protein RSC2087 RSC2087 or
FT                   RS03652 SWALL:Q8XXM6 (EMBL:AL646068) (194 aa) fasta scores:
FT                   E(): 9.5e-28, 44.44% id in 180 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05851"
FT                   /db_xref="GOA:Q5LJ25"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ25"
FT                   /protein_id="CAH05851.1"
FT                   /translation="MQEMNQITSVCVYCASSTKIDQTYFDAAMKLGHLLANRHIRLING
FT                   AGNIGLMRSVADAVLQNGGEVTGVIPHFMVDQGWHHTGLTELIEVEGMHERKRLMAEKS
FT                   DAVIALPGGCGTLEELLEIITWKQLGLYLNPIVILNTNGFFDPLLEMLENAIEGNFMRK
FT                   QHGDIWHVAHTPEEAVELVYSIPVWDGSIRKFAAI"
FT   misc_feature    71309..71710
FT                   /note="Pfam match to entry PF03641 Lysine_decarbox, Lysine
FT                   decarboxylase family, score 184.2, E-value 1.8e-52"
FT   CDS_pept        71749..72579
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0073"
FT                   /old_locus_tag="BF0074"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3225 SWALL:AAO78331 (EMBL:AE016939) (240 aa)
FT                   fasta scores: E(): 6.2e-67, 72.72% id in 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05852"
FT                   /db_xref="GOA:Q5LJ24"
FT                   /db_xref="InterPro:IPR025367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ24"
FT                   /protein_id="CAH05852.1"
FT                   /translation="MIFVQDSLGAQEADTVQHVISAAGAPQNTLGSRVDLQAVSETVTG
FT                   AEGMPIPYSPRTDDGLAMILLGCFFVSAYVLARSKKFLLQQVKDFMLHRERTSIFASST
FT                   AADMRYLLLLIVQTCVLGGVCIFNYFNDVRPALMERVSPHILLGVYVAVCLLYLLFKWI
FT                   LYSFLGWVFFDKSKTDIWLESYSTLIYYLGFALFPFVLFLVYFDLNVTFLVSIGCVLVI
FT                   FTKILMFYKWLKLFSCNIYGVFLLILYFCALEIVPCLIVYQGMIQLNNVLIINF"
FT   misc_feature    order(71926..71979,72079..72138,72181..72249,72310..72366,
FT                   72379..72447,72466..72534)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BF0074 by TMHMM2.0 at aa 60-77, 111-130, 145-167, 188-206,
FT                   211-233 and 240-262"
FT   CDS_pept        72584..73336
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0074"
FT                   /old_locus_tag="BF0075"
FT                   /product="possible uroporphyrinogen-III synthase"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3226 SWALL:AAO78332 (EMBL:AE016939) (163 aa)
FT                   fasta scores: E(): 1e-56, 92.02% id in 163 aa, and to
FT                   Oceanobacillus iheyensis uroporphyrinogen-III synthase
FT                   ob2067 SWALL:Q8EPM9 (EMBL:AP004599) (252 aa) fasta scores:
FT                   E(): 0.039, 22.31% id in 242 aa, and to Chlorobium
FT                   vibrioforme uroporphyrinogen-III synthase hemD
FT                   SWALL:HEM4_CHLVI (SWALL:Q59335) (246 aa) fasta scores: E():
FT                   0.16, 20.23% id in 252 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05853"
FT                   /db_xref="GOA:Q5LJ23"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ23"
FT                   /protein_id="CAH05853.1"
FT                   /translation="MKIKKVLVSQPKPASEKSPYYDIAEKYGVKIDFRPFIKVESVSAK
FT                   EFRQQKVSILDHTAVIFTSRHAIDHFFHLCTELRVTIPETMKYFCVTEAVALYIQKYVQ
FT                   YRKRKIFFGATGKIEDLIPSIVKHKTEKYLVPMSDVHNDDVRDLLDKNNIQHTECVMYR
FT                   TVSNDFMEGEEFDYDMLVFFSPAGVSSLKKNFPDFDQKDIKIGTFGSTTAQAVRDAGLR
FT                   LDLEAPNVKAPSMTAALDLFIKENNKGK"
FT   misc_feature    72617..73297
FT                   /note="Pfam match to entry PF02602 HEM4,
FT                   Uroporphyrinogen-III synthase HemD, score 9.9, E-value
FT                   2.2e-06"
FT   CDS_pept        73484..73807
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0075"
FT                   /old_locus_tag="BF0076"
FT                   /product="possible ribonuclease P component"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   ribonuclease P protein component BT3227 SWALL:AAO78333
FT                   (EMBL:AE016939) (109 aa) fasta scores: E(): 1.3e-24, 72.89%
FT                   id in 107 aa, and to Chlorobium tepidum ribonuclease P
FT                   protein component RnpA or CT0004 SWALL:RNPA_CHLTE
FT                   (SWALL:Q8KGG4) (154 aa) fasta scores: E(): 0.0019, 35.96%
FT                   id in 114 aa, and to Escherichia coli, and Shigella
FT                   flexneri ribonuclease p protein component RnpA or B3704 or
FT                   SF3760 SWALL:RNPA_ECOLI (SWALL:P06277) (119 aa) fasta
FT                   scores: E(): 0.42, 50% id in 34 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05854"
FT                   /db_xref="GOA:Q5LJ22"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ22"
FT                   /protein_id="CAH05854.1"
FT                   /translation="MFAGGSKSFSIFPLRVVYMPVENQDVQASILLSVSKKRFKRAVKR
FT                   NRVKRQLREAYRMHKHQLLQILTDKQQQLAIAFIYLSDELTSSAEIEEKMKILLARISE
FT                   KLV"
FT   misc_feature    73577..73672
FT                   /note="Pfam match to entry PF00825 Ribonuclease_P,
FT                   Ribonuclease P, score 33.4, E-value 1.6e-08"
FT   misc_feature    73598..73642
FT                   /note="PS00648 Bacterial ribonuclease P protein component
FT                   signature."
FT   CDS_pept        73804..74025
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0076"
FT                   /old_locus_tag="BF0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3228 SWALL:AAO78334 (EMBL:AE016939)
FT                   (91 aa) fasta scores: E(): 7e-27, 82.19% id in 73 aa, and
FT                   to Neisseria meningitidis hypothetical protein NMA0549 or
FT                   NMB1906 SWALL:Y549_NEIMA (SWALL:Q9JW47) (73 aa) fasta
FT                   scores: E(): 6.6e-19, 65.75% id in 73 aa, and to
FT                   Fusobacterium nucleatum hypothetical protein Fn0003
FT                   SWALL:Y003_FUSNN (SWALL:Q8RHA5) (82 aa) fasta scores: E():
FT                   3.1e-16, 63.76% id in 69 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05855"
FT                   /db_xref="GOA:Q5LJ21"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ21"
FT                   /protein_id="CAH05855.1"
FT                   /translation="MKRLLSYILLLPIYFYRACISPMTPPSCRFTPTCSQYAIEAIKKH
FT                   GPFKGLYLAVRRILRCHPWGGSGYDPVP"
FT   misc_feature    73816..74019
FT                   /note="Pfam match to entry PF01809 DUF37, Domain of unknown
FT                   function DUF37, score 124.6, E-value 1.6e-34"
FT   CDS_pept        74032..74667
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0077"
FT                   /old_locus_tag="BF0078"
FT                   /product="putative tatD-related DNAse protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron TatD-related
FT                   DNAse BT3229 SWALL:AAO78335 (EMBL:AE016939) (229 aa) fasta
FT                   scores: E(): 2.4e-29, 42.79% id in 222 aa, and to
FT                   Shewanella oneidensis hydrolase, TatD family so1213
FT                   SWALL:Q8EHK8 (EMBL:AE015565) (256 aa) fasta scores: E():
FT                   1.6e-13, 35.09% id in 151 aa, and to Vibrio vulnificus
FT                   Mg-dependent DNAse VV11722 SWALL:Q8DBT5 (EMBL:AE016802)
FT                   (265 aa) fasta scores: E(): 9.4e-10, 28.94% id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05856"
FT                   /db_xref="GOA:Q5LJ20"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ20"
FT                   /protein_id="CAH05856.1"
FT                   /translation="MDILDIHTHRMPVELGQAIQNCQPAEFDPLAGAYYSVGIHPWYLT
FT                   RENLDRQWEMLLAAIQCPQVLAIGEAGLDKLVRTDYMLQQEVFEKQAMLAHEMKYPLVI
FT                   HAVRSANEIICLRKKMKPSNPWIIHGFRGKKELALQYIREGIYVSLGEKYQEEVLWGIP
FT                   LEYLFLETDESMIDIHCLYERAALLLEIPLCKLMQQVRQNINNVFFRQ"
FT   misc_feature    74032..74661
FT                   /note="Pfam match to entry PF01026 TatD_DNase, TatD related
FT                   DNase, score 55.6, E-value 9.1e-14"
FT   CDS_pept        74735..76027
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="BF9343_0078"
FT                   /old_locus_tag="BF0079"
FT                   /product="putative tyrosyl-tRNA synthetase 1"
FT                   /EC_number="6.1.1.1"
FT                   /note="Similar to Bacillus subtilis tyrosyl-tRNA synthetase
FT                   1 TyrS SWALL:SYY1_BACSU (SWALL:P22326) (422 aa) fasta
FT                   scores: E(): 4e-72, 45.95% id in 433 aa, and to Bacteroides
FT                   thetaiotaomicron tyrosyl-tRNA synthetase BT3230
FT                   SWALL:AAO78336 (EMBL:AE016939) (430 aa) fasta scores: E():
FT                   3.5e-159, 92.32% id in 430 aa, and to Enterococcus faecalis
FT                   V583 tyrosyl-tRNA synthetase TryS-2 SWALL:AAO81513
FT                   (EMBL:AE016952) (420 aa) fasta scores: E(): 1.1e-72, 47.77%
FT                   id in 427 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05857"
FT                   /db_xref="GOA:Q5LJ19"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ19"
FT                   /protein_id="CAH05857.1"
FT                   /translation="MNFVEELRWRGMVHDMMPGTEELLAKEQVTAYVGIDPTADSLHIG
FT                   HLCGVMILRHFQRCGHKPLALIGGATGMIGDPSGKSAERNLLDEETLRHNQACIKKQLA
FT                   KFLDFESDAPNRAELVNNYDWMKEFTFLDFAREVGKHITVNYMMAKESVKKRLNGEARD
FT                   GLSFTEFTYQLLQGYDFLHLYETKGCKLQMGGSDQWGNITTGTELIRRTNGGEAYALTC
FT                   PLITKADGGKFGKTESGNIWLDPRYTSPYKFYQFWLNVSDADAERYIKIFTSLDKAEID
FT                   GLIAEHNEAPHLRVLQKRLAKEVTVMVHSEEDYNAAVDASNILFGNATSDALKKLDEDT
FT                   LLAVFEGVPQFEISRDALAEGVKAVDLFVDNAAVFASKGEMRKLVQGGGVSLNKEKLAA
FT                   FDQVITTADLLDEKYLLVQRGKKNYYLIIAK"
FT   misc_feature    74810..75712
FT                   /note="Pfam match to entry PF00579 tRNA-synt_1b, tRNA
FT                   synthetases class I (W and Y), score 363.2, E-value
FT                   2.3e-106"
FT   misc_feature    74843..74875
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        complement(76140..79412)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0079"
FT                   /old_locus_tag="BF0080"
FT                   /product="putative peptidase/protease family protein"
FT                   /note="Similar to Streptomyces coelicolor tricorn protease
FT                   homolog 1 Tri1 or sco2549 or scc77.16C SWALL:TRI1_STRCO
FT                   (SWALL:Q9RDE2) (1067 aa) fasta scores: E(): 4.7e-27, 23.81%
FT                   id in 1121 aa, and to Prevotella sp. RS2 MdsD protein
FT                   precursor SWALL:Q9L5V8 (EMBL:AF248951) (1073 aa) fasta
FT                   scores: E(): 9.3e-177, 44.56% id in 1086 aa, and to
FT                   Bacteroides thetaiotaomicron putative tricorn-like protease
FT                   BT1408 SWALL:AAO76515 (EMBL:AE016931) (1102 aa) fasta
FT                   scores: E(): 3.1e-155, 76.6% id in 1103 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05858"
FT                   /db_xref="GOA:Q5LJ18"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ18"
FT                   /protein_id="CAH05858.1"
FT                   /translation="MRKLFVCIALGLTTLTGNAASPLWMRDVQISPDGTEIAFCYKGDI
FT                   YKVSAGGGTAIQLTTQPSYECTPIWSPDSKQIAFASDRNGNFDIFVMPATGGTAQRLTT
FT                   HSSSELPSAFTPDGKYILFSASIQDPSQSALFPTTAMTELYKVPVNGGRTEQVLGTPAE
FT                   AVCYAPSGEFFLYQDRKGFEDEWRKHHTSSITRDIWLYDTKTGKHTNLTNHAGEDRNPV
FT                   LSPDGKSVYLLSERKGSFNVYSFPLDNAQDLKAVTSFKTHPVRFLSMSHGGTLCYAYDG
FT                   EIYTQKDNATPQKINIDIVRDDQDKIADLTFTNGATSGTVSPDGKQIAFIVRGEVFVTS
FT                   TDYATTKQITHTPAREAGLTFAPDNRTLAYASERNGNWQLFLAKIARKEEANFPNATII
FT                   EEEVLLPSATVERAYPQFSPDGKELAFIEERNRLMVINLDTKKVRQITDGSTWFSTDGN
FT                   FDYQWSPDGKWFTLEFIGNRHDPYSDIGLVSAKGDSPITNLTNSGYMSGSPRWVLDGNA
FT                   ILFTTERYGMRAHASWGSQNDAMLVFLNQDAFDKFRLSKEDYELQKELEKEQQKDKEKA
FT                   SIDPKKDKKKDPQTDTEKKDEIKNILVELNGLEDRIIRLTPNSSNLGSTIISKDGETLY
FT                   YLSAFEGGFDLWKMDLRKKETKLLHKMNAGWASMDMDKDGKSLFVLGGNTMQKMDLSGE
FT                   TLKPINYKAEMKMDLAAEREYMFDHVYKQQQKRFYNANMHGVNWDTMSAAYRKFLPHIN
FT                   NNYDFAELLSEWLGELNVSHTGGRFSPSIPGDATASLGVLTDWNYKGKGASIMEVIEKG
FT                   PFDHARSKVKAGTIIEKINGQEITPETDYHTLLNDKANKKTLVSLYNPQSGERWEEVVI
FT                   PIGNGILNNLLYKRWVKQRAADVDKWSDGRLGYVHIQSMGDDSFRSVYSDILGKYNNRE
FT                   GIVIDTRFNGGGRLHEDIEVLFSGKKYFTQVVRGREACDMPSRRWNKPSIMLTCEANYS
FT                   NAHGTPWVYSHQKLGKLVGMPVPGTMTSVSWERLQDPSLVFGIPVIGYRLPDGSYLENT
FT                   QLEPDIKVANSPETIVKGEDTQLKTAVEELLKELPAGKGKKH"
FT   misc_feature    complement(76167..77312)
FT                   /note="Pfam match to entry PF03572 Peptidase_S41B,
FT                   Peptidase family S41B, score 236.5, E-value 3.3e-68"
FT   misc_feature    complement(79356..79412)
FT                   /note="Signal peptide predicted for BF0080 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.962 between residues 19 and 20"
FT   tRNA            79576..79646
FT                   /note="tRNA Gln anticodon TTG, Cove score 47.95"
FT   CDS_pept        80020..81552
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0080"
FT                   /old_locus_tag="BF0081"
FT                   /product="putative choline-sulfatase"
FT                   /note="Similar to Rhizobium meliloti choline-sulfatase BetC
FT                   or r00949 or SMC00127 SWALL:BETC_RHIME (SWALL:O69787) (512
FT                   aa) fasta scores: E(): 2.5e-32, 31.64% id in 455 aa, and to
FT                   Bacteroides thetaiotaomicron choline-sulfatase BT1918
FT                   SWALL:AAO77025 (EMBL:AE016933) (500 aa) fasta scores: E():
FT                   1.2e-146, 67.36% id in 478 aa, and to Clostridium
FT                   perfringens probable phosphonate monoester hydrolase
FT                   CPE0231 SWALL:Q8XNV1 (EMBL:AP003186) (481 aa) fasta scores:
FT                   E(): 8.4e-45, 37.39% id in 476 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05859"
FT                   /db_xref="GOA:Q5LJ17"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ17"
FT                   /protein_id="CAH05859.1"
FT                   /translation="MAASPSTYAFNGESKETGNDSSKLSKAPATKGGKPHIIFIMSDQH
FT                   RGDALHCMGNKAVISPNIDKLAQEGSLFVCGYSSAPSSTPARAGLLTGMSPWHHGMLGY
FT                   GKVASKYKYEMPQMLRDLGYYTFGIGKMHWFPQKALHGFHATLVDESGRSETRDFISDY
FT                   REWFQLQAPGKNPDLTGIGWNNHNAGTYKLEERLHPTAWTGQTACELIRNYDSDQPLFL
FT                   KVSFARPHSPYDPPKRYLDMYEKVDIPVPFVGDWCGKYAERKDPERVSKDAAFANLGEE
FT                   YAVNSRRHYYANVTFIDDQIGQIIQTLKEKGMYENAIICYTADHGDMLGDHYHWRKTYA
FT                   YEGSAKIPYIIKWPSAMTTQAIRGKRIEQPVELRDFLPTFIELAGGTVPDDMDGKSLVA
FT                   LASGNKNGWRKYIDLEHATCYSADNYWCALTDGKMKYIWFIHTGEEQLFDLSSDPGEQK
FT                   NLSGNSRYADRLVEMRKAMVDHLQERGTEFVKDGKLAVRDQTLLYSPNYPKD"
FT   misc_feature    80122..81207
FT                   /note="Pfam match to entry PF00884 Sulfatase, Sulfatase,
FT                   score 155.7, E-value 6.6e-44"
FT   misc_feature    80260..80298
FT                   /note="PS00523 Sulfatases signature 1."
FT   CDS_pept        81676..82518
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0081"
FT                   /old_locus_tag="BF0082"
FT                   /product="putative 4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="Similar to Erwinia chrysanthemi
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase KduI
FT                   SWALL:KDUI_ERWCH (SWALL:Q05529) (278 aa) fasta scores: E():
FT                   3.8e-54, 49.09% id in 277 aa, and to Bacteroides
FT                   thetaiotaomicron 4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase BT3231 SWALL:AAO78337 (EMBL:AE016939) (280
FT                   aa) fasta scores: E(): 2e-107, 91.42% id in 280 aa, and to
FT                   Bacteroides thetaiotaomicron
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase BT4106
FT                   SWALL:AAO79211 (EMBL:AE016943) (306 aa) fasta scores: E():
FT                   1e-63, 54.67% id in 289 aa, and to Yersinia pestis
FT                   4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase KduI
FT                   or YPO1725 or Y1887 SWALL:Q8ZFH8 (EMBL:AJ414150) (278 aa)
FT                   fasta scores: E(): 3.2e-56, 50.54% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05860"
FT                   /db_xref="GOA:Q5LJ16"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LJ16"
FT                   /protein_id="CAH05860.1"
FT                   /translation="MKTNYEIRYAAHPEDARSYDTKRIRRDFLIEKVFSADEVNMVYSM
FT                   YDRMVVGGAMPVKEVLKLEAIDPLKAPYFLTRREMGIFNVGGPGVVRAGDAIFQLDYKE
FT                   ALYLGAGDRDVTFESTDAAHPAKFYFNSLAAHRNYPDKKVTKADAVVAEMGTLEGSNHR
FT                   NINKMLVNQVLPTCQLQMGMTELAPGSVWNTMPAHVHSRRMEAYFYFEVPEEHAVCHFM
FT                   GEVDETRHVWMKGDQAVLSPEWSIHSAAATHNYTFIWGMGGENLDYGDQDFSLITDLK"
FT   misc_feature    81688..82515
FT                   /note="Pfam match to entry PF04962 KduI, 5-keto
FT                   4-deoxyuronate isomerase, score 470.6, E-value 1.1e-138"
FT   CDS_pept        82585..83376
FT                   /transl_table=11
FT                   /gene="gno"
FT                   /locus_tag="BF9343_0082"
FT                   /old_locus_tag="BF0083"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="Similar to Escherichia coli O6 gluconate
FT                   5-dehydrogenase c0321 SWALL:Q8FKS4 (EMBL:AE016755) (266 aa)
FT                   fasta scores: E(): 1.2e-71, 73.07% id in 260 aa, and to
FT                   Streptococcus pneumoniae 5-keto-D-gluconate 5-reductase Gno
FT                   or spr0290 SWALL:Q8DR79 (EMBL:AE008410) (271 aa) fasta
FT                   scores: E(): 2.4e-83, 83.46% id in 260 aa, and to
FT                   Clostridium acetobutylicum short-chain alcohol
FT                   dehydrogenase family protein CAC2607 SWALL:Q97FW9
FT                   (EMBL:AE007758) (267 aa) fasta scores: E(): 4.1e-83, 84.67%
FT                   id in 261 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05861"
FT                   /db_xref="GOA:Q5LJ15"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ15"
FT                   /protein_id="CAH05861.1"
FT                   /translation="MVNFSLEGKVAWVTGASYGIGFALATAFSEAGAKIVFNDISRELV
FT                   DKGLAAYKELGIEARGYVCDVTSEEQVNALVAQIEKEVGVVDILVNNAGIIKRIPMCEM
FT                   TAEQFRQVIDVDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGG
FT                   LKMLTRNIASEYGEFNIQCNGIGPGYIATPQTAPLREVQSDGSRHPFDSFIISKTPAAR
FT                   WGTPEDLMGPAVFLASDASNFVNGHVLYVDGGILAYIGKQP"
FT   misc_feature    82603..83349
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 298.9, E-value 5.3e-87"
FT   misc_feature    83014..83100
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        83403..84647
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0083"
FT                   /old_locus_tag="BF0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3233 SWALL:AAO78339 (EMBL:AE016939) (414 aa)
FT                   fasta scores: E(): 1.4e-116, 70.45% id in 413 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05862"
FT                   /db_xref="GOA:Q5LJ14"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR032342"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ14"
FT                   /protein_id="CAH05862.1"
FT                   /translation="MKKVFLFVAAVLLCLACNEAGRTVSVTVSNATSLERSGEMVEVSM
FT                   GEVSSKLHLPDTAQIVVVDAEGQQVPYQITSDEKVIFPVTVQANGSAVYTIKVGIPQEC
FT                   PVKACGRYYPERVDDVAWENDLTAFRAYGPALQETGERAFGYDIWTKYNTTEPVVEARY
FT                   EGELNPDMKAKIAELGKTDPKAAQELYRSVSYHVDHGNGLDCYKVGPTLGGGTTALMAG
FT                   DTIVYPYCYATQEILDNGPLRFTVKLVYNPLVVKGDSTIIETRIITLDAGSYCNKTVVS
FT                   YTNLKETMPLAVGIVLHEPDGAIVADAANGYMTYVDPTDNAGGDNGKIFVGAAFPTLVK
FT                   EAKAVLFPEKEKKELRGGADGHVLAISEYEPGADFTYYWGAAWSKADIKDSAAWNAYMA
FT                   DFAQKVRNPLTVTVK"
FT   misc_feature    83403..83459
FT                   /note="Signal peptide predicted for BF0084 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.286 between residues 19 and 20"
FT   CDS_pept        complement(84681..85610)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0084"
FT                   /old_locus_tag="BF0085"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="Similar to Escherichia coli putative electron
FT                   transport protein YjeS or B4166 SWALL:YJES_ECOLI
FT                   (SWALL:P39288) (379 aa) fasta scores: E(): 1.6e-38, 39.35%
FT                   id in 310 aa, and to Bacteroides thetaiotaomicron putative
FT                   iron-sulfur cluster-binding protein BT3245 SWALL:AAO78351
FT                   (EMBL:AE016939) (343 aa) fasta scores: E(): 7.4e-55, 60% id
FT                   in 340 aa, and to Pseudomonas syringae iron-sulfur
FT                   cluster-binding protein PSPTO4948 SWALL:AAO58376
FT                   (EMBL:AE016873) (362 aa) fasta scores: E(): 3.4e-43, 44.07%
FT                   id in 304 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05863"
FT                   /db_xref="GOA:Q5LJ13"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ13"
FT                   /protein_id="CAH05863.1"
FT                   /translation="METKINSKALKAEALRLGFSACGIAPAEPIDQAHQNALKMWLDAD
FT                   RQAGMTYMANHFDKRCDPALLVEGTRCVVSVALNYYPATRIPDEEYQFAWYAYGKDYHD
FT                   LMREKLATLFRFIQESDVPELNGRMFCDTAPVPERYWAWRAGLGWIGKNTQLIIPHAGS
FT                   TFFLGELFLNTEADTYDRPQPNRCGRCNRCLQACPTKALETPYSLNAHRCLSYLTIENK
FT                   SEIPDSIAPFMGNRVYGCDECQKACPWNRFATPCRTPELQPSPEFMNMKKEDWKQLSEE
FT                   KYRALFKGSAVKRAKYSGLIRNIRQMED"
FT   misc_feature    complement(85002..85073)
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 22.0, E-value 8.1e-05"
FT   misc_feature    complement(85017..85052)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        complement(85610..86224)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0085"
FT                   /old_locus_tag="BF0086"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="Similar to C-terminus of Streptococcus pneumoniae
FT                   peptidoglycan GlcNac deacetylase PgdA SWALL:Q9K516
FT                   (EMBL:AJ251472) (463 aa) fasta scores: E(): 6.6e-16, 36.61%
FT                   id in 183 aa, and to Bacteroides thetaiotaomicron
FT                   polysaccharide deacetylase BT3246 SWALL:AAO78352
FT                   (EMBL:AE016939) (204 aa) fasta scores: E(): 4.7e-70, 80.39%
FT                   id in 204 aa, and to Anabaena sp. polysaccharide
FT                   deacetylase ALL4345 SWALL:Q8YP55 (EMBL:AP003596) (305 aa)
FT                   fasta scores: E(): 1.7e-20, 39.47% id in 190 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05864"
FT                   /db_xref="GOA:Q5LJ12"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ12"
FT                   /protein_id="CAH05864.1"
FT                   /translation="MFIEQPPWFFRAIYPDAIFRMDPDEKAVYLTFDDGPIPEVTPWVL
FT                   ELLDKHNIKATFFMVGDNIRKHPDVFRMVVERGHRIGNHTFNHIRGFEYLSSNYLANTD
FT                   KANEMMKTDLFRPPHGHMRWMQYMTLKRHYKIIMWDLVTRDYSKKLRPPQVLANVMRYA
FT                   RNGSIITFHDSLKSWNNGNLQYALPRAIDFLKEEGYEFRLL"
FT   misc_feature    complement(85814..86167)
FT                   /note="Pfam match to entry PF01522 Polysacc_deacet,
FT                   Polysaccharide deacetylase, score 91.2, E-value 1.8e-24"
FT   CDS_pept        complement(86241..89600)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0086"
FT                   /old_locus_tag="BF0087"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3247 SWALL:AAO78353 (EMBL:AE016939)
FT                   (1124 aa) fasta scores: E(): 0, 81.3% id in 1123 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT0968 SWALL:AAO76075 (EMBL:AE016929) (1044 aa) fasta
FT                   scores: E(): 1.1e-128, 51.55% id in 1129 aa, and to
FT                   Chlorobium tepidum hypothetical protein CT2009 SWALL:Q8KAY9
FT                   (EMBL:AE012951) (886 aa) fasta scores: E(): 9e-29, 28.85%
FT                   id in 1050 aa, and to Homo sapiens hypothetical protein
FT                   SWALL:AAH45556 (EMBL:BC045556) (272 aa) fasta scores: E():
FT                   0.051, 27.27% id in 209 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05865"
FT                   /db_xref="GOA:Q5LJ11"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ11"
FT                   /protein_id="CAH05865.1"
FT                   /translation="MKQYKTVNNLVGWITFLIAATVYCMTIEPTASFWDCPEFITTAYK
FT                   LEVGHPPGAPFFMLTANLFTQFVSDPALVAKMVNYMSALMSGACILFLFWSITHLVRKL
FT                   VITDETNITRGQLITVMGSGLVGALAYTFSDTFWFSAVEGEVYAYSSMFTAIVFWLILK
FT                   WEDVADQPHSDRWIILIAYLTGLSIGVHLLNLLCLPAIVLVYYYKKVPGANAKGSLLAL
FT                   AGSMVLVAAVLYGIVPGVVKVGGWFELLFVNSLGMPFNTGVIVYVALLAAAIIWGIYES
FT                   YNEKSRTRMNLSFLLTIAMLGIPFYGHGASAVIIGILVLGVLAAYLFASKLNEKIRMSA
FT                   RTMNTALLCTMMIMVGYSSYALIVIRSVANTPMDQNSPEDIFTLGEYLGREQYGTRPLF
FT                   YGPAYSSKVALDVEDGYCVPRQKSTDTKYVRKEKTSPDEKDSYVELPGRVEYEYAQNML
FT                   FPRMYSSAHTAYYKSWQDITGYDVPYDQCGEMLMVNMPTQWDNIKFFFSYQLNFMYWRY
FT                   FMWNFAGRQNDIQSSGEIEHGNWITGIPFIDNLLYGDQNMLPQELKDNKGHNVFYCLPL
FT                   ILGIIGLFWQAWRGQKGIQQFWVVFFLFFMTGIAIVLYLNQTPGQPRERDYAYAGSFYA
FT                   FAIWIGMGVAGIVHLLRNYMKEVPAAALTSAVCLLVPIQMASQTWDDHDRSGRYVARDF
FT                   GQNYLMSLQESGNPIIYTNGDNDTFPLWYNQETEGFRTDARTCNLSYLQTDWYIDQMKR
FT                   PAYDSPALPITWDRTEYMEGQNEYVPIRPDFKKQIDKAYKAAEEEVLNGKNPEALNNIR
FT                   AQFGDNPYELKNILKYWVRTKDGQAVIPTDSIVVKIDKEAVRRSGMMIPEALGDSIPDY
FT                   MHISLKDEKGNPKRALYKSELMMLEMLANANWERPIYMAITVGTDNQLNMREHFIQEGL
FT                   TYRFTPFDTEALGATIDSEKMYDNLMNKFKFGGIDKPGIYIDENTMRMCYTHRRIFAQL
FT                   ITQLMKEGKKDKALAALEYAEKMIPAFNVPYDVQNGALEMAEAYYQLGNNTKADQIIDE
FT                   LANKSVEYLTWYLSLDDNHLLMSQREFIMHLSALDMEAKMMEKYKSKLAGNYTPKVNEL
FT                   YNIYVGRMKAHQ"
FT   misc_feature    complement(order(87648..87716,87753..87821,87834..87893,
FT                   88506..88574,88617..88721,88767..88835,88878..88946,
FT                   89007..89075,89118..89186,89199..89267,89295..89363,
FT                   89376..89444,89514..89582))
FT                   /note="13 probable transmembrane helices predicted for
FT                   BF0087 by TMHMM2.0 at aa 7-29, 53-75, 80-102, 112-134,
FT                   139-161, 176-198, 219-241, 256-278, 294-328, 343-365,
FT                   570-589, 594-616 and 629-651"
FT   repeat_region   89789..89949
FT                   /note="invertible region A; inactive in shotgun"
FT   CDS_pept        90096..91688
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0087"
FT                   /old_locus_tag="BF0088"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05866"
FT                   /db_xref="GOA:Q5LJ10"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ10"
FT                   /protein_id="CAH05866.1"
FT                   /translation="MNTKTKLLYVGFRALSTCCLYAAFLMITSCGDNVVNPDSPEPDGE
FT                   DMIPVTISRVEDGSYMESHVDTPDTTGGRTLVDEWVPVKEPPASRAIPAAVPYEGPSAV
FT                   RMTLREEPQVTTRASTLGNDIYFRLIAFRKVGSNYVFQSAADFTTNGASAPTLRLGNLL
FT                   TRAGTVRVIGYSFNSTAGMGTIPSSYTYNSTSVTIPNMNSDFMVYDSGDIANVSTISHN
FT                   LSVSFTQKLCKLTVKLSLSQFGSNTFTNCTGVYVSQGGNTSAWTIGPSTNNVSANTGNT
FT                   PTFNIANNSTATVRLVPFSGSRAITVHIGTLKLSNYFNANNRNITSSQNVQLLPGKSYT
FT                   ITLKFELGVQLAASDINLTQNGCTASDKNYLAKLRWATGNLKSTGNTNYVWTSSTDRGY
FT                   YYTFYSTYTGNKTTNNTDPCSKLNTAYYGTGWRTPSENDYISLSRCTDKVLTNGGMWFM
FT                   NKSIGVFLLASGGIGWGGSSSTGDPTSDGGTGGQYWSSTYNKNDAKRLVFANGSAGIGL
FT                   DYLASGLAVRCVK"
FT   misc_feature    90114..90182
FT                   /note="1 probable transmembrane helix predicted for BF0088
FT                   by TMHMM2.0 at aa 7-29"
FT   repeat_region   91906..92066
FT                   /note="invertible region B; active in shotgun"
FT   CDS_pept        92218..93834
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0088"
FT                   /old_locus_tag="BF0089"
FT                   /product="hypothetical protein"
FT                   /note="Very limited similarity to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT4606 SWALL:AAO79711
FT                   (EMBL:AE016945) (394 aa) fasta scores: E(): 0.039, 21.18%
FT                   id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05867"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ09"
FT                   /protein_id="CAH05867.1"
FT                   /translation="MNRTFIMRECLGKALWLCFCLSIAGCAEDDRMTPLSADSGNTADE
FT                   LIPIHISLTGDNDYHSSSFNDASTRSHSPLIAEWVGVKAFSPTRTGEQPDYEGPRIASM
FT                   ELTEDTLPRVSTRATVPVGVYFRLIVFRKSGNNYVFQSAADYASNGTGTPVLKQGKLLT
FT                   RSGTIRVVGYSFNTTADLGTIPASYTYNSSTVSIPDMTKDFMTFDSGDITNVNSLSHNL
FT                   LPVSFSQKLCKLTITISPTGFPSNTITNCTGVYVKQGGNSTSWKIGPSTNVVAANTNNT
FT                   AAFSPSTALSTTIRMVPFAGARTITVHFNTLTISGRTIPNNTEITSTQSIQLKEGKSYT
FT                   MKIQFKKTIGINVPSGSINLTTNGCSSADKTALAKLIWADGNLKSTGSANYVWGTYSEY
FT                   GYYYTWKSTYTGNTSLNNTDPCPKLKSDYGTGWRTPSKDEMDKLSRCTNKAVVTNGGNK
FT                   GFWFMNSTIGLFLPFGGSHGGATGSKTTPPGNAGSEGAYWCLDANGSTYGYLLYFTTGG
FT                   ESRTGHYPKTNGQSVRCVKNK"
FT   CDS_pept        93863..94621
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0089"
FT                   /old_locus_tag="BF0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0003 SWALL:AAO75110 (EMBL:AE016926) (258 aa)
FT                   fasta scores: E(): 1.3e-57, 64.65% id in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05868"
FT                   /db_xref="GOA:Q5LJ08"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR027824"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ08"
FT                   /protein_id="CAH05868.1"
FT                   /translation="MKTELKGWLADNTVTTDNKEDKILVLESAGNLTLSDVLDEMKKED
FT                   TGLRAETLKHAVDLFQRTVSELVLNGYSVNTGLFRAVPQFRGVIDGGVWNPERNSIYVS
FT                   FNQDKDLRETIARTGVKILGAKGDPAYFIGGEDAATRATDGSATAGRNYRLQGKNIKVT
FT                   GTDSAVGIVLIDEKGTETKLPMDMIAVNNPSEVLVLLPADLKDGVYELRLTTQFSTGNK
FT                   LLKVPRTVIRSLVIGLPSGGDGDIVDDPTA"
FT   CDS_pept        complement(94794..95603)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0090"
FT                   /old_locus_tag="BF0091"
FT                   /product="putative metal uptake system ABC transporter
FT                   ATP-binding protein"
FT                   /note="Similar to Listeria monocytogenes zinc uptake system
FT                   ATP-binding protein ZurA or LMO1447 SWALL:ZURA_LISMO
FT                   (SWALL:Q9XDA6) (257 aa) fasta scores: E(): 9e-22, 35.74% id
FT                   in 221 aa, and to Bacteroides thetaiotaomicron putative
FT                   metal ABC transporter, ATP-binding protein BT3248
FT                   SWALL:AAO78354 (EMBL:AE016939) (273 aa) fasta scores: E():
FT                   6e-55, 73.89% id in 272 aa, and to Synechocystis sp. ABC
FT                   transporter SLR2044 SWALL:P73086 (EMBL:D90903) (289 aa)
FT                   fasta scores: E(): 1.5e-34, 38.79% id in 250 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05869"
FT                   /db_xref="GOA:Q5LJ07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ07"
FT                   /protein_id="CAH05869.1"
FT                   /translation="MDKERKPHKHTEAATSSPLLSIRGLSAAYDGRTVLHDVDLEVYEH
FT                   DFLGIIGPNGGGKTTLIKCILGLLRPTGGEIIKYHEPLTTGYLPQYNSIDRSFPISVLE
FT                   VVLSGLSSKKSLTGRFNDRHREKARQVIHRMGLEGLEHRAIGQLSGGQLQRALLGRAII
FT                   SDPQLLILDEPSTYIDKRFEARLYQLLAEINRDCAIILVSHDIGTVLQQVKNIACVNET
FT                   LDYHPAASVNTEWLERNFNCPIELLGHGTLPHRVLGEHCHCHEDGKA"
FT   misc_feature    complement(94938..95471)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 143.9, E-value 2.5e-40"
FT   misc_feature    complement(95118..95162)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(95427..95450)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(95624..96556)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0091"
FT                   /old_locus_tag="BF0092"
FT                   /product="putative metal ABC transporter substrate-binding
FT                   precursor"
FT                   /note="Similar to Streptococcus pyogenes, and Streptococcus
FT                   pyogenes metal ABC transporter substrate-binding
FT                   lipoprotein precursor MtsA or SPY0453 or SPYM3_0318 or
FT                   SPS1539 SWALL:MTSA_STRPY (SWALL:Q9A157) (310 aa) fasta
FT                   scores: E(): 1e-14, 27.11% id in 284 aa, and to Bacteroides
FT                   thetaiotaomicron putative zinc ABC transporter,
FT                   zinc-binding protein BT3249 SWALL:AAO78355 (EMBL:AE016939)
FT                   (308 aa) fasta scores: E(): 1.6e-80, 75.17% id in 294 aa,
FT                   and to Chlorobium tepidum adhesion protein, putative CT2106
FT                   SWALL:Q8KAQ0 (EMBL:AE012959) (344 aa) fasta scores: E():
FT                   3.1e-34, 35.58% id in 281 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05870"
FT                   /db_xref="GOA:Q5LJ06"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ06"
FT                   /protein_id="CAH05870.1"
FT                   /translation="MRMNRTHQSIVTHIPGRGMRGQTVLFLFLLLLSACSGRGKGDAGE
FT                   RIITVTMEPQRYFTEAIAGDKFTVRSMVPKGSSPETYDPTPQQLVSLGESEAYLRIGYI
FT                   GFERSWMDRLMNNTPHIQVFDTSTGVDLIFESAFDHGDHRHEGGVEPHIWNSTANALII
FT                   AGNTFKALTVLDKGNEAYYKARYDSLCQRIEQTDSLIRQTLSVPGADRAFIIYHPALSY
FT                   FARDYGLHQISIEEGGKEPSPAHLKGLMDLCKKEGVRVIFVQPEFDRRNAEIIAKQTGT
FT                   QVISINPLSYDWEEEMLNVARSLRGEPGY"
FT   misc_feature    complement(95642..96490)
FT                   /note="Pfam match to entry PF01297 SBP_bac_9, Periplasmic
FT                   solute binding protein family, score 168.3, E-value
FT                   1.1e-47"
FT   misc_feature    complement(96437..96556)
FT                   /note="Signal peptide predicted for BF0092 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.677) with cleavage site
FT                   probability 0.198 between residues 40 and 41"
FT   CDS_pept        complement(96562..97338)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0092"
FT                   /old_locus_tag="BF0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3250 SWALL:AAO78356 (EMBL:AE016939)
FT                   (240 aa) fasta scores: E(): 1.5e-55, 65.73% id in 251 aa,
FT                   and to Escherichia coli O157:H7 hypothetical protein YfcK
FT                   or Z3587 or ECS3208 SWALL:YFCK_ECO57 (SWALL:Q8XCQ7) (668
FT                   aa) fasta scores: E(): 3.5e-10, 31.12% id in 241 aa, and to
FT                   Escherichia coli O6 hypothetical protein YfcK or C2870
FT                   SWALL:Q8FFH0 (EMBL:AE016764) (688 aa) fasta scores: E():
FT                   3.6e-10, 32.08% id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05871"
FT                   /db_xref="GOA:Q5LJ05"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ05"
FT                   /protein_id="CAH05871.1"
FT                   /translation="MERIIEYTADGSATLFVPELNEHYHSVKGALTESSHIFIDMGLKA
FT                   SASPAPHILEIGFGTGLNALLTLIEAERSGRQIHYTGIELYPLPWETVEKLRYNDRPGG
FT                   DGEQRLTTGDEQAAQWMKALHTSPWGEDVRITPHFTLRKIQGDFTIMDRSSLITDRTSL
FT                   FSLLYFDAFAPEKQPEMWTQELFDELYVMMEEEGILTTYCAKGVVRRMLQAAGFIVERL
FT                   PGPPGGKREILRAKKRSQDSPAVTQCNAQPTLKQKG"
FT   CDS_pept        complement(97347..97823)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0093"
FT                   /old_locus_tag="BF0094"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein, putative integral membrane protein
FT                   BT3251 SWALL:AAO78357 (EMBL:AE016939) (159 aa) fasta
FT                   scores: E(): 4.9e-48, 78.98% id in 157 aa, and to
FT                   Methanosarcina acetivorans hypothetical protein Ma3555
FT                   SWALL:Q8TK61 (EMBL:AE011064) (153 aa) fasta scores: E():
FT                   2.4e-13, 33.09% id in 142 aa, and to Campylobacter jejuni
FT                   putative integral membrane protein cj0341C SWALL:Q9PIF9
FT                   (EMBL:AL139074) (147 aa) fasta scores: E(): 3.7e-13, 34.32%
FT                   id in 134 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05872"
FT                   /db_xref="GOA:Q5LJ04"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ04"
FT                   /protein_id="CAH05872.1"
FT                   /translation="MDAFIETVSQILIDWGYPGLFISALLAGSIVPFSSEIVLLGLVKL
FT                   GLDPTLCLISASLGNTAGGMTCYYMGRLGRIDWIEKYFKVKKEKIDKMQRFLQGKGALM
FT                   AFFAFLPAIGEVISIALGYMRSNVWLTTASMFAGKLIRYIILLKAMQEALNLVM"
FT   misc_feature    complement(order(97383..97442,97452..97520,97698..97766))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BF0094 by TMHMM2.0 at aa 20-42, 102-124 and 128-147"
FT   CDS_pept        complement(97808..98800)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0094"
FT                   /old_locus_tag="BF0095"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3252 SWALL:AAO78358 (EMBL:AE016939) (336 aa)
FT                   fasta scores: E(): 2.7e-86, 63.09% id in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05873"
FT                   /db_xref="GOA:Q5LJ03"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ03"
FT                   /protein_id="CAH05873.1"
FT                   /translation="MRNQRLQGRITAGRFTLPIVIFTCIACWVLTSVLLPGLEVKESSY
FT                   PLWNIVNIPAWANRIVSFLLFAGIGYFLIELNNTFAIIRMRASVQTSLYFLLITACPGM
FT                   HLLYAGDVAAVTFLISLYFLFKSYQQPRPAGYLFHSFALLSAGSVAFPQLTYFIPIWLM
FT                   GASGFQSLTFRSFCGSIIGWSIPYWFLLGHAFFHNEIELFYQPFIHLADFRDIDFGRDF
FT                   QLWEVVTLGYLFILYIVSSIHCIVAGYEDKIRTRAYLHFLIFLNFCIFLFIVLQPALSM
FT                   NLLSLLLIGISILVGHLFVLTNSKSSNLFFIGSMITLIALFCFNIWTLL"
FT   misc_feature    complement(order(97814..97882,97901..97954,97964..98032,
FT                   98069..98137,98210..98278,98315..98383,98426..98521,
FT                   98579..98638,98696..98764))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BF0095 by TMHMM2.0 at aa 13-35, 55-74, 94-125, 140-162,
FT                   175-197, 222-244, 257-279, 283-300 and 307-329"
FT   CDS_pept        complement(98800..100074)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BF9343_0095"
FT                   /old_locus_tag="BF0096"
FT                   /product="putative phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="Similar to Escherichia coli
FT                   phosphoribosylamine--glycine ligase PurD or B4005
FT                   SWALL:PUR2_ECOLI (SWALL:P15640) (429 aa) fasta scores: E():
FT                   5.5e-69, 48.25% id in 429 aa, and to Bacteroides
FT                   thetaiotaomicron phosphoribosylamine--glycine ligase BT3253
FT                   SWALL:AAO78359 (EMBL:AE016939) (424 aa) fasta scores: E():
FT                   1.1e-136, 83.96% id in 424 aa, and to Pseudomonas putida
FT                   phosphoribosylamine--glycine ligase PurD or PP4823
FT                   SWALL:AAN70392 (EMBL:AE016792) (431 aa) fasta scores: E():
FT                   8.1e-71, 49.06% id in 428 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05874"
FT                   /db_xref="GOA:Q5LJ02"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ02"
FT                   /protein_id="CAH05874.1"
FT                   /translation="MKILLLGSGGREHALAWKIAQSPKVEKLFIAPGNAGTGEVGENVN
FT                   IKATDFAALGAFALEESIDMIVVGPEDPLVEGIYDHFQSNPCLKNIAIIGPSKEGARLE
FT                   GSKEFAKEFMHRHHIPTARYQSVTADTLNEGLAFLETLEAPYVLKADGLCAGKGVLILP
FT                   TLEEAKKELKEMLGGMFGNASATVVIEEFLSGIECSVFVLTDGDHYKVLPVAKDYKRIG
FT                   EGDKGLNTGGMGSVTPVPFADEVFMEKVRTRIIEPTVNGLKAEGITYKGFIFLGLINVK
FT                   GEPMVIEYNVRMGDPETESVMLRIQSDLVELLEGVAEGNLDARSLVIDPRTATCVMMVS
FT                   GGYPEAYQKGYAINGLEAARATDSILFHAGTAMKDGQAVTSGGRVLAICSYGNDKADAL
FT                   AQCYKVADMIDFKDKNYRRDIGFDL"
FT   misc_feature    complement(98806..99081)
FT                   /note="Pfam match to entry PF02843 GARS_C,
FT                   Phosphoribosylglycinamide synthetase, C domain, score
FT                   111.3, E-value 1.5e-30"
FT   misc_feature    complement(99091..99507)
FT                   /note="Pfam match to entry PF01071 GARS,
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain,
FT                   score 205.7, E-value 6.1e-59"
FT   misc_feature    complement(99244..99267)
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT   misc_feature    complement(99508..99759)
FT                   /note="Pfam match to entry PF02842 GARS_B,
FT                   Phosphoribosylglycinamide synthetase, B domain, score
FT                   117.8, E-value 1.7e-32"
FT   misc_feature    complement(99763..100074)
FT                   /note="Pfam match to entry PF02844 GARS_N,
FT                   Phosphoribosylglycinamide synthetase, N domain, score
FT                   169.7, E-value 4.2e-48"
FT   CDS_pept        complement(100096..102255)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0096"
FT                   /old_locus_tag="BF0097"
FT                   /product="putative exported dipeptidyl peptidase IV"
FT                   /note="Similar to Xanthomonas maltophilia dipeptidyl
FT                   peptidase IV SWALL:P95782 (EMBL:D83263) (741 aa) fasta
FT                   scores: E(): 2.2e-56, 32.47% id in 622 aa, and to
FT                   Bacteroides thetaiotaomicron dipeptidyl peptidase IV BT3254
FT                   SWALL:AAO78360 (EMBL:AE016939) (732 aa) fasta scores: E():
FT                   1.7e-113, 69.95% id in 729 aa, and to Xanthomonas
FT                   axonopodis dipeptidyl peptidase IV XAC4046 SWALL:Q8PFD7
FT                   (EMBL:AE012053) (757 aa) fasta scores: E(): 1.2e-57, 31.48%
FT                   id in 632 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05875"
FT                   /db_xref="GOA:Q5LJ01"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ01"
FT                   /protein_id="CAH05875.1"
FT                   /translation="MIKQIMKTNSKQKSALLVMLLSLLIPNIMAQEPKMPTLEDLIPGG
FT                   ATYRSAENISGLQWWGDQCIKPGIEAVFMINPKNGKETPLTTRNIVNKALEAGNHGKLQ
FT                   HFYNVSFPWPKKSLMLIALPDKYIVYDFDYREVISTRPLPKEGANRDYHPETGHVAYTI
FT                   GNNLYVDDRAVTNEPEGIVCGQSVHRNEFGIKKGTFWSPSGNLLAFYRMDQSMVAQYPL
FT                   VDVTAPIAEVNNIRYPMAGMTSHQVKVGIYNPTTGKSIYLNAGDPTDRYFTNISWAPDE
FT                   KSLYLIELNRNQNHAKLCRYDVETGELTATLFEEKSDKYVEPQDPIIFLPWDNSKFIYQ
FT                   SQKDGFSHLYLYDTNGRQIRQLTEGDWLVKEVLGFDTKKKEIIIASTEFSPLQNNLFRL
FT                   DTKTGTRTPLGSAEGVHSGQLSPSGRYLIDQYNSPTVPRSINIIDVQSGKSVNLLTAAD
FT                   PFTGYKMPGIETGTIKAADGKTDLYYRLIKPADFDPNKKYPAIVYVYGGPHAQLVTNGW
FT                   QNGARGWDIYMANKGYIMFTVDGRGSSNRGLDFENVTFRQLGIEEGRDQVKGTEFLKSL
FT                   PYVDGNRIGVHGWSFGGHMTTALLLRYPEIFKVGVAGGPVIDWGYYEVMYGERYMDTPQ
FT                   SNPKGYKECNLKNLAGNLKGHLMIIHDDHDDTCVPQHTLSFMKACIDARTYPDLFIYPC
FT                   HKHNVSGRDRVHLHEKITRYFEDYL"
FT   misc_feature    complement(100471..100695)
FT                   /note="Pfam match to entry PF00326 Peptidase_S9, Prolyl
FT                   oligopeptidase family, score 21.8, E-value 2.3e-05"
FT   misc_feature    complement(100720..102150)
FT                   /note="Pfam match to entry PF00930 DPPIV_N_term, Dipeptidyl
FT                   peptidase IV (DPP IV) N-terminal region, score 109.6,
FT                   E-value 5e-30"
FT   misc_feature    complement(102166..102255)
FT                   /note="Signal peptide predicted for BF0097 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 30 and 31"
FT   CDS_pept        complement(102391..103731)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0097"
FT                   /old_locus_tag="BF0098"
FT                   /product="putative methylase"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   N6-adenine-specific DNA methylase BT3255 SWALL:AAO78361
FT                   (EMBL:AE016939) (489 aa) fasta scores: E(): 4.3e-143,
FT                   78.11% id in 489 aa, and to Synechocystis sp. hypothetical
FT                   protein SLR0064 SWALL:Y064_SYNY3 (SWALL:Q55156) (384 aa)
FT                   fasta scores: E(): 2.2e-46, 38.48% id in 369 aa, and to
FT                   Vibrio parahaemolyticus putative N6-adenine-specific DNA
FT                   methylase vp1597 SWALL:BAC59860 (EMBL:AP005078) (707 aa)
FT                   fasta scores: E(): 4.4e-41, 35.06% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05876"
FT                   /db_xref="GOA:Q5LJ00"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LJ00"
FT                   /protein_id="CAH05876.1"
FT                   /translation="MSEQFEMIAKTFQGLEEILAEELTTLGANDVQIGRRMVSFTGDKE
FT                   MMYKANFCLRTAIRILKPIKHFTAKDADAVYEQIKAIRWEEILDVDKTFAVDAVVFSDE
FT                   FRHSKFVSYKVKDAIVDYFRELNGKRPSVRISRPDVLLNIHIAQTTCTLSLDSSGESLH
FT                   RRGYRQEAVEAPLNEVLAAGMILMTGWKGECDLIDPMCGSGTIPIEAALIARNIAPGVF
FT                   RKEFAFEKWGDFDQNLFDRIYNDDSQEREFTHKIYGYDNNPKANEIATHNVKAAGVSKD
FT                   IILKLQPFQQFEQPAEKSIIITNPPYGERISTNDLLGLYNMIGERLKHAFVGNDAWILS
FT                   YREECFDQIGLKPSVKTPLFNGPLECEFRKYQIFDGKYKEFKSQEGGDENGERAPKERR
FT                   EFKPRREEGGFRGERRPREERNSEYGDRRPREFKGNREPKIKKPQED"
FT   misc_feature    complement(102622..103239)
FT                   /note="Pfam match to entry PF01170 UPF0020, Putative RNA
FT                   methylase family UPF0020, score 144.7, E-value 1.4e-40"
FT   misc_feature    complement(102811..102831)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    complement(103105..103140)
FT                   /note="PS01261 Uncharacterized protein family UPF0020
FT                   signature."
FT   misc_feature    complement(103261..103554)
FT                   /note="Pfam match to entry PF02926 THUMP, THUMP domain,
FT                   score 51.6, E-value 1.5e-12"
FT   CDS_pept        complement(103809..104708)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0098"
FT                   /old_locus_tag="BF0099"
FT                   /product="putative serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Similar to Synechococcus sp. serine
FT                   acetyltransferase, plasmid srpH SWALL:SRPH_SYNP7
FT                   (SWALL:Q59967) (319 aa) fasta scores: E(): 9.8e-49, 48.28%
FT                   id in 292 aa, and to Bacteroides thetaiotaomicron serine
FT                   acetyltransferase BT3256 SWALL:AAO78362 (EMBL:AE016939)
FT                   (300 aa) fasta scores: E(): 1.6e-103, 89.03% id in 301 aa,
FT                   and to Synechococcus sp. CysE sex3037 SWALL:AAM81165
FT                   (EMBL:AF441790) (319 aa) fasta scores: E(): 9.8e-49, 48.28%
FT                   id in 292 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05877"
FT                   /db_xref="GOA:Q5LIZ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ9"
FT                   /protein_id="CAH05877.1"
FT                   /translation="MSPLNFTHILTQTVDELSESESYKGLFHQHKDGEPLPSPRVLCDV
FT                   IELARSILFPGYYGNSTVNSRTINYHIGVNVEKLFNLLTEQILAGLCFGNGDRCDECTE
FT                   AKREEAARLAAKFISKLPHLRRVLATDVEAAYNGDPAAQSFGEVIFCYPAIKAISNYRI
FT                   AHELLELGVPLIPRIITEMAHSETGIDIHPGARIGTHFTIDHGTGVVIGATSIIGNNVK
FT                   LYQGVTLGARSFPLDADGKPIKGIPRHPILEDNVIVYSNATILGRITIGRDATVGGNIW
FT                   VTENIPAGARIVQTKAKK"
FT   misc_feature    complement(103893..103946)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 10.6,
FT                   E-value 3"
FT   misc_feature    complement(104016..104069)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 17.2,
FT                   E-value 0.034"
FT   CDS_pept        104835..106865
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0099"
FT                   /old_locus_tag="BF0100"
FT                   /product="putative two-component regulator sensor kinase"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   two-component system sensor histidine kinase BT3257
FT                   SWALL:AAO78363 (EMBL:AE016939) (692 aa) fasta scores: E():
FT                   1.6e-160, 61.41% id in 679 aa, and to Escherichia coli, and
FT                   Escherichia coli O157:H7 hypothetical protein YpdA or b2380
FT                   or Z3645 or ECS3260 SWALL:YPDA_ECOLI (SWALL:P76523) (565
FT                   aa) fasta scores: E(): 4.9e-11, 25.67% id in 335 aa, and to
FT                   Escherichia coli O6 hypothetical protein YpdA or c2919
FT                   SWALL:Q8FFE1 (EMBL:AE016764) (565 aa) fasta scores: E():
FT                   7.6e-11, 25.37% id in 335 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05878"
FT                   /db_xref="GOA:Q5LIZ8"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ8"
FT                   /protein_id="CAH05878.1"
FT                   /translation="MRHRANLAIVFFCLLLPLTGCKQKINRSDSAFGGMSIDSVERCAQ
FT                   DSLFSNTRYSRSLLRHAMADAPDSLSYYYLLSFYSKSYFVTADFDSVLYYNRLVKRFCN
FT                   EVELSAEVHDLLSTVYNMEGNVLMQCTQPDSAIISYKKAYEERLQGQQTDYLPDLCINL
FT                   ADANVHKGDYAYAAYYYRRALFICDSLGLPDRNKFPVYYGLGQTYMELRDFELSNHYYE
FT                   LAGNFFPQMSVSEKWTYLNNRGNHFYYKKDYPQAVHYIGRALEVVKSYPQMVFEQNLCK
FT                   ANLGELYVITNKLDSAQLYLDESYRFFSGIGNQSALYYIETQMIELALKKGNVALAGDI
FT                   IRRSADYGHIDANMINIRNHYLQHYYEQVGNYKKAYEYQKHDLQLNDSIRNERVRTRVA
FT                   ELDMRYRQDTIVMRKELVIEKQKGEMEVLKLTTYIWALIGIVSVIVAGLVYWYMKKKRM
FT                   FLQERHINQISRFRMENIRNRLSPHFTFNVLNREISRFRDGETLCGDLTELVKLLRKSL
FT                   ELTEKLSISLYDELEFVKTYIHLEQGRLGSDFSMDVKIEEDLDIQQVVIPSMVVQIPVE
FT                   NALKHGLAGIDGLKLLGISVCRKGSGILIDICDNGRGYSPQTLSSTRGTGTGLKVLYQT
FT                   IQLLNDKNREKIRFEIKNLVNNGQTGTQVLIYIPLDYSYNL"
FT   misc_feature    105183..105284
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   2.1, E-value 2.3"
FT   misc_feature    105303..105404
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   12.5, E-value 0.18"
FT   misc_feature    105426..105527
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   5.9, E-value 0.91"
FT   misc_feature    105543..105644
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   21.6, E-value 0.0016"
FT   misc_feature    106125..106193
FT                   /note="1 probable transmembrane helix predicted for BF0100
FT                   by TMHMM2.0 at aa 431-453"
FT   misc_feature    106518..106847
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 35.3,
FT                   E-value 1.2e-07"
FT   CDS_pept        106878..107633
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0100"
FT                   /old_locus_tag="BF0101"
FT                   /product="putative two-component response regulator"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   two-component system response regulator BT3258
FT                   SWALL:AAO78364 (EMBL:AE016939) (210 aa) fasta scores: E():
FT                   1.7e-56, 70.47% id in 210 aa, and to Vibrio cholerae
FT                   hypothetical response regulatory protein Vc0693
FT                   SWALL:Q9KU36 (EMBL:AE004155) (237 aa) fasta scores: E():
FT                   5e-13, 31.2% id in 250 aa, and to Vibrio parahaemolyticus
FT                   hypothetical response regulatory protein Vp0538
FT                   SWALL:BAC58801 (EMBL:AP005074) (242 aa) fasta scores: E():
FT                   3.4e-12, 40.32% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05879"
FT                   /db_xref="GOA:Q5LIZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ7"
FT                   /protein_id="CAH05879.1"
FT                   /translation="MYKVIIIDDEKAAIETLRRDLEVQTDLEIKGTAGNGAKGKKLIMD
FT                   IHPDLLFLDIELPDIQGIRLLSEIREQVLWDMKVVFYTAYDKYLLQALRESAFDYLLKP
FT                   YDIEELNLIIERYRKTMASARPLPSFASAVGTLMPGRDLFMISTVTGFRFLRLEEIGYF
FT                   EYLKDKRLWQVELFNQTKLCLKKNTTAGDIIGYSDAFVQISQSAIININYLAMIKSKQC
FT                   LLYPPFSDKEDLIISRGFLKELQERFCII"
FT   misc_feature    106881..107243
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 86.2, E-value 5.7e-23"
FT   CDS_pept        107845..107961
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0101"
FT                   /old_locus_tag="BF0102"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05880"
FT                   /db_xref="GOA:Q5LIZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ6"
FT                   /protein_id="CAH05880.1"
FT                   /translation="MKKLRLFYDVVISNNLFYFFFMFHVTQKKTEAVSNGLF"
FT   misc_feature    107863..107922
FT                   /note="1 probable transmembrane helix predicted for BF0102
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(108009..108404)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0102"
FT                   /old_locus_tag="BF0103"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3259 SWALL:AAO78365 (EMBL:AE016939) (131 aa)
FT                   fasta scores: E(): 1.3e-34, 68.7% id in 131 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT2500
FT                   SWALL:AAO77607 (EMBL:AE016936) (172 aa) fasta scores: E():
FT                   2.7e-10, 29.54% id in 132 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05881"
FT                   /db_xref="InterPro:IPR024339"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ5"
FT                   /protein_id="CAH05881.1"
FT                   /translation="MKTTGFLKTVALSAVLLVSSVAVSARNYDNNLIYNSEEENGMLIG
FT                   QTVYKKEGSSLANYMKYNYKYDDNKRMIESQTMKWNSNKNNWENDLLVRYTYEGKTITT
FT                   NYYKWNNRKSEFILAPEMTVTMDNPNL"
FT   misc_feature    complement(108330..108404)
FT                   /note="Signal peptide predicted for BF0103 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.645 between residues 25 and 26"
FT   CDS_pept        complement(108674..111499)
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BF9343_0103"
FT                   /old_locus_tag="BF0104"
FT                   /product="putative DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase I PolA or
FT                   ResA or B3863 SWALL:DPO1_ECOLI (SWALL:P00582) (928 aa)
FT                   fasta scores: E(): 2.1e-121, 44.57% id in 949 aa, and to
FT                   Bacteroides thetaiotaomicron DNA polymerase I BT3260
FT                   SWALL:Q8A2P5 (EMBL:AE016939) (949 aa) fasta scores: E():
FT                   1.7e-191, 83.26% id in 950 aa, and to Yersinia pestis DNA
FT                   polymerase I PolA or YPO0017 or Y3811 SWALL:Q8ZJS1
FT                   (EMBL:AJ414141) (932 aa) fasta scores: E(): 7.2e-125,
FT                   42.66% id in 947 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05882"
FT                   /db_xref="GOA:Q5LIZ4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ4"
FT                   /protein_id="CAH05882.1"
FT                   /translation="MKKLKNMNQNSKLFLLDAYALIYRAYYAFIKNPRINSKGFNTSAI
FT                   LGFVNTLEEVLKKENPTHIGVAFDPPGPTFRHEAFEQYKAQREETPEAIRLSVPIIKDI
FT                   IKAYRIPILEVAGYEADDVIGTLATEAGNQGITTYMMTPDKDYGQLVTDHVFMYRPKYG
FT                   DKEFEVMGVEQVKAKFDIQSPAQVIDMLGLMGDSSDNIPGCPGVGEKTAQKLIAEFGSI
FT                   ENLLEHTDQLKGALKTKVETNREMIIFSKFLATIKVDVPIRLDMNSLVREQADEDTLRK
FT                   IFEELEFRTLMERIFKKESSPASPIAGTLFNQENGPVQGNLFEEFTPDHTNEEKKSNLE
FT                   SLNSLSYDYQLIDTEEKRNEIIKKLLTSEILALDTETTGTDPMDAELVGMSFSITENQA
FT                   FYVPVPAEREEAIKIVREFEPVFKNEKSLKVGQNIKYDMLVLQNYGIEVRGKLFDTMVA
FT                   HYVLQPELRHNMDYLAEIYLHYQTIHIEELIGPKGKGQKNMRDLSPQEVYLYACEDADV
FT                   TLKLKNILEQELKKNDAEKLFYEIEMPLVPVLVNIESNGVRLDTEALKQSSEHFTTRLQ
FT                   SIEKEIYTLAEGEFNIASPKQVGEILFDKLKIVEKAKKTKTGQYVTSEEVLESLRNKHD
FT                   IIGKILEYRGLKKLLSTYIDALPQLINPKTGRIHTSFNQTVTATGRLSSSNPNLQNIPI
FT                   RDEDGKEIRKAFIPDDGCSFFSADYSQIELRIMAHLSEDKNMIDAFLSGYDIHAATAAK
FT                   IYKVDIKEVTADMRRKAKTANFGIIYGISVFGLAERMNVDRKEAKELIDGYFETYPQVK
FT                   SYMDKSIQVAREHGYVETIFHRKRFLPDINSRNAVVRGYAERNAINAPIQGSAADIIKV
FT                   AMARIYERFKAEGLKAKMILQVHDELNFSVPAKEKEIVEQVVIEEMEKAYRMHVPLKAD
FT                   CGWGTNWLEAH"
FT   misc_feature    complement(108680..109825)
FT                   /note="Pfam match to entry PF00476 DNA_pol_A, DNA
FT                   polymerase family A, score 594.6, E-value 5.2e-176"
FT   misc_feature    complement(109142..109201)
FT                   /note="PS00447 DNA polymerase family A signature."
FT   misc_feature    complement(109910..110473)
FT                   /note="Pfam match to entry PF01612 3_5_exonuclease, 3'-5'
FT                   exonuclease, score 164.5, E-value 1.5e-46"
FT   misc_feature    complement(110657..110950)
FT                   /note="Pfam match to entry PF01367 5_3_exonuclease, 5'-3'
FT                   exonuclease, C-terminal SAM fold, score 157.7, E-value
FT                   1.7e-44"
FT   misc_feature    complement(110963..111337)
FT                   /note="Pfam match to entry PF02739 5_3_exonuc_N, 5'-3'
FT                   exonuclease, N-terminal resolvase-like domain, score 108.6,
FT                   E-value 1e-29"
FT   CDS_pept        111567..112541
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0104"
FT                   /old_locus_tag="BF0105"
FT                   /product="putative octaprenyl-diphosphate synthase"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   octaprenyl-diphosphate synthase IspB or Cel or B3187 or
FT                   SF3227 SWALL:ISPB_ECOLI (SWALL:P19641) (323 aa) fasta
FT                   scores: E(): 1.2e-27, 32.66% id in 300 aa, and to
FT                   Bacteroides thetaiotaomicron octaprenyl-diphosphate
FT                   synthase BT3261 SWALL:AAO78367 (EMBL:AE016939) (324 aa)
FT                   fasta scores: E(): 3.7e-94, 75.61% id in 324 aa, and to
FT                   Chlorobium tepidum polyprenyl synthetase CT1206
FT                   SWALL:Q8KD49 (EMBL:AE012881) (324 aa) fasta scores: E():
FT                   2.4e-36, 34.87% id in 324 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05883"
FT                   /db_xref="GOA:Q5LIZ3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ3"
FT                   /protein_id="CAH05883.1"
FT                   /translation="MDSLSLIKSPITTELEDFKNLFDSSLSSSNLLLNNVIAHIRQRNG
FT                   KMMRPILVLLVAKLYGEIKPETLHAAVSLELLHTASLVHDDVVDESTERRGQLSVNAIF
FT                   NNKVAVLVGDFLLATSLVHAERTRNHDIIGVVACLGQDLAEGEILQLSNVSNREYSETI
FT                   YFDVIRKKTAALFAACTKAAALSVEVTDEKAEFARLFGENIGICFQIKDDIFDYFESKE
FT                   IGKPTGNDMLEGKLTLPALYVLNTTTDAWAQEMALRVKAGTATVDEITRLIEFIKQNGG
FT                   IEYAVKVMYEYKERALDLLRTLPDSAVKTSLITYLDYVVDRDK"
FT   misc_feature    111660..112397
FT                   /note="Pfam match to entry PF00348 polyprenyl_synt,
FT                   Polyprenyl synthetase, score 163.9, E-value 2.4e-46"
FT   misc_feature    111810..111854
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT   misc_feature    112176..112214
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT   CDS_pept        complement(112551..113258)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0105"
FT                   /old_locus_tag="BF0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3262 SWALL:AAO78368 (EMBL:AE016939) (226 aa)
FT                   fasta scores: E(): 7.4e-21, 34.45% id in 209 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT3652 SWALL:AAO78757 (EMBL:AE016941) (262 aa) fasta
FT                   scores: E(): 2.5e-07, 23.68% id in 228 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05884"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ2"
FT                   /protein_id="CAH05884.1"
FT                   /translation="MAEQALFQPFNRNQQRENLESTKETDLLISLIPSLQEDFYVDSLT
FT                   TGASKETLSKLLLRNPGIKNETAVIEMIHFLHDEGDRISFSILLPFLVAEYDPKELEEK
FT                   IRERFFGIELFIRKCNNLHHFITCIKADQTFKIGEEELKRGVLAWDMGRMVCLTRIAYD
FT                   AGFIDESLAWNYICSAGQQCIQAFNDWTEVGKSFLLGQAMEATEKRKQELYIRLYRQAT
FT                   ENPNSPWKKRTLK"
FT   CDS_pept        113306..113479
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0106"
FT                   /old_locus_tag="BF0107"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05885"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ1"
FT                   /protein_id="CAH05885.1"
FT                   /translation="MLCIFPGASASRYDDTSNSLTLHSIYNKSIYVKVRETRLLITFHN
FT                   MNFAEFQEKDNN"
FT   CDS_pept        complement(113659..114555)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0107"
FT                   /old_locus_tag="BF0108"
FT                   /product="putative deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   deoxyribose-phosphate aldolase DeoC or Dra or ThyR or B4381
FT                   or C5465 SWALL:DEOC_ECOLI (SWALL:P00882) (259 aa) fasta
FT                   scores: E(): 1.1e-27, 41.39% id in 244 aa, and to
FT                   Bacteroides thetaiotaomicron putative deoxyribose-phosphate
FT                   aldolase BT3263 SWALL:AAO78369 (EMBL:AE016939) (300 aa)
FT                   fasta scores: E(): 2.5e-97, 83.83% id in 297 aa, and to
FT                   Caenorhabditis elegans putative deoxyribose-phosphate
FT                   aldolase f09e5.3 SWALL:DEOC_CAEEL (SWALL:Q19264) (303 aa)
FT                   fasta scores: E(): 6.6e-36, 43.4% id in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05886"
FT                   /db_xref="GOA:Q5LIZ0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIZ0"
FT                   /protein_id="CAH05886.1"
FT                   /translation="MNDTPQDKYLTALAKYDTQLNDADVQVQVAALIEKKVPENNTEEV
FT                   KKFLFNCIDLTTLNTTDSDESVMRFTEKVNRFDDEFPDLKNVAAICVYPNFAQVVKDTL
FT                   EVEGINIACVSGGFPSSQTFTEVKIAETAMALADGADEIDIVIPVGAFLSGDYETMCEE
FT                   IMELKETCKEHHLKVILETGALKTASNIKKASILSMYSGADFIKTSTGKQQPAATPEAA
FT                   YVMCQAIKEYYEQTGNKVGFKPAGGINTVNDALIYYTIVKEVLGKEWLSNELFRLGTSR
FT                   LANLLLSEIKGEELKFF"
FT   misc_feature    complement(113731..114417)
FT                   /note="Pfam match to entry PF01791 DeoC,
FT                   Deoxyribose-phosphate aldolase, score 202.2, E-value
FT                   6.6e-58"
FT   CDS_pept        complement(114548..114886)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0108"
FT                   /old_locus_tag="BF0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3264 SWALL:AAO78370 (EMBL:AE016939)
FT                   (112 aa) fasta scores: E(): 1.6e-34, 81.25% id in 112 aa,
FT                   and to Leptospira interrogans conserved hypothetical
FT                   protein LB212 SWALL:Q8EXJ6 (EMBL:AE011608) (114 aa) fasta
FT                   scores: E(): 2.7e-22, 58.87% id in 107 aa, and to
FT                   Staphylococcus aureus hypothetical protein sav1459 sav1459
FT                   or sa1292 or mw1349 SWALL:Q99U30 (EMBL:AP003362) (105 aa)
FT                   fasta scores: E(): 5.7e-12, 45.45% id in 99 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05887"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR012359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIY9"
FT                   /protein_id="CAH05887.1"
FT                   /translation="MTLEEAQKAVDEWIHKYGVRYFSELTNMAVLTEEVGELARIMARK
FT                   YGDQSFKEGEKDDISDEITDVLWVLLCIANQTGVNLTEAFARNLEKKTQRDNKRHINNP
FT                   KLSEHGNE"
FT   CDS_pept        complement(114886..115338)
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="BF9343_0109"
FT                   /old_locus_tag="BF0110"
FT                   /product="putative D-tyrosyl-tRNA acylase"
FT                   /note="Similar to Bacillus subtilis putative D-tyrosyl-tRNA
FT                   Dtd SWALL:DTD_BACSU (SWALL:O32042) (146 aa) fasta scores:
FT                   E(): 4.5e-24, 51.37% id in 146 aa, and to Bacteroides
FT                   thetaiotaomicron putative D-tyrosyl-tRNA deacylase BT3265
FT                   SWALL:AAO78371 (EMBL:AE016939) (150 aa) fasta scores: E():
FT                   4.7e-50, 86% id in 150 aa, and to Enterococcus faecalis
FT                   hypothetical protein EF1973 SWALL:AAO81719 (EMBL:AE016953)
FT                   (148 aa) fasta scores: E(): 3.3e-29, 58.38% id in 149 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05888"
FT                   /db_xref="GOA:Q5LIY8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIY8"
FT                   /protein_id="CAH05888.1"
FT                   /translation="MRVVIQRVSHASVTIDGHCKSAIQKGMMILVGIEETDSWEDIDWL
FT                   CKKIVNLRIFDDENGVMNKSILEDEGNILVISQFTLHASTKKGNRPSYIKAAKPEISIP
FT                   LYEQFCNDLSCALGKEVKTGEFGADMKVELLNDGPVTICIDTKNKE"
FT   misc_feature    complement(114901..115257)
FT                   /note="Pfam match to entry PF02580 Tyr_Deacylase,
FT                   D-Tyr-tRNA(Tyr) deacylase, score 210.1, E-value 2.8e-60"
FT   CDS_pept        complement(115384..117210)
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BF9343_0110"
FT                   /old_locus_tag="BF0111"
FT                   /product="putative excinuclease UvrC protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 UvrABC system protein c UvrC
FT                   or B1913 or C2326 or Z3001 or ECS2651 SWALL:UVRC_ECOLI
FT                   (SWALL:P07028) (610 aa) fasta scores: E(): 4.1e-55, 32.18%
FT                   id in 609 aa, and to Bacteroides thetaiotaomicron
FT                   excinuclease ABC subunit C BT3266 SWALL:AAO78372
FT                   (EMBL:AE016939) (609 aa) fasta scores: E(): 1.3e-194,
FT                   86.51% id in 608 aa, and to Eubacterium acidaminophilum
FT                   UvrC protein uvrC SWALL:Q93SG1 (EMBL:AJ312124) (607 aa)
FT                   fasta scores: E(): 2.9e-62, 36.34% id in 597 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05889"
FT                   /db_xref="GOA:Q5LIY7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIY7"
FT                   /protein_id="CAH05889.1"
FT                   /translation="MDTNQELKTSEYLKGIVSNLPEKPGIYQYLNAEGTIIYVGKAKNL
FT                   KRRVYSYFSKEHQPGKTRVLVSKIADIRYIVVNSEEDALLLENNLIKKYKPRYNVLLKD
FT                   DKTYPSICVQNEYFPRVFKTRRIIRNGSSYYGPYSHSPSMHAVLDLIKHLYPLRTCNLN
FT                   LSPENIRAGKFNVCLEYHIKNCAGPCIGLQSQEEYLKNIAEIKEILKGNTQEISRLLYQ
FT                   RMQDLAAEMKFEEAQKVKEKYALIENYRSKSEVVSSVLHNIDVFSIEEDGEKSAFINYL
FT                   HITNGAINQAFTFEYKKKLNETKEELLTLGIIEMRERYKSASREIIVPFDIEIELNDVT
FT                   FTIPQRGDKKKLLELSLLNVKQYKADRMKQAEKLNPEQRSMRLMKEIQQELHLDRLPMQ
FT                   IECFDNSNIQGTDAVAACVVFKKAKPSKSDYRKYNIKTVVGADDYASMKEVVRRRYQRA
FT                   IEEESPLPDLIITDGGKGQMEVVRQVMEELQLDIPIAGLAKDRKHRTSEVLFGFPPQTI
FT                   GIKQHSPLFRLLEQIQDEVHRFAITFHRDKRSKRQVASALDNIKGIGEKTKTALLKEFK
FT                   SVKRIKEATIEEVSAIIGESKAKIIKEGLDNH"
FT   misc_feature    complement(116890..117144)
FT                   /note="Pfam match to entry PF01541 Exci_endo_N,
FT                   Endo/excinuclease amino terminal domain, score 105.9,
FT                   E-value 6.6e-29"
FT   CDS_pept        complement(117263..117799)
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="BF9343_0111"
FT                   /old_locus_tag="BF0112"
FT                   /product="putative adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   adenine phosphoribosyltransferase Apt or B0469 or C0588
FT                   SWALL:APT_ECOLI (SWALL:P07672) (183 aa) fasta scores: E():
FT                   2.6e-25, 50.62% id in 160 aa, and to Bacteroides
FT                   thetaiotaomicron adenine phosphoribosyltransferase BT3267
FT                   SWALL:AAO78373 (EMBL:AE016939) (176 aa) fasta scores: E():
FT                   9.5e-54, 86.51% id in 178 aa, and to Leptospira interrogans
FT                   adenine phosphoribosyltransferase LB176 SWALL:Q8EXN2
FT                   (EMBL:AE011606) (177 aa) fasta scores: E(): 1.1e-26, 50.29%
FT                   id in 169 aa, and to Triticum aestivum adenine
FT                   phosphoribosyltransferase 1 apt1 SWALL:APT1_WHEAT
FT                   (SWALL:Q43199) (181 aa) fasta scores: E(): 1.5e-25, 50% id
FT                   in 156 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05890"
FT                   /db_xref="GOA:Q5LIY6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIY6"
FT                   /protein_id="CAH05890.1"
FT                   /translation="MIMSKEKLIKSIREVPDFPIPGILFYDVTTLFKDSERLQELSDIM
FT                   YEMYKDKGITKVVGIESRGFIMGPILATRLGAGFIPIRKPGKLPAETMEESYDKEYGKD
FT                   TVQIHKDALNENDVVLLHDDLLATGGTMKAACNLVKKLHPKKVYVNFIIELKELNGKQV
FT                   FENDQDVDIQSVLSL"
FT   misc_feature    complement(117272..117727)
FT                   /note="Pfam match to entry PF00156 Pribosyltran,
FT                   Phosphoribosyl transferase domain, score 140.1, E-value
FT                   3.3e-39"
FT   CDS_pept        complement(117850..119727)
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BF9343_0112"
FT                   /old_locus_tag="BF0113"
FT                   /product="putative glucose inhibited division protein A"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   glucose inhibited division protein A GidA or B3741 or c4669
FT                   SWALL:GIDA_ECOLI (SWALL:P17112) (629 aa) fasta scores: E():
FT                   1.3e-104, 47.74% id in 622 aa, and to Bacteroides
FT                   thetaiotaomicron glucose-inhibited division protein a
FT                   BT3268 SWALL:AAO78374 (EMBL:AE016939) (628 aa) fasta
FT                   scores: E(): 1e-216, 88.21% id in 628 aa, and to Chlorobium
FT                   tepidum glucose inhibited division protein A GidA or CT2283
FT                   SWALL:Q8KA85 (EMBL:AE012973) (621 aa) fasta scores: E():
FT                   8.6e-116, 50.64% id in 622 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05891"
FT                   /db_xref="GOA:Q5LIY5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIY5"
FT                   /protein_id="CAH05891.1"
FT                   /translation="MDFKYDVIVIGAGHAGCEAAAAAANLGSKTCLITMDMNKVAQMSC
FT                   NPAVGGIAKGQIVREIDALGGYMGLVTDQTAIQFRILNRSKGPAMWSPRAQCDRNKFIW
FT                   AWREILENIPNLHIWQDTVKEIIVENGEVVGLKTFWDVTFHARCIVLTAGTFLNGLMHV
FT                   GKTQLPGGRMAEPASYKLTESIAEHGIEYGRMKTGTPVRIDGRSVHYELMDTQDGECDF
FT                   HKFSFMNTSVRHLKQLQCWTCFTNEEAHNVLRNGLADSPLFNGQIQSIGPRYCPSIETK
FT                   IVTFPDKEQHQLFLEPEGETTQELYLNGFSSSLPMEIQIEALKKIPAFKDLVIYRPGYA
FT                   IEYDYFDPTQLKHTLESKKIKNLFFAGQVNGTTGYEEAGGQGIIAGINAHINCHGGEPF
FT                   TLARDEAYIGVLIDDLVTKGVDEPYRMFTSRAEYRILLRMDDADMRLTERAYKLGLVKE
FT                   DRYALLKSKREAVENIVNFTRNYSIKAALINDALENLGTTPLRQGCKLIDLINRPQITI
FT                   ENISEYVPAFKRELDKITDERKEEILEAAEILIKYEGYIGRERIIADKLARLESIKIKG
FT                   KFDYDSLQSLSTEARQKLKKIDPETIAQASRIPGVSPSDINVLLVLSGR"
FT   misc_feature    complement(117856..119715)
FT                   /note="Pfam match to entry PF01134 GIDA, Glucose inhibited
FT                   division protein A, score 1009.6, E-value 6.2e-301"
FT   misc_feature    complement(117865..117930)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1214.000, SD 3.32 at aa 600-621, sequence
FT                   ETIAQASRIPGVSPSDINVLLV"
FT   misc_feature    complement(118561..118632)
FT                   /note="PS01281 Glucose inhibited division protein A family
FT                   signature 2."
FT   misc_feature    complement(119230..119253)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        120464..122152
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0113"
FT                   /old_locus_tag="BF0114"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4492 SWALL:AAO79597 (EMBL:AE016945)
FT                   (578 aa) fasta scores: E(): 5.7e-40, 30.42% id in 572 aa,
FT                   and to Bacteroides thetaiotaomicron TPR-repeat-containing
FT                   protein BT3220 SWALL:AAO78326 (EMBL:AE016939) (578 aa)
FT                   fasta scores: E(): 1.4e-22, 24.69% id in 567 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT0240 SWALL:AAO75347 (EMBL:AE016926) (584 aa) fasta
FT                   scores: E(): 8.9e-18, 24.39% id in 578 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05892"
FT                   /db_xref="GOA:Q5LIY4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIY4"
FT                   /protein_id="CAH05892.1"
FT                   /translation="MNKTFVGFIFLLFLVGGVVSCQRSSSPYPYSLRYADSLMEISPER
FT                   TLAYLRKLDVSTYSAGDRAYFSLLFTQATDKNMLSLLPCDSLIDTALDYYIKKDGVNWA
FT                   KAWLYKGRIQKKMNMTEQALKSCFTALQGVEGNTGEELKLKGMLYEDMGSIYLHQSLYQ
FT                   KAFDAFYRSYQCDSLLNDHRLVMYPLSNMGWVRVIQGKTVEAFYYLNQSIQLALRLNDS
FT                   AFVSDIYERMSLNCENVDSAFLYAHLSHQYLTKDGDSISLWLTFGDLYLDKQELDSAEY
FT                   YLKRILDTADFKRKILASYSLAEVEKIRGNYQRAFEYQSYYGDNIDSIFLLNKASDIER
FT                   LAYKYDSEAKVVKEKEKQRFLIQQLCYGGVLFLLVIVVIFQRVYRRRQIARLLYEQRIT
FT                   YLNEKTALSQLQIERLEVQISALKQSGMEREQEIDLKQAELCCVIDEKARLRNCLFMET
FT                   SIFKHIRELSTQPRLGQNGTKGSPKVLLMKEQEQLKNILFGIYDDYIRYLKGTYPKITD
FT                   NDCIYCCLKLCEFDDQTIAYCFGNVSKQIVAQRRLRLKKKMAEAN"
FT   misc_feature    120464..120538
FT                   /note="Signal peptide predicted for BF0114 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.975) with cleavage site
FT                   probability 0.356 between residues 25 and 26"
FT   misc_feature    120494..120526
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    120785..120850
FT                   /note="Predicted helix-turn-helix motif with score 983.000,
FT                   SD 2.53 at aa 108-129, sequence LYKGRIQKKMNMTEQALKSCFT"
FT   misc_feature    121544..121603
FT                   /note="1 probable transmembrane helix predicted for BF0114
FT                   by TMHMM2.0 at aa 361-380"
FT   CDS_pept        122322..122672
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0114"
FT                   /old_locus_tag="BF0115"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIY3"
FT                   /protein_id="CAH05893.1"
FT                   /translation="MKTKMIVLVGMLFTQIVFTSNNVYGEDVMAIMKDRHKVHLITHKE
FT                   ANLQRSTLLVACGYIEESQLFLNFNSSLENRKIQVVDSETGQTVFDDTITGTSFSIFLE
FT                   RDSDSFDIYIGR"
FT   misc_feature    122322..122396
FT                   /note="Signal peptide predicted for BF0115 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985) with cleavage site
FT                   probability 0.526 between residues 25 and 26"
FT   CDS_pept        122708..123931
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0115"
FT                   /old_locus_tag="BF0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   pyrogenic exotoxin B BT2451 SWALL:Q8A4Z6 (EMBL:AE016936)
FT                   (426 aa) fasta scores: E(): 1.1e-05, 24.13% id in 435 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05894"
FT                   /db_xref="GOA:Q5LIY2"
FT                   /db_xref="InterPro:IPR000200"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIY2"
FT                   /protein_id="CAH05894.1"
FT                   /translation="MKEIFKLILLLVILSGCIENDEEIILNNSDLEDVSEYKRAEDLIC
FT                   QFSERIDKEKGGTRSSTSQIILSLAGKKSVVIPKIATRTGEISTDSVNMFIFDTEKDGR
FT                   FGFAIATGKAEVGRVYAYVENGILSDTIENEGMAYLVSQIPDIIKQDQLNPNLTRSGEQ
FT                   RTTHVSIPLVKTEWNQHYPYNAQMPTNGKCSISYYYAGCIPIAVAQAITYYRKCPVAYD
FT                   WDAFTVNTGIYDTNLIAPVSQFVKKVADGIKVGYKCDGTGAKNLGSTNDFLKGWGYNVE
FT                   RHKTNDVDKNLLYKCLITKNVVIFGGKKKKSTGHVWLVDGGVFEYSGNMMIGCTNIQVK
FT                   AIHCNFGWNRANNGWYAIKDGAYNRPANSASQDGNNPTNDKNSPNGNFYTENDYIYFHE
FT                   AMGTEILW"
FT   CDS_pept        123949..124329
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0116"
FT                   /old_locus_tag="BF0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="Low similarity to Bacteroides thetaiotaomicron
FT                   hypothetical protein BT0224 SWALL:AAO75331 (EMBL:AE016926)
FT                   (134 aa) fasta scores: E(): 0.015, 25.54% id in 137 aa, and
FT                   to Bacteroides thetaiotaomicron hypothetical protein BT2452
FT                   SWALL:AAO77559 (EMBL:AE016936) (131 aa) fasta scores: E():
FT                   0.21, 27.41% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIY1"
FT                   /protein_id="CAH05895.1"
FT                   /translation="MKKVFFLYCISLLCIYGCNDDSDKYSSNFLKSREVTLNAEGGDIT
FT                   VEGREKFILVQTEEILNQDTIFSIGEINGVEYQGGWYQLEVNGKEMTLNCDRNLTGNKR
FT                   KVVLHFQGTGNSFDVFSLTQLE"
FT   misc_feature    124159..124200
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        complement(124621..125040)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0117"
FT                   /old_locus_tag="BF0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein with conserved domain BT3283
FT                   SWALL:AAO78389 (EMBL:AE016939) (137 aa) fasta scores: E():
FT                   1.6e-49, 86.13% id in 137 aa, and to Chlorobium tepidum
FT                   hypothetical protein CT1383 SWALL:Q8KCN1 (EMBL:AE012896)
FT                   (137 aa) fasta scores: E(): 1.7e-12, 38.05% id in 113 aa,
FT                   and to Treponema pallidum hypothetical UPF0054 protein
FT                   TP0650 SWALL:Y650_TREPA (SWALL:O83656) (160 aa) fasta
FT                   scores: E(): 3.5e-09, 39.42% id in 104 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05896"
FT                   /db_xref="GOA:Q5LIY0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIY0"
FT                   /protein_id="CAH05896.1"
FT                   /translation="MAITYQTEGIKMPDIKKRETTEWIKAVAATYEKRIGEIAYIFCSD
FT                   EKILEVNRQYLQHDYYTDIITFDYCEGNRLSGDLFISLETVKTNSEQFNTPYEEELHRT
FT                   IIHGILHLCGINDKGPGEREIMEAAENKALAMRKQ"
FT   misc_feature    complement(124651..124914)
FT                   /note="Pfam match to entry PF02130 UPF0054, Uncharacterized
FT                   protein family UPF0054, score 25.6, E-value 2.1e-07"
FT   CDS_pept        125239..125361
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0118"
FT                   /old_locus_tag="BF0119"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05897"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX9"
FT                   /protein_id="CAH05897.1"
FT                   /translation="MVRIVFKELISMIFRHYLFANITEAPKSRSDIEENREMSN"
FT   CDS_pept        125490..125915
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0119"
FT                   /old_locus_tag="BF0120"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX8"
FT                   /protein_id="CAH05898.1"
FT                   /translation="MTEFRYSICEPLNPKVIEKGMIAPDSVIGLFNDFQWDYYLKQIEV
FT                   AETRKMDIYFSPSLEVENKANKNGLTISAVGDPEDPEFYIFYKRPISVVKKQFFRKPQT
FT                   VVEDYVSEITGQTKEDVIECLNALIKNDQEFLRRKIA"
FT   CDS_pept        126080..126961
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0120"
FT                   /old_locus_tag="BF0121"
FT                   /product="putative exported protein"
FT                   /note="Similar to Shewanella oneidensis hypothetical
FT                   protein SO0764 SWALL:Q8EIS1 (EMBL:AE015521) (269 aa) fasta
FT                   scores: E(): 2e-24, 41.32% id in 196 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05899"
FT                   /db_xref="GOA:Q5LIX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX7"
FT                   /protein_id="CAH05899.1"
FT                   /translation="MKIVIKEKVIPYILISLFSSIGLSAYGYKAEGQGGSKAVVWSISK
FT                   IDTMQKNVQRNDERNPNIQNIEYLKKIFRQKAVDEISENIVYPLKRTSPIPSVENAEEL
FT                   KERFDSIFDEDLIRIITSSDIDQWSEMGWRGIMLDDGILWMDYDGKITAVNYQSKYEKK
FT                   LAKKLTSKVKGDLSSDLRHNFKGEVYKFKTKNYFIRIDELKNGMYRYACWKKENPESTK
FT                   PDLVLENGKIEFSGSGGNHVITFKNNIYEYKVFHNKIAASGIADITLVVEKNGKEILSE
FT                   DGKLEGDTTQTD"
FT   misc_feature    126080..126166
FT                   /note="Signal peptide predicted for BF0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.904) with cleavage site
FT                   probability 0.484 between residues 29 and 30"
FT   CDS_pept        127330..127464
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0121"
FT                   /old_locus_tag="BF0122"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX6"
FT                   /protein_id="CAH05900.1"
FT                   /translation="MTKSKTGRGKPHSMIIKNLLEEVVRLLPEHHAQTDKILGQREKL"
FT   CDS_pept        complement(127629..129254)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0122"
FT                   /old_locus_tag="BF0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT4606 SWALL:AAO79711 (EMBL:AE016945) (394 aa)
FT                   fasta scores: E(): 0.00073, 22.98% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX5"
FT                   /protein_id="CAH05901.1"
FT                   /translation="MNRTFIMRECLGKALWLCFCLSITGCAEDDRMTPLSADSGDTADE
FT                   LIPIHISLTGDNDYHSSSFNDASTRSHSPLIAEWVGVKAFSPTRTGEQPDYEGPRIASM
FT                   ELTEDTLPRVSTRATVPAGVYFRLIVFRKSGNNYVFQSVADYASNGTGTPVLERGKLLT
FT                   RSGTIRVVGYSFNTTADLGDMPSTYAYNSSTVSIPDMSKDFMTFDSGDITNVNSLSHNL
FT                   PVSFSQKLCKLTITISPTGFPSNTITNCTGVYVKQGGNSTSWKIGPSTNVVAANTNNTA
FT                   AFSPNTTLNTTIRMVPFAGARTITVHFNTLTVGGRTVNNNTEITSTQSVQLKEGKSYTL
FT                   KIQFKKGPGINVPASNINLTQNGCTENDKTILSKLRWAEGNLNSQSNYNLTWASSTTDY
FT                   GYYYIWKNVYVSSGYTGYGAVDPCTRLDESIYGSGWRTPTRSEFISLSRCSNKQLVKYN
FT                   GIQGMWFMNSSTGLFLPAAGYRDGDKGSGTTATAYTNGTGSYYWSSDLNGNSAYGLYIL
FT                   KNDVFVDANGNRKSGVSVRCVHNL"
FT   repeat_region   129406..129566
FT                   /note="invertible region C; active in shotgun"
FT   CDS_pept        129652..129759
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0123"
FT                   /old_locus_tag="BF0124"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX4"
FT                   /protein_id="CAH05902.1"
FT                   /translation="MSESLEKLTSEFLVYAEHGKVCEVNCHNSSLTEYL"
FT   CDS_pept        complement(129876..131108)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0124"
FT                   /old_locus_tag="BF0125"
FT                   /product="putative transmembrane spore maturation-like
FT                   protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3284 SWALL:AAO78390 (EMBL:AE016939)
FT                   (410 aa) fasta scores: E(): 1e-133, 87.31% id in 410 aa,
FT                   and N-terminus to residue 198 similar to Bacillus subtilis
FT                   spore maturation protein A SpmA SWALL:SPMA_BACSU
FT                   (SWALL:P35157) (196 aa) fasta scores: E(): 1.4e-24, 43.45%
FT                   id in 191 aa, and C-terminus from residue 243 is similar to
FT                   Bacillus subtilis spore maturation protein B SpmB
FT                   SWALL:SPMB_BACSU (SWALL:P35158) (179 aa) fasta scores: E():
FT                   1.8e-15, 38.46% id in 169 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05903"
FT                   /db_xref="GOA:Q5LIX3"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX3"
FT                   /protein_id="CAH05903.1"
FT                   /translation="MVLNYIWIAFFVIAFVVAVCKLLFFGDTQIFTEIINSTFDSSKTA
FT                   FEISLGLTGVLSLWLGVMKIGENSGLINALSRWLSPVFCRLFPDIPKGHPVMGSIFMNM
FT                   SANMLGLDNAATPMGLKAMKELQELNPKKDTASNPMIMFLVINTSGLIIIPISIMVYRA
FT                   QMGAAQPTDIFIPILLSTFISTLVGVIAVSISQRINLINKAILTLMGCLSLFFGGIIYL
FT                   TTTLSREEMGVYSTLIANVILFSVILLFIIAGIRKKINVYDSFVEGAKEGFTTAVRIIP
FT                   YLVAFLVGIAVFRTSGAMDILVGGIGAIVEFCGLDTGFVGALPTALMKSLSGSGANGLM
FT                   IDTMKQFGPDSFVGRVSCVVRGASDTTFYILAVYFGSVGITKTRNAVTCGLIADFAGII
FT                   AAILISYLFFF"
FT   misc_feature    complement(129882..130355)
FT                   /note="Pfam match to entry PF03751 Spore_mat_B, Spore
FT                   maturation protein B, score 151.2, E-value 1.6e-42"
FT   misc_feature    complement(order(129882..129950,129969..130037,
FT                   130140..130208,130227..130286,130344..130412,
FT                   130431..130499,130527..130592,130626..130694,
FT                   130920..130973,131031..131099))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BF0125 by TMHMM2.0 at aa 4-26, 46-63, 139-161, 173-194,
FT                   204-226, 233-255, 275-294, 301-323, 358-380 and 387-409"
FT   misc_feature    complement(130512..131105)
FT                   /note="Pfam match to entry PF04291 Spore_mat_A, Spore
FT                   maturation protein A, score 321.0, E-value 1.2e-93"
FT   CDS_pept        131215..131913
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0125"
FT                   /old_locus_tag="BF0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Chlorobium tepidum hypothetical protein
FT                   CT1302 SWALL:Q8KCV8 (EMBL:AE012890) (232 aa) fasta scores:
FT                   E(): 1.4e-47, 54.62% id in 227 aa, and to Rickettsia
FT                   conorii hypothetical protein RC0866 SWALL:Q92HA5
FT                   (EMBL:AE008641) (139 aa) fasta scores: E(): 7.3e-21, 43.7%
FT                   id in 135 aa, and to Methanosarcina mazei hypothetical
FT                   protein MM0566 SWALL:Q8PZC8 (EMBL:AE013281) (239 aa) fasta
FT                   scores: E(): 2.4e-10, 27.38% id in 241 aa, and to
FT                   Methanosarcina acetivorans predicted protein MA3673
FT                   SWALL:Q8TJV4 (EMBL:AE011076) (239 aa) fasta scores: E():
FT                   1.1e-09, 28.68% id in 244 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05904"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX2"
FT                   /protein_id="CAH05904.1"
FT                   /translation="MKAIEIQKELETYIDPVKREYLPGFFKTGKGQYGEGDRFLGIVVP
FT                   ATRLVAKKYKNAPFEVMAELLQSEWHECRLCALLMMVERFKKSGGEEREAIYRFYLSQT
FT                   ERINNWDLVDLSAPYIVGEYLKDKSRDDLYRLAESTLLWDQRIAVVSTVTFIRNNDFID
FT                   ILRLSELLLQHKHDLMRKAIGWMLREMGKRDKTLLLQFLDKYSKVMPRTMLRYSIEKLT
FT                   DEERKLYMER"
FT   CDS_pept        132026..132154
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0126"
FT                   /old_locus_tag="BF0127"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIX1"
FT                   /protein_id="CAH05905.1"
FT                   /translation="MENFVRDISSGAAKEISCPESDNKERQICRRNLWACLSLNKA"
FT   CDS_pept        132242..133270
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="BF9343_0127"
FT                   /old_locus_tag="BF0128"
FT                   /product="putative holliday junction DNA helicase"
FT                   /note="Similar to Pseudomonas aeruginosa holliday junction
FT                   DNA helicase RuvB or pa0967 SWALL:RUVB_PSEAE (SWALL:Q51426)
FT                   (352 aa) fasta scores: E(): 7e-64, 60.31% id in 320 aa, and
FT                   to Bacteroides thetaiotaomicron holliday junction DNA
FT                   helicase RuvB BT3285 SWALL:AAO78391 (EMBL:AE016939) (343
FT                   aa) fasta scores: E(): 3.1e-110, 95.89% id in 341 aa, and
FT                   to Chlorobium tepidum holliday junction DNA helicase RuvB
FT                   or CT1630 SWALL:RUVB_CHLTE (SWALL:Q8KC00) (344 aa) fasta
FT                   scores: E(): 6e-67, 61.35% id in 326 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05906"
FT                   /db_xref="GOA:Q5LIX0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIX0"
FT                   /protein_id="CAH05906.1"
FT                   /translation="MEEDFNIRDHQLTSRERDFENALRPLSFEDFNGQDKVVDNLRIFV
FT                   KAARLRAEALDHVLLHGPPGLGKTTLSNIIANELGVGFKVTSGPVLDKPGDLAGVLTSL
FT                   EPNDVLFIDEIHRLSPVVEEYLYSAMEDYRIDIMIDKGPSARSIQIDLNPFTLVGATTR
FT                   SGLLTAPLRARFGINLHLEYYDDDILSNIISRSAGILDVPCSSQAAGEIASRSRGTPRI
FT                   ANALLRRVRDFAQVKGSGSIDTEIANYALEALNIDKYGLDEIDNKILCTIIDKFKGGPV
FT                   GLTTIATALGEDAGTIEEVYEPFLIKEGFLKRTPRGREVTELAYKHLGRSLYNSQKTLF
FT                   ND"
FT   misc_feature    132410..132949
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   105.2, E-value 1.1e-28"
FT   misc_feature    132425..132448
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        133263..134795
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0128"
FT                   /old_locus_tag="BF0129"
FT                   /product="possible polysaccharide biosynthesis
FT                   transmembrane protein"
FT                   /note="Similar to Leptospira interrogans hypothetical 51.3
FT                   kDa protein SWALL:Q8VTY3 (EMBL:AF316500) (447 aa) fasta
FT                   scores: E(): 6.3e-05, 21.19% id in 368 aa, and to
FT                   Bacteroides thetaiotaomicron polysaccharide biosynthesis
FT                   protein BT3287 SWALL:AAO78393 (EMBL:AE016939) (482 aa)
FT                   fasta scores: E(): 1.4e-82, 61.24% id in 498 aa, and to
FT                   Chlorobium tepidum polysaccharide biosynthesis protein
FT                   CT0273 SWALL:Q8KFP9 (EMBL:AE012806) (514 aa) fasta scores:
FT                   E(): 3e-27, 25.91% id in 521 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05907"
FT                   /db_xref="GOA:Q5LIW9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW9"
FT                   /protein_id="CAH05907.1"
FT                   /translation="MISGNTINHKNNMAGLKSLVKDTALYGLSSMVGRFLNYLLVPLYT
FT                   AVLPAASGGYGVVTNVYAWAGLIMVLLTFGMETGFFRFANKSEEDPVKVYANSLISVGG
FT                   ISLIFAILCLTFLQPVSHLLEYGDHPDFIGMMIIVMALDAFLCIPFAYLRFKKRPIKFV
FT                   AIKFVSIIANIVLNLFFLLLCPWLHEHFPAWVDWFYNPTYLVGYIFVSNLITTCLQLFC
FT                   LIPELRGFAYRVDKQLLKRMLIYSFPILIFGLVGILNQTVDKIIYPFLFADRQEGLVQL
FT                   GIYGAATKIAMVMAMFTQAFRYAYEPFVFGKQKEGDNRRMYAQAMKYFLIFAMFAFLVV
FT                   MFYLDLLRYMVAPDYWAGLSVVAIVIGAEIFKGIYFNLSFWYKLIDETRWGAYFSIVGC
FT                   VIIVGMNVMLVPTYGFVASAWASVAGYAVITILSYWIGQKKYPIHYDLKHLGTYVLFTA
FT                   VLYVIGEWVPIENIVLRLAFRTVLLLIFMAYVVRKDLPLSQIPVINRIIKKK"
FT   misc_feature    order(133365..133433,133443..133511,133548..133616,
FT                   133659..133727,133746..133814,133872..133931,
FT                   133989..134048,134106..134174,134247..134315,
FT                   134328..134396,134433..134492,134505..134573,
FT                   134610..134663,134676..134735)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BF0129 by TMHMM2.0 at aa 35-57, 61-83, 96-118, 133-155,
FT                   162-184, 204-223, 243-262, 282-304, 329-351, 356-378,
FT                   391-410, 415-437, 450-467 and 472-491"
FT   CDS_pept        134798..136165
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0129"
FT                   /old_locus_tag="BF0130"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   integral membrane protein BT3288 SWALL:AAO78394
FT                   (EMBL:AE016939) (451 aa) fasta scores: E(): 6.2e-143,
FT                   84.58% id in 454 aa, and to Leptospira interrogans
FT                   conserved hypothetical protein la3012 SWALL:Q8F1W6
FT                   (EMBL:AE011464) (456 aa) fasta scores: E(): 5.8e-65, 41.59%
FT                   id in 440 aa, and to Chlorobium tepidum membrane protein,
FT                   putative CT0488 SWALL:Q8KF44 (EMBL:AE012825) (441 aa) fasta
FT                   scores: E(): 1.7e-53, 39.42% id in 449 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05908"
FT                   /db_xref="GOA:Q5LIW8"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW8"
FT                   /protein_id="CAH05908.1"
FT                   /translation="MKADNRNIFAIKAFLREYLDLRKDKDNELATVDSIRKGVEFKGAN
FT                   LWILIFAIFMASLGLNVNSTAVIIGAMLISPLMGPIMGVGLSVGMNDFELMKRSLKSFL
FT                   ITTAFSVTTATVFFLFTPIAEAQSELLARTSPTIYDVFIALFGGLAGVVALSTKEKGNV
FT                   IPGVAIATALMPPLCTAGYGLASGNLIYFLGAFYLYFINSVFISLATFIGVRLMHFQRK
FT                   EFVDKNREKKVRKYIVLIVILTMCPAIYLTMGIIRSTFFEAAANRFVSEQLNFDNTQVL
FT                   NKKIHYEGDSCEIRVVLIGPEVPEASIAIARSKMKDYKLENTKLIVLQGMNNNEAMDMS
FT                   SIRAMVMEDFYKNSEQRLQEQQVKIATLQQSLERYKSYDEMSRKIIPELKVLYPSVTAL
FT                   SISHTIETTVDSMKTDTIALAVLKFTRHPKNEEKAKISAWLQARVGAKKLRLIVEE"
FT   misc_feature    order(134924..134983,134996..135064,135101..135169,
FT                   135197..135265,135284..135352,135380..135448,
FT                   135506..135565)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BF0130 by TMHMM2.0 at aa 43-62, 67-89, 102-124, 134-156,
FT                   163-185, 195-217 and 237-256"
FT   misc_feature    134969..135424
FT                   /note="Pfam match to entry PF04087 DUF389, Domain of
FT                   unknown function (DUF389), score 180.6, E-value 2.2e-51"
FT   CDS_pept        136217..138394
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0130"
FT                   /old_locus_tag="BF0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3289 SWALL:AAO78395 (EMBL:AE016939)
FT                   (713 aa) fasta scores: E(): 0, 78.12% id in 704 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT0237 SWALL:AAO75344 (EMBL:AE016926) (695 aa) fasta
FT                   scores: E(): 1e-93, 39.54% id in 703 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT0236
FT                   SWALL:AAO75343 (EMBL:AE016926) (682 aa) fasta scores: E():
FT                   1.4e-90, 38.86% id in 687 aa, and to Xylella fastidiosa
FT                   hypothetical protein Xf1887 xf1887 SWALL:Q9PC94
FT                   (EMBL:AE004008) (716 aa) fasta scores: E(): 9.5e-60, 30.7%
FT                   id in 723 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05909"
FT                   /db_xref="GOA:Q5LIW7"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW7"
FT                   /protein_id="CAH05909.1"
FT                   /translation="MNKMKVITSFHNGKRWGEALFLALLLLYPVSMHADEGMWMLGNLN
FT                   KETRKTMKELGLQMPADQLYSTRHPSLKDAVVSFGGFCSGVVVSEDGLVFTNHHCGFSS
FT                   IQQHSSVDHDYLKDGFTAHSREEELPNPELYVRFLLRTENVTRRVLKATTPGMTESERS
FT                   LAIDSMMVLLGDEVTKKDSTLVGIVDAYYGGNEFWLSVYRDFNDVRLVFAPPSSIGKFG
FT                   WDTDNWMWPRHTGDFCVFRIYAGKDNRPADYSPDNVPYRPEYVAPITLDGYKEGSFCMT
FT                   LGYPGSTERYLSSFGIEEMMNGMNQAMIDVRGVKQAIWKREMDRRDSIRIKYASKYDES
FT                   SNYWKNSIGTNKAIRKLKVLDKKRQAEEALRQWIQKTPAEREKLLHLMSSLELNYKDRK
FT                   EVNRAMSYFGESFINGPELVQFALTILNFDFEAEQKQVVAQLQKLLDKYANYDVSIDKE
FT                   VFVAMLKEYRSKVDKAYLPDLYQTIDTLYGGNEQMYVDTLYAHSELTSPRGLKRFLERD
FT                   TTFHMIDDPAVSLGIDLIVKLFDMRSQMAEASDNIEKDEREFNAAMRRMYADRNFYPDA
FT                   NSTMRLSFGTIGSYSPYDGADYGYYTTVKGIFEKVKEHSGDPDFAVQPEVLSLLSSGDF
FT                   GRYADTKGDMNVCFISNNDITGGNSGSAMFNGKGELLGLAFDGNWEAMSSDIVFEPDVQ
FT                   RCIGVDVRYMLFIIEKFGKASHLIQELKIEG"
FT   CDS_pept        complement(138444..139307)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0131"
FT                   /old_locus_tag="BF0132"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3290 SWALL:AAO78396 (EMBL:AE016939)
FT                   (288 aa) fasta scores: E(): 1e-82, 78.47% id in 288 aa, and
FT                   to Bacteroides thetaiotaomicron putative integral membrane
FT                   protein BT2248 SWALL:AAO77355 (EMBL:AE016935) (284 aa)
FT                   fasta scores: E(): 5.5e-36, 39.32% id in 267 aa, and to
FT                   Clostridium tetani integral membrane protein CTC01885
FT                   SWALL:AAO36400 (EMBL:AE015942) (299 aa) fasta scores: E():
FT                   2.1e-18, 29.35% id in 293 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05910"
FT                   /db_xref="GOA:Q5LIW6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW6"
FT                   /protein_id="CAH05910.1"
FT                   /translation="MNKLNGFLYGLLSSASFGLIPLFTIPAMREGMNFESILFYRFLFA
FT                   CLALGCILLLDKQSFHIKRKEIPSLMLLAFLYLMSAVFLFWGYKFMASGVATTIHFMYP
FT                   VLTTLIMMIFFRERKSTWRFFAIALAVVGVSCLSYGDSSGGITALGLFIVLLSALGYAL
FT                   YLVTVSQLKIGQMKGLRLTFYVFLFGTLLLLAGIGTTTGIQTIPDWHTGGNLVLLALIP
FT                   TVVSNLALVRAVKSIGSTLTSVLGAMEPVTAVCVGIFIFGEPFTQSIGIGILLIISAVI
FT                   VIILKR"
FT   misc_feature    complement(138453..138833)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 57.2, E-value 3.1e-14"
FT   misc_feature    complement(order(138453..138515,138528..138596,
FT                   138615..138683,138699..138767,138804..138872,
FT                   138885..138944,138963..139022,139050..139109,
FT                   139143..139199,139227..139295))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BF0132 by TMHMM2.0 at aa 5-27, 37-55, 67-86, 96-115,
FT                   122-141, 146-168, 181-203, 209-231, 238-260 and 265-285"
FT   misc_feature    complement(138891..139265)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 47.0, E-value 3.5e-11"
FT   CDS_pept        complement(139391..139810)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0132"
FT                   /old_locus_tag="BF0133"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05911"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW5"
FT                   /protein_id="CAH05911.1"
FT                   /translation="MPAASEEETHSIGTFFIKAPVSESVGIRRGARTNYQKGTIFLSER
FT                   SICSQITAYSKNQKGNRRILKHRILSLMQNPAIFITSTGERAEINDSEWVGKAKSQNDN
FT                   IHRRATKSKPDLWVTNDIYLRKAVESAVNTSCDPP"
FT   CDS_pept        complement(140054..141997)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0133"
FT                   /old_locus_tag="BF0134"
FT                   /product="putative RNA helicase dead-box protein"
FT                   /note="Similar to Escherichia coli cold-shock dead-box
FT                   protein A Dead or CsdA or MssB or B3162 SWALL:DEAD_ECOLI
FT                   (SWALL:P23304) (628 aa) fasta scores: E(): 1.6e-51, 34.3%
FT                   id in 618 aa, and to Bacteroides thetaiotaomicron
FT                   ATP-dependent RNA helicase BT3303 SWALL:AAO78409
FT                   (EMBL:AE016940) (647 aa) fasta scores: E(): 8.8e-175,
FT                   84.99% id in 653 aa, and to Methanosarcina acetivorans
FT                   ATP-dependent RNA helicase Dead or ma3956 SWALL:Q8TJ32
FT                   (EMBL:AE011107) (555 aa) fasta scores: E(): 3.3e-59, 38.92%
FT                   id in 578 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05912"
FT                   /db_xref="GOA:Q5LIW4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW4"
FT                   /protein_id="CAH05912.1"
FT                   /translation="MHPKIKIYRDLMKTFEELGVSPEIRKAIEEMGYENPMPVQEEVIP
FT                   YLLGENNDVVALAQTGTGKTAAFGLPLIQKINVKNRIPQSLVLCPTRELCLQIAGDLND
FT                   YSKYIDGLKVLPVYGGSSIDSQIRSLKRGVHIIVATPGRLLDLMERKTVSLATVTNVVM
FT                   DEADEMLNMGFTDSINAILADVPQERNTLLFSATMSPEIARISKNYLHNAKEITIGRKN
FT                   ESTSNVKHVVYTVHAKDKYAALKRIVDYYPQIYGIIFCRTRKETQEIADKLMQEGYNAD
FT                   SLHGELSQAQRDTVMQKFRIRNIQILVATDVAARGLDVDDLTHVINYGLPDDTESYTHR
FT                   SGRTGRAGKTGTSIAIINLREKGKMREIERIIGKKFIAGEMPTGKQICEKQLLKVIDDL
FT                   EKVKVNEEDINDFMPEIYRKLEWLSKEDLIKRMVSHEFNRFVDYYRNREEIEVPTDSRS
FT                   ERAGKSREGKSSRQAEPGYTRLFINLGKMDNFFPHELITLLNNNTRGRVELGRIDLMKN
FT                   FSFFEVEEKQAQNVVKALNRTNWNGRKVTVEVAGEEASTEHKGRGKRNEGNDQGGRGRS
FT                   SAPSADRKERGKGSKDSKQADSRKGKKPSREERGYSAARGPKGKDEWKQFFKDAEPDFS
FT                   EEGWARRKPKKS"
FT   misc_feature    complement(140345..140599)
FT                   /note="Pfam match to entry PF03880 DbpA, DbpA RNA binding
FT                   domain, score 40.9, E-value 2.4e-09"
FT   misc_feature    complement(140591..140614)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(140954..141187)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 124.1, E-value 2.2e-34"
FT   misc_feature    complement(141305..141922)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 249.2, E-value 4.7e-72"
FT   misc_feature    complement(141488..141514)
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT   misc_feature    complement(141803..141826)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(142059..143114)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0134"
FT                   /old_locus_tag="BF0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3304 SWALL:AAO78410 (EMBL:AE016940)
FT                   (356 aa) fasta scores: E(): 4.6e-94, 68.75% id in 352 aa,
FT                   and to Listeria innocua hypothetical protein LIN2049
FT                   SWALL:Q92A73 (EMBL:AL596170) (326 aa) fasta scores: E():
FT                   9.1e-26, 34.36% id in 323 aa, and to Listeria monocytogenes
FT                   hypothetical protein LMO1935 SWALL:Q8Y5X0 (EMBL:AL591981)
FT                   (326 aa) fasta scores: E(): 2.7e-23, 32.19% id in 323 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05913"
FT                   /db_xref="GOA:Q5LIW3"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW3"
FT                   /protein_id="CAH05913.1"
FT                   /translation="MYKNLFNLLTILLILPSCTDMSPNISVVCEENNIGNCILKWETTP
FT                   LIKGQVKVYTSDNPEFIPEDNPVAMANISDARMTIVTNDPSRRSYYMLVFNDKYRVKVA
FT                   PRNVNMPGIQNFRDLGGYKSATGKHVRWGKLYRSAQIDSLNCFALRKLQNLGIKTILDL
FT                   RSESELHNTPPLQKGFNVVHIPINTGDMEHILHGIQQEKIKTDTIYHMVEAMNRELVAK
FT                   YQKEYKEIFDILLDKNSYPVVIHCSSGKGRTGIVSALILASLDVNADIIMEDYRLSNDY
FT                   FNIPKASKYAYNLPVNSQEAITTLFSAKEDFLNAAKDEIERKYGDVPTYLRKAIGLQSE
FT                   DIHRLRTILLE"
FT   misc_feature    complement(142347..142385)
FT                   /note="PS00383 Tyrosine specific protein phosphatases
FT                   active site."
FT   CDS_pept        complement(143299..144219)
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="BF9343_0135"
FT                   /old_locus_tag="BF0136"
FT                   /product="putative fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="Similar to Rhizobium leguminosarum fructokinase frK
FT                   SWALL:SCRK_RHILT (SWALL:P42720) (326 aa) fasta scores: E():
FT                   4.3e-11, 25.53% id in 282 aa, and to Bacteroides
FT                   thetaiotaomicron fructokinase BT3305 SWALL:AAO78411
FT                   (EMBL:AE016940) (308 aa) fasta scores: E(): 9.5e-106,
FT                   84.26% id in 305 aa, and to Vibrio cholerae fructokinase
FT                   vca0656 SWALL:Q9KLT5 (EMBL:AE004395) (323 aa) fasta scores:
FT                   E(): 4.6e-13, 25.68% id in 257 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05914"
FT                   /db_xref="GOA:Q5LIW2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW2"
FT                   /protein_id="CAH05914.1"
FT                   /translation="MRKVIGIGETILDIIFRNDQPSAAVPGGSVFNGIVSLGRMGVNVC
FT                   FISETGNDHVGNIILQFMRDNHIPTDHVNVFPDGKSPVSLAFLNEHSDAEYIFYKDYPK
FT                   QRLDVLFPSINEDDIIVIGSYYALNPVLRDKILELLDIAKEKRAIVYYDPNFRSSHKNE
FT                   AMKLAPTIIENLEYADIVRGSLEDFYYMYGIKDVEKIYKDKIKFYCPLFLCTAGAERIS
FT                   LRTNAISKEYPVAPLEAVSTIGAGDNFNAGLIYGMLKYDVRYRDLQHLSEETWDKVIQC
FT                   GQDFAAEVCKSFNNSISGEFAANYR"
FT   misc_feature    complement(143314..144219)
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 103.8, E-value 2.9e-28"
FT   misc_feature    complement(143458..143499)
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   CDS_pept        complement(144207..144812)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0136"
FT                   /old_locus_tag="BF0137"
FT                   /product="putative sugar isomerase SIS-domain protein"
FT                   /note="Similar to Leptospira interrogans polysialic acid
FT                   capsule expression protein KpsF or la0046 SWALL:Q8F9Z1
FT                   (EMBL:AE011196) (322 aa) fasta scores: E(): 4.2e-21, 37.24%
FT                   id in 196 aa, and to Bacteroides thetaiotaomicron putative
FT                   sugar isomerase BT3306 SWALL:AAO78412 (EMBL:AE016940) (201
FT                   aa) fasta scores: E(): 8.6e-68, 91.04% id in 201 aa, and to
FT                   Pseudomonas putida KpsF/GutQ family protein PP0957
FT                   SWALL:AAN66582 (EMBL:AE016777) (324 aa) fasta scores: E():
FT                   4e-25, 43.35% id in 203 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05915"
FT                   /db_xref="GOA:Q5LIW1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="PDB:3ETN"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW1"
FT                   /protein_id="CAH05915.1"
FT                   /translation="MIESIQELLQKEAQAVLNIPVTDAYEKAVELIVEQIHRKKGKLVT
FT                   SGMGKAGQIAMNIATTFCSTGIPSVFLHPSEAQHGDLGILQENDLLLLISNSGKTREIV
FT                   ELTQLAHNLNPGLKFIVITGNPDSPLASESDVCLSTGHPAEVCTLGMTPTTSTTVMTVI
FT                   GDILVVQTMKRTEFTIEEYSKRHHGGYLGEKSRKLCVK"
FT   misc_feature    complement(144303..144713)
FT                   /note="Pfam match to entry PF01380 SIS, SIS domain, score
FT                   95.7, E-value 8.1e-26"
FT   CDS_pept        complement(144812..145342)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0137"
FT                   /old_locus_tag="BF0138"
FT                   /product="putative lysine decarboxylase"
FT                   /note="Similar to Eikenella corrodens lysine decarboxylase
FT                   SWALL:Q9Z4R8 (EMBL:U89166) (183 aa) fasta scores: E():
FT                   1.1e-14, 36.49% id in 137 aa, and to Bacteroides
FT                   thetaiotaomicron lysine decarboxylase BT3307 SWALL:AAO78413
FT                   (EMBL:AE016940) (161 aa) fasta scores: E(): 2.6e-40, 72.5%
FT                   id in 160 aa, and to Bacillus halodurans lysine
FT                   decarboxylase BH2746 SWALL:Q9K9A3 (EMBL:AP001516) (190 aa)
FT                   fasta scores: E(): 1.2e-17, 40.78% id in 152 aa"
FT                   /note="unknown EC_number: ORLD"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05916"
FT                   /db_xref="GOA:Q5LIW0"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIW0"
FT                   /protein_id="CAH05916.1"
FT                   /translation="MEKIGIFCSASGSIDPIYFDAAHQIGEWMGKNGKTLIYGGANLGL
FT                   MECVAKAVKENGGHVIGVVPSKLEENGKVSTYPDEIIATHDLSDRKDIILQQSDVLVAL
FT                   PGGIGTLDEVFHVMAAASIGYHQKKVIFYNADGFYNPLLAVLSELQARGFTRHPLSSYY
FT                   EVANTFNELTIKI"
FT   misc_feature    complement(144815..145207)
FT                   /note="Pfam match to entry PF03641 Lysine_decarbox, Lysine
FT                   decarboxylase family, score 89.1, E-value 7.7e-24"
FT   CDS_pept        145471..146691
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0138"
FT                   /old_locus_tag="BF0139"
FT                   /product="putative peptidase"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   zinc protease YmxG BT3308 SWALL:AAO78414 (EMBL:AE016940)
FT                   (406 aa) fasta scores: E(): 1.4e-139, 85.71% id in 406 aa,
FT                   and to Rickettsia conorii hypothetical zinc protease RC0293
FT                   rc0293 SWALL:Q92IX7 (EMBL:AE008595) (412 aa) fasta scores:
FT                   E(): 3.2e-40, 32.59% id in 405 aa, and to Cucumis melo
FT                   mitochondrial processing peptidase beta subunit
FT                   SWALL:Q9AXQ2 (EMBL:AF297643) (528 aa) fasta scores: E():
FT                   3.6e-25, 30% id in 400 aa, and to Blastocladiella emersonii
FT                   mitochondrial processing peptidase beta subunit,
FT                   mitochondrial precursor mpp1 SWALL:Q00302 (EMBL:U41300)
FT                   (465 aa) fasta scores: E(): 1.6e-24, 25.67% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05917"
FT                   /db_xref="GOA:Q5LIV9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV9"
FT                   /protein_id="CAH05917.1"
FT                   /translation="MQYNIHTLSNGLRIIHEPSSSKVAYCGFAVDAGTRDEAENEQGMA
FT                   HFVEHLIFKGTRKRKAWHILNRMENVGGDLNAYTNKEETVIYSAFLTEHFGRALELLAD
FT                   IVFHSTFPQNEIEKETEVIIDEIQSYEDTPSELIFDDFEDMIFRNHPLGRNILGRPDLL
FT                   KKFRSEDAMAFTSRFYQPSNMVFFVLGDFNFQKIVRQVEKLLVDLPLVTVENQRTIPPL
FT                   YVPEQLVVHKETHQAHVMIGSRGYNAYDDKRTALYLLNNILGGPGMNSRLNVSLRERRG
FT                   LVYTVESNLTSYTDTGAFCIYFGTDPEDVDTCLKLTYKELKRMRDVKMTSSQLMAAKKQ
FT                   LIGQIGVASDNNENNALGMAKTFLHYNKYESSESVFRRIEALTAEGLLEVANEMFAEEY
FT                   LSTLIYR"
FT   misc_feature    145504..145950
FT                   /note="Pfam match to entry PF00675 Peptidase_M16,
FT                   Insulinase (Peptidase family M16), score 129.9, E-value
FT                   3.9e-36"
FT   misc_feature    145567..145638
FT                   /note="PS00143 Insulinase family, zinc-binding region
FT                   signature."
FT   misc_feature    145966..146493
FT                   /note="Pfam match to entry PF05193 Peptidase_M16_C,
FT                   Peptidase M16 inactive domain, score 144.7, E-value
FT                   1.4e-40"
FT   CDS_pept        complement(146857..147243)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0139"
FT                   /old_locus_tag="BF0140"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05918"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV8"
FT                   /protein_id="CAH05918.1"
FT                   /translation="MPPIMAAYIKLLMLCLLFLVFGTQKSSALQPVNNGVAVTTAVKSH
FT                   THNVPSFDNSGHDLFDFNQGILLKKSVSDSANPYKQGNNFHPAIKTDAQRPITFKEDTS
FT                   TYTLRNRVKPAQKYDVFALRHILI"
FT   misc_feature    complement(147160..147243)
FT                   /note="Signal peptide predicted for BF0140 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.823 between residues 28 and 29"
FT   CDS_pept        147455..147985
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0140"
FT                   /old_locus_tag="BF0141"
FT                   /product="possible acetyltransferase protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT2051 SWALL:AAO77158 (EMBL:AE016934)
FT                   (178 aa) fasta scores: E(): 2.7e-15, 34.28% id in 175 aa,
FT                   and to Clostridium perfringens hypothetical protein CPE0912
FT                   SWALL:Q8XLX8 (EMBL:AP003188) (181 aa) fasta scores: E():
FT                   2.2e-13, 36.69% id in 139 aa, and low similarity to
FT                   Thermoanaerobacter tengcongensis acetyltransferases RimI3
FT                   or TTE0537 SWALL:Q8RC99 (EMBL:AE013024) (149 aa) fasta
FT                   scores: E(): 0.00079, 26.45% id in 155 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05919"
FT                   /db_xref="GOA:Q5LIV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV7"
FT                   /protein_id="CAH05919.1"
FT                   /translation="MMTLIRITSADDSRLNRLIPLYEESFPESERRKIGQLKRMIENHA
FT                   PMYFNAIECDGELSGMFVYWDMGDFYYLEHLAVFPEMRNKKIGQQVLDYVAEHLKGVRL
FT                   LEVEPTEDEMTTRRVNYYRRNGYEVLDKTYVQPSYHALEDACPLWIMGSEDSPRLAEQV
FT                   ERIKEEVYRQQVG"
FT   misc_feature    147602..147838
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 34.9, E-value
FT                   1.6e-07"
FT   CDS_pept        complement(148132..149322)
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="BF9343_0141"
FT                   /old_locus_tag="BF0142"
FT                   /product="putative mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="Similar to Escherichia coli mannonate dehydratase
FT                   UxuA or B4322 SWALL:UXUA_ECOLI (SWALL:P24215) (394 aa)
FT                   fasta scores: E(): 6.2e-99, 61.89% id in 391 aa, and to
FT                   Bacteroides thetaiotaomicron mannonate dehydratase BT1432
FT                   SWALL:AAO76539 (EMBL:AE016931) (389 aa) fasta scores: E():
FT                   8.1e-131, 81.23% id in 389 aa, and to Haemophilus
FT                   influenzae mannonate dehydratase UxuA or hi0055
FT                   SWALL:UXUA_HAEIN (SWALL:P44488) (394 aa) fasta scores: E():
FT                   8.2e-100, 64.12% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05920"
FT                   /db_xref="GOA:Q5LIV6"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIV6"
FT                   /protein_id="CAH05920.1"
FT                   /translation="MTLPKDKLFLSEQTWRWYGPDDPVSLWDIKQAGATGIVNALHHIP
FT                   NGEVWTVEEIMKRKELIESVGLKWSVVESVPVHEHIKTQTGNFRKYIENYKESLRNLGQ
FT                   CGIHIVTYNFMPVLDWTRTDLAYTLPDGSKALRFERAAFIAFDLFLLKRPGAETEYTDE
FT                   EKTKARIRFEQMDEKEKQLLVRNMIAGLPGSEESFTLEQFQHELDRYRGIDAEKLRTHL
FT                   IYFLKEITSTADEAGVKLVIHPDDPPCSILGLPRIMSCAEDFQALIDAVPNESNGLCLC
FT                   TGSLGVSCANDLEGMMRRFGDRINFVHFRSTQRDAEGNFYEANHLEGDVDMYHVMKAFL
FT                   ELQQRRKVSIPMRPDHGHQMVDDLKKKTNPGYSCIGRLRGLAELRGLEMGIAKSIF"
FT   misc_feature    complement(148144..149292)
FT                   /note="Pfam match to entry PF03786 UxuA, D-mannonate
FT                   dehydratase (UxuA), score 716.6, E-value 9.6e-213"
FT   CDS_pept        complement(149437..150249)
FT                   /transl_table=11
FT                   /gene="uxuB"
FT                   /locus_tag="BF9343_0142"
FT                   /old_locus_tag="BF0143"
FT                   /product="putative D-mannonate oxidoreductase"
FT                   /note="Similar to Bacillus stearothermophilus D-mannonate
FT                   oxidoreductase UxuB SWALL:Q9ZFL6 (EMBL:AF098273) (281 aa)
FT                   fasta scores: E(): 1.8e-20, 47.65% id in 277 aa, and to
FT                   Bacteroides thetaiotaomicron putative oxidoreductase BT1433
FT                   SWALL:AAO76540 (EMBL:AE016931) (270 aa) fasta scores: E():
FT                   3.4e-61, 65.92% id in 270 aa, and to Nostoc punctiforme
FT                   oxidoreductase HrmU SWALL:Q51311 (EMBL:L37087) (278 aa)
FT                   fasta scores: E(): 6.3e-45, 50.92% id in 271 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05921"
FT                   /db_xref="GOA:Q5LIV5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV5"
FT                   /protein_id="CAH05921.1"
FT                   /translation="MANLFSVKDKVVVITGGTGVLGKAIAAHLAEEGAKVILLGRKTEV
FT                   GNKIVESIRTQGGEALFLTTDVLDRKILEQNLADILKAYGRIDALLNAAGGNMPGATIS
FT                   PTGDIFDLKIDEFQKVLDLNLTGTILPTQVFLKPMVEQRAGAIVNFSSMAAFRPLTRVA
FT                   GYAAAKAGISNFTAFMATEIAKKFGEGIRINAIAPGFFLTEQNRALLTNPDGTYTQRGQ
FT                   DVIRQTPFGRMGRAEELCGTIQYLISDAASFVTGTVAVVDGGFNAFAM"
FT   misc_feature    complement(149455..150228)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 217.7, E-value 1.5e-62"
FT   misc_feature    complement(149710..149796)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(150378..151022)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0143"
FT                   /old_locus_tag="BF0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3317 SWALL:AAO78423 (EMBL:AE016940)
FT                   (209 aa) fasta scores: E(): 1.4e-73, 83.49% id in 206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05922"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV4"
FT                   /protein_id="CAH05922.1"
FT                   /translation="MKVAYLSSAYLAPVEYYSKLLNYDKIFIEQHDHYMKQTYRNRCTI
FT                   AGPEGELALSIPIVKPEEPKCPMKDIRISDHGNWRHLHWNAIESAYNSTPFFEYYKDDF
FT                   RPFYEKKYEFLTDFNEELCRLVCELIDIQPAIERTKEYKTDFAPNEIDFREAIHPKKDF
FT                   HRTDPEFIPQPYYQVFEARYGFLPNLSIIDLLFNMGPESLLILQKTCADSQ"
FT   CDS_pept        complement(151086..152021)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0144"
FT                   /old_locus_tag="BF0145"
FT                   /product="putative exported signal peptidase I"
FT                   /note="Low similarity to Bradyrhizobium japonicum signal
FT                   peptidase SipS SWALL:Q45225 (EMBL:U33883) (259 aa) fasta
FT                   scores: E(): 0.00072, 29.68% id in 128 aa, and similar to
FT                   Bacteroides thetaiotaomicron signal peptidase I BT3318
FT                   SWALL:AAO78424 (EMBL:AE016940) (312 aa) fasta scores: E():
FT                   1.6e-94, 74.43% id in 309 aa, and to Bacteroides
FT                   thetaiotaomicron signal peptidase I BT3319 SWALL:AAO78425
FT                   (EMBL:AE016940) (493 aa) fasta scores: E(): 1.1e-11, 25.64%
FT                   id in 429 aa, and to Rhizobium loti signal peptidase i
FT                   mlr7763 SWALL:Q985A7 (EMBL:AP003012) (249 aa) fasta scores:
FT                   E(): 3.8e-07, 26.72% id in 232 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05923"
FT                   /db_xref="GOA:Q5LIV3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV3"
FT                   /protein_id="CAH05923.1"
FT                   /translation="MGKGLKWIIAFAGAMVIVLLLRGFAFTSCLIPSAGMENSLFQGER
FT                   ILVNKWSYGLRVPYMSLFSYHRWGESPIHKDDIVVFNNPAGIKEPVIDRREIYISRCIG
FT                   VPGDTLLIDSLFNVVDRSTQLGPDRKQLYTYPQTKEQQLDSLLSILSIGPNELMGQHEG
FT                   KNVRSFSRYEYYLLDQAMNGKSWIQPLQQSLQEEAKPLIVPGKGKAVRVYPWNRTLLRN
FT                   TLVLHEGKQAEIRNDTLYIEGRPSQHCYFTKDYYWMASNNSVNLSDSRLFGFVPQDHVI
FT                   GKASRIWFSKTDHTGIFSGYRWERFFQPVK"
FT   misc_feature    complement(151176..152021)
FT                   /note="Pfam match to entry PF00461 Peptidase_S26, Signal
FT                   peptidase I, score 3.7, E-value 5e-05"
FT   misc_feature    complement(151914..152021)
FT                   /note="Signal peptide predicted for BF0145 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.948) with cleavage site
FT                   probability 0.428 between residues 36 and 37"
FT   CDS_pept        complement(152029..153513)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0145"
FT                   /old_locus_tag="BF0146"
FT                   /product="possible signal peptidase"
FT                   /note="Similar to 80 amino acids at the C-terminus of
FT                   Escherichia coli O6 signal peptidase I LepB or C3092
FT                   SWALL:Q8FF16 (EMBL:AE016764) (324 aa) fasta scores: E():
FT                   2.2e-06, 44.3% id in 79 aa, and to entire protein of
FT                   Bacteroides thetaiotaomicron signal peptidase I BT3319
FT                   SWALL:AAO78425 (EMBL:AE016940) (493 aa) fasta scores: E():
FT                   3.1e-175, 85.83% id in 494 aa, and to Chlorobium tepidum
FT                   signal peptidase I LepB or CT1450 SWALL:Q8KCH1
FT                   (EMBL:AE012902) (280 aa) fasta scores: E(): 8.2e-15, 27.72%
FT                   id in 440 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05924"
FT                   /db_xref="GOA:Q5LIV2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV2"
FT                   /protein_id="CAH05924.1"
FT                   /translation="MRKATRTQWIKCSIAILLYLIFLIWVKSWWGLIVVPFIFDIYITK
FT                   KIPWSFWKKSKNPTVRSVMSWVDAIVFALVAVYFVNIYVFQNYQIPSSSLEKSLLVGDF
FT                   LYVSKMSYGPRVPNTPLSMPLAQHTLPILNTKSYIEWPQWKYKRVPGFGKVKLNDIVVF
FT                   NFPAGDTVALNFQDADFYTLAYNIGKQIYPNPIDMDSLTREQQKTVYDLYYNAGRKEIL
FT                   SNPQRYGKVVTRPVDRRENYVKRCVGLPGDTLQIINGQVMIDGKAIENPENLQFNYFVQ
FT                   TTGPYITEEMFRELGISKADQRLTPEGAGYEEGLIELGLDGRNAQGGLNPVYHLPLTKK
FT                   MYDTLSGNKKLVGKIVIEPEEYSGEVYPLNLNTHWNRSDYGPIWIPAKGATITLTPDNL
FT                   PIYERCITAYEGNKLEQKEDGIYINGVKTNQYTFQMDYYWMMGDNRHNSADSRYWGFVP
FT                   EDHVVGKPIVVWLSLDKDRNWFDGKIRWNRIFKWVD"
FT   misc_feature    complement(152122..152202)
FT                   /note="Pfam match to entry PF00461 Peptidase_S26, Signal
FT                   peptidase I, score 39.7, E-value 3e-12"
FT   misc_feature    complement(152161..152202)
FT                   /note="PS00761 Signal peptidases I signature 3."
FT   misc_feature    complement(152701..152799)
FT                   /note="Pfam match to entry PF00461 Peptidase_S26, Signal
FT                   peptidase I, score 13.8, E-value 0.00026"
FT   misc_feature    complement(order(153259..153327,153385..153453))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0146 by TMHMM2.0 at aa 21-43 and 63-85"
FT   CDS_pept        complement(153518..154246)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0146"
FT                   /old_locus_tag="BF0147"
FT                   /product="putative dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /note="Similar to Pseudomonas syringae dihydrodipicolinate
FT                   reductase DapB SWALL:DAPB_PSESZ (SWALL:Q52419) (267 aa)
FT                   fasta scores: E(): 5.8e-13, 30.71% id in 267 aa, and to
FT                   Bacteroides thetaiotaomicron dihydrodipicolinate reductase
FT                   BT3320 SWALL:AAO78426 (EMBL:AE016940) (254 aa) fasta
FT                   scores: E(): 1.9e-56, 83.07% id in 254 aa, and to
FT                   Chlorobium tepidum dihydrodipicolinate reductase DapB or
FT                   CT1850 SWALL:Q8KBD8 (EMBL:AE012936) (249 aa) fasta scores:
FT                   E(): 1.1e-28, 40.63% id in 251 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05925"
FT                   /db_xref="GOA:Q5LIV1"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV1"
FT                   /protein_id="CAH05925.1"
FT                   /translation="MKIALIGYGKMGKEIEKVALSRGHEIVSIIDINNQDDFESEAFKS
FT                   ADVAIEFTNPMVAYSNYMKAFKAGVKLVSGSTGWMAEHGDEVKELCNKGGKTLFWSSNF
FT                   SLGVTIFSAVNKYLAKIMNQFPAYDVTMSETHHVHKLDAPSGTAITLAEGILENMKRKS
FT                   VWVKEEAHATNELPIHSIREGEVFGIHTIRYDSEADSISITHDAKNRGGFALGAVLAAE
FT                   YTAAHEGYLGMSDLFPFLKD"
FT   misc_feature    complement(153533..153928)
FT                   /note="Pfam match to entry PF05173 DapB_C,
FT                   Dihydrodipicolinate reductase, C-terminus, score 97.9,
FT                   E-value 1.7e-26"
FT   misc_feature    complement(153935..154246)
FT                   /note="Pfam match to entry PF01113 DapB_N,
FT                   Dihydrodipicolinate reductase, N-terminus, score 67.6,
FT                   E-value 2.3e-17"
FT   CDS_pept        154342..155610
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0147"
FT                   /old_locus_tag="BF0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3321 SWALL:AAO78427 (EMBL:AE016940) (427 aa)
FT                   fasta scores: E(): 1.4e-133, 69.55% id in 427 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05926"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIV0"
FT                   /protein_id="CAH05926.1"
FT                   /translation="MEQLLHYVWKHKIFPLHELQTTTGLPVEVIDTGLPNSDSGPDFFN
FT                   AKLKIGGTLWVGNVEIHTASSDWFRHGHDRDIAYDSVILHIVTEIDCEIYRSNGEPVPQ
FT                   LRLPCPEQVKEHYDELCRADIHPPCYSILETLPKLTIHSWLTALQTERFDQKNRTITRR
FT                   LQRCNQHWEDAFFITLARNFGFGLNGDAFETWANLLSFRAIDKHRDDLTQVEAFFFGQA
FT                   GLLEGESADDYFSWMQKEFRYLQHKFELPPVMNPSLWRFLRLRPGNFPHVRLAQLASLY
FT                   YRERSLFSRVMEAETLKDLKHIFAGHTSAYWEEHFMFGKSSPRREKSIGAGAKELIIIN
FT                   TVIPFLYAYGLHKADERLCERAASLLEELKAENNYVTRMWSGAGIPVQTAADSQALLQL
FT                   QKEYCDKKKCLYCRFGYEYLRHK"
FT   misc_feature    154420..154455
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   CDS_pept        155702..156262
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0148"
FT                   /old_locus_tag="BF0149"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3323 SWALL:AAO78429 (EMBL:AE016940) (173 aa)
FT                   fasta scores: E(): 2.3e-51, 74.85% id in 175 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU9"
FT                   /protein_id="CAH05927.1"
FT                   /translation="MKVKRFVLCLFMLTLIGGICFISCGNTSKAKAESDVAAETAEETF
FT                   QSFLKKFTSSASFQYTRVKFPLKTPITLMTDDGNSEKTFPFTQEKWPLLDAETLKEERI
FT                   TQEEGGIYVSKFTVNEPTHKEFEAGYEESEVDLRVIFDLIDGKWYVTDCYTGWYGYDLP
FT                   IDDLNETVKQVKEENDTFKELHP"
FT   misc_feature    155702..155797
FT                   /note="Signal peptide predicted for BF0149 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.496 between residues 32 and 33"
FT   CDS_pept        complement(156456..157388)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0149"
FT                   /old_locus_tag="BF0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   NifR3 family tim-barrel enzyme with dihydrouridine synthase
FT                   domain BT3326 SWALL:AAO78432 (EMBL:AE016940) (314 aa) fasta
FT                   scores: E(): 1.3e-83, 64.72% id in 309 aa, and to
FT                   Clostridium perfringens probable transcriptional regulator
FT                   CPE1275 SWALL:Q8XKW7 (EMBL:AP003189) (321 aa) fasta scores:
FT                   E(): 2.3e-34, 33.97% id in 312 aa, and to Clostridium
FT                   acetobutylicum predicted tim-barrel enzyme, NifR3 family
FT                   CAC3454 SWALL:Q97DM0 (EMBL:AE007843) (311 aa) fasta scores:
FT                   E(): 2.6e-31, 33.12% id in 314 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05928"
FT                   /db_xref="GOA:Q5LIU8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU8"
FT                   /protein_id="CAH05928.1"
FT                   /translation="MNTLPIHLAPLQGYTEAAYRNAHAAVFGGVDVYHTPFVRIDRGEF
FT                   RHKDVRDILPENNRVPHLIPQLIASEMDKTERIIALFIEQGYREMDINLGCPFPMLAKR
FT                   QCGSGMLPHPDKVETLLKQIEQYPDVSFSVKMRLGWKKPDECLTLLPLLNAAPLTEIIV
FT                   HPRLGIQQYKGEVNMEGFTAFYEACRHPVIYNGDILTIEDIRCITEKFPKLTGVMIGRG
FT                   LLANPALGWEYKEGRKLMPEEWREKLRALHTAVFQHYETQIQGGEAQLVTKMKTFWEYL
FT                   APQIDRKSWKAIHKSTTLAKYNIAVRSAF"
FT   misc_feature    complement(157065..157121)
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT   CDS_pept        complement(157395..158615)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0150"
FT                   /old_locus_tag="BF0151"
FT                   /product="conserved hypothetical outer membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3325 SWALL:AAO78431 (EMBL:AE016940) (409 aa)
FT                   fasta scores: E(): 4.5e-72, 76.29% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05929"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU7"
FT                   /protein_id="CAH05929.1"
FT                   /translation="MKKHLILSACLIMAISSFAQKKDFSYKFYGQIRTDLYYNSRANEE
FT                   TVDGLFYMYPKDEVFDSNGRDLNATANGSFYTLYTRLGLDVKGPKLGRAMTSAKVEADF
FT                   RGSGTSYSTIRLRHAYLNLDWGRSALLLGQTWHPLFGDVSPQILNLSVGAPFQPFSRAP
FT                   QIRYRYTHKGFQLTGAAIWQSQYLSQGIVGKSQTYIKNSCVPEFYLGLDYKANGWIAGA
FT                   GIELLSLKPRTESKVEDQVYKVNERITTLSYEGHVKYSNKDWFVGAKTVLGSNLTQTSM
FT                   LGGFGIKSIDNRTGEQKYTPIRVSSSWLNVVYGQKWKPGIFLGYVKNMGTSDALASNQV
FT                   YGTGTNVDQVVTAGAELTYNVNHWKFGVEYTYTSAAYGSLYLKNGKIIDTHSVGNNRIV
FT                   GVAMFMF"
FT   CDS_pept        158846..159487
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0151"
FT                   /old_locus_tag="BF0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3335 SWALL:AAO78441 (EMBL:AE016940) (213 aa)
FT                   fasta scores: E(): 9.1e-74, 76.99% id in 213 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05930"
FT                   /db_xref="GOA:Q5LIU6"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU6"
FT                   /protein_id="CAH05930.1"
FT                   /translation="MKVKKISIANVEVDALPELLDKEKIGFQPIDNVNWEAYPYRPKVE
FT                   FRIAHSDDAVLLHFNVKEASVRAKYGEDDGSVWTDSCVEFFSVPAGDGIYYNIECNCIG
FT                   TILIGAGAERNNRERASREVTDQVKRWASLGRQPFDERIGECNWEVALVIPYTAFFKHH
FT                   ITSLDGKTITANFYKCGDELQTPHFLSWNPIKIEKPDFHRPDFFGTLEFE"
FT   CDS_pept        complement(159589..160359)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0152"
FT                   /old_locus_tag="BF0153"
FT                   /product="putative
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Shigella flexneri
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase LpxA or B0181 or C0218 or SF0171
FT                   SWALL:LPXA_ECOLI (SWALL:P10440) (262 aa) fasta scores: E():
FT                   1.3e-29, 36.18% id in 257 aa, and to Bacteroides
FT                   thetaiotaomicron UDP-N-acetylglucosamine acetyltransferase
FT                   BT3336 SWALL:AAO78442 (EMBL:AE016940) (256 aa) fasta
FT                   scores: E(): 1.4e-85, 83.98% id in 256 aa, and to
FT                   Bacteroides thetaiotaomicron
FT                   acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine
FT                   O-acyltransferase BT4205 SWALL:AAO79310 (EMBL:AE016944)
FT                   (255 aa) fasta scores: E(): 1.4e-46, 47.65% id in 256 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05931"
FT                   /db_xref="GOA:Q5LIU5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU5"
FT                   /protein_id="CAH05931.1"
FT                   /translation="MISPLASIAPGAKIGKNVIIQPFAYIEDNVEIGDDCIIMPYASVL
FT                   NGTRLGKGNKVYQHAVLGAEPQDFHYKGEESSLIIGDNNHIRENVVISRATFGGNATKI
FT                   GNGNFLMDKVHICHDVQIGDNCVAGIGTTIAGECTLDDCVILSGNVTLHQYCHVGQWTL
FT                   VQSGCRISKDVPPYSIMAGNPVEYHGVNAVVLQQHKNTSERVLRHIANAYRLIYQGNFS
FT                   LQDAVQKIIDQVPMSEEIENIVAFVKESKRGIVK"
FT   misc_feature    complement(159880..159933)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 10.2,
FT                   E-value 3.3"
FT   misc_feature    complement(159952..160005)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 11.7,
FT                   E-value 1.6"
FT   misc_feature    complement(160006..160059)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 8.7, E-value
FT                   5.3"
FT   misc_feature    complement(160078..160131)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 11.3,
FT                   E-value 2.1"
FT   misc_feature    complement(160168..160221)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 10.1,
FT                   E-value 3.5"
FT   misc_feature    complement(160222..160275)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 18.4,
FT                   E-value 0.014"
FT   misc_feature    complement(160276..160329)
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 20.2,
FT                   E-value 0.0043"
FT   CDS_pept        complement(160379..161770)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0153"
FT                   /old_locus_tag="BF0154"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="Similar to Escherichia coli probable outer membrane
FT                   lipoprotein CusC precursor or IbeB or B0572
FT                   SWALL:CUSC_ECOLI (SWALL:P77211) (457 aa) fasta scores: E():
FT                   3.7e-32, 29.5% id in 461 aa, and to Bacteroides
FT                   thetaiotaomicron outer membrane protein OprM precursor,
FT                   multidrug resistance protein BT3337 SWALL:AAO78443
FT                   (EMBL:AE016940) (461 aa) fasta scores: E(): 1.6e-127,
FT                   77.75% id in 463 aa, and to Bacteroides thetaiotaomicron
FT                   multidrug efflux pump channel protein BT1965 SWALL:AAO77072
FT                   (EMBL:AE016934) (456 aa) fasta scores: E(): 4.2e-88, 56.37%
FT                   id in 463 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05932"
FT                   /db_xref="GOA:Q5LIU4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU4"
FT                   /protein_id="CAH05932.1"
FT                   /translation="MKKQIIGMLCATALLSSCHIYKSYDRPKDIEASGLYRDTVSVADT
FT                   LVSDTVNFGNLPWREVFTDPQLQALIEQGLTHNTDLLTAALKVKEAQASLMSARLAYAP
FT                   SLGLSPQGTISSFDKHAATKTYSLPATASWEIDLFGKLLNAKRGAQVTLLQTKAYRQAV
FT                   QTQIISGIANTYYTLLMLDRQLDITEQTADIMKRNVETMQAMKDAAMFNTTSAGVEQSK
FT                   AAYAQVLASIPAIQKSIREAENAMSMLLAQAPQTIKRGVLEEQQLPEDFSVGVPLQLLS
FT                   NRPDVKAAEMALAGTYYNANSARAAFYPQITISGSAGWTNSAGSAIINPGKLLASVLGS
FT                   LTQPLFYRGANIARLKIAKAQQEEAKLAFQQSLLNAGSEVSNALYQYQSASEKTASRKL
FT                   QVESSEKASEYTKELFKLGTSTYLEVLSAEQSLLSARLSQVNDTFDRMQAVVSLYQALG
FT                   GGRED"
FT   misc_feature    complement(160391..160945)
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 107.6, E-value 2.1e-29"
FT   misc_feature    complement(160985..161572)
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 49.1, E-value 8.5e-12"
FT   misc_feature    complement(161702..161770)
FT                   /note="Signal peptide predicted for BF0154 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.848) with cleavage site
FT                   probability 0.650 between residues 23 and 24"
FT   misc_feature    complement(161717..161749)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(161787..164990)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0154"
FT                   /old_locus_tag="BF0155"
FT                   /product="putative AcrB/AcrD family RND transport protein"
FT                   /note="Similar to Pseudomonas aeruginosa RND transporter
FT                   MexF protein SWALL:P95422 (EMBL:X99514) (1062 aa) fasta
FT                   scores: E(): 1e-143, 39.77% id in 1056 aa, and to
FT                   Bacteroides thetaiotaomicron AcrB/AcrD family multidrug
FT                   resistance protein BT3338 SWALL:AAO78444 (EMBL:AE016940)
FT                   (1071 aa) fasta scores: E(): 0, 75.91% id in 1071 aa, and
FT                   to Bacteroides thetaiotaomicron multidrug resistance
FT                   protein, AcrB/AcrD family BT1966 SWALL:AAO77073
FT                   (EMBL:AE016934) (1065 aa) fasta scores: E(): 1.5e-204,
FT                   55.81% id in 1066 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05933"
FT                   /db_xref="GOA:Q5LIU3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU3"
FT                   /protein_id="CAH05933.1"
FT                   /translation="MKLDRFINRPVLSTVISIVIVILGVLGLLSLPISQYPDIAPPTVR
FT                   VNTTYQGANAQTVLNSVIAPLEEQINGVENMMYMTSTATNTGEASIEVYFKQGTDPDMA
FT                   AVNVQNRVAKAQGLLPAEVTKVGVITSKRQTSMLLVFSLYSSDDKYDNEFLENYAKINL
FT                   VPEVQRVPGVGDAMVLGADYSMRIWLKPDVMAQYHLMPTDVSAALAEQNIEAAPGSFGE
FT                   QGKQTFQYTLRYKGRLQSQEEFENIVIRANSDGQVLRLKDIATIELGRLTYGFSNNVNG
FT                   HPAVTVIVFQTAGSNATAIINDILDLLEKSESTFPPGVKVNISQNANDFLFASIHEVVK
FT                   TLIEAFILVFIVVYIFLQDLRSTLIPAIAIPVALIGTFFVLYIIGFSINLLTLCAMVLA
FT                   IAIVVDDAIVVVEGVHAKLDQGYKSARLASIDAMNELGGAIVSITLVMMSVFIPVSFMT
FT                   GTSGTFYRQFGLTMAIAIALSAVNALTLSPALCAILLKPHDPDAKKKSTLASRFHASFN
FT                   AAYDTVLKKYKKRVLFFIQKPVLTIGSVVVGFALLIFLMKVTPTGLVPNEDTGTIMAVV
FT                   DMPPGSSLERTQEVMWQVDSLLASDPAIESRTMIAGYSFIAGQGPSYGSFICKMKNWDE
FT                   RSIAQRSDFVSGMLYLKAREVIKDARVLLFAPPMIPGYSVSNGFEMNLQDKTGGSLDKF
FT                   YEVAQDFITKLQARPEIQSAQTSFNPNFPQYMIDIDAAACKKAGLSPSDILTTLQGYYG
FT                   GLYSSNFNRFGKMYRVMIQADPNSRTNLESLNSVKVRNGNEMAPITQFMSVKRIYGPDN
FT                   IKRFNMFTAMTINGSPADGYSSGQAIQAMQEVAEQTLPTGYGYEFSGMTREEQSSSGST
FT                   TAMIFVLCFVFVYLLLSAQYESYILPFAVLLSIPFGLAGSFIFAHLMGLANNVLPILGA
FT                   ATNNIYMQIALIMLMGLLAKNAILIVEFALDRRKMGMSITWAAVLGAGARLRPILMTSL
FT                   AMVVGLLPLMFAMGVGANGNRALGTAAVGGMFIGMICQIFVVPALFVIFQYLQEKVKPI
FT                   EWEDIDNTDAETEIEQYAK"
FT   misc_feature    complement(161874..164987)
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family, score 1190.2, E-value 0"
FT   misc_feature    complement(order(161877..161945,161973..162041,
FT                   162111..162179,162237..162305,162324..162392,
FT                   163332..163400,163506..163574,163617..163685,
FT                   163746..163805,163833..163901,163920..163988,
FT                   164889..164957))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BF0155 by TMHMM2.0 at aa 12-34, 335-357, 364-386, 396-415,
FT                   436-458, 473-495, 531-553, 867-889, 896-918, 938-960,
FT                   984-1006 and 1016-1038"
FT   CDS_pept        complement(165015..166169)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0155"
FT                   /old_locus_tag="BF0156"
FT                   /product="putative AcrA/AcrE RND transport or HlyD
FT                   secretion family protein"
FT                   /note="Similar to Enterobacter aerogenes EefA lipoprotein
FT                   precursor SWALL:Q8GC84 (EMBL:AJ508047) (374 aa) fasta
FT                   scores: E(): 5.2e-27, 33.69% id in 368 aa, and to
FT                   Bacteroides thetaiotaomicron AcrA/AcrE family multidrug
FT                   resistance protein BT3339 SWALL:AAO78445 (EMBL:AE016940)
FT                   (391 aa) fasta scores: E(): 3.7e-84, 61.09% id in 383 aa,
FT                   and to Bacteroides thetaiotaomicron multidrug efflux
FT                   protein BT1967 SWALL:AAO77074 (EMBL:AE016934) (380 aa)
FT                   fasta scores: E(): 2e-60, 49.18% id in 370 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05934"
FT                   /db_xref="GOA:Q5LIU2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU2"
FT                   /protein_id="CAH05934.1"
FT                   /translation="MKSKIVLFAFCLALLSGCGKKGFNMGGTPECAVETLQPTTVNLKS
FT                   SYPATIKGKQDIEIRPQVSGFITKLNIDEGSMVKKGQVLFVIDPVQYESAARAAKAAVA
FT                   TAKANVSTQEITVKNKRELNKKNIISDYDLEMAENTLASAKAQLASAEAQLISANQNLA
FT                   YTRVTSPSDGVAGTIPYRVGSLVSASSPSPLTVISDITQMYVYFSLTEKELLNLIRQDG
FT                   SQTEFLNSFPAVQLTLADGTLYADSGKIETVSGVIDQNTGAVSMRATFPNHGHLLRTGG
FT                   TGNIQIPYSKENVIVIPQKATYEIQDKKFVYLLQPDNTVKNTEIEILNLNDGQNYVVTA
FT                   GLKAGDKIVVENVSTLKDGATIKPLTQQESAERFKAALEERKNQ"
FT   misc_feature    complement(165120..166007)
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein, score 86.1, E-value 5.9e-23"
FT   misc_feature    complement(165639..165890)
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 20.3, E-value 6.6e-06"
FT   CDS_pept        complement(166478..169582)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0156"
FT                   /old_locus_tag="BF0157"
FT                   /product="putative exported beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="Similar to Thermotoga maritima beta-galactosidase
FT                   LacZ or TM1193 SWALL:BGAL_THEMA (SWALL:Q56307) (1084 aa)
FT                   fasta scores: E(): 3.6e-111, 39.86% id in 1016 aa, and to
FT                   Bacteroides thetaiotaomicron beta-galactosidase BT3340
FT                   SWALL:AAO78446 (EMBL:AE016940) (1036 aa) fasta scores: E():
FT                   0, 79.32% id in 1035 aa, and to Bacteroides
FT                   thetaiotaomicron beta-galactosidase BT3293 SWALL:AAO78399
FT                   (EMBL:AE016939) (1421 aa) fasta scores: E(): 5.4e-119,
FT                   36.74% id in 1064 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05935"
FT                   /db_xref="GOA:Q5LIU1"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU1"
FT                   /protein_id="CAH05935.1"
FT                   /translation="MKRQLLTCCLAMCSLATMAQHDEWKNPEINAVNRAPMHTNYFAYS
FT                   SSEEAAKADKENSSNFMTLNGIWKFNWVKNADARPTDFYRTDYNDKGWGQMKVPGVWEM
FT                   NGYGDPIYVNVGYAWRSQYKNNPPYVPIENNHVGSYRKEIIIPAEWSGKEIFAHFGSVT
FT                   SNMYLWVNGKYVGYSEDSKLEAEFNLTKYLKPGKNLIAFQVFRWCDGTYLEDQDFFRYS
FT                   GVGRNCYLYSRNKKYIQDIRVTPDLDSNYTNGTLNVALNLNGSGTVELNLTDPAGKSVA
FT                   TAQVNGNGQKSVVMDVSNPEKWTAETPNLYTLTATLKNGSNTLEVIPVKVGFRKIELKG
FT                   GQILVNGQPVLFKGADRHEMDPDGGYVVSRERMLQDILRMKQLNINAVRTCHYPDDNLW
FT                   YDLCDQYGIYVVAEANIESHGMGYGKETLAKNPSYKKAHMERNQRNVQRGYNHPSIIFW
FT                   SLGNEAGYGPNFEQCYTWIKNEDKTRAVQYEQAGTNEFTDIFCPMYYDYDACKKYSEGN
FT                   IDKPLIQCEYAHAMGNSQGGFKEYWDLIRKYPKYQGGFIWDFVDQSNHWKNKDGIDIYG
FT                   YGGDFNKYDASDNNFNDNGLISPDRRPNPHAHEVGYFYQSIWTTPGDLSKGEIKVYNEN
FT                   FFRDLSAYYMEWQLLANGEVMQTGVVQDLNVAPQQTATLKLNLNTEKICPCKELLLNVT
FT                   YKLKAAETLMPAGSTVAYDQLTIRPYTAKALELKNQKASNLDIVVPVIKDNDHNYLIVE
FT                   GENFIIEFNKHNGYLSRYEADGMQLLNPGAQLTPNFWRAPTDNDYGAGLQHRYAVWKNP
FT                   GLKLTSLKQSIENEQAIVQAEYEMKAVKGKLFLTYVINNEGAVKVTQKMEAGKEEKVSD
FT                   MFRFGMQMQMPENFNEVEYYGRGPVENYADRNHSTLIGKYRQTVAEQFYPYIRPQETGT
FT                   KTDLRWWRVLNISGNGLQFVGDAPFSASALNYSIESLDDGVQKDQRHSPEVAKAPFTNL
FT                   CIDKVQMGLGCVNSWGTLPLEKYRVPYQDYEFSFILTPVRHKVNM"
FT   misc_feature    complement(166508..166819)
FT                   /note="Pfam match to entry PF02930 Bgal_small_C, Beta
FT                   galactosidase small chain, C terminal domain, score 66.6,
FT                   E-value 4.5e-17"
FT   misc_feature    complement(166847..167377)
FT                   /note="Pfam match to entry PF02929 Bgal_small_N, Beta
FT                   galactosidase small chain, N terminal domain, score 129.4,
FT                   E-value 5.8e-36"
FT   misc_feature    complement(167726..168577)
FT                   /note="Pfam match to entry PF02836 Glyco_hydro_2_C,
FT                   Glycosyl hydrolases family 2, TIM barrel domain, score
FT                   391.2, E-value 8.9e-115"
FT   misc_feature    complement(168350..168427)
FT                   /note="PS00719 Glycosyl hydrolases family 2 signature 1."
FT   misc_feature    complement(168581..168877)
FT                   /note="Pfam match to entry PF00703 Glyco_hydro_2, Glycosyl
FT                   hydrolases family 2, immunoglobulin-like beta-sandwich
FT                   domain, score 91.7, E-value 1.3e-24"
FT   misc_feature    complement(168881..169450)
FT                   /note="Pfam match to entry PF02837 Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2, sugar binding domain, score
FT                   184.2, E-value 1.8e-52"
FT   misc_feature    complement(169526..169582)
FT                   /note="Signal peptide predicted for BF0157 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.926 between residues 19 and 20"
FT   CDS_pept        169688..171607
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0157"
FT                   /old_locus_tag="BF0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3341 SWALL:AAO78447 (EMBL:AE016940)
FT                   (642 aa) fasta scores: E(): 1.1e-137, 73.2% id in 642 aa,
FT                   and to Chlorobium tepidum hypothetical protein CT2013
FT                   SWALL:Q8KAY5 (EMBL:AE012951) (584 aa) fasta scores: E():
FT                   8.5e-10, 26.41% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05936"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIU0"
FT                   /protein_id="CAH05936.1"
FT                   /translation="MDKAYFCSMLKDNIYRKKRLIRSLLGVAALVATLYSCASMGRPDG
FT                   GPFDETPPRFIGSTPAAGAVNTKKSKIVLDFDEFIKLEKASEKVVVSPPQLQQPEIKPG
FT                   GKRITVNLLDSLKPNTTYTIDFSDAIVDNNEGNPLGNFAFTFSTGASIDTMEVSGTLLE
FT                   ASDLEPIKGMLVGLHSNLNDSAFTKLPFDRVARTDSRGHFTIRGIAPGKYRIFGLMDAD
FT                   QNFFYNQKGEAVAFNDSLIIPRFEERIRQDTAWVDSLTIDTIVEQKYTYFLPDNIVLRS
FT                   FKKPSVSQYLVKSERLTPNKFSLYFSAPADSLPVLKGLNFDEKDAFVIEKTFRNDTIHY
FT                   WIRDSLLYQQDTLTLSLNYLYTDTLNQLVPRTDTLRLAAKKVKKEEPKKKKKKDDEPEP
FT                   TKFLSVNTHAPSSMDVFDYITMTFEEPVARFDSAAIHLRQKVDTIWTDVPFEFEHDSLD
FT                   VRRYNLYYDWEPGGEYEFAVDSTAFHGIYGLFTDKIKQAFKVRQIEEYGNVFLNITGAD
FT                   SIAFVELLDNQDKVLRRRPVIDGRAEFYYLNPGKYGARLVNDTNGNGVWDAGDYEKGIQ
FT                   PEMVYYYPHIIEFKANWDATQDWNVTAVPLDKQKPDELKKQKPDEDKKKKTRDSQNANR
FT                   SRRN"
FT   CDS_pept        171717..172424
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0158"
FT                   /old_locus_tag="BF0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3342 SWALL:AAO78448 (EMBL:AE016940) (259 aa)
FT                   fasta scores: E(): 5.6e-77, 76.82% id in 233 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05937"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT9"
FT                   /protein_id="CAH05937.1"
FT                   /translation="MYELYFNWKFIWKKVGLASLTTNSTTYHSEPAYRVNLLAISSKEA
FT                   DFFFKMRDTLTSVMTEKLEPRYFRKGAEEGKRYTVDEARFSFRNGMCYVNQKRVRKDGS
FT                   ITETEQSDNRCIYDMLTILAQARSFDPKEYTIGQRIQFPMATGRRVEEQTLIYRGIKKI
FT                   TAENDTTYRCLIFSLVEYNKKGKEKEVITFYVTDDRNHLPVRLDMHLNFGSAKAFLKSV
FT                   SGYRHPQTSIVTK"
FT   CDS_pept        complement(172414..172818)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0159"
FT                   /old_locus_tag="BF0160"
FT                   /product="putative phenylacetic acid degradation protein"
FT                   /note="Similar to Escherichia coli phenylacetic acid
FT                   degradation protein PaaI or B1396 SWALL:PAAI_ECOLI
FT                   (SWALL:P76084) (140 aa) fasta scores: E(): 4.9e-12, 35.77%
FT                   id in 123 aa, and to Bacteroides thetaiotaomicron putative
FT                   phenylacetic acid degradation protein BT3343 SWALL:AAO78449
FT                   (EMBL:AE016940) (134 aa) fasta scores: E(): 3.5e-42, 87.31%
FT                   id in 134 aa, and to Methanosarcina acetivorans
FT                   phenylacetic acid degradation protein PaaI or ma0735
FT                   SWALL:Q8TSR0 (EMBL:AE010734) (146 aa) fasta scores: E():
FT                   2.1e-19, 50% id in 130 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05938"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT8"
FT                   /protein_id="CAH05938.1"
FT                   /translation="MTAQEFFKNDLFATNAGVELIEIREGYSKAKLEIKPEHLNAGQRT
FT                   QGGAIFTLADLALAAAANSHGTLAFSLSSNITFLRASGPGDTLYAEARERYTGRSTGYY
FT                   QIDVTDQEGRLIATFESSVFRKKDEVPFTL"
FT   misc_feature    complement(172450..172725)
FT                   /note="Pfam match to entry PF03061 4HBT, Thioesterase
FT                   superfamily, score 68.4, E-value 1.3e-17"
FT   CDS_pept        complement(172929..174404)
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BF9343_0160"
FT                   /old_locus_tag="BF0161"
FT                   /product="putative cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="Similar to Deinococcus radiodurans cysteinyl-tRNA
FT                   synthetase CysS or dr1670 SWALL:SYC_DEIRA (SWALL:Q9RTT6)
FT                   (498 aa) fasta scores: E(): 9.3e-82, 49.49% id in 495 aa,
FT                   and to Bacteroides thetaiotaomicron cysteinyl-tRNA
FT                   synthetase BT3351 SWALL:AAO78457 (EMBL:AE016940) (493 aa)
FT                   fasta scores: E(): 2e-185, 90.06% id in 493 aa, and to
FT                   Chlorobium tepidum cysteinyl-tRNA synthetase CysS or CT2158
FT                   SWALL:Q8KAK2 (EMBL:AE012964) (487 aa) fasta scores: E():
FT                   6.3e-86, 48.79% id in 496 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05939"
FT                   /db_xref="GOA:Q5LIT7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIT7"
FT                   /protein_id="CAH05939.1"
FT                   /translation="MEHQLTIYNTLDRKKELFVPLHAPHVGMYVCGPTVYGDAHLGHAR
FT                   PAITFDVLFRYLTRLGYKVRYVRNITDVGHLEHDADEGEDKIAKKARLEQLEPMEVVQY
FT                   YLNRYHKAMEALNVLPPSIEPHASGHIIEQIELVKKILDAGYAYESQGSVYFDVAKYNK
FT                   DYHYGKLSGRNLDDVLNTTRELDGQEEKHNPADFALWKRAQPEHIMRWPSPWGDGFPGW
FT                   HAECTAMGRKYLGEHFDIHGGGMDLIFPHHECEIAQSVASQGDDMVHYWMHNNMITING
FT                   TKMGKSLGNFITLDEFFSGSHKLLTQAYSPMTIRFFILQAHYRSPVDFSNEALQAAEKG
FT                   LSRLMEAVDSLEKITPAATSNVDVKSLRTKCFEAMNDDLNTPIVISHLFDGAKMINNII
FT                   AGNNTISADDLKDLKEVFHTFCFDILGLKEEIGSSDGREAAYGKVVDMLLEQRVKAKAN
FT                   KDWATSDLIRNELTALGFEIKDTKDGFEWKLNK"
FT   misc_feature    complement(172977..174356)
FT                   /note="Pfam match to entry PF01406 tRNA-synt_1e, tRNA
FT                   synthetases class I (C), score 528.1, E-value 5.3e-156"
FT   CDS_pept        complement(174959..175795)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0161"
FT                   /old_locus_tag="BF0163"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Similar to Bacteroides thetaiotaomicron haloacid
FT                   dehalogenase-like hydrolase BT3352 SWALL:AAO78458
FT                   (EMBL:AE016940) (270 aa) fasta scores: E(): 9.3e-70, 70.41%
FT                   id in 267 aa, and to Bacteroides thetaiotaomicron putative
FT                   hydrolase, haloacid dehalogenase-like hydrolase BT4699
FT                   SWALL:AAO79804 (EMBL:AE016946) (410 aa) fasta scores: E():
FT                   1.2e-42, 48.12% id in 266 aa, and to Vibrio cholerae
FT                   hypothetical protein Vc1364 vc1364 SWALL:Q9KS95
FT                   (EMBL:AE004216) (273 aa) fasta scores: E(): 3.6e-27, 35.33%
FT                   id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05940"
FT                   /db_xref="GOA:Q5LIT6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT6"
FT                   /protein_id="CAH05940.1"
FT                   /translation="MKYKLLVLDLDGTLTNAKKEITLHNREALIRVQQQGVKLILASGR
FT                   PTFGIVPLADELRMKEFGGFILSYNGGEIIDWSTGEIVYANVLPDEVIPRLYECATRNQ
FT                   LPILTYDRQYIITEYPDDVYVRKEAFLNKMQIYPSTDFLKDIRLPLPKCLIVGEPHRLI
FT                   PIEAELSVELQGQLSVYRSEPFFLELVPQGIDKAQSLSVLLNKLNMNREEMVAVGDGYN
FT                   DLSMIQFAGLGVAMGNAQEPVKKAADYITLSNEEDGVAAVVNKFFTKAPEKGETTV"
FT   misc_feature    complement(175076..175789)
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 49.1, E-value 8.6e-12"
FT   misc_feature    complement(175079..175147)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT   CDS_pept        complement(175859..176536)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0162"
FT                   /old_locus_tag="BF0164"
FT                   /product="putative two-component system, response regulator
FT                   protein"
FT                   /note="Similar to Bacteroides fragilis transcriptional
FT                   regulatory protein RprY SWALL:Q9AE24 (EMBL:S59000) (236 aa)
FT                   fasta scores: E(): 1.6e-13, 30.73% id in 231 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system response
FT                   regulator BT2165 SWALL:AAO77272 (EMBL:AE016935) (233 aa)
FT                   fasta scores: E(): 1.4e-13, 30.73% id in 231 aa, and to
FT                   Anabaena sp. two-component system response regulator
FT                   ALL1964 SWALL:Q8YVL1 (EMBL:AP003587) (236 aa) fasta scores:
FT                   E(): 2.4e-13, 31.03% id in 232 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05941"
FT                   /db_xref="GOA:Q5LIT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT5"
FT                   /protein_id="CAH05941.1"
FT                   /translation="MGKKLKIFFIDDDIALGHICTRIMQEEGYEVLYQTSLNGAKACIV
FT                   ETHPDMIVLDVEIGNKNGIEAVPELKAIAPNTPILFISSHTNSQLVVQALSAGAVAYLK
FT                   KPLEIDELIAYIKRYAISHPYQIKIGSLILDTDTQLLCTKELRVIKQLSEAEYKLLKLL
FT                   VAYKEQLVERRQIEEELWGKVNGNEQGINNLISKLRKYLSIDPTIELVTIPRNGYKLSV
FT                   NLS"
FT   misc_feature    complement(175877..176104)
FT                   /note="Pfam match to entry PF00486 trans_reg_C,
FT                   Transcriptional regulatory protein, C terminal, score 43.1,
FT                   E-value 5.3e-10"
FT   misc_feature    complement(176165..176524)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 75.2, E-value 1.1e-19"
FT   CDS_pept        complement(176546..177898)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0163"
FT                   /old_locus_tag="BF0165"
FT                   /product="putative two-component regulatory system, sensor
FT                   kinase protein"
FT                   /note="Similar to Bacteroides fragilis sensor regulator
FT                   protein RprX SWALL:Q08408 (EMBL:S59000) (519 aa) fasta
FT                   scores: E(): 3.8e-14, 24.13% id in 290 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase BT0733 SWALL:AAO75840 (EMBL:AE016929) (459
FT                   aa) fasta scores: E(): 6.4e-17, 27.54% id in 374 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase BT2166 SWALL:AAO77273 (EMBL:AE016935) (515
FT                   aa) fasta scores: E(): 9.3e-17, 24.62% id in 333 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05942"
FT                   /db_xref="GOA:Q5LIT4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT4"
FT                   /protein_id="CAH05942.1"
FT                   /translation="MKKELLLTILSSIALILLQVFWINSMYQKYENQYTEKINKAFFNA
FT                   IEKEVGLRSMHIEQSKHSTIFIKSVEYMSEEERAGYKGDTIDLVHLEQNGVARNVSELL
FT                   TQIKQDGLLAIQKPPILSIIDSLFQDELYDLNINHYITLRNKEKQIIDSVGNAHLQSHF
FT                   QIIINQKPIGTKGLLYIQIESGLPNDTILSQMLYSLIASTLIVAIVLGCLIFQLTVIRK
FT                   KNEILKNREASVNGIVHDLKSPLNALITLTCWLKKNESDHKKKQLMNEVIKRAKHLTTQ
FT                   IESILICARGTTQHIILQRTKINIEEVIKTAIGNICVDLSSKPHSIEIVNESPNIECLA
FT                   DQLYIENAIKNLIENALKYSNDGVKIQIKIVKISQGIQIEVKDNGWGIAHKYQKKIFSQ
FT                   YYQVPRETSQIQKGYGIGLSYVKYIIQAHGGKIRLRSRENEGSTFTFYISK"
FT   misc_feature    complement(176552..176881)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 81.8,
FT                   E-value 1.2e-21"
FT   misc_feature    complement(177017..177214)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 25.9, E-value 8.2e-05"
FT   misc_feature    complement(order(177239..177307,177818..177886))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0165 by TMHMM2.0 at aa 5-27 and 198-220"
FT   CDS_pept        178047..178241
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0164"
FT                   /old_locus_tag="BF0166"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT3"
FT                   /protein_id="CAH05943.1"
FT                   /translation="MFATYPNYNKMEKILEKLSPEGMTICPTESCDPYFVGCGIDEHQG
FT                   CNSDSFCLGDDFDHCMAMT"
FT   CDS_pept        178449..179729
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0165"
FT                   /old_locus_tag="BF0167"
FT                   /product="hypothetical Kelch-like protein"
FT                   /note="Low similarity to Homo sapiens kelch-like protein 2
FT                   klhl2 SWALL:KHL2_HUMAN (SWALL:O95198) (593 aa) fasta
FT                   scores: E(): 1.6e-06, 24.4% id in 254 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05944"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT2"
FT                   /protein_id="CAH05944.1"
FT                   /translation="MRSLFLIFFFCYVTGKAQDRACVVSEKDSIPLSNVYICLKDRRVI
FT                   AISDEKGVFSLEKYDSLSLNDTLYFSHINYLHKKLSYGDLIKNRCTVFLIENNRVLEEV
FT                   SIFSNRHLNRFLHYEILSPLKRGVYSFASVLVDGQIYIVGGSTSCGPFQSNIRSTLFWE
FT                   KYSNMMYRYDIKQDKWETIRHKFRERAYHTAGYYDGKIFILGGKRLSETRIVDYLDNAI
FT                   EIYDIKRDTVWTDYTNPHQATLLGSVVYKDNMIVLGGVKKVLQNNEGVYSDEMHLWNLK
FT                   SGYWYELGKMPIRQAPETILVDHCIYLIGNRNGGGWSIECYNLLTGAWTNAGHLLYRLG
FT                   WPSLAYHNDIIYIFEQGVVQTFNIKSRQVRSYMIDLKLKSPALYYFDGKLYILGGFYMG
FT                   DPSRNVYSVDLKEFDKTEVDYYYNNVR"
FT   misc_feature    178827..179006
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 27.1, E-value 3.6e-05"
FT   misc_feature    179010..179168
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 20.3, E-value 0.004"
FT   misc_feature    179169..179324
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 16.7, E-value 0.038"
FT   misc_feature    179325..179456
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 9.9, E-value 0.21"
FT   misc_feature    179601..179684
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 8.9, E-value 0.057"
FT   CDS_pept        180086..180772
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0166"
FT                   /old_locus_tag="BF0168"
FT                   /product="putative two-component response regulator
FT                   transcriptional regulatory protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 transcriptional regulatory
FT                   protein CusR or B0571 or C0657 or Z0709 or ECS0609
FT                   SWALL:CUSR_ECOLI (SWALL:P77380) (227 aa) fasta scores: E():
FT                   1.5e-32, 42.98% id in 221 aa, and to Bacteroides
FT                   thetaiotaomicron two-component system response regulator
FT                   BT0990 SWALL:AAO76097 (EMBL:AE016930) (228 aa) fasta
FT                   scores: E(): 1.5e-65, 77.63% id in 228 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system response
FT                   regulator BT0682 SWALL:AAO75789 (EMBL:AE016928) (245 aa)
FT                   fasta scores: E(): 7e-36, 47.11% id in 225 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05945"
FT                   /db_xref="GOA:Q5LIT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT1"
FT                   /protein_id="CAH05945.1"
FT                   /translation="MYSILIIEDEQRVADLLRVGLEENGYNCLVAYDGAMGLRMFRANT
FT                   FDLVISDIVLPKMDGFELCKEIRAANPAIPILMLTALGSTDDKLDGFDAGADDYMVKPF
FT                   DFRELYARIRVLLKRKLAVVTDVEEELNYADLSVNLLDKSVKRAGRDIKLSPKEYNLLV
FT                   YMIENAEKVVSRMDIADKVWNTHFDTGTNFIDVYINYLRKKIDRDFDTKLIHTKTGMGF
FT                   ILTDKL"
FT   misc_feature    180089..180448
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 145.0, E-value 1.1e-40"
FT   misc_feature    180530..180757
FT                   /note="Pfam match to entry PF00486 trans_reg_C,
FT                   Transcriptional regulatory protein, C terminal, score 67.6,
FT                   E-value 2.3e-17"
FT   CDS_pept        180769..182136
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0167"
FT                   /old_locus_tag="BF0169"
FT                   /product="putative two-component regulator sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Escherichia coli sensor kinase CusS or
FT                   b0570 SWALL:CUSS_ECOLI (SWALL:P77485) (480 aa) fasta
FT                   scores: E(): 2.5e-19, 28.09% id in 331 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase BT0989 SWALL:AAO76096 (EMBL:AE016930) (455
FT                   aa) fasta scores: E(): 5e-119, 69.67% id in 455 aa, and to
FT                   Fusobacterium nucleatum two-component sensor kinase CzcS
FT                   FN0586 SWALL:Q8R693 (EMBL:AE010570) (445 aa) fasta scores:
FT                   E(): 8.5e-23, 28.86% id in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05946"
FT                   /db_xref="GOA:Q5LIT0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIT0"
FT                   /protein_id="CAH05946.1"
FT                   /translation="MKIRSILTIKYAGITATIFLVFMATIYCVNEHLRSDSFYRSLRSE
FT                   AITKAHLFLNNQVDVETMQSIYLNNRQFIDEVEVAVYTPDFRILYHDALHNDIIKETPG
FT                   MIDEIVRKKEIDFRTGDYQGIGILYEFGGKNYVVTAAAYDRYGHINQVIMTRLLLLLSI
FT                   GGLSVLVIVGYMLAKSSLAPIRSIVRKAEGITVTQIDERLPVKNEHDELGELALAFNAL
FT                   LDRVEKTFNDQRMFVSNVSHELRTPMAALSAELDLALQKERTVTQYQNSIHNALQDSQR
FT                   VIELIDGLLNLAKADYYPEQIKKEEIRLDELLLDANELVLKAHPDYHIELIFEQEADDD
FT                   RVLTVIGNPYLLTTAFVNLIENNCKYSDNRTSFIQISFCDQWTIVSLSDNGAGMSETDK
FT                   ENLFKLFYRGENKNQAQGHGIGMTLTKKILTLHKSEISVYSHQGEGTTFVIRFHHL"
FT   misc_feature    order(180787..180855,181222..181290)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0169 by TMHMM2.0 at aa 7-29 and 152-174"
FT   misc_feature    181240..181452
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain, score
FT                   54.6, E-value 1.9e-13"
FT   misc_feature    181462..181662
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 59.4, E-value 6.5e-15"
FT   misc_feature    181807..182133
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 80.3,
FT                   E-value 3.3e-21"
FT   CDS_pept        182296..184947
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="BF9343_0168"
FT                   /old_locus_tag="BF0170"
FT                   /product="putative Mg2+ transport ATPase protein"
FT                   /EC_number="3.6.3.2"
FT                   /note="Similar to Salmonella typhimurium Mg2+ transporter
FT                   MgtA or STM4456 SWALL:ATMA_SALTY (SWALL:P36640) (902 aa)
FT                   fasta scores: E(): 1.6e-170, 52.17% id in 874 aa, and to
FT                   Bacteroides thetaiotaomicron Mg2+ transport ATPase protein
FT                   B BT0988 SWALL:AAO76095 (EMBL:AE016930) (883 aa) fasta
FT                   scores: E(): 0, 78.95% id in 884 aa, and to Escherichia
FT                   coli, and Escherichia coli O157:H7 Mg2+ transporter MgtA or
FT                   Mgt or CorB or B4242 or Z5853 or ECS5219 SWALL:ATMA_ECOLI
FT                   (SWALL:P39168) (898 aa) fasta scores: E(): 1.6e-171, 52.34%
FT                   id in 873 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05947"
FT                   /db_xref="GOA:Q5LIS9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS9"
FT                   /protein_id="CAH05947.1"
FT                   /translation="MIWRKKEKKKAQYQFNSERVFLVATQPAKTAYSYFQTSSVGLSEE
FT                   EIGQRQSAYGKNEISREQKKNPLVLFIRTFINPFIGVLTALAVISLVIDVVMARPEDRE
FT                   WTAVLIIISMVVCSAILRFWQEWKASEATDSLMKMVKNTCFVKRFSGSEEVDITELVPG
FT                   DVVCLAAGDMIPADIRIIESKDLFVSQASLTGESDPVEKFPEINGRRHSHGSVIELDNI
FT                   CYMGSTVISGSAKGIVFGTGNDTYLGTIARSLVGERATTAFDKGISKVSFLLIRFMLVM
FT                   VPFVFFVNGFTKGDWFEAFIFALSVAVGLTPEMLPMIVTANLSKGAVSMSKKKTVVKNL
FT                   NAIQNFGAMNILCTDKTGTLTCDKIVLEKYINADGSDDHSRRILRHAFLNSYFQTGLKN
FT                   LMDKAILAHVREENLEHLTEGYTKIDEIPFDFSRRRMSVVIEDQQGKRQIITKGAVEEM
FT                   LNICSHAEFNGQVYELTDKLRSKAKRISDDMNRNGMRVLAIAQKSFISKARDFAVTDED
FT                   EMVLIGYLAFLDPPKPSSAEAIRQLREYGIEVKILSGDNDVIVNAIARQIGIDTCHSVT
FT                   GVELEGKDGEELREIVGQATLFSRLTPLQKSEIIMILQQNGNTVGFLGDGVNDAGALRQ
FT                   SDIGISVDSAVDIAKESADIILLDKDLSVLKEGVLEGRKTFGNITKYIKMTASSNFGNM
FT                   FSVMFASAFLPFLPMLPIHLLIQNLLYDISQTTIPFDRMDAEFLKQPQKWDASDLSRFM
FT                   IYIGPISSVFDIATYCLMWYVFACNSPEHQTLFQSGWFVEGLLSQTLIVHMIRTRKIPF
FT                   FQSRATWPVLGLTFLIMAMGIAIPFTSFGLSIGLEPLPLSYFPWLVLILVSYCVLTQFM
FT                   KSWYIRRFSKWL"
FT   misc_feature    182353..182580
FT                   /note="Pfam match to entry PF00690 Cation_ATPase_N, Cation
FT                   transporter/ATPase, N-terminus, score 52.3, E-value
FT                   9.3e-13"
FT   misc_feature    order(182500..182568,182611..182667,183109..183168,
FT                   183196..183264,184363..184431,184555..184623,
FT                   184744..184812,184855..184923)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BF0170 by TMHMM2.0 at aa 69-91, 106-124, 272-291, 301-323,
FT                   690-712, 754-776, 817-839 and 854-876"
FT   misc_feature    182623..183330
FT                   /note="Pfam match to entry PF00122 E1-E2_ATPase, E1-E2
FT                   ATPase, score 249.9, E-value 3e-72"
FT   misc_feature    183340..184233
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 59.9, E-value 4.5e-15"
FT   misc_feature    183358..183378
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   CDS_pept        185012..186097
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0169"
FT                   /old_locus_tag="BF0171"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05948"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS8"
FT                   /protein_id="CAH05948.1"
FT                   /translation="MNYIAIVCWMLFGSVLRLCAQTCGATYITEFQYDLKKRTNWCNLL
FT                   RLDAYVPIGTKGILEFASIHVYKTRPERIINDLQTFSNIEEDNLPCAIAVLGYTRLVGN
FT                   VTLFAGIRNLNEDYFTTPCMSLFTNSSCGIFPTLSANYPIANYPLAALCLDYKMTLGRF
FT                   GIESSLYNGKGYNGWSKGKHPFTFNPRKDGVFSITEINYQTEYGKCFGGFSLHTNGDMP
FT                   DVAGEWKTREREKKVSPKMTFAWWGYAERKLWSRVRQEVNLLVQYTRTSSVFSECRNYM
FT                   GAGVTWIYVPGGQKRHEAGLFLSAAQFKSCNEVAGEVTYRYSFNRDTYIQPAIHLIKNG
FT                   GGLHEVFLIRMGYILNGGRVR"
FT   CDS_pept        186318..187115
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0170"
FT                   /old_locus_tag="BF0172"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05949"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS7"
FT                   /protein_id="CAH05949.1"
FT                   /translation="MKTRALRSYLCFTLLATAFLLGLAGCDKEESEPLRIGDDSFNNIE
FT                   NGVWTAYYPNTNQTSIAIYGGVKPYTVSSNSDILKVNMDKLSDAFNYETLGVGDAEVTI
FT                   TDAKGESVGLKVKIDYRSDKMKIVKLDAYVKGDKMTVAAQKELKEKALASIPVKAGGGY
FT                   QFIYTKDQGGIVYVYPDKYGEKYKEGTFTRSSLAVGNSSYRKYEIKLDGMERTYIVQRY
FT                   YPSKTRSVAMVPYGFYEDLLDQFTDDYPEVESVYTMQVVSAVF"
FT   misc_feature    186318..186392
FT                   /note="Signal peptide predicted for BF0172 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.960) with cleavage site
FT                   probability 0.528 between residues 25 and 26"
FT   misc_feature    186363..186395
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(187162..190212)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0171"
FT                   /old_locus_tag="BF0173"
FT                   /product="putative SNF family helicase"
FT                   /note="Similar to Bacteroides thetaiotaomicron Snf2 family
FT                   helicase BT3353 SWALL:AAO78459 (EMBL:AE016940) (1027 aa)
FT                   fasta scores: E(): 4.1e-129, 61.8% id in 1029 aa, and to
FT                   Chlamydia muridarum helicase, Snf2 family tc0081
FT                   SWALL:Q9PLL8 (EMBL:AE002276) (1181 aa) fasta scores: E():
FT                   2.5e-50, 28.45% id in 970 aa, and to Chlamydia trachomatis
FT                   Swf/Snf family helicase CT708 SWALL:O84714 (EMBL:AE001341)
FT                   (1163 aa) fasta scores: E(): 3.2e-50, 28.35% id in 970 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05950"
FT                   /db_xref="GOA:Q5LIS6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS6"
FT                   /protein_id="CAH05950.1"
FT                   /translation="MKEALTTNQVVIVLVEHPVLGLLLVPYTVGRALDNTLEVIEQAFH
FT                   ASPDALKKMNEAEQKAIDIASHYTEKYLMGVYSREKTVPKFLRKLTEDSNKLKQQIRPF
FT                   IEKKLLEMLELICNGQLPFYQKPSGSKQLYEHHAYRVHPHNLKTHFSFKVTEEHFSYQL
FT                   QCYDDDTPVSLMEQKPVVVLTSNPATLLLGMDLYTFSHIEASRLLPFTKKERISADASL
FT                   TEKYIDNIIIPLARYHDISIQGLKVVREKRPCNAYLYLEDTIYNDTLLRLDFRYGEQSF
FT                   SPQPSDETRKFVFREQEEEEIVIHYFQRNSTAERKAVHLLQKAGLQCISDSHFKLSSAA
FT                   PEKNITEWISHHRQMLLEEFVLSSDTQNKPYYLPEIRIEQSCEDGPDWFDLHITVVIGN
FT                   QRIPFSRFRKNILEGNREYILPDGHIVLLPEEWFSKYANLLEAGKESDKTIRLKRPFIG
FT                   VIESILEKDRQSTSIKTLLSKEIPVPIGLKANLRSYQQKGFSWLANLYLEGFGGCLADD
FT                   MGLGKTLQTLALLQYVYKPGNTTEAIRETIDLKKAESTSGCLPQKQVFFDEKGQFSLFP
FT                   MQSKEEENSRIAPQVPQIPEPVQKQNRISPLHGTLIVVPTSLLHNWKREASRFTNLSMM
FT                   EYNGSSPNEITRLKKYFDRYHLIFTTYGTMRNNIATLSQYTFECIVLDESQNIKNSESL
FT                   TFRSAIQLRSRHRLILTGTPIENSLKDLWAQFHFLQPELLGNETTFSKHFINAIRQGDE
FT                   RMKDRLRQLITPFILRRSKQEVTPELPSLTEEVVYCDMTERQNELYQHEKNSLRNILLE
FT                   QTAEKGQQSFTVLNGILRLRQLSCHPQLFLPDFIGDSGKLYQIIETFETLRSEGHKVLI
FT                   FSSFVKHLELVAGEFRKRKWDYAFLTGSSTNRPEEIARFNRDPKIQAFLISLKAGGVGL
FT                   NLTQADYVFIIDPWWNPAAESQAIARAHRIGQNNQVIAYRFITQGSIEEKIIQLQEEKR
FT                   KLAETFITDTEQLPALTNREWARLLGS"
FT   misc_feature    complement(187330..187563)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 75.3, E-value 1.1e-19"
FT   misc_feature    complement(187690..188733)
FT                   /note="Pfam match to entry PF00176 SNF2_N, SNF2 family
FT                   N-terminal domain, score 262.4, E-value 5e-76"
FT   CDS_pept        190264..191358
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0172"
FT                   /old_locus_tag="BF0174"
FT                   /product="putative tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="Similar to Escherichia coli tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   tRmu or AsuE or MnmA or B1133 SWALL:TRMU_ECOLI
FT                   (SWALL:P25745) (368 aa) fasta scores: E(): 1.4e-29, 33.69%
FT                   id in 374 aa, and to Bacteroides thetaiotaomicron tRNA
FT                   BT3354 SWALL:Q8A2F1 (EMBL:AE016940) (370 aa) fasta scores:
FT                   E(): 1.2e-63, 74.18% id in 368 aa, and to Bacteroides
FT                   thetaiotaomicron putative tRNA BT3888 SWALL:Q8A0Y3
FT                   (EMBL:AE016942) (351 aa) fasta scores: E(): 1.8e-50, 42.07%
FT                   id in 347 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05951"
FT                   /db_xref="GOA:Q5LIS5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIS5"
FT                   /protein_id="CAH05951.1"
FT                   /translation="MMEKNKRVLLGMSGGTDSSVAAMLLLEAGYEVTGVTFRFYEFNGS
FT                   TEYLEDARALAARLGIGHITYDARKVFQEQIIDYFIDEYMSGHTPVPCTLCNNQLKWPL
FT                   LAKIADEMGIFYLATGHYVRKQWIDGNYYIAPAEDVDKDQSFFLWGLRQEILQRMLLPM
FT                   GGMTKSEARAYAAGRGFEKVSKKKDSIGVCFCPLDYRSFLKKCLCDESGDKNRNIYRKV
FT                   ERGRFLDESGNFIAWHEGYPFYTIGQRRGLGIQLNRAVFVKEIHPETNEVVLASLKSLE
FT                   KSEMWLKDWNIVDESRLLGCDDVIVKIRYRKQENHCSVTITPEGLLHIRLHEPLSAIAE
FT                   GQAAAFYKDGLLLGGGIITMTDQR"
FT   misc_feature    190297..191337
FT                   /note="Pfam match to entry PF03054 tRNA_Me_trans, tRNA
FT                   methyl transferase, score 360.5, E-value 1.5e-105"
FT   CDS_pept        complement(191418..192929)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0173"
FT                   /old_locus_tag="BF0175"
FT                   /product="putative plant auxin-regulated protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   auxin-regulated protein BT3355 SWALL:AAO78461
FT                   (EMBL:AE016940) (503 aa) fasta scores: E(): 4.3e-190,
FT                   91.01% id in 501 aa, and to Arabidopsis thaliana nt-gh3
FT                   deduced protein, putative f11i4_14 SWALL:Q9C736
FT                   (EMBL:AC073555) (525 aa) fasta scores: E(): 3.3e-10, 24.33%
FT                   id in 522 aa, and to Clostridium acetobutylicum homolog of
FT                   plant auxin-responsive gh3-like protein CAC3411
FT                   SWALL:Q97DR1 (EMBL:AE007838) (563 aa) fasta scores: E():
FT                   7.3e-10, 23.92% id in 560 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05952"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS4"
FT                   /protein_id="CAH05952.1"
FT                   /translation="MNITKIISKVFDSRLKAIDLYDTQAGEIQHRVLTRLVKQAENTEW
FT                   GKKYDYKSIRNYEDFKNRLPIQTYEEVKPYVERLRAGEQNLLWPSEIRWFAKSSGTTND
FT                   KSKFLPVSKEALEDIHYRGGKDAAAIYFRMNPESRFFSGKGLILGGSHSPNLNSNHSLV
FT                   GDLSAILIQNVSPLINLIRVPSKQIALMDEWEAKIEAIANSTIPVDVTNLSGVPSWMLV
FT                   LIKRILEKTGKQTLEEVWPNLEVFFHGGVAFTPYREQYRQVIHSSKMHYVETYNASEGY
FT                   FGTQNDLSDPSMLLMIDYGVFYEFIPLEDVEKENPRTYCLEEVELNKNYAMVISTSCGL
FT                   WRYMIGDTVKFTRKNPYKFVITGRTKHFINAFGEELIVDNAEKGLAKACAETGAQVSEY
FT                   SAAPVFMDANAKCRHQWLIEFAKMPDSIEKFAMILDATLKEVNSDYEAKRWKDIALQPL
FT                   EVIVARKGLFHDWLAKKGKLGGQHKVPRLSNTRDYIEEMIALNER"
FT   misc_feature    complement(191439..192893)
FT                   /note="Pfam match to entry PF03321 GH3, GH3
FT                   auxin-responsive promoter, score -184.4, E-value 1.6e-08"
FT   CDS_pept        193099..194109
FT                   /transl_table=11
FT                   /gene="pfkA2"
FT                   /gene_synonym="pfk2"
FT                   /locus_tag="BF9343_0174"
FT                   /old_locus_tag="BF0176"
FT                   /product="putative 6-phosphofructokinase 2"
FT                   /EC_number="2.7.1.11"
FT                   /note="Similar to Bacillus stearothermophilus
FT                   6-phosphofructokinase PfkA or Pfk SWALL:K6PF_BACST
FT                   (SWALL:P00512) (319 aa) fasta scores: E(): 5.9e-41, 41.72%
FT                   id in 302 aa, and to Bacteroides thetaiotaomicron
FT                   6-phosphofructokinase BT3356 SWALL:AAO78462 (EMBL:AE016940)
FT                   (336 aa) fasta scores: E(): 2e-118, 93.15% id in 336 aa,
FT                   and to Clostridium perfringens 6-phosphofructokinase PfkA
FT                   or Pfk or CPE0361 SWALL:K6PF_CLOPE (SWALL:Q8XNH2) (319 aa)
FT                   fasta scores: E(): 3e-41, 43.04% id in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05953"
FT                   /db_xref="GOA:Q5LIS3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS3"
FT                   /protein_id="CAH05953.1"
FT                   /translation="MKIGILTSGGDCPGINATIRGVCKTAINHYGMEVVGIHSGFQGLL
FT                   TKEVESFTEKSLSGLLNLGGTMLGTSREKPFRKQGIISDVDKPALIQRNIAELGLDCVV
FT                   CIGGNGTQKTAAKFAAMGINIVSVPKTIDNDIWGTDISFGFDSAVSIATDAIDRLHSTA
FT                   SSHKRVMVIEVMGHKAGWIALYSGMAGGGDVILVPEIPYNIKNIGDTILNRLKKGKPYS
FT                   IVVVAEGIQTDGRKRAAEYIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGG
FT                   HATELIANGQFGRMIALKGDEISSVALEEVAGKLKLVTEEHDLVVQGRRMGICFG"
FT   misc_feature    193102..193965
FT                   /note="Pfam match to entry PF00365 PFK,
FT                   Phosphofructokinase, score 327.1, E-value 1.7e-95"
FT   CDS_pept        complement(194128..195000)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0175"
FT                   /old_locus_tag="BF0177"
FT                   /product="putative ribonuclease III"
FT                   /note="Similar to Staphylococcus epidermidis RNAse III
FT                   se0908 SWALL:Q8CPI1 (EMBL:AE016747) (245 aa) fasta scores:
FT                   E(): 8.7e-17, 34.34% id in 230 aa, and to Bacteroides
FT                   thetaiotaomicron ribonuclease III BT3357 SWALL:AAO78463
FT                   (EMBL:AE016940) (324 aa) fasta scores: E(): 4e-84, 80.76%
FT                   id in 286 aa, and to Chlorobium tepidum ribonuclease III
FT                   Rnc or CT2119 SWALL:RNC_CHLTE (SWALL:Q8KAN7) (272 aa) fasta
FT                   scores: E(): 7.4e-20, 33.98% id in 256 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05954"
FT                   /db_xref="GOA:Q5LIS2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIS2"
FT                   /protein_id="CAH05954.1"
FT                   /translation="MLRNKIDKIRLLFRKDRESYSCFYRILGFYPRNIRLYEQALLHKS
FT                   TAVRSEKGRPLNNERLEFLGDAILDAIVGDIVYQHFEGKREGFLTNTRSKIVQRETLNK
FT                   LAVEIGLDKLIKYSTRSSSHNSYMYGNAFEAFIGAIYLDRGYECCKQFMERRIIEPYID
FT                   LDKLSRKEVNFKSKLIEWSQKNKMEVSFELIEQSLDKENNPVFQTEVRIEGILGGSGTG
FT                   YSKKESQQNAAQMTLKKIKGDPEFMASVQEAKTQNNVPAEDTTPESETSLTAENQQIDE
FT                   IISTEEISV"
FT   misc_feature    complement(194281..194481)
FT                   /note="Pfam match to entry PF00035 dsrm, Double-stranded
FT                   RNA binding motif, score 54.7, E-value 1.7e-13"
FT   misc_feature    complement(194566..194826)
FT                   /note="Pfam match to entry PF00636 Ribonuclease_3, RNase3
FT                   domain, score 118.3, E-value 1.2e-32"
FT   misc_feature    complement(194800..194826)
FT                   /note="PS00517 Ribonuclease III family signature."
FT   CDS_pept        complement(195005..196267)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0176"
FT                   /old_locus_tag="BF0178"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="Similar to Synechocystis sp.
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II FabF or
FT                   sll1069 SWALL:FABF_SYNY3 (SWALL:P73283) (416 aa) fasta
FT                   scores: E(): 1.7e-76, 49.88% id in 419 aa, and to
FT                   Bacteroides thetaiotaomicron
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II BT3358
FT                   SWALL:AAO78464 (EMBL:AE016940) (420 aa) fasta scores: E():
FT                   3.5e-148, 93.33% id in 420 aa, and to Chlorobium tepidum
FT                   3-oxoacyl- FabF or CT2118 SWALL:Q8KAN8 (EMBL:AE012960) (413
FT                   aa) fasta scores: E(): 1.7e-86, 58.27% id in 417 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05955"
FT                   /db_xref="GOA:Q5LIS1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIS1"
FT                   /protein_id="CAH05955.1"
FT                   /translation="MELKRVVVTGLGAITPVGNNVPEFWENLVNGVSGAGPITHFDASQ
FT                   FKTQFACEVKGFDATQYIDRKEARKMDLYTQYAVAVAKEAVADSGLDIENEDLNRIGVI
FT                   FGAGIGGIRTFEEETSNYALHKENGPKYNPFFIPKMISDIAAGQISIMYGFHGPNYATC
FT                   SACATSTNAIADAFNLIRLGKANVIVSGGSEAAIAAAGVGGFNAMHALSTRNDEPQSAS
FT                   RPFSASRDGFVMGEGGGCLILEELEHAKARGAKIYAEVAGVGMSADAHHLTASHPEGLG
FT                   AKLVMKNALEDAEMSPEEVDYINVHGTSTPVGDISEAKAIKEVFGEHAFELNISSTKSM
FT                   TGHLLGAAGAVESIASILAIKNGIVPPTINHAEGDNDENIDYNLNFTFNKAQKREINVA
FT                   LSNTFGFGGHNACVIFKKYAE"
FT   misc_feature    complement(195011..195499)
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain, score 223.5,
FT                   E-value 2.6e-64"
FT   misc_feature    complement(195521..196261)
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain, score 263.5,
FT                   E-value 2.4e-76"
FT   CDS_pept        complement(196283..196519)
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /gene_synonym="acpF"
FT                   /locus_tag="BF9343_0177"
FT                   /old_locus_tag="BF0179"
FT                   /product="putative acyl carrier protein"
FT                   /note="Similar to Azospirillum brasilense acyl carrier
FT                   protein AcpP or AcpF SWALL:ACP_AZOBR (SWALL:P94123) (78 aa)
FT                   fasta scores: E(): 2.4e-15, 68.42% id in 76 aa, and to
FT                   Bacteroides thetaiotaomicron acyl carrier protein BT3359
FT                   SWALL:AAO78465 (EMBL:AE016940) (78 aa) fasta scores: E():
FT                   5.1e-23, 94.87% id in 78 aa, and to Leucothrix mucor acyl
FT                   carrier protein AcpP SWALL:ACP_LEUMU (SWALL:P80920) (76 aa)
FT                   fasta scores: E(): 8.7e-14, 61.33% id in 75 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05956"
FT                   /db_xref="GOA:Q5LIS0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIS0"
FT                   /protein_id="CAH05956.1"
FT                   /translation="MSEIASRVKAIIVDKLGVEESEVTETASFTNDLGADSLDTVELIM
FT                   EFEKEFGISIPDDQAEKIGTVQDAVAYIEEHAK"
FT   misc_feature    complement(196292..196339)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   misc_feature    complement(196301..196504)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 80.9, E-value
FT                   2.3e-21"
FT   misc_feature    complement(196379..196426)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   CDS_pept        196618..197241
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BF9343_0178"
FT                   /old_locus_tag="BF0180"
FT                   /product="putative phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Similar to Bacillus subtilis
FT                   phosphoribosylglycinamide formyltransferase PurN
FT                   SWALL:PUR3_BACSU (SWALL:P12040) (195 aa) fasta scores: E():
FT                   3.5e-20, 40% id in 190 aa, and to Bacteroides
FT                   thetaiotaomicron phosphoribosylglycinamide
FT                   formyltransferase BT3360 SWALL:Q8A2E5 (EMBL:AE016940) (208
FT                   aa) fasta scores: E(): 1.2e-59, 74.63% id in 205 aa, and to
FT                   Chlorobium tepidum phosphoribosylglycinamide
FT                   formyltransferase PurN or CT0319 SWALL:Q8KFK7
FT                   (EMBL:AE012810) (199 aa) fasta scores: E(): 7.8e-28, 41.88%
FT                   id in 191 aa. Possible alternative start site at codon 18."
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05957"
FT                   /db_xref="GOA:Q5LIR9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR9"
FT                   /protein_id="CAH05957.1"
FT                   /translation="MQSFAHFSLFCALKGLIMGKNIAIFASGSGTNAENIIRYFEKNAS
FT                   VRVRLVLSNRKDAYVLERACRLGVPYRAFPKSDWEAAESILDLLRKYQIDFIVLAGFLL
FT                   RIPDALLHAYPDKIINIHPALLPKFGGKGMYGDRVHEAVVMAGESESGITIHYIDEHYD
FT                   EGSTVFQAKCPVLPGDTPADVAKKVHALEYEWFPKIIERVVNSL"
FT   misc_feature    196675..197217
FT                   /note="Pfam match to entry PF00551 formyl_transf, Formyl
FT                   transferase, score 187.0, E-value 2.5e-53"
FT   CDS_pept        complement(197279..198325)
FT                   /transl_table=11
FT                   /gene="pdxB"
FT                   /locus_tag="BF9343_0179"
FT                   /old_locus_tag="BF0181"
FT                   /product="putative erythronate-4-phosphate dehydrogenase"
FT                   /note="Similar to Escherichia coli erythronate-4-phosphate
FT                   dehydrogenase PdxB or B2320 SWALL:PDXB_ECOLI (SWALL:P05459)
FT                   (378 aa) fasta scores: E(): 2.3e-47, 41.29% id in 356 aa,
FT                   and to Bacteroides thetaiotaomicron erythronate-4-phosphate
FT                   dehydrogenase BT3361 SWALL:AAO78467 (EMBL:AE016940) (348
FT                   aa) fasta scores: E(): 2.4e-97, 71.83% id in 348 aa, and to
FT                   Shigella flexneri erythronate-4-phosphate dehyrogenase PdxB
FT                   or SF2396 SWALL:AAN43909 (EMBL:AE015255) (378 aa) fasta
FT                   scores: E(): 1.7e-48, 41.85% id in 356 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05958"
FT                   /db_xref="GOA:Q5LIR8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIR8"
FT                   /protein_id="CAH05958.1"
FT                   /translation="MKVIVDNKIPYIREAIEQIADEVIYVPGKDFTPELVQDADALIIR
FT                   TRTRCDRSLLAGSKVKFIATATIGFDHIDTAYCREAGITWTNAPGCNSASVAQYIQSAL
FT                   FILQQTRGMKLNQMTIGIVGVGNVGSKVADVARKLGIQVMLNDLPREEREESTMFASLK
FT                   SIAEKCDIITFHVPLYKEGKYKTYHLADKHFFHSLKKGAVIMNTSRGEVIETEALLEAL
FT                   RSGILSDAVIDVWEHEPDIDLELLEKVIIGTPHIAGYSADGKANATRMSLEALCRFFRI
FT                   ETDYRITPPEPKNKLISTATYEEASLMIYDPRRDSDALKSHPGLFEQLRGDYPLRREEG
FT                   AYRIVITK"
FT   misc_feature    complement(197561..198052)
FT                   /note="Pfam match to entry PF02826 2-Hacid_DH_C, D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain,
FT                   score 132.0, E-value 9.4e-37"
FT   misc_feature    complement(198056..198325)
FT                   /note="Pfam match to entry PF00389 2-Hacid_DH, D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, catalytic domain,
FT                   score 77.5, E-value 2.4e-20"
FT   CDS_pept        198458..199174
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0180"
FT                   /old_locus_tag="BF0182"
FT                   /product="hypothetical protein"
FT                   /note="Very low similarity to Methanosarcina mazei
FT                   glycosyltransferase MM2109 SWALL:Q8PV65 (EMBL:AE013452)
FT                   (297 aa) fasta scores: E(): 2, 27.15% id in 151 aa.
FT                   Extremely low similarity to other glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05959"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR7"
FT                   /protein_id="CAH05959.1"
FT                   /translation="MKCIHIITPVKDSIELTLQTAEAILKSDFTVPFHYTIYNDFSTDE
FT                   NTKQLKEASLKMGFELVNLSEITSHPSPNYLLVLQMAQEKAIAAEAGLLIVESDVIVKK
FT                   HTLQSLFDGAQARKDCGIAAAVTVDEHEAINYPYLYAKGKENQVFPEKKHLSFCCSLLT
FT                   TDFLRAFDFHSLNPEKNWFDVTISHQALEKGFVNYLFTTLTVWHRPHSSRPWKQLKYTN
FT                   PLKYYWLKFTKGLDKI"
FT   CDS_pept        199179..199892
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0181"
FT                   /old_locus_tag="BF0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3364 SWALL:AAO78470 (EMBL:AE016940) (247 aa)
FT                   fasta scores: E(): 1.5e-31, 42.15% id in 223 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05960"
FT                   /db_xref="GOA:Q5LIR6"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR6"
FT                   /protein_id="CAH05960.1"
FT                   /translation="MTKRLTKIGVNPDFQELSSFVHELPTVFETGGKVIYKGRNELKEF
FT                   DVEGKKLIVKSYQLPHLLNRIIYNFFRASKAKRSYSYALMLRKLGIGSPAPVGYYSTGS
FT                   WLLFGRSYFVCLKSDCPYTYRDFEKTVFPNQEQILRAIARTTAMLHENGLLHKDYSAGN
FT                   ILFRTIDEKVEVEIIDLNRMRFGNVGIEAGCKNFERLPGTHEMFAILAEEYAKARGFDV
FT                   QTCLELIEQAHSLSD"
FT   misc_feature    199638..199676
FT                   /note="PS00109 Tyrosine protein kinases specific
FT                   active-site signature."
FT   CDS_pept        complement(199861..200796)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0182"
FT                   /old_locus_tag="BF0184"
FT                   /product="putative lipopolysaccharide
FT                   1,2-glucosyltransferase/general stress protein"
FT                   /EC_number="2.4.1.58"
FT                   /note="Similar to Escherichia coli lipopolysaccharide
FT                   1,2-glucosyltransferase RfaJ or WaaJ or B3626
FT                   SWALL:RFAJ_ECOLI (SWALL:P27129) (338 aa) fasta scores: E():
FT                   2.2e-20, 28.66% id in 307 aa, and to Bacillus subtilis
FT                   general stress protein A GspA or Ipa-12D SWALL:GSPA_BACSU
FT                   (SWALL:P25148) (286 aa) fasta scores: E(): 2.1e-23, 29.03%
FT                   id in 279 aa, and to Escherichia coli
FT                   UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase
FT                   WaaR SWALL:O68204 (EMBL:AF019375) (338 aa) fasta scores:
FT                   E(): 7.4e-20, 28.33% id in 307 aa, and to Enterococcus
FT                   faecalis general stress protein A GspA-2 or EF1811
FT                   SWALL:AAO81579 (EMBL:AE016952) (281 aa) fasta scores: E():
FT                   1.5e-19, 30.51% id in 272 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05961"
FT                   /db_xref="GOA:Q5LIR5"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR5"
FT                   /protein_id="CAH05961.1"
FT                   /translation="MIHIACNIDSNFTIHCAVTLTSLFANNRNSEFCVHIIASTLPEAD
FT                   QKALSSIAESYGNKICFYFPEKDLLNNFSIKKSGNRISIATYYRCLLSRILPVNIDKIL
FT                   YIDCDIVVLNDISEFWNTDITQYAIGCIEDIGSDEEEYYSRLQYDKKYSYFNAGVLLIN
FT                   LKYWREHKIDEMCEQYFLAHSDRIRFNDQDLLNALLYKDKLFVPFRWNVQDTFYRRTYS
FT                   HKVKEHSGLKEALLHPAILHYTNKKPWNYDSMHPLKQEYFKYLDMTPWKGTRPIIDFQT
FT                   RVITGFKRLLYITGIKKSKYINLKDYELAQ"
FT   misc_feature    complement(200026..200793)
FT                   /note="Pfam match to entry PF01501 Glyco_transf_8, Glycosyl
FT                   transferase family 8, score 188.0, E-value 1.3e-53"
FT   CDS_pept        complement(200824..201846)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0183"
FT                   /old_locus_tag="BF0185"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /note="Similar to Bacteroides nodosus lipopolysaccharide
FT                   biosynthesis LpsA protein SWALL:LPSA_BACNO (SWALL:P39907)
FT                   (318 aa) fasta scores: E(): 8.2e-34, 35.11% id in 319 aa,
FT                   and to Bacteroides thetaiotaomicron lipopolysaccharide core
FT                   biosynthesis protein LpsA BT3363 SWALL:AAO78469
FT                   (EMBL:AE016940) (324 aa) fasta scores: E(): 1.1e-65, 57.73%
FT                   id in 336 aa, and to Vibrio parahaemolyticus putative
FT                   lipopolysaccharide A protein vp0191 SWALL:BAC58454
FT                   (EMBL:AP005073) (311 aa) fasta scores: E(): 2.1e-43, 41.35%
FT                   id in 324 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05962"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR4"
FT                   /protein_id="CAH05962.1"
FT                   /translation="MGDSLVYKLRSGKPPKFIYFAYDMLKMAIPSYFYRMQLKRTIAQL
FT                   SKRPDRAYIEERVSYYNRLSGNNHPIPQGTHVENKIRYLIYRGKLGNYKMSYFHKAYFF
FT                   DAREYTRWFSPDLRWQYCPGDVYFTPDSPTIVKSRLLAGDNQNSVILKLDALRHFMFVN
FT                   DKRSFTTKKDCAIFRGKIRDSRIRTQFIKMYINHPLCDCGVVGHETGIPQEWMVAKKTI
FT                   REHLEYKFILSLEGNDVASNLKWVMSSNSIAVMTRPTCETWFMEGKLIPDYHYIEIKND
FT                   FSDFEEKLTYYINHPEKAQQIIDHAHEYIKQFQNKKRERLISLLVLDKYFKATGQSGEM
FT                   "
FT   CDS_pept        complement(201849..202652)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0184"
FT                   /old_locus_tag="BF0186"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar C-terminus of Campylobacter jejuni putative
FT                   two-domain glycosyltransferase CJ1135 SWALL:Q9PNF9
FT                   (EMBL:AL139077) (515 aa) fasta scores: E(): 1.7e-30, 40.55%
FT                   id in 254 aa, and to entire protein of Vibrio
FT                   parahaemolyticus hypothetical protein VP0192 SWALL:BAC58455
FT                   (EMBL:AP005073) (262 aa) fasta scores: E(): 2.9e-44, 44.61%
FT                   id in 269 aa, and to C-terminus of Campylobacter jejuni
FT                   putative two-domain glycosyltransferase SWALL:Q938Y0
FT                   (EMBL:AY044868) (515 aa) fasta scores: E(): 5.4e-29, 38.4%
FT                   id in 250 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05963"
FT                   /db_xref="GOA:Q5LIR3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR3"
FT                   /protein_id="CAH05963.1"
FT                   /translation="MKTTLIISTYNRPEALSVCLDSVRFQTVMPDEVIVGDDGSTSETK
FT                   DLIESFKKDFPVPLIHLWQEDKGFRLAMMRNKSVAAATGDYIIEIDGDIFLHNKFVEDH
FT                   KRLAKPGHYLRGTRVNLGQKLTEEICKSKVNRRIYPWTIGIQNRAETAIHSTPVSNFFA
FT                   DRYKKNVSSGLGCNMSFWRSDFLAINGYDEFFEGWGKEDDDLTHRLQRKGCKKRSLRFA
FT                   GIVYHLWHGHESMESDQKNAEYFRKNNEKNIVYCENGVSKYLKQE"
FT   misc_feature    complement(202095..202643)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 78.5, E-value 1.2e-20"
FT   CDS_pept        complement(202773..203843)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0185"
FT                   /old_locus_tag="BF0187"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to Lactobacillus delbrueckii
FT                   glycosyltransferase EpsJ SWALL:Q9F0B8 (EMBL:AF267127) (327
FT                   aa) fasta scores: E(): 9.9e-34, 39.06% id in 256 aa, and to
FT                   Bacteroides thetaiotaomicron putative glycosyltransferase
FT                   YibD BT3366 SWALL:AAO78472 (EMBL:AE016940) (336 aa) fasta
FT                   scores: E(): 5.3e-54, 43.21% id in 324 aa, and to
FT                   Enterococcus faecalis glycosyl transferase, group 2 family
FT                   protein EF2170 SWALL:AAO81902 (EMBL:AE016953) (324 aa)
FT                   fasta scores: E(): 3.5e-37, 41.51% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05964"
FT                   /db_xref="GOA:Q5LIR2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR2"
FT                   /protein_id="CAH05964.1"
FT                   /translation="MEVNKPLPLISIIVPIYNIAEYASECIQSLINQTYKNIEIILVDD
FT                   GSTDHSPAICDEFAEQDERIKVIHKRNGGLSDARNAGLDVATGEYIGFVDGDDWVDEDM
FT                   YETLYHLIYEHQADISICTHYTELPNRTKVKYKSKKTKIFSSQKAIATLIEDKIIQNYI
FT                   WEKLFKRELFTELRFPVGWSFEDIALCYKVFHKARKIVLLQTPKYHYRTRPGSITNSTR
FT                   NPLKEFQYLQALHEQFQFAAENNIKVRKPKKLVQKTFHFINHIIILPPSSLKKKYINDA
FT                   FEIAHTYDYLRNWEIGVAATLRRFFVYNYFNAYASVIITYRKYIPARTVKSTTEFFFVR
FT                   RVATSLATAMRSILYI"
FT   misc_feature    complement(203340..203813)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 163.5, E-value 3.1e-46"
FT   CDS_pept        204264..206099
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0186"
FT                   /old_locus_tag="BF0188"
FT                   /product="putative transport ATP-binding protein"
FT                   /note="Similar to Leptospira interrogans probable transport
FT                   ATP-binding protein MsbA or la3694 SWALL:Q8F003
FT                   (EMBL:AE011524) (626 aa) fasta scores: E(): 1.8e-60, 36.68%
FT                   id in 627 aa, and to Bacteroides thetaiotaomicron ABC
FT                   transporter, ATP-binding protein BT3386 SWALL:AAO78492
FT                   (EMBL:AE016940) (611 aa) fasta scores: E(): 1.6e-187,
FT                   85.31% id in 613 aa, and to Chlorobium tepidum ABC
FT                   transporter, ATP-binding protein CT0215 SWALL:Q8KFV5
FT                   (EMBL:AE012801) (620 aa) fasta scores: E(): 3.8e-68, 41.05%
FT                   id in 531 aa. High similarity to lipid A transport
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05965"
FT                   /db_xref="GOA:Q5LIR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR1"
FT                   /protein_id="CAH05965.1"
FT                   /translation="MKEFFQLMRRFVSPYKKFLGWAVFLNLLSAVFNIFSFTLLIPILQ
FT                   ILFKMDNKVYEFIPWDAAGEGLKDIAVNNFYYYVTRMIEINGPSLTLLFLGLFLAFMTL
FT                   LKTSCYFASSAVMIPLRTGVVRDIRIMVYSKVMSLPLGFFSEERKGDIIARMSGDVGEV
FT                   ENSITSSLDMLIKNPILIVMYFGTLIITSWQLTLFTLLVVPGMGWIMGKVGKKLKRQSL
FT                   EAQAKWSDTMSQLEETLGGLRIIKAFIAEQKMINRFTECSNEFRDATNRVAMRQALAHP
FT                   MSEFLGTLLIVVVLWFGGSLILGNHSSIDAPTFIFYMVILYSVINPLKEFSKAGYNIPK
FT                   GLASMERVDKILKAENKIVEIPNPKPLNGLEEQVEFKDISFSYDGKKEVLQHINLTVPK
FT                   GKTVALVGQSGSGKSTLVDLLPRYHDVQEGTITIDGVNIKDVRISDLRSLIGNVNQEAI
FT                   LFNDTFFNNIAFGVENATMEQVIEAAKIANAHDFIMEKEDGYHTNIGDRGSKLSGGQRQ
FT                   RISIARAILKNPPILILDEATSALDTESERLVQEALERLMKTRTTIAIAHRLSTIKNAD
FT                   EICVLYEGEIVERGKHEELLAKNGYYKRLNDMQSL"
FT   misc_feature    204321..205247
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 109.8, E-value
FT                   4.5e-30"
FT   misc_feature    order(204324..204392,204531..204599,204801..204869,
FT                   205116..205175,205194..205247)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BF0188 by TMHMM2.0 at aa 21-43, 90-112, 180-202, 285-304
FT                   and 311-328"
FT   misc_feature    205461..206015
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 190.9, E-value 1.8e-54"
FT   misc_feature    205482..205505
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    205794..205838
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        206102..207334
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0187"
FT                   /old_locus_tag="BF0189"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05966"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIR0"
FT                   /protein_id="CAH05966.1"
FT                   /translation="MTKKWQYLCRCLLVLVFIGGVIPAKAQLVERVCRTDYKISPERKG
FT                   ELLLELDNISFFKDNEFAGTVIKGYSLPGLWIQPKFVYYPLKNIKLEGGVHMLWFSGAY
FT                   RYPSVSYQDIALWKGEQYQKGAHLLPFFRAQISMKSVDLILGNIYGGSNHGLIAPLYNP
FT                   ELNLTADPETGFQVLAGAPWIDLDAWIDWQSFIFRDDTHQEAFTVGLSTRFKLNAPSST
FT                   FHCYIPLQILAQHRGGEIDTIRESSVQTLMNGAVGAGVTWNIDRRILKRVNVELDAAGY
FT                   YQQKGELWPYHKGIGVYSSAFVDLGNFRVKMGHWICNDFITMFGIPYFGTVSTKKEGIT
FT                   YDKPQTLFCSIEYSRMFGKHYALGLKADAYQFFPGTMRSANGELTSPGSTTSFSVGVYF
FT                   RINPSFLLKKF"
FT   misc_feature    206102..206179
FT                   /note="Signal peptide predicted for BF0189 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.959) with cleavage site
FT                   probability 0.757 between residues 26 and 27"
FT   CDS_pept        complement(207338..207967)
FT                   /transl_table=11
FT                   /gene="rnh1"
FT                   /locus_tag="BF9343_0188"
FT                   /old_locus_tag="BF0190"
FT                   /product="putative ribonuclease H1"
FT                   /note="Similar to Trypanosoma brucei ribonuclease H1 RnH1
FT                   SWALL:O00870 (EMBL:U74470) (301 aa) fasta scores: E():
FT                   0.00053, 34% id in 100 aa, and to Bacteroides
FT                   thetaiotaomicron ribonuclease H-related protein BT3391
FT                   SWALL:AAO78497 (EMBL:AE016940) (211 aa) fasta scores: E():
FT                   8.5e-73, 82.93% id in 211 aa, and to Bacillus halodurans
FT                   ribonuclease H-related protein BH0863 SWALL:Q9KEI9
FT                   (EMBL:AP001510) (196 aa) fasta scores: E(): 3.1e-24, 49.52%
FT                   id in 210 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05967"
FT                   /db_xref="GOA:Q5LIQ9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017290"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ9"
FT                   /protein_id="CAH05967.1"
FT                   /translation="MGKQKFYVVWDGVTPGIYTSWTECQLQVKGYDSAKYKSFDNREEA
FT                   ERAFAASPYAYIGKNAKKKTTGPSTEMLPAAVIENSLAVDAACSGNPGPMEYRGVHVAS
FT                   RQEIFHFGPMKGTNNIGEFLALVHGLALLKQKGFDMPIYSDSANAISWVKQKKCKTKLS
FT                   RTAETEALFVLIERAEKWLKENKYTTPILKWETREWGEIPADFGRK"
FT   CDS_pept        208087..208689
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0189"
FT                   /old_locus_tag="BF0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   nitroreductase BT3392 SWALL:AAO78498 (EMBL:AE016940) (200
FT                   aa) fasta scores: E(): 5.9e-63, 78% id in 200 aa, and to
FT                   Clostridium acetobutylicum nitroreductase family protein
FT                   CAC3314 SWALL:Q97E06 (EMBL:AE007828) (198 aa) fasta scores:
FT                   E(): 1.5e-47, 61.3% id in 199 aa, and to Listeria innocua
FT                   hypothetical protein LIN2962 SWALL:Q926S9 (EMBL:AL596174)
FT                   (199 aa) fasta scores: E(): 5.1e-40, 54% id in 200 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05968"
FT                   /db_xref="GOA:Q5LIQ8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ8"
FT                   /protein_id="CAH05968.1"
FT                   /translation="MKKSFEEALKHRRTYYSITNQSPVSDEEIERIVNLAVTHVPSAFN
FT                   SQSTRVVLLLGENHKKLWHIVKETLRKIVPPEVFKTTEAKIDNSFASGYGTVLFFEDQS
FT                   VVKGLQEAFSSYKDNFPGWSLQTSAMHQLAVWTMLEDVGFGASLQHYNPLIDEEVRHTW
FT                   HLPEEWHLIAEMPFGLPVQGPGDKDFKDLDTRVKVFK"
FT   repeat_region   208948..209450
FT                   /note="hit to rep1 6..513 score: 2303 percent id: 95.47"
FT   CDS_pept        209525..210064
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0190"
FT                   /old_locus_tag="BF0192"
FT                   /product="putative shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="Similar to Bacteroides thetaiotaomicron shikimate
FT                   kinase BT3393 SWALL:Q8A2B2 (EMBL:AE016940) (175 aa) fasta
FT                   scores: E(): 1.2e-52, 81.14% id in 175 aa, and to Bacillus
FT                   anthracis str. Ames shikimate kinase AroK or ba4457
FT                   SWALL:AAP28170 (EMBL:AE017037) (165 aa) fasta scores: E():
FT                   4.2e-16, 43.91% id in 148 aa, and to Anabaena sp. shikimate
FT                   kinase Alr1244 SWALL:Q8YXG9 (EMBL:AP003585) (181 aa) fasta
FT                   scores: E(): 2.1e-15, 37.72% id in 167 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05969"
FT                   /db_xref="GOA:Q5LIQ7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIQ7"
FT                   /protein_id="CAH05969.1"
FT                   /translation="MIRIFLTGYMGAGKTTLGKALARELHIPFIDLDWYIEERFHKTVG
FT                   ELFSERGEASFRELEKNMLHEVGEFEDVVISTGGGAPCFFDNMEYMNRVGTTVFLDVDP
FT                   KVLFSRLRVAKQQRPILQGKKDDELLDFIVQALEKRAPFYRQANYIYCADKLEDRSQIE
FT                   TSVQQLRKLLNLHIAS"
FT   misc_feature    209552..210046
FT                   /note="Pfam match to entry PF01202 SKI, Shikimate kinase,
FT                   score 93.5, E-value 3.6e-25"
FT   CDS_pept        210211..212709
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0191"
FT                   /old_locus_tag="BF0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminus of Encephalitozoon cuniculi
FT                   hypothetical protein Ecu11_0430 ecu11_0430 SWALL:Q8SU70
FT                   (EMBL:AL590450) (590 aa) fasta scores: E(): 1.7e-30, 29.14%
FT                   id in 470 aa, and to C-terminus of Escherichia coli O6
FT                   hypothetical protein c1269 SWALL:Q8FIV2 (EMBL:AE016759)
FT                   (378 aa) fasta scores: E(): 4.2e-27, 30.8% id in 383 aa,
FT                   and to C-terminus of Coxiella burnetii immunoreactive
FT                   protein SWALL:Q9RN76 (EMBL:AF185288) (469 aa) fasta scores:
FT                   E(): 6.9e-22, 29.04% id in 451 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05970"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ6"
FT                   /protein_id="CAH05970.1"
FT                   /translation="METLKEKFEALAHRIQSSGKPAAAWFPQFTPVTLLNAENWWEALA
FT                   VCEYALDTHEDEALTAGFFELIFSAYDCNVEVDLNEEEYAYWWEKVISVCDRVAVFNGA
FT                   GWSQKGAQYSEARYGKRDLSLLFPCYEKAAEMGSPEAEATVAYWRYMGFYCEQDRAEGE
FT                   RRFAALSSPEALLWGKYYRAYAEQHTGSKEKALLMRKELLDELPEGHRLRAHVYAAMGD
FT                   ALDIEEGSVAEEAACYEKSLELVPNLYSLKNLATLYFRYPELGKQKELAFELWEKAWHA
FT                   GVWSAANFLGYNYQEEEWLDMPKAIEWLEKGMLYCESYCAYELALIYLYNDEYKNVERG
FT                   LMCLQRCVDDNYVEAIETLANVYFNGELVEENISYACQLLERAIELGSGSAAYRIGWMY
FT                   ERGLLSEEPDYQKAMEYYEKAVSMDSADGYARAALYLANGYSGVTDAGKSKAYYEKAAE
FT                   LGSCFAMVELAFLYENGEVVEQSYEKAFDLLQKAAGQEYPYAMYRVGLYLDRGVIGEPR
FT                   PEEAFAWYAKAAERGDGDAIFALGRCYKNGIGTEENPDKALEWFTKGAENNEPRCLTEM
FT                   GLAYEYGSGIEENPHQAVEYMTKAAEQNYGYAQFKMGDYFFFGYGACPEDNKQAVEWYE
FT                   KAVANDIPLAMLRMGEYYLYDYDKLNESEKAFSYFKKAAEAECYNEGLGICYEMGIGVE
FT                   DNETEAFKYYTLAAGSGNVMSMYRTGLCYYNGVGVKQNYTEAYRWFNDAAGNDNVASYY
FT                   YLGKMLMYGEGCVPDAEAGLQWLMKAAEHNSDKAQFELGNAYLMGNGVEENDEIAMEWF
FT                   EKAAENGNAKALKITGRRQR"
FT   misc_feature    211534..211557
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        212717..214483
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0192"
FT                   /old_locus_tag="BF0194"
FT                   /product="putative heat-shock protein"
FT                   /note="Similar to Leptospira interrogans heat shock protein
FT                   HtpG HtpG1 or La1231 SWALL:Q8F6S0 (EMBL:AE011304) (603 aa)
FT                   fasta scores: E(): 2e-63, 36.54% id in 602 aa, and to
FT                   Listeria monocytogenes hypothetical protein LMO0942
FT                   SWALL:Q8Y8G2 (EMBL:AL591977) (601 aa) fasta scores: E():
FT                   9.4e-47, 32.82% id in 594 aa, and to Listeria innocua
FT                   hypothetical protein Lin0941 SWALL:Q92D78 (EMBL:AL596167)
FT                   (564 aa) fasta scores: E(): 2e-42, 34.05% id in 552 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05971"
FT                   /db_xref="GOA:Q5LIQ5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ5"
FT                   /protein_id="CAH05971.1"
FT                   /translation="MEKEGNNLFQVNLKGMIALLSEHIYSNPNTFVRELLQNSVDAITA
FT                   LHNIDENYSGRIDVFLNGDGSMVFQDNGIGLKEEEVYRFLTVIGESSKRDTPDADDFIG
FT                   RFGIGLLSCFVVTNEIRVESRSAMGGNPVCWCGKVDGTYQTTFPDEEWEIGSRVVLRPK
FT                   NEWAHLFEYEVFKKILVNYGEVLPYPVYLHGGEEEELVNTPSPVWLDPKATRKELLDYG
FT                   TKVFQSSALDAFPIRTEHGRIEGVLYVLPFRTQFSVRNSHKVYLKRMLLSEDDCNLLPS
FT                   WAFFIRCLVNADGLLSTASRESFVSNDSLKDARKEIGVAIKEYLRALVQNNRSVFNKIL
FT                   DVHHFHIKAIASEDNELLRLFMDYLPFETNKGIRSFGSIRSSNNTIYYTRNLEDFRQVR
FT                   RIAGAQGRLVVNAAYTFDETLLKKYIRLNQELSLEEISPARLLEEFAEVEGNKEHRSFE
FT                   TKASELLKRFGCICRLKHFTPVDTPVIFVAEEKEENSKVANNPLAAVLGSVNAKKRLPP
FT                   TLTFNADNEMVQTLLRIQGDNKLFQHVVHILYVQSLLQGKYPVNSEEMELFNHSLSELM
FT                   TAKMNDFINFLN"
FT   misc_feature    212792..213211
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 15.4,
FT                   E-value 0.0025"
FT   misc_feature    213227..214468
FT                   /note="Pfam match to entry PF00183 HSP90, Hsp90 protein,
FT                   score -224.5, E-value 0.00014"
FT   CDS_pept        214492..215571
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0193"
FT                   /old_locus_tag="BF0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Leptospira interrogans conserved
FT                   hypothetical protein La1230 SWALL:Q8F6S1 (EMBL:AE011304)
FT                   (371 aa) fasta scores: E(): 3.1e-19, 27.64% id in 340 aa,
FT                   and to Listeria innocua hypothetical protein Lin0939
FT                   SWALL:Q92D79 (EMBL:AL596167) (320 aa) fasta scores: E():
FT                   3.4e-15, 28.12% id in 352 aa, and to Listeria monocytogenes
FT                   hypothetical protein LMO0940 SWALL:Q8Y8G4 (EMBL:AL591977)
FT                   (320 aa) fasta scores: E(): 3.9e-15, 31.66% id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05972"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ4"
FT                   /protein_id="CAH05972.1"
FT                   /translation="MKYTLEIQKLLLQAQNDNLHPREKANLLREAIRIADENEDVQWAV
FT                   EMRLDLIYELNLLSADAEEIAVFSKILDSYENHKDQINEDDILWKYKWIWSCTFDLPSI
FT                   PMEQVEAVGEDYKTRILRNGYSLRTYYHRLSVEYTKMREYAKAKECIDKMLAEKMDDLT
FT                   CEACELNFMLDYYLETGQFEEAYNRAQPLITRQVSCYEANLRAYMKLAYYACKAGKPEI
FT                   AADMCARAEEALVGREKDEYLLLYLGLFIAYYFMTHPDRGWEYAERCIPWSLNTNMQKK
FT                   YRFSCDMVEALSYESREEVSLSLPEEFPLYRADGIYSVAALRDYFYKQATQLASLYDTR
FT                   NGNNGYQERLFNVNLIGNL"
FT   CDS_pept        215629..217521
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0194"
FT                   /old_locus_tag="BF0196"
FT                   /product="putative arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="Similar to Escherichia coli biosynthetic arginine
FT                   decarboxylase SpeA or B2938 SWALL:SPEA_ECOLI (SWALL:P21170)
FT                   (658 aa) fasta scores: E(): 1.7e-101, 45.15% id in 629 aa,
FT                   and to Bacteroides thetaiotaomicron putative arginine
FT                   decarboxylase BT3394 SWALL:AAO78500 (EMBL:AE016940) (630
FT                   aa) fasta scores: E(): 0, 95.39% id in 630 aa, and to
FT                   Synechococcus elongatus arginine decarboxylase tll1807
FT                   SWALL:Q8DHY6 (EMBL:AP005375) (637 aa) fasta scores: E():
FT                   3.1e-114, 46.09% id in 627 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05973"
FT                   /db_xref="GOA:Q5LIQ3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIQ3"
FT                   /protein_id="CAH05973.1"
FT                   /translation="MRKWRIEDSEELYNITGWGTSYFGINDKGHVVVTPRKDGVAVDLK
FT                   ELVDELQLRDVAAPMLVRFPDILDNRIEKTAYCFKQASEEYGYKAQNFIIYPIKVNQMR
FT                   PVVEEIISHGKKFNLGLEAGSKPELHAVIAVNTDSDSLIICNGYKDESYIELALLAQKM
FT                   GKRIFLVVEKMNELKLIARMAKQLNVQPNIGIRIKLASSGSGKWEESGGDASKFGLTSS
FT                   ELLEALDFLESKGMKDCLKLIHFHIGSQVTKIRRIKTALREASQFYVQLHAMGFNVEFV
FT                   DIGGGLGVDYDGTRSSSSESSVNYSIQEYVNDSISTLVDASDKNGIPHPNIITESGRAL
FT                   TAHHSVLIFEVLETATLPQWDDEEEIAPDAHELVQELYGIWDTLNQNKMLEAWHDAQQI
FT                   REEALDLFSHGIVDLKTRAQIERLYWSITREINQIAGGLKHAPDEFRGLSKLLADKYFC
FT                   NFSLFQSLPDSWAIDQIFPIMPIQRLDEKPDRSATLQDITCDSDGKIANFISTRNVAHY
FT                   MPVHSLKQKEPYYVAVFLVGAYQEILGDMHNLFGDTNAVHVSVNEKGYNIEQIIDGETV
FT                   AEVLDYVQYSPKKLVRTLETWVTKSVKEGKISVEEGKEFLSNYRSGLYGYTYLE"
FT   misc_feature    215824..216657
FT                   /note="Pfam match to entry PF02784 Orn_Arg_deC_N,
FT                   Pyridoxal-dependent decarboxylase, pyridoxal binding
FT                   domain, score 213.9, E-value 2e-61"
FT   misc_feature    215914..215970
FT                   /note="PS00878 Orn/DAP/Arg decarboxylases family 2
FT                   pyridoxal-P attachment site."
FT   misc_feature    216451..216492
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2."
FT   misc_feature    216664..217305
FT                   /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, C-terminal sheet domain,
FT                   score 39.6, E-value 9.1e-10"
FT   CDS_pept        217649..218434
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0195"
FT                   /old_locus_tag="BF0197"
FT                   /product="putative acetylglutamate kinase"
FT                   /note="Similar to Campylobacter jejuni acetylglutamate
FT                   kinase ArgB or CJ0226 SWALL:ARGB_CAMJE (SWALL:Q9PIR8) (281
FT                   aa) fasta scores: E(): 2.5e-20, 34.78% id in 253 aa, and to
FT                   Bacteroides thetaiotaomicron putative acetylglutamate
FT                   kinase BT3395 SWALL:AAO78501 (EMBL:AE016940) (257 aa) fasta
FT                   scores: E(): 1.5e-82, 91.05% id in 257 aa, and to
FT                   Methanopyrus kandleri acetylglutamate kinase ArgB or mk1631
FT                   SWALL:ARGB_METKA (SWALL:Q8TUX2) (246 aa) fasta scores: E():
FT                   3.7e-28, 40.23% id in 256 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05974"
FT                   /db_xref="GOA:Q5LIQ2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIQ2"
FT                   /protein_id="CAH05974.1"
FT                   /translation="MKEKMKEKLTVIKVGGKIVEEEATLNQLLNDFAAIEGHKVLVHGG
FT                   GRSATKIAAQLGIDSKMVNGRRITDAETLKVVTMVYGGLVNKNIVAGLQARGVNALGLT
FT                   GADMNVIRSMKRPVKEVDYGFVGDVERVDSTLLSDLIHKGVVPVMAPLTHDGQGNMLNT
FT                   NADTIAGETAKALSAIFDVTLVYCFEKKGVLRDENDDESVIPQINHAEFQRYIAEGVIQ
FT                   GGMIPKLENSFEAINAGVSEVVITLASAIHTDGGTRIKK"
FT   misc_feature    217670..218389
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 96.8, E-value 3.7e-26"
FT   CDS_pept        218496..219005
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0196"
FT                   /old_locus_tag="BF0198"
FT                   /product="putative extracytoplasmic function alternative
FT                   sigma factor"
FT                   /note="Similar to Mycobacterium smegmatis extracytoplasmic
FT                   function alternative sigma factor SigE SWALL:O05767
FT                   (EMBL:U87307) (204 aa) fasta scores: E(): 3.8e-06, 29.33%
FT                   id in 150 aa, and to Bacteroides thetaiotaomicron RNA
FT                   polymerase ECF-type sigma factor BT3396 SWALL:AAO78502
FT                   (EMBL:AE016940) (169 aa) fasta scores: E(): 9.5e-50, 86.98%
FT                   id in 169 aa, and to Bacteroides thetaiotaomicron putative
FT                   RNA polymerase ECF-type sigma factor BT0326 SWALL:AAO75433
FT                   (EMBL:AE016927) (173 aa) fasta scores: E(): 1.6e-12, 33.12%
FT                   id in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05975"
FT                   /db_xref="GOA:Q5LIQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ1"
FT                   /protein_id="CAH05975.1"
FT                   /translation="MQEISFRDDILPLKDKLFRLALRITFDRAEAEDVVQDTMIRVWNK
FT                   REEWTQFGSIEAYCLTVAKNLAIDRSQKKEAQNVELTPEMEEESEISGPYDQLVNNERM
FT                   SIIHRLINELPEKQRLIMQLRDIEGESYKEIAKILNLTEEQVKVNLFRARQKVKQRYLE
FT                   IDEYGL"
FT   misc_feature    218520..218726
FT                   /note="Pfam match to entry PF04542 sigma70_r2, Sigma-70
FT                   region 2, score 52.5, E-value 7.7e-13"
FT   misc_feature    218823..218972
FT                   /note="Pfam match to entry PF04545 sigma70_r4, Sigma-70,
FT                   region 4, score 61.0, E-value 2.3e-15"
FT   misc_feature    218883..218948
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1597.000, SD 4.63 at aa 130-151, sequence
FT                   ESYKEIAKILNLTEEQVKVNLF"
FT   CDS_pept        218995..219504
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0197"
FT                   /old_locus_tag="BF0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3397 SWALL:AAO78503 (EMBL:AE016940) (158 aa)
FT                   fasta scores: E(): 2e-34, 63.52% id in 170 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT0325
FT                   SWALL:AAO75432 (EMBL:AE016927) (153 aa) fasta scores: E():
FT                   0.00066, 30.76% id in 143 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIQ0"
FT                   /protein_id="CAH05976.1"
FT                   /translation="MDYKYIEQLLERYWQCETSLEEESELRSFFSEEEVPAHLLRYKEL
FT                   FVYQTVQQEVGLGKDFDARILAQVEAPVVKAKHLTMVGRFMPLFKAAAVVALILSLGNV
FT                   AQHTFFADEALDYNYDAYKDTYDDPEVAYKQVSSALMMLSEGINKSQDQVVRDSVKVEP
FT                   VRVMKE"
FT   CDS_pept        219509..219985
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0198"
FT                   /old_locus_tag="BF0200"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05977"
FT                   /db_xref="InterPro:IPR025348"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP9"
FT                   /protein_id="CAH05977.1"
FT                   /translation="MKSVLLMCWMALLSVAVSAQDFASRFMAEHQADSNLTCVTISPKM
FT                   MEEIMKSDAEKDKEVLDMISNLKSMQVLTSDVEGKKYFNAALKVVEKNSGRFESFLSFK
FT                   DKSENCQIMVRKKKSTIVELVMLMHEKNHFAVVNFTGNMSPEFIAQIKRHFHLL"
FT   misc_feature    219509..219565
FT                   /note="Signal peptide predicted for BF0200 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.992 between residues 19 and 20"
FT   CDS_pept        complement(220173..220952)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0199"
FT                   /old_locus_tag="BF0201"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3398 SWALL:AAO78504 (EMBL:AE016940)
FT                   (261 aa) fasta scores: E(): 4.8e-40, 48.65% id in 261 aa,
FT                   and to Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein BT1007 SWALL:AAO76114 (EMBL:AE016930) (263 aa)
FT                   fasta scores: E(): 3e-26, 36.29% id in 259 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT1534
FT                   SWALL:AAO76641 (EMBL:AE016932) (208 aa) fasta scores: E():
FT                   1.1e-09, 27.77% id in 216 aa, and to Pseudomonas
FT                   resinovorans hypothetical protein SWALL:Q8GI04
FT                   (EMBL:AB088420) (246 aa) fasta scores: E(): 1.1e-06, 27.85%
FT                   id in 219 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05978"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP8"
FT                   /protein_id="CAH05978.1"
FT                   /translation="MKKYILSSLTITFLLLSITACSQGKQISGSSNYITKNIKVGSFDQ
FT                   IKSMSSSDIVYTQKQGAPTVQIYGPDNIVELMETSVSGRTLTIKFKKNTSIRNSGKLEI
FT                   RVSSPSLKHLSIYGSGNTTFTNGIKSHDELQMSIYGSGNISGNSFSCTKLAARIYGSGN
FT                   VNLKRISTSDTQVNISGSGNVLLDGKSTEAEYHIAGSGDINATELKVENVNARISGSGS
FT                   IRCYATENLTGGVSGSGNVAYKGNPQINFSKRGLQKL"
FT   misc_feature    complement(220887..220952)
FT                   /note="Signal peptide predicted for BF0201 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.491 between residues 22 and 23"
FT   misc_feature    complement(220890..220922)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(220972..221706)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0200"
FT                   /old_locus_tag="BF0202"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3398 SWALL:AAO78504 (EMBL:AE016940)
FT                   (261 aa) fasta scores: E(): 2.6e-12, 29.88% id in 251 aa,
FT                   and to Bacteroides thetaiotaomicron hypothetical protein
FT                   BT1534 SWALL:AAO76641 (EMBL:AE016932) (208 aa) fasta
FT                   scores: E(): 1.5e-11, 31.18% id in 186 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT1007 SWALL:AAO76114 (EMBL:AE016930) (263 aa) fasta
FT                   scores: E(): 7.6e-10, 33.07% id in 254 aa, and to Anabaena
FT                   sp. ORFr4 ALL1511 SWALL:P70759 (EMBL:U72238) (125 aa) fasta
FT                   scores: E(): 4.6e-08, 35.71% id in 112 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05979"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="PDB:3PET"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP7"
FT                   /protein_id="CAH05979.1"
FT                   /translation="MKTIFRMLSVLLLTTGLLSSCIQIGEGIQPSKKLITRDYKVKEFN
FT                   KIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKM
FT                   KITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVG
FT                   DVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSI
FT                   KYKGSPTIKSLSKKGVGTIKNI"
FT   misc_feature    complement(221632..221706)
FT                   /note="Signal peptide predicted for BF0202 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.663 between residues 25 and 26"
FT   misc_feature    complement(221644..221676)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        221827..222525
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0201"
FT                   /old_locus_tag="BF0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   zinc protease BT3399 SWALL:Q8A2A6 (EMBL:AE016940) (232 aa)
FT                   fasta scores: E(): 1.8e-67, 71.98% id in 232 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein atu0016 or
FT                   agr_c_25 SWALL:Q8UJB2 (EMBL:AE008976) (255 aa) fasta
FT                   scores: E(): 4.4e-12, 27.92% id in 222 aa, and to
FT                   Chlorobium tepidum zinc protease, putative CT0704
FT                   SWALL:Q8KEI5 (EMBL:AE012841) (248 aa) fasta scores: E():
FT                   1.1e-10, 26.9% id in 223 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05980"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP6"
FT                   /protein_id="CAH05980.1"
FT                   /translation="MDRVIEDKELGRLVVRDNVRAKRLVFRTKADAIYISIPLGVTMRE
FT                   VKEAIEKLRPRLLDSRQKLVRPLIDLNYRIETEYFKLSLVSGKRERFLAHSELGEMRII
FT                   CPPTADFTDSNLQDWLRKVIEEALRRNAKIILPPRLYMLSEKHRLPYESVQINSSRGRW
FT                   GSCSSRKKINLSYFLVLLPKHLIDYVLLHELCHTCEMNHGDRFWDLLNGLTDGKALELR
FT                   EELKRYKTEI"
FT   misc_feature    221953..222519
FT                   /note="Pfam match to entry PF01863 DUF45, Protein of
FT                   unknown function DUF45, score 2.1, E-value 1.6e-06"
FT   CDS_pept        complement(222687..223085)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0202"
FT                   /old_locus_tag="BF0204"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3400 SWALL:AAO78506 (EMBL:AE016940) (131 aa)
FT                   fasta scores: E(): 7.8e-37, 76.33% id in 131 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05981"
FT                   /db_xref="GOA:Q5LIP5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP5"
FT                   /protein_id="CAH05981.1"
FT                   /translation="MAHRLNTNKQFMVGNGILAFAVIFVVVIFVYMSLRLQREKEANRH
FT                   FSETYSIQLTKGFVGDSISLFVNDSLIMNKQIKEEPTAIEVGRFAEQSALMIVNNQTET
FT                   VAAFDLSEKGGTYRFEKDIDGIKQLPQK"
FT   misc_feature    complement(222984..223052)
FT                   /note="1 probable transmembrane helix predicted for BF0204
FT                   by TMHMM2.0 at aa 12-34"
FT   CDS_pept        223192..224247
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0203"
FT                   /old_locus_tag="BF0205"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Synechocystis sp. regulatory components
FT                   of sensory transduction system SLR1837 SWALL:P73404
FT                   (EMBL:D90906) (234 aa) fasta scores: E(): 0.052, 31.25% id
FT                   in 80 aa, and to Clostridium tetani transcriptional
FT                   regulatory component of sensory transduction system
FT                   CTc01421 SWALL:Q894W3 (EMBL:AE015941) (230 aa) fasta
FT                   scores: E(): 0.26, 23.93% id in 188 aa, and to
FT                   Synechococcus elongatus two-component response regulator
FT                   tll2099 SWALL:Q8DH60 (EMBL:AP005376) (232 aa) fasta scores:
FT                   E(): 0.55, 26.89% id in 119 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05982"
FT                   /db_xref="GOA:Q5LIP4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP4"
FT                   /protein_id="CAH05982.1"
FT                   /translation="MVMSWEKTIFGCLIGGYALLGLLGGNYAYEQEVKALHVYADSVFH
FT                   EAFHVELQKRGMDQVESWRYGCEDSFVSSVDTAFKKVTIQDEYGTYSFRVDAMKIRKNI
FT                   VSSPGEQGLHTVVCLTHPLSVDTLNILWRTMLNERQKFPIRTGLKLTVSDNNGVVRSSF
FT                   SPDSLSCLSYSSIFTYYVGYRCEIEILGFVSISFFSVFVNIVWTLIGVVVAFVLCVILT
FT                   IYIYKLSVHPPKIKEVTTYIQTVAVKKGTLPIYDLKDDLKLDVGKGVLICENMEVSLTP
FT                   QQRVLLVLFIKAENHTLSMSQIMADVWPGKSISPDCFHKAIERLRDLLRQLPMTIQIEY
FT                   LGEEIYQMQIL"
FT   misc_feature    order(223210..223278,223801..223869)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0205 by TMHMM2.0 at aa 7-29 and 204-226"
FT   misc_feature    224104..224127
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        224408..224635
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0204"
FT                   /old_locus_tag="BF0206"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05983"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP3"
FT                   /protein_id="CAH05983.1"
FT                   /translation="MRNFFVSAFLLLVGIAVMTVCRMNNKQYLSELALVNVEALATGEG
FT                   DVPTSCYGSGNVDCPISDSKVSYVMNGRSF"
FT   misc_feature    224408..224476
FT                   /note="Signal peptide predicted for BF0206 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.932) with cleavage site
FT                   probability 0.398 between residues 23 and 24"
FT   CDS_pept        224815..225081
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0205"
FT                   /old_locus_tag="BF0207"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05984"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP2"
FT                   /protein_id="CAH05984.1"
FT                   /translation="MNYKKKIICLLALFTIVVVNVLNVVVKSDDAETLTLSGIEAVAAT
FT                   YENSPGNYTGAHNQYCTSPKNATGCVSDPDPTRTCSYSIFCKK"
FT   misc_feature    224815..224883
FT                   /note="Signal peptide predicted for BF0207 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.429 between residues 23 and 24"
FT   CDS_pept        225143..226336
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0206"
FT                   /old_locus_tag="BF0208"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP1"
FT                   /protein_id="CAH05985.1"
FT                   /translation="MLVMKYLNLFIFVLLLAGCNRPVKHSDIIQADTMVSIIPQEDTIT
FT                   LSALFSRCEIVKLNDIVLASINKVFKYDSLWIVQGKSDQGGVHLFNNEGRYLKTVLKWG
FT                   QGPEEAYDIWSIKLLDGSIYLLINSGTEVVEYSLQKQKMVERFRLPSEILSATDFVVDN
FT                   GGNYIFLKSISREKKKEEYKLYVYNKKEGTIVNRILNMDKKSSEYISFDQSDCLYRVQD
FT                   EIYYYEVFRNGICRLSANDMTGYIAFKQNEYTFPEKELYNEDHTFQSFIDVCENSPFIW
FT                   AHRNLFEGERFVSSTYMYKKELFWNIIDKSDYSVHSYKWVYDDLILNEVVPVEDYLYRA
FT                   NVQENIHYYTLSFYDFDRIMQLKKKCKKSVGEKWMVKLDDMLDENSNDIIVCFYEKK"
FT   misc_feature    225167..225199
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    226341..226409
FT                   /note="1 probable transmembrane helix predicted for BF0209
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        226356..226883
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0207"
FT                   /old_locus_tag="BF0209"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIP0"
FT                   /protein_id="CAH05986.1"
FT                   /translation="MLALCLFTNCLFIGYYYYQQNREVLLGQELEHQKKQNYELIVNQI
FT                   ESGIIPHVISDKKEFAGYFVLVFPNGICDVCNKWLFKQISELSSTSDLVVVVPDKLKKN
FT                   MEIYNTVYKLKLSSIFCSEKYAMPQEEFKDMTYIFYCSKTGTVLYPLALHHKNIDLDLY
FT                   FKLVKSIDLDFL"
FT   CDS_pept        227088..228068
FT                   /transl_table=11
FT                   /gene="fucR"
FT                   /locus_tag="BF9343_0208"
FT                   /old_locus_tag="BF0210"
FT                   /product="putative GntR-family regulatory protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron FucR or
FT                   BT1272 SWALL:AAO76379 (EMBL:AF137263) (331 aa) fasta
FT                   scores: E(): 1.3e-85, 68.3% id in 325 aa, and to
FT                   Bacteroides thetaiotaomicron FucR or BT1272 SWALL:Q9RQ14
FT                   (EMBL:AF137263) (331 aa) fasta scores: E(): 1.3e-85, 68.3%
FT                   id in 325 aa, and to Bacteroides thetaiotaomicron putative
FT                   transcriptional regulator BT2096 SWALL:AAO77203
FT                   (EMBL:AE016934) (325 aa) fasta scores: E(): 4.6e-33, 36.22%
FT                   id in 323 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05987"
FT                   /db_xref="GOA:Q5LIN9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN9"
FT                   /protein_id="CAH05987.1"
FT                   /translation="MKITFGQQTTKVKQLADKISFDISMGVYKSGDSLPSINQLSQAYE
FT                   VSRDTVFKAFLDLKERGIIDSTPGKGYYVVGRLKNVLLLLDEYSPFKYALYNSFVKRLS
FT                   IRYKVDLLFHQYNERLFNTIIRESLGRYNKYIVMNFDNEKLSPNLYKINPSKLLLLDFG
FT                   KFEKEGFSYVCQDFDQGFYNALFQLADRLRKYQKLVFVLVDDSMHPRSSRDFFERFCAD
FT                   QHLGCEVVSDIEGLQVRRGEVYIAIRQIDVVSIIKKSRVEGLQCGVDFGLIGYNDTPAY
FT                   EVIDQGITALSVDWEKMGDKAAEFVLQGKTIQDYLPTEVRLRASL"
FT   misc_feature    227130..227309
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 53.1, E-value
FT                   5.1e-13"
FT   misc_feature    227187..227261
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        228141..229913
FT                   /transl_table=11
FT                   /gene="fucI"
FT                   /locus_tag="BF9343_0209"
FT                   /old_locus_tag="BF0211"
FT                   /product="putative L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /note="Similar to Escherichia coli, and Shigella flexneri
FT                   L-fucose isomerase FucI or B2802 or SF2816 SWALL:FUCI_ECOLI
FT                   (SWALL:P11552) (591 aa) fasta scores: E(): 4.7e-158, 63% id
FT                   in 592 aa, and to Bacteroides thetaiotaomicron L-fucose
FT                   isomerase FucI or BT1273 SWALL:Q9RQ13 (EMBL:AF137263) (591
FT                   aa) fasta scores: E(): 0, 90.52% id in 591 aa, and to
FT                   Bacteroides thetaiotaomicron L-fucose isomerase FucI or
FT                   BT1273 SWALL:AAO76380 (EMBL:AF137263) (591 aa) fasta
FT                   scores: E(): 0, 90.52% id in 591 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05988"
FT                   /db_xref="GOA:Q5LIN8"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIN8"
FT                   /protein_id="CAH05988.1"
FT                   /translation="MKKYPKIGIRPTIDGRQGGVRESLEEKTMNLAKAVAELITSNLKN
FT                   GDGTPVECVIADGTIGRVAESAACAEKFEREGVGATITVTSCWCYGAETMDMNPYYPKA
FT                   VWGFNGTERPGAVYLAAVLAGHAQKGLPAFGIYGRDVQDLNDNSIPADVAEKILRFARA
FT                   AQAVATMRGKSYLSMGSVSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMAEGIYDK
FT                   EEYAKAMAWTEKYCKKNEGNDFNIPEKTKTRAQKDEDWEFIVKMTIIMRDLMQGNPKLK
FT                   ELGFKEEALGHNAIAAGFQGQRQWTDFYPNGDFSEALLNTSFDWNGIREAFVVTTENDA
FT                   CNGVAMLFGHLLTNRAQIFSDVRTYWSPEAVKRVTGKELTGMAANGIIHLINSGATTLD
FT                   GTGQQTNANGEPAMKPCWEITEGEVEKCLEATTWYPANRDYFRGGGFSSNFLSKGGMPV
FT                   TMMRLNLIKGLGPVLQIAEGWTVEIDPEIHKLLDERTDRTWPTTWFVPRLCDKPAFKDV
FT                   YSVMNNWGANHGAISYGHIGQDVITLASMLRIPVCMHNVEEDQIFRPAAWNAFGMDKEG
FT                   ADYRACTTYGPIYK"
FT   misc_feature    229206..229910
FT                   /note="Pfam match to entry PF02952 fucose_iso_C, L-fucose
FT                   isomerase, C-terminal domain, score 606.2, E-value
FT                   1.6e-179"
FT   CDS_pept        229932..231086
FT                   /transl_table=11
FT                   /gene="fucO"
FT                   /locus_tag="BF9343_0210"
FT                   /old_locus_tag="BF0212"
FT                   /product="putative lactaldehyde reductase"
FT                   /EC_number="1.1.1.77"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 lactaldehyde reductase FucO or B2799 or Z4116 or
FT                   ECS3659 SWALL:FUCO_ECOLI (SWALL:P11549) (383 aa) fasta
FT                   scores: E(): 1.3e-74, 55.87% id in 383 aa, and to
FT                   Bacteroides thetaiotaomicron lactaldehyde reductase BT3767
FT                   SWALL:AAO78872 (EMBL:AE016942) (384 aa) fasta scores: E():
FT                   2.7e-88, 64.15% id in 385 aa, and to Salmonella typhimurium
FT                   L-1,2-propanediol oxidoreductase FucO or STM2973
FT                   SWALL:Q8ZMC8 (EMBL:AE008836) (382 aa) fasta scores: E():
FT                   4e-77, 56.91% id in 383 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05989"
FT                   /db_xref="GOA:Q5LIN7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN7"
FT                   /protein_id="CAH05989.1"
FT                   /translation="MINRFILNEVSYFGPGAREVLPKEISRLGLHKAFVATDKDLIKFG
FT                   VADKVLKVLEAAKIPYEIFSEIKPNPTVSNVKAGVEAFASSGADFILAIGGGSSMDTAK
FT                   AIGIITNNPEFSDVVSLEGVADTKKKSVPIIALPTTAGTAAEVTINYVITDEKNQKKMV
FT                   CVDPNDIPSIAIVDAELMYTLPKSLTAATGLDALTHAIEGLITKGAWEMSDMFEIKAIE
FT                   MINRYLVTAVEEPSNAEARNGMAVAQYIAGMAFSNVGLGVVHGMAHPLGAIFDIPHGVA
FT                   NALLLPIIMEFNAPAALDKYVEIAKAMNVYSTDMTKEKAAEAAVEAVKTLSLRVNIPQH
FT                   LSDLGIQESDLDRLATAAFADVCTPGNPREVTKEIILDLYKKAL"
FT   misc_feature    229953..231059
FT                   /note="Pfam match to entry PF00465 Fe-ADH, Iron-containing
FT                   alcohol dehydrogenase, score 532.4, E-value 2.7e-157"
FT   misc_feature    230451..230537
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   misc_feature    230712..230774
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   CDS_pept        231083..231721
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="BF9343_0211"
FT                   /old_locus_tag="BF0213"
FT                   /product="putative aldolase"
FT                   /note="Similar to Escherichia coli hypothetical aldolase
FT                   class II protein YgbL or B2738 SWALL:YGBL_ECOLI
FT                   (SWALL:Q46890) (212 aa) fasta scores: E(): 3.8e-13, 33.51%
FT                   id in 182 aa, and to Bacteroides thetaiotaomicron
FT                   L-fuculose-1-phosphate aldolase FucA or BT1274 SWALL:Q9RQ12
FT                   (EMBL:AF137263) (212 aa) fasta scores: E(): 2.1e-79, 91.5%
FT                   id in 212 aa, and to Bacteroides thetaiotaomicron
FT                   L-fuculose-1-phosphate aldolase FucA or BT1274
FT                   SWALL:AAO76381 (EMBL:AF137263) (212 aa) fasta scores: E():
FT                   2.1e-79, 91.5% id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05990"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN6"
FT                   /protein_id="CAH05990.1"
FT                   /translation="MITNEHIEQYLAQAHRYGDAKLMLCSSGNLSWRIGEEALVSGTGS
FT                   WVPNLQKEKVSICNIATGTPQNGVKPSMESTFHLGILRERPDVNVVLHFQSEYATAVSC
FT                   MKNKPSNFNVTAEIPCHVGKEIPIIPYYRPGSPALAKAVVEAMKEHNSVLLTNHGQVVC
FT                   GKDFDQVYERATFFEMACRIIVQSGGDYSVLTPEEIDDLEVYVLGKKTK"
FT   misc_feature    231095..231676
FT                   /note="Pfam match to entry PF00596 Aldolase_II, Class II
FT                   Aldolase and Adducin N-terminal domain, score 163.5,
FT                   E-value 3.1e-46"
FT   CDS_pept        231739..233151
FT                   /transl_table=11
FT                   /gene="fucK"
FT                   /gene_synonym="rhaB"
FT                   /locus_tag="BF9343_0212"
FT                   /old_locus_tag="BF0214"
FT                   /product="putative fuculokinase"
FT                   /EC_number="2.7.1.5"
FT                   /note="Similar to Salmonella typhimurium rhamnulokinase
FT                   RhaB or STM4047 SWALL:RHAB_SALTY (SWALL:P27030) (489 aa)
FT                   fasta scores: E(): 1e-63, 40.59% id in 468 aa, and to
FT                   Bacteroides thetaiotaomicron L-fuculose kinase FucK or
FT                   BT1275 SWALL:Q9RQ11 (EMBL:AF137263) (476 aa) fasta scores:
FT                   E(): 3.9e-138, 68.87% id in 469 aa, and to Bacteroides
FT                   thetaiotaomicron L-fuculose kinase FucK or BT1275
FT                   SWALL:AAO76382 (EMBL:AF137263) (476 aa) fasta scores: E():
FT                   3.9e-138, 68.87% id in 469 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05991"
FT                   /db_xref="GOA:Q5LIN5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN5"
FT                   /protein_id="CAH05991.1"
FT                   /translation="MSTYLAADFGGGSGRIMAGTLTEGKLKLEEVYRFANRQIKLGNCV
FT                   YWDFLSLFEEMKNGLRVAARKGYEVKSMAIDTWGVDFGLIDKDGKLLGNPVCYRDSRTD
FT                   GIPERVFKQIDQTVHYAETGIQVMPINTLFQLYSMKQNDDVQLRVADKLLFMPDLFSYF
FT                   LTGVANNEYCIASTSELLDARQRNWSDNLISELGLPRQLFGEIVFPGTVRGKLKQEIAD
FT                   ETGLGCINVVAVGSHDTASAVFAVPSNEPNRAYLSSGTWSLLGAEVDQPILTEEARVAG
FT                   FTNEGGIQGKIRFLQNITGLWILQRLMAEWKEQGKEISYDCAIAEATVSDIRSVIDVDD
FT                   SAFCNPDHMEESIIKYCHKHHLRTPVSQGEFVRCVIESLAYRYKLGVEQMNRCLPAPVK
FT                   QLHIIGGGCQNRLLNQLTANALGIPVYAGPVEATAIGNILVQAKAQGEVDSWEELKEII
FT                   INSVEPQVYYPE"
FT   misc_feature    231745..232473
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, N-terminal domain, score 8.3, E-value
FT                   1e-09"
FT   misc_feature    232840..233013
FT                   /note="Pfam match to entry PF02782 FGGY_C, FGGY family of
FT                   carbohydrate kinases, C-terminal domain, score 26.6,
FT                   E-value 1.9e-07"
FT   CDS_pept        233163..234494
FT                   /transl_table=11
FT                   /gene="fucP"
FT                   /locus_tag="BF9343_0213"
FT                   /old_locus_tag="BF0215"
FT                   /product="putative L-fucose permease"
FT                   /note="Similar to Escherichia coli L-fucose permease FucP
FT                   or B2801 SWALL:FUCP_ECOLI (SWALL:P11551) (438 aa) fasta
FT                   scores: E(): 1.9e-46, 35.08% id in 419 aa, and to
FT                   Bacteroides thetaiotaomicron L-fucose permease FucP or
FT                   BT1277 SWALL:Q9RQ10 (EMBL:AF137263) (438 aa) fasta scores:
FT                   E(): 5.9e-141, 82.56% id in 436 aa, and to Bacteroides
FT                   thetaiotaomicron L-fucose permease FucP or BT1277
FT                   SWALL:AAO76384 (EMBL:AF137263) (438 aa) fasta scores: E():
FT                   5.9e-141, 82.56% id in 436 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05992"
FT                   /db_xref="GOA:Q5LIN4"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN4"
FT                   /protein_id="CAH05992.1"
FT                   /translation="MKNTNRSILHKDGVSYILPFILVTSCFALWGFANDITNPMVKAFS
FT                   KIFRMSVTDGALVQVAFYGGYFAMAFPAAMFIRKYSYKAGILLGLGLYALGALLFFPAK
FT                   MTGDYYPFLLAYFILTCGLSFLETSANPYILSMGTEETATRRLNLAQSFNPMGSLLGMY
FT                   VAMNFIQARLNPMDTVERSQLSPAEFEVLKESDLSVLIAPYLIIGLVILAMLFVIRAVK
FT                   MPKNGDKNHNIDFIPTLKRIFKIPHYREGVIAQFFYVGAQIMCWTFVIQYGTRLFMSQG
FT                   MEEKAAEVLSQEYNIIAMIIFCISRFVCTFILRYLNPGMLLKILAIAGGAFTLGVIFLQ
FT                   DIWGLYCLVAVSACMSLMFPTIYGIALRGLGDDAKFGAAGLIMAILGGSVLPPLQACII
FT                   DQHTLLGMPAVNLSFILPFICFVVIIIYGHRTCARVKKIKAERG"
FT   misc_feature    order(233199..233258,233325..233393,233412..233471,
FT                   233499..233567,233601..233669,233757..233825,
FT                   233916..233984,234042..234110,234123..234191,
FT                   234204..234272,234291..234359,234372..234440)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BF0215 by TMHMM2.0 at aa 13-32, 55-77, 84-103, 113-135,
FT                   147-169, 199-221, 252-274, 294-316, 321-343, 348-370,
FT                   377-399 and 404-426"
FT   CDS_pept        235211..235678
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0214"
FT                   /old_locus_tag="BF0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3402 SWALL:AAO78508 (EMBL:AE016940)
FT                   (155 aa) fasta scores: E(): 1.9e-50, 89.03% id in 155 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein Pa4746
FT                   SWALL:Q9HV53 (EMBL:AE004888) (152 aa) fasta scores: E():
FT                   0.00019, 34.78% id in 92 aa, and to Ralstonia solanacearum
FT                   hypothetical protein RSC1287 or RS02964 SWALL:Q8XZV8
FT                   (EMBL:AL646063) (162 aa) fasta scores: E(): 0.00027, 29.48%
FT                   id in 156 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05993"
FT                   /db_xref="GOA:Q5LIN3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIN3"
FT                   /protein_id="CAH05993.1"
FT                   /translation="MIEKRTVCQIVEEWLEDKDYFLVEVTVSPDDKIVVEIDHAEGVWI
FT                   EDCVELSRFIESKLNREEEDYELEVGSAGIGQPFKVLQQYYNHIGLEVEVLTKGGRKLS
FT                   GVLKDADEEKFVVTVQKKVKPEGAKRPQLVEEDETFTYDDIKYTKYLISFK"
FT   misc_feature    235238..235660
FT                   /note="Pfam match to entry PF02576 DUF150, Uncharacterised
FT                   BCR, YhbC family COG0779, score 41.1, E-value 2.2e-09"
FT   CDS_pept        235681..236943
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0215"
FT                   /old_locus_tag="BF0218"
FT                   /product="putative N utilization substance protein A"
FT                   /note="Similar to Bacillus subtilis N utilization substance
FT                   protein A homolog NusA SWALL:NUSA_BACSU (SWALL:P32727) (371
FT                   aa) fasta scores: E(): 3.6e-37, 35.75% id in 358 aa, and to
FT                   Bacteroides thetaiotaomicron putative nitrogen utilization
FT                   substance protein BT3403 SWALL:AAO78509 (EMBL:AE016940)
FT                   (439 aa) fasta scores: E(): 1.4e-145, 98.32% id in 418 aa,
FT                   and to Bradyrhizobium japonicum N-utilization substance
FT                   protein A NusA or BLL0785 SWALL:BAC46050 (EMBL:AP005937)
FT                   (536 aa) fasta scores: E(): 3.2e-40, 31.46% id in 429 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05994"
FT                   /db_xref="GOA:Q5LIN2"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN2"
FT                   /protein_id="CAH05994.1"
FT                   /translation="MAKKEETISLIDTFSEFKELKNIDRTTMVSVLEESFRSVIAKMFG
FT                   TDENYDVIVNPDKGDFEIWRNREVVADEDLTNPNMQISLTEAQKIDASYEVGEEVTDEV
FT                   IFAKFGRRAILNLRQTLASKILELEKDSIYNKYIDKVGTIINAEVYQIWKKEMLLLDDE
FT                   GNELLLPKTEQIPSDFYRKGETARAVVARVDNKNNNPKIILSRTSPVFLQRLFEMEVPE
FT                   INDGLITIKKIARIPGERAKIAVESYDDRIDPVGACVGVKGSRIHGIVRELRNENIDVI
FT                   NYTSNISLFIQRALSPAKISSIRLNEEERKAEVFLKPEEVSLAIGKGGLNIKLASMLTE
FT                   YTIDVFRELDENAQDEDIYLDEFRDEIDGWVIDAIKAIGIDTAKSVLNAPREMLIEKTD
FT                   LEEETVDEVLRILKSEFEDNE"
FT   misc_feature    236617..236766
FT                   /note="Pfam match to entry PF00013 KH, KH domain, score
FT                   23.9, E-value 0.00033"
FT   CDS_pept        237064..240111
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0216"
FT                   /old_locus_tag="BF0219"
FT                   /product="putative translation initiation factor IF-2"
FT                   /note="Similar to Salmonella typhimurium translation
FT                   initiation factor IF-2 InfB or STM3286 SWALL:IF2_SALTY
FT                   (SWALL:Q9ZF31) (892 aa) fasta scores: E(): 7.8e-82, 41.81%
FT                   id in 916 aa, and to Bacteroides thetaiotaomicron
FT                   translation initiation factor IF-2 BT3404 SWALL:AAO78510
FT                   (EMBL:AE016940) (1040 aa) fasta scores: E(): 1.5e-177,
FT                   81.6% id in 1049 aa, and to Chlorobium tepidum translation
FT                   initiation factor IF-2 InfB or CT0241 SWALL:IF2_CHLTE
FT                   (SWALL:Q8KFT1) (914 aa) fasta scores: E(): 4.9e-92, 42.74%
FT                   id in 1020 aa. CDS truncated at the N-terminus relative to
FT                   the Salmonella IF2"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05995"
FT                   /db_xref="GOA:Q5LIN1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIN1"
FT                   /protein_id="CAH05995.1"
FT                   /translation="MTIRLNKVTRDLNVGIATVVEFLQKKGYTVEANPNTKITEEQYAM
FT                   LVKEFSTDKNLRLESERFIQERQNKDRNKASVSIDGYDKKEPEKTVADDVIKTVIPEDV
FT                   RPKFKPVGKIDLDKLNRKVEKEPVKEEPKPQPVAAEEKKVAEEVKPVVNEVKKEEVTVT
FT                   PATSEPKPVKEEPKPVVVEKPVETEKKVVEEVKKEEPKVVVSPEKTEKKEEKPVAEAPV
FT                   TPVEKEEEGVFKIRPTEFVSKINVIGQIDLAALNQSTRPKKKSKEEKRKEREEKEKLRQ
FT                   DQKKQMKEAIIKEIRKEDSKQAKVVGKENLDPNGKKKRNRINNNKEKVDVNNVASNFAH
FT                   PTPNSERTNNNRGGNQQGGGGQNRNRNNNNKDRFKKPVVKQEVSEEDVAKQVKETLARL
FT                   TSKGKNKGAKYRKEKRDMASNRMQELEDQEMAESKVLKLTEFVTANELASMMNVSVNQV
FT                   IGTCMSIGMMVSINQRLDAETINLVAEEFGFKTEYVSAEVAQAIVEEEDAPEDLEHRAP
FT                   IVTVMGHVDHGKTSLLDYIRKANVIAGEAGGITQHIGAYHVTLEDGRKITFLDTPGHEA
FT                   FTAMRARGAKVTDIAIIIVAADDDVMPQTKEAINHAAAAGVPIVFAINKIDKPHANPEK
FT                   IKETLAQMNYLVEEWGGKYQSQDISAKKGLGVPELMEKVLLEAEMLDLKANPNRNATGS
FT                   IIESTLDKGRGYVATVLVSNGTLKVGDIVLAGTSYGRVKAMFNERNQRVAQAGPSEPVL
FT                   ILGLNGAPAAGDTFHVIETDQEAREIANKREQLQREQGLRTQKLLTLDEVGRRIALGNF
FT                   QELNVIVKGDVDGSIEALSDSLIKLSTEQIQVNVIHKAVGQISESDVTLAAASDAIIIG
FT                   FQVRPSASARKFAEQEGVDIRLYSVIYAAIEEVKAAMEGMLAPEVKEVVTATIEVREVF
FT                   HITKVGTVAGAVVKEGKVKRSDKARLIRDGIVIFSGSINALKRFKDDVKEVGTNFECGI
FT                   SLVNYNDLKVGDMIETYEEVEVKQTL"
FT   misc_feature    238378..238533
FT                   /note="Pfam match to entry PF04760 IF2_N, Translation
FT                   initiation factor IF-2, N-terminal region, score 50.0,
FT                   E-value 4.5e-12"
FT   misc_feature    238603..239109
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 176.5, E-value 3.7e-50"
FT   misc_feature    238630..238653
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    239170..239367
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 62.8, E-value 6.3e-16"
FT   misc_feature    239863..240075
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 33.5, E-value 4.2e-07"
FT   CDS_pept        240186..240689
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0217"
FT                   /old_locus_tag="BF0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3405 SWALL:AAO78511 (EMBL:AE016940)
FT                   (176 aa) fasta scores: E(): 4e-50, 83.13% id in 166 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05996"
FT                   /db_xref="GOA:Q5LIN0"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIN0"
FT                   /protein_id="CAH05996.1"
FT                   /translation="MTTIDIIILIALGAGVIVGFMKGFIRQLASILGLIVGLLAAKALY
FT                   TSLAVKLCPTVTDSMTVAQILAFIIIWIAVPLIFTLVASVLTKALEAVSLGWLNRMLGA
FT                   GLGALKYLLLVSLVICVIQFIDSDSQLISQTKKEQSLLYYPMESFAGIFFPAAKEVTQQ
FT                   YIFK"
FT   misc_feature    240192..240662
FT                   /note="Pfam match to entry PF02674 Colicin_V, Colicin V
FT                   production protein, score 74.1, E-value 2.5e-19"
FT   misc_feature    order(240195..240248,240267..240335,240363..240431,
FT                   240492..240560,240603..240656)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BF0220 by TMHMM2.0 at aa 4-21, 28-50, 60-82, 103-125 and
FT                   140-157"
FT   CDS_pept        240692..242149
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0218"
FT                   /old_locus_tag="BF0221"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="Similar to Escherichia coli predicted ABC
FT                   transporter SufB protein or B1683 SWALL:SUFB_ECOLI
FT                   (SWALL:P77522) (495 aa) fasta scores: E(): 2.3e-124, 61.72%
FT                   id in 499 aa, and to Bacteroides thetaiotaomicron ABC
FT                   transporter permease BT3406 SWALL:AAO78512 (EMBL:AE016940)
FT                   (484 aa) fasta scores: E(): 4.8e-194, 98.14% id in 484 aa,
FT                   and to Rhizobium meliloti hypothetical protein R01735 or
FT                   SMC00530 SWALL:Q92PK9 (EMBL:AL591788) (489 aa) fasta
FT                   scores: E(): 1.9e-141, 69.95% id in 486 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05997"
FT                   /db_xref="GOA:Q5LIM9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM9"
FT                   /protein_id="CAH05997.1"
FT                   /translation="MMQQEEPNKYVKELTQEKYKYGFTTEVHTDIIEKGLNEDVVRLIS
FT                   SKKNEPEWLLEFRLKAYRHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDE
FT                   VDPELIKTFNKLGIPLEEQMALSGMAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVR
FT                   EHPDLVKKYLGSVVGYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTG
FT                   QFERTLIVADDDSYVSYLEGCTAPMRDENQLHAAIVEIMVHDRAEVKYSTVQNWYPGDA
FT                   EGKGGVYNFVTKRGNCKGVDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTN
FT                   NYQQADTGTKMIHLGKNTRSTIVSKGISAGKSENSYRGLVRVAEKADNARNYSQCDSLL
FT                   LGDKCGAHTFPYMDIHNETAVVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAK
FT                   EVLNKLPMEFAVEAQKLLTISLEGSVG"
FT   misc_feature    241337..242059
FT                   /note="Pfam match to entry PF01458 UPF0051, Uncharacterized
FT                   protein family (UPF0051), score 464.7, E-value 6.5e-137"
FT   CDS_pept        242149..242895
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0219"
FT                   /old_locus_tag="BF0222"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05998"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM8"
FT                   /protein_id="CAH05998.1"
FT                   /translation="MKTKRVGWLLIFLSYVGVVLAQNLDDQERRWAISGSWGGNWPIVT
FT                   KNTLSGKAVSAGHIHTLMLEYYIPYTRFSLKGGYTGEEIGLNPGISASMSNLEIGGRYY
FT                   FLPQRFAIQPYGGLSTGWNLSPRRQEGMGSSSYYDPSRQEFRKDYDYRYRIKEPLFTVS
FT                   PVVGADIYFLSCLALTLEYNFRMGIAGKISGEIEKTNSRGTGFVRSNGMRQTVSVGVKV
FT                   NFPFTITQTDGNSILQWLDEVIFGKE"
FT   misc_feature    242149..242211
FT                   /note="Signal peptide predicted for BF0222 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.998 between residues 21 and 22"
FT   misc_feature    242308..242340
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   misc_feature    242326..242358
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT   CDS_pept        242919..243671
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0220"
FT                   /old_locus_tag="BF0223"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to Escherichia coli probable ATP-dependent
FT                   transporter SufC or B1682 SWALL:SUFC_ECOLI (SWALL:P77499)
FT                   (248 aa) fasta scores: E(): 1.5e-50, 61.13% id in 247 aa,
FT                   and to Bacteroides thetaiotaomicron ABC transporter
FT                   ATP-binding protein BT3407 SWALL:Q8A298 (EMBL:AE016940)
FT                   (250 aa) fasta scores: E(): 1.3e-83, 98.4% id in 250 aa,
FT                   and to Ceratium horridum putative ATP-dependent transporter
FT                   YCF16 SWALL:AAO85447 (EMBL:AF490364) (263 aa) fasta scores:
FT                   E(): 3.4e-57, 68.54% id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAH05999"
FT                   /db_xref="GOA:Q5LIM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM7"
FT                   /protein_id="CAH05999.1"
FT                   /translation="MLEIKDLHASINGKEILKGINLTVKPGEVHAIMGPNGSGKSTLSS
FT                   VLVGNPAFEVTKGSITFYGKNLLELSPEDRSHEGIFLSFQYPVEIPGVSMVNFMRAAVN
FT                   EQRKYKGLPALTASEFLKLMREKRAVVELDNKLANRSVNEGFSGGEKKRNEIFQMAMLE
FT                   PRLSILDETDSGLDIDALRIVAEGVNKLKTPDTSCIVITHYQRLLDYIKPDIVHVLYKG
FT                   RIVKTAGPELALELEEKGYDWIKKELGE"
FT   misc_feature    242997..243584
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 105.0, E-value 1.3e-28"
FT   misc_feature    243018..243041
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        243668..245023
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0221"
FT                   /old_locus_tag="BF0224"
FT                   /product="putative ABC transporter protein"
FT                   /note="Similar to Erwinia chrysanthemi ABC transporter SufD
FT                   protein SWALL:Q9EXP3 (EMBL:AJ301654) (430 aa) fasta scores:
FT                   E(): 5.3e-25, 29.8% id in 416 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein, putative
FT                   ABC transporter permease component BT3408 SWALL:AAO78514
FT                   (EMBL:AE016940) (447 aa) fasta scores: E(): 2.2e-167,
FT                   91.72% id in 447 aa, and to Bradyrhizobium japonicum
FT                   Blr4341 protein SWALL:BAC49606 (EMBL:AP005950) (434 aa)
FT                   fasta scores: E(): 3.8e-36, 32.01% id in 431 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06000"
FT                   /db_xref="GOA:Q5LIM6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM6"
FT                   /protein_id="CAH06000.1"
FT                   /translation="MSLIMNAEQQYIDLFSQCEAMICRHSAEALNAPRATAFADFERQG
FT                   FPTRKQEKYKYTDVSKFFEPDYGLNLNRLPIPVNPYEVFKCDVPNMSTSLFFVVNDAFY
FT                   NQALPKSGLPEGVIFGSLRNMAEQHPELVKKYYGKLADTSKDAVTAFNTAFAQDGVLMY
FT                   VPKNVIVDRPIQLVNILRADVNFMVNRRVLIILEEGAQARLLICDHAMDNVNFLATQVI
FT                   EVFAEENSVFDLYELEETHTSTVRFSNLYVKQGANSNVLLNGMTLHNGTTRNTTEVTLA
FT                   GEGAEINLCGMAIADKNQHVDNNTSIDHAVPNCTSNELFKYVLDDQSVGAFAGLVLVRP
FT                   DAQHTSSQQTNRNLCATRDARMYTQPQLEIYADDVKCSHGATVGQLDENALFYMRARGI
FT                   AEKEARLLLMFAFVNEVIDTIRLEALKDRLHLLVEKRFRGELNKCQGCSICK"
FT   misc_feature    244208..244903
FT                   /note="Pfam match to entry PF01458 UPF0051, Uncharacterized
FT                   protein family (UPF0051), score 133.1, E-value 4.4e-37"
FT   CDS_pept        245035..246246
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0222"
FT                   /old_locus_tag="BF0225"
FT                   /product="putative aminotransferase"
FT                   /note="Similar to Erwinia chrysanthemi cysteine desulfurase
FT                   SufS SWALL:Q9EXP2 (EMBL:AJ301654) (412 aa) fasta scores:
FT                   E(): 6.8e-79, 50% id in 402 aa, and to Bacteroides
FT                   thetaiotaomicron aminotransferase, putative cysteine
FT                   desulfurase BT3409 SWALL:Q8A296 (EMBL:AE016940) (403 aa)
FT                   fasta scores: E(): 7.3e-138, 87.59% id in 403 aa, and to
FT                   Nitrosomonas europaea aminotransferase class-V NE1447
FT                   SWALL:CAD85358 (EMBL:BX321861) (422 aa) fasta scores: E():
FT                   7.5e-92, 57.85% id in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06001"
FT                   /db_xref="GOA:Q5LIM5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM5"
FT                   /protein_id="CAH06001.1"
FT                   /translation="MNIHKIREDFPILSRTVYGKPLVYLDNGATTQKPRLVIDSIVDEY
FT                   YSVNANVHRGVHFLSQQATELHEASRETVRQFINARSTREVIFTRGTTESINLIVSSFG
FT                   EEFMQEGDEVIVSVMEHHSNIVPWQLLAARKGIAIKVIPMNDKGELLLEEYENLFSERT
FT                   KIVSVTQVSNVLGTINPVKEMIATAHAHGVPVMIDGAQSIPHMKVDVQDLDADFFVFSG
FT                   HKIYGPTGIGVLYGKEDWLERLPPYQGGGEMIQSVSFEKTVFGELPFKFEAGTPDYIAT
FT                   TGLAKALDYVTGIGLDPIALHEHELTVYAMQRLKEIPNMRIFGEAEHKSSVISFLVGDI
FT                   HHLDLGTLLDRLGIAVRTGHHCAEPLMRRLGIEGTVRASFAVYNTKEEVDALVAGIERV
FT                   SKMF"
FT   misc_feature    245143..246210
FT                   /note="Pfam match to entry PF00266 aminotran_5,
FT                   Aminotransferase class-V, score 58.3, E-value 1.4e-14"
FT   CDS_pept        246538..246858
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0223"
FT                   /old_locus_tag="BF0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3410 SWALL:AAO78516 (EMBL:AE016940)
FT                   (107 aa) fasta scores: E(): 1.2e-29, 84.9% id in 106 aa,
FT                   and to Salmonella typhimurium, and Salmonella typhi
FT                   hypothetical protein YbjQ or STM0930 or STY0926 or t2003
FT                   SWALL:YBJQ_SALTY (SWALL:Q8XGV2) (107 aa) fasta scores: E():
FT                   1e-22, 63.1% id in 103 aa, and to Salmonella typhimurium,
FT                   and Salmonella typhi hypothetical protein YbjQ or STM0930
FT                   or STY0926 or t2003 SWALL:AAO69615 (EMBL:AE008739) (107 aa)
FT                   fasta scores: E(): 1e-22, 63.1% id in 103 aa, and to
FT                   Escherichia coli, Escherichia coli O6, and Escherichia coli
FT                   O157:H7 hypothetical protein YbjQ or B0866 or C0999 or
FT                   Z1099 or ECS0952 SWALL:YBJQ_ECOLI (SWALL:P75819) (107 aa)
FT                   fasta scores: E(): 1.6e-22, 63.1% id in 103 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06002"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIM4"
FT                   /protein_id="CAH06002.1"
FT                   /translation="MLLATTPIIEGKRITTYYGIVSGETIIGANVFRDFFASIRDIVGG
FT                   RSGSYEEVLREAKDTALKEMSEQARQMGANAVIGVDLDYETVGGSGSMLMVTASGTAVF
FT                   LE"
FT   misc_feature    246538..246855
FT                   /note="Pfam match to entry PF01906 DUF74, Domain of unknown
FT                   function DUF74, score 201.6, E-value 1e-57"
FT   CDS_pept        complement(246933..248525)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0224"
FT                   /old_locus_tag="BF0227"
FT                   /product="putative exported alpha-galactosidase"
FT                   /note="Similar to Coffea arabica alpha-galactosidase
FT                   precursor SWALL:AGAL_COFAR (SWALL:Q42656) (378 aa) fasta
FT                   scores: E(): 3.1e-31, 39.13% id in 368 aa, and to
FT                   Bacteroides thetaiotaomicron alpha-galactosidase precursor
FT                   BT4157 SWALL:AAO79262 (EMBL:AE016944) (606 aa) fasta
FT                   scores: E(): 1.5e-105, 49.22% id in 518 aa, and to
FT                   Bacteroides thetaiotaomicron alpha-galactosidase precursor
FT                   BT2662 SWALL:AAO77769 (EMBL:AE016937) (507 aa) fasta
FT                   scores: E(): 1.2e-90, 48.52% id in 509 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06003"
FT                   /db_xref="GOA:Q5LIM3"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM3"
FT                   /protein_id="CAH06003.1"
FT                   /translation="MKKKKVTTYCCLLLLASFFTTVTAQNTNTPMMGWSSWNTFRVHIN
FT                   EELIKETADAMVNRGLKDVGYGYVNIDDGYFGGRNSEGRLFANKKKFPNGMRVLSDYIH
FT                   SKGLKAGIYSDAGSNTCGSIYDADTLGIGVGLWKHDDIDCQTFLKDWGYDFIKIDWCGG
FT                   EATGQSEQQRYTDIYKAIRRTGRTDVRYNICRWQFPGTWATQLAGSWRIHTDINPRFTT
FT                   IDRIIERNLYLAPYASPGHYNDMDMLEVGRGLTEDEEKTHFGIWSILSSPLMIGCDLRT
FT                   IPEKTLSIITNKEVIALNQDSLGLQAEAIERGKDYLILSKAIQKREGKLRAVALYNRSN
FT                   TDQQIRVDFDKLYLSGDVRVRDLWNHQEMGTFTDYYETLVPAHGTALIRLEGSKRHDRT
FT                   CYEAEYAFMQEFLPDNKQAAHFTPKSGASGEYIMKNLGNSPSNWAEFRNVYISKGGDYQ
FT                   LKLTYYSGDKRDIQIAVNGTEYKQSNLYSGTWDQAATTTIKVKLRTGYNTIRLYNSYGW
FT                   APDIDKMEIIKGR"
FT   misc_feature    complement(246942..247277)
FT                   /note="Pfam match to entry PF03422 CBM_6, Carbohydrate
FT                   binding module (family 6), score -1.3, E-value 0.0035"
FT   misc_feature    complement(247512..248507)
FT                   /note="Pfam match to entry PF02065 Melibiase, Melibiase,
FT                   score -49.9, E-value 2.5e-11"
FT   misc_feature    complement(248454..248507)
FT                   /note="1 probable transmembrane helix predicted for BF0227
FT                   by TMHMM2.0 at aa 7-24"
FT   misc_feature    complement(248454..248525)
FT                   /note="Signal peptide predicted for BF0227 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.942 between residues 24 and 25"
FT   CDS_pept        complement(248617..250461)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0225"
FT                   /old_locus_tag="BF0228"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   outer membrane protein, probably involved in nutrient
FT                   binding BT2858 SWALL:AAO77964 (EMBL:AE016937) (646 aa)
FT                   fasta scores: E(): 2.6e-44, 36.5% id in 652 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT2904
FT                   SWALL:AAO78010 (EMBL:AE016938) (640 aa) fasta scores: E():
FT                   6.1e-44, 34.38% id in 666 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT3013 SWALL:AAO78119
FT                   (EMBL:AE016938) (644 aa) fasta scores: E(): 3.4e-39, 35.84%
FT                   id in 664 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06004"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM2"
FT                   /protein_id="CAH06004.1"
FT                   /translation="MKLKNIIVALLIGASLHSCDYLDIVPDDTPILADAFKNEQTAENF
FT                   VFACYSFIPNYLNFRQNFSWCTTPETVGSAHWTTTWFTFMRMQQGLYNSADPIIDVWQS
FT                   SYNGIRQCYTFLDNIDDVKPSQISEADLAAKKVLWKGEVKFLIAYYHYLLLQNYGPIVI
FT                   LDEAIPLNAPKEELFKPRVPYDECVSRIAQMFDNASADLPMTVKASNYGRATKVIAQAL
FT                   KARMYLYAASPQFNGNADMYKNFKNKDGQLLMNLTYDKNKWKTAMDECKKAIDMAHQAG
FT                   AELYKYTKKGNLPEFNQAIANARNLVVDAWNKELIWGYSGWKETWADGNSIQTHVIPKG
FT                   ISTSSGAPYGALGATAFSADMYLTKNGLPIDEDPEFDYAHRFTVAEGDSVAVLHRNREP
FT                   RFYGSIGFNRGDYLINGDTINLKMRFKEQNGTRDAGSDQLYGSYAIAKLAHPETFVSGT
FT                   SNSLVAFPFPIIRLGELYLDYAEAYFEYNGTLEGDALTYFNLIRQRAGIPNVEVSYKGL
FT                   PSGDKLREVIHRERTIELMFEGHMSYDYRRWLIALKEWSGMENGMIGLNSYGTTNEEYY
FT                   KNARLDAQPFIFRDEQYLSPIKQDYLNVNSNLVQNPGW"
FT   misc_feature    complement(250408..250461)
FT                   /note="Signal peptide predicted for BF0228 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.966) with cleavage site
FT                   probability 0.956 between residues 18 and 19"
FT   CDS_pept        complement(250476..253874)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0226"
FT                   /old_locus_tag="BF0229"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Bacteroides fragilis FrrG SWALL:Q8VTA9
FT                   (EMBL:AF329100) (1137 aa) fasta scores: E(): 1.5e-44,
FT                   27.16% id in 1178 aa, and to Bacteroides thetaiotaomicron
FT                   putative outer membrane protein, probably involved in
FT                   nutrient binding BT3012 SWALL:AAO78118 (EMBL:AE016938)
FT                   (1125 aa) fasta scores: E(): 6.4e-178, 43.82% id in 1125
FT                   aa, and to Bacteroides thetaiotaomicron putative outer
FT                   membrane protein, probably involved in nutrient binding
FT                   BT2905 SWALL:AAO78011 (EMBL:AE016938) (1067 aa) fasta
FT                   scores: E(): 2.3e-150, 43.62% id in 1043 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06005"
FT                   /db_xref="GOA:Q5LIM1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM1"
FT                   /protein_id="CAH06005.1"
FT                   /translation="MKKKAIPCHKAGRITSFFLLISIFLLIPSITTPVYAVETYTQQTV
FT                   FTLHATNKTVKEVFEYIEKNSEFVVLYSKDLLPVLQKKVSVSIDKQNVESILNILSKEA
FT                   GLKYNINDRQITITKATAEAPQQEKKIKITGQVLDENGEGIPGANIVIKGNSTLGTVTN
FT                   VEGNFTLMAPENSTLVASFIGYTPVEILLKGKKIVVFKLVPDAQSLEEVVVVGFGTQKK
FT                   ASVVGAVQSIKPAELRVPSSNLSTSFAGRIAGVISMQRTGEPGADGANFWIRGAATFSG
FT                   TTDPLIFIDGVEVSAGDMNAIPSEAIENFSILKDASATALYGARGANGVILITTRTGKD
FT                   LEKARINVRIDNTFTAPTRTLKLADAVTAMKLRNEAILTRNPDGTPAFSDDKIQGTLEG
FT                   RNQYVYPNVDWFDYMFKDYSMNQSANLNVMGGTKKVDYFISASINNDNGMLKKDPNNTF
FT                   DNNIQNLRYSFQSNVGAWLTSSTKVNVRINSQIVNYNGPSTSMDDLYKYVMEAPSMYFA
FT                   PVYPNINREDHTIFGNKSGGPIGSGGFSIYRNPYASMVQGSSKQSAYTINTAFELEQKL
FT                   DFLTKGLNFKALVSFKNWSKTTVNRSFSPYFYELQNPQEQEDGSYLYDYNSISKGRTAL
FT                   ETSTSTTGDRLMNLQATLNYQRMFGDKHDVGAMLVYLQREYNLNNPDNNYYNTLPERNQ
FT                   GLAGRVTYAYDGRYLAEFNFGYNGSENFEKGSRYGFFPSLAVGYLISNEKFFEPLTKVI
FT                   SNLKIRASYGLVGNADIGSNRFPYLTKVDLGGAGFVFGDQWQTSSNGATITTYGAEKVT
FT                   WEIGKKYNVGFDLGLFNKLSLNVDFFREDRKDIFLRRNTIPAESGITGDLRPYGNLGKV
FT                   RNQGVDMSLDYNHAVSKDFMISAKGTFTYAKNQYMEIDEPDYEYAYMSQVGRPLNQYKG
FT                   YIALGLFKDQEEIDNSPKQILTGVVQPGDIKYADLNNDGKIDGNDQTYIGNPELPQISY
FT                   GLGVSIQYKKWDASIFFQGVGKRSIMLSDIHPFGGESYGVMQFVADNHWTEANPNPEAM
FT                   YPRLTNGKNNNNNPNSTYWLRDGSYIRLKNVELGYSYKFLRAYISGQNLLTFSKFKLWD
FT                   PELYTSNGLKYPTQIMGSIGLQFTF"
FT   misc_feature    complement(251541..251591)
FT                   /note="PS00237 G-protein coupled receptors signature."
FT   misc_feature    complement(253770..253838)
FT                   /note="1 probable transmembrane helix predicted for BF0229
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(253890..254021)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0227"
FT                   /old_locus_tag="BF0230"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIM0"
FT                   /protein_id="CAH06006.1"
FT                   /translation="MFNLKKHTLLCRKKADKKRKSDNTPILSDSNDFLLNHKLLMIN"
FT   CDS_pept        complement(254040..255188)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0228"
FT                   /old_locus_tag="BF0231"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Bacteroides fragilis regulatory cluster
FT                   gene FrrF SWALL:Q8VTB0 (EMBL:AF329100) (336 aa) fasta
FT                   scores: E(): 2.1e-18, 34.27% id in 213 aa, and to
FT                   Bacteroides thetaiotaomicron putative anti-sigma factor
FT                   BT4635 SWALL:AAO79740 (EMBL:AE016946) (404 aa) fasta
FT                   scores: E(): 3.2e-36, 35.26% id in 346 aa, and to
FT                   Bacteroides thetaiotaomicron putative anti-sigma factor
FT                   BT3518 SWALL:AAO78624 (EMBL:AE016941) (400 aa) fasta
FT                   scores: E(): 6e-30, 33.73% id in 329 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06007"
FT                   /db_xref="GOA:Q5LIL9"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL9"
FT                   /protein_id="CAH06007.1"
FT                   /translation="MRKNKFKSFASRLNKDGDHPEKISFESPEEQAEYDKLDFLWNRCL
FT                   PEETGEPDIWAKVQAKINADNTPVRLALKSNKTARLFSILKYSAVAASVALLIGAGCFL
FT                   LLNDEERHDLNKIAQSLQTEIPQDIKEVTLVVSDQKKIELDNNAQIVYSATGQVQVNSN
FT                   KLVEDDIKEEYNQIIVPKGKRSQIVLADNSKIWINSGSKVIYPRAFEGKYREIYVEGEV
FT                   YLNVTHDTSKPFIVNTSGFEVRVLGTSFNISAYKNQEKAAVVLVEGSVNVKDQQNHHIK
FT                   MVPNEKVELNQEGISGKEKVNARDYISWIDGIWTLQGESLKQVLLRLQDYYGQNIRCDA
FT                   EIENEQMFGKLFLNDDLNQVMKSILSILPAEYTMKNNVIYIE"
FT   misc_feature    complement(254163..254651)
FT                   /note="Pfam match to entry PF04773 FecR, FecR protein,
FT                   score 28.1, E-value 4.6e-08"
FT   misc_feature    complement(254871..254939)
FT                   /note="1 probable transmembrane helix predicted for BF0231
FT                   by TMHMM2.0 at aa 84-106"
FT   CDS_pept        complement(255275..255838)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0229"
FT                   /old_locus_tag="BF0232"
FT                   /product="putative ECF-type sigma factor"
FT                   /note="Similar to Bacteroides fragilis ECF-type sigma
FT                   factor RpoE SWALL:Q8VTB1 (EMBL:AF329100) (187 aa) fasta
FT                   scores: E(): 1.5e-11, 28.65% id in 171 aa, and to
FT                   Bacteroides thetaiotaomicron RNA polymerase ECF-type sigma
FT                   factor BT2169 SWALL:AAO77276 (EMBL:AE016935) (182 aa) fasta
FT                   scores: E(): 2.5e-12, 30.9% id in 165 aa, and to
FT                   Bacteroides thetaiotaomicron RNA polymerase ECF-type sigma
FT                   factor BT1877 SWALL:AAO76984 (EMBL:AE016933) (196 aa) fasta
FT                   scores: E(): 3.3e-11, 28.96% id in 183 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06008"
FT                   /db_xref="GOA:Q5LIL8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL8"
FT                   /protein_id="CAH06008.1"
FT                   /translation="MVTITLYMNNNIEYISKIKKGEETSFRHFVNSYSKDLFYYAQCFV
FT                   RSKETAEEVVSDVFLDVWRHREEIDEIKNIKAWLLTLTHNKAISYLRKAENSSEIASWE
FT                   EIDDFQIIGNLQTPDEEMISKEEIAQINSLIQTLPPKCKVVFALAKIERLPYKEIADML
FT                   NISVKTINVHVAKALEIISNGLKK"
FT   misc_feature    complement(255290..255439)
FT                   /note="Pfam match to entry PF04545 sigma70_r4, Sigma-70,
FT                   region 4, score 41.8, E-value 1.3e-09"
FT   misc_feature    complement(255314..255379)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1853.000, SD 5.50 at aa 154-175, sequence
FT                   LPYKEIADMLNISVKTINVHVA"
FT   misc_feature    complement(255548..255754)
FT                   /note="Pfam match to entry PF04542 sigma70_r2, Sigma-70
FT                   region 2, score 53.7, E-value 3.4e-13"
FT   CDS_pept        complement(256048..258207)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0230"
FT                   /old_locus_tag="BF0233"
FT                   /product="putative exported alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /note="Similar to Bacillus stearothermophilus
FT                   alpha-galactosidase AgaA SWALL:Q9ALJ4 (EMBL:AY013286) (729
FT                   aa) fasta scores: E(): 2.2e-65, 32.3% id in 650 aa, and to
FT                   Bacteroides thetaiotaomicron alpha-galactosidase BT3131
FT                   SWALL:AAO78237 (EMBL:AE016939) (718 aa) fasta scores: E():
FT                   2.8e-186, 62.22% id in 720 aa, and to Bacteroides
FT                   thetaiotaomicron alpha-galactosidase BT2851 SWALL:AAO77957
FT                   (EMBL:AE016937) (721 aa) fasta scores: E(): 1.3e-185,
FT                   62.63% id in 720 aa. Note: Also similar to BF0498 (723 aa)
FT                   fasta scores: E(): 9.6e-125, 44.693% identity in 716 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06009"
FT                   /db_xref="GOA:Q5LIL7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL7"
FT                   /protein_id="CAH06009.1"
FT                   /translation="MKKLLATLLILVACIHVNAQESRQIRISTDRTDLILEVAPDGRLY
FT                   QSYLGDRLLNEQDLKNLSGSSRGWEVYPGSGGEDYFEPAVAITNNDGNLSTILRYVSSE
FT                   QKAVEGGTETIIRMKDDQYPVDVTLHYVAYPKQNVIKTWSEIKHQQKKPVVLWRYASTM
FT                   LYFSNQKYYLTEFSSDWAKEVQMSTQQLQPGKKILDTKLGSRAAMHMQPFFELGLEQPA
FT                   QEHQGQVVLGTIGWTGNYQFTFEVDNEGNLRIIPAINPYASDYQLKANETFTTPEFIFT
FT                   LSNNGTGEASRNLHNWARNYQLKDGKGDRMTLLNNWENTYFTFDEELLGKLMKEAKHLG
FT                   VDMFLLDDGWFGNKHPRNDDHAGLGDWEAMKSKLPGGIPALVEKAKEAGVKFGIWIEPE
FT                   MVNPKSDLFETHPEWAIHYPNRETYYFRNQLVLDLSNPKVQDFVFGVVDKIMTENPDVA
FT                   FFKWDCNSPITNIYSPYLKDKQGQLYVDHVRGIYNVLKRVKEKYPNVPMMLCSGGGARC
FT                   DYEALKYFTEFWCSDNTDPVERLFIQWGFSQFFPAKAMCAHVTSWNSKTSVKFRTDVAS
FT                   MCKLGFDIGLKDMKADELTYCQEVVANYKRLKPVILDGDQYRLVSPYDGNHMAVMYTAP
FT                   DASKAVLFTYDIHPRFGEKLLPVKLRGLDAQKMYRVKEINLMPGRKSNLSGNEKIFSGD
FT                   YLMKIGLNAFTTSQTNSRVIELVAE"
FT   misc_feature    complement(256210..257394)
FT                   /note="Pfam match to entry PF02065 Melibiase, Melibiase,
FT                   score 459.3, E-value 2.7e-135"
FT   misc_feature    complement(258151..258207)
FT                   /note="Signal peptide predicted for BF0233 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 19 and 20"
FT   CDS_pept        258451..259005
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0231"
FT                   /old_locus_tag="BF0234"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL6"
FT                   /protein_id="CAH06010.1"
FT                   /translation="MKTGMKLIQGALFVLLFLFAACTPHRRPIPDEMIGEHRIHRADGL
FT                   MTQDYRLSISPVNDSVYDIKLWERKSSSESPEKVYYDGLRFHYRDTVHIFTKRVTSGTE
FT                   TYRVNRRRVTRDKNPRIWYTLKLSSTGFVMSDSLVERKGASDEQHRKLLYKRYGRLTFR
FT                   EGKIIFLNSRCPAFYVKKEEK"
FT   misc_feature    258451..258513
FT                   /note="Signal peptide predicted for BF0234 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.834) with cleavage site
FT                   probability 0.481 between residues 21 and 22"
FT   misc_feature    258484..258516
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        259129..261333
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0232"
FT                   /old_locus_tag="BF0235"
FT                   /product="putative inorganic pyrophosphatase"
FT                   /note="Similar to Brucella suis inorganic pyrophosphatase
FT                   (fragment) but extended at the N-terminus SWALL:Q8VRZ4
FT                   (EMBL:AF417512) (680 aa) fasta scores: E(): 9.2e-66, 43.63%
FT                   id in 715 aa, and to entire Bacteroides thetaiotaomicron
FT                   pyrophosphate-energized vacuolar membrane proton pump
FT                   BT3411 SWALL:AAO78517 (EMBL:AE016940) (734 aa) fasta
FT                   scores: E(): 0, 93.46% id in 734 aa, and to entire
FT                   Acetabularia mediterranea inorganic pyrophosphatase
FT                   SWALL:Q9STC8 (EMBL:D88820) (751 aa) fasta scores: E():
FT                   6.8e-85, 46.5% id in 772 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06011"
FT                   /db_xref="GOA:Q5LIL5"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL5"
FT                   /protein_id="CAH06011.1"
FT                   /translation="MDSILFWLVPFASVLALCFALYFHKQMMKESEGTPQMIKIAAAVR
FT                   RGAMSYLKQQYKIVGWVFLGLVILFSVMAYGFQVQNAWVPIAFLTGGFFSGLSGFLGMK
FT                   TATYASARTANAARTSLNAGLRIAFRSGAVMGLVVVGLGLLDISFWYLLLNWAIPADVL
FT                   TPTHKLCIITTTMLTFGMGASTQALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRN
FT                   PATIADNVGDNVGDVAGMGADLYESYCGSILATAALGAAAFIHTDDTVMQFKAVIAPML
FT                   IAAIGIILSIIGIFSVRTKENATMKDLLGSLAWGTNLSSALIVAVTFFILWLLQLDNWM
FT                   WISCAVVVGLVVGIVIGRSTEYYTSQSYRPTQKLSESGKTGPATVIISGIGLGMLSTAI
FT                   PVVAVVIGIIASYLLASGFDFNNVGMGLYGIGIAAVGMLSTLGITLATDAYGPIADNAG
FT                   GNAEMSSLGKEVRKRTDALDSLGNTTAATGKGFAIGSAALTGLALLASYIEEIRIGLTR
FT                   LGNLVLTFPNGDTISTANATFVDFMNYYEVNLMNPKVLSGMFLGSMMAFLFCGLTMNAV
FT                   GRAAGHMVDEVRRQFREMKGILTGETEPDYERCVAISTKGAQREMVVPSLIAIIAPILT
FT                   GLIFGVPGVLGLLIGGLSSGFVLAIFMANAGGAWDNAKKYVEEGNFGGKGSEVHKATVV
FT                   GDTVGDPFKDTSGPSLNILIKLMSMVAIVMAGLTVAWSLF"
FT   misc_feature    259132..261303
FT                   /note="Pfam match to entry PF03030 H_PPase, Inorganic H+
FT                   pyrophosphatase, score 1005.4, E-value 1.1e-299"
FT   misc_feature    order(259138..259197,259300..259359,259369..259437,
FT                   259522..259590,259633..259701,259858..259926,
FT                   259954..260022,260059..260127,260140..260199,
FT                   260287..260355,260398..260466,260599..260652,
FT                   260788..260856,260992..261051,261061..261129,
FT                   261259..261327)
FT                   /note="16 probable transmembrane helices predicted for
FT                   BF0235 by TMHMM2.0 at aa 4-23, 58-77, 81-103, 132-154,
FT                   169-191, 244-266, 276-298, 311-333, 338-357, 387-409,
FT                   424-446, 491-508, 554-576, 622-641, 645-667 and 711-733"
FT   CDS_pept        261582..262907
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0233"
FT                   /old_locus_tag="BF0237"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06012"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL4"
FT                   /protein_id="CAH06012.1"
FT                   /translation="MGKYLTLVIFLTFFDSSSLFSQVGGRIVDAKTKQPLVGANIYTDL
FT                   GVGVSVADKKGEFMINNGELLRDADTLCFSFVGYCTKRFSVTSLLQKKNVILLQEEPFA
FT                   LGEVTVYGIKKSYLRLPYTQISSMPVPLYSFAMISLEKKLYLTGGDRSQIKPPMGFSLT
FT                   GSGGLPSGFVYEKYSNKIYVYDIISNTWTIINKKLRERAYHSALYNDGKIYVIGGKRFS
FT                   TNRKIEYLDETVEIYDIHRDTLLTDPVNPHQAASAAAFVYDDKLIVMGGSTYRIENGWQ
FT                   KYSDKIHMLDLKEGVWYEAGKMPLGMETNGILVGHTVFLFGGYRQRTLSDILTYDLITG
FT                   LWRKRGKLWFSVGKAALARGGDKVYILENGVIQVYNLYTNEIKAYQIDLKLREGGLYCT
FT                   DDKLIIVGGYSEGIDGKLGDAGVYEVRLSDFNRTELHLINRE"
FT   misc_feature    261972..262175
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 23.0, E-value 0.00061"
FT   misc_feature    262179..262334
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 22.5, E-value 0.00084"
FT   misc_feature    262338..262493
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 28.6, E-value 1.2e-05"
FT   misc_feature    262494..262628
FT                   /note="Pfam match to entry PF01344 Kelch, Kelch motif,
FT                   score 7.9, E-value 0.35"
FT   CDS_pept        complement(262986..263201)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0234"
FT                   /old_locus_tag="BF0238"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL3"
FT                   /protein_id="CAH06013.1"
FT                   /translation="MKNKRINVRHNNFISARMPVLTSPRTRPHGHRHAGRSRSQAIIAK
FT                   DIKENKMLLTTFILKEGTTSISPSTV"
FT   CDS_pept        263354..263959
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BF9343_0235"
FT                   /old_locus_tag="BF0239"
FT                   /product="putative ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="Similar to Escherichia coli ribonuclease HII RnhB or
FT                   B0183 SWALL:RNH2_ECOLI (SWALL:P10442) (198 aa) fasta
FT                   scores: E(): 2.6e-27, 51.13% id in 176 aa, and to
FT                   Bacteroides thetaiotaomicron ribonuclease HII BT3412
FT                   SWALL:AAO78518 (EMBL:AE016940) (200 aa) fasta scores: E():
FT                   3.8e-70, 87.87% id in 198 aa, and to Porphyromonas
FT                   gingivalis ribonuclease HII RnhB SWALL:RNH2_PORGI
FT                   (SWALL:Q51832) (168 aa) fasta scores: E(): 4.3e-38, 63.46%
FT                   id in 156 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06014"
FT                   /db_xref="GOA:Q5LIL2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIL2"
FT                   /protein_id="CAH06014.1"
FT                   /translation="MLLPWLNEELIEAGCDEAGRGCLAGAVYAAAVILPKDFENELLND
FT                   SKQLSEKQRYALREVIERDAVAWAVGIVSPEEIDKINILNASFLAMHRAVDRLKTRPQH
FT                   LLIDGNRFKKYPDIPHTTVIKGDGKYLSIAAASILAKTYRDDYMNKLHQEFPCYDWEHN
FT                   KGYPTKKHRAAIAGHGTTPYHRMTFNLLGDGQLELFSK"
FT   misc_feature    263390..263926
FT                   /note="Pfam match to entry PF01351 RNase_HII, Ribonuclease
FT                   HII, score 232.7, E-value 4.5e-67"
FT   CDS_pept        complement(263967..264893)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0236"
FT                   /old_locus_tag="BF0240"
FT                   /product="putative cationic transporter"
FT                   /note="Similar to Staphylococcus epidermidis cationic
FT                   transporter se1958 SWALL:Q8CN83 (EMBL:AE016750) (315 aa)
FT                   fasta scores: E(): 7.9e-27, 31.05% id in 293 aa, and to
FT                   Bacteroides thetaiotaomicron mg2+/co2+ transporter BT3414
FT                   SWALL:AAO78520 (EMBL:AE016940) (309 aa) fasta scores: E():
FT                   2.1e-105, 88.99% id in 309 aa, and to Clostridium
FT                   acetobutylicum magnesium and cobalt transporter CAC0294
FT                   SWALL:Q97MA4 (EMBL:AE007544) (315 aa) fasta scores: E():
FT                   9.7e-34, 37.28% id in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06015"
FT                   /db_xref="GOA:Q5LIL1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIL1"
FT                   /protein_id="CAH06015.1"
FT                   /translation="MRTYLYCEAGFVEKAQWLPNSWVNVVCPDSSDFKFLTETLKVPES
FT                   FLNDIADTDERPRTETEGNWLLTILRIPVQNAQSSIPYTTVPIGIITNNEIIVSVCYHQ
FT                   TDMIPDFIEHTRRKGIEVRNKLDLIFRLIYSSAVWFLKYLKQINIDITAAEKELERSIR
FT                   NEDLLRLMKLQKTLVYFNTSIRGNEVMIGKLKTIFQDTDYLDEELVEDVIIELKQAFNT
FT                   VNIYSDILTGTMDAFASIISNNVNAIMKRMTSLSITLMIPTLIASFYGMNVDIHLEEMP
FT                   HAFLLIILVSVFLSALSFVIFRKIKWF"
FT   misc_feature    complement(263970..264845)
FT                   /note="Pfam match to entry PF01544 CorA, CorA-like Mg2+
FT                   transporter protein, score 41.9, E-value 1.3e-09"
FT   misc_feature    complement(order(263988..264056,264084..264137))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0240 by TMHMM2.0 at aa 253-270 and 280-302"
FT   CDS_pept        265179..266693
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /gene_synonym="pgmI"
FT                   /locus_tag="BF9343_0237"
FT                   /old_locus_tag="BF0241"
FT                   /product="putative 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="Similar to Clostridium acetobutylicum
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate mutase
FT                   GpmI or Pgm-I or CAC0712 SWALL:GPMI_CLOAB (SWALL:Q97L53)
FT                   (510 aa) fasta scores: E(): 8.5e-91, 49.7% id in 511 aa,
FT                   and to Bacteroides thetaiotaomicron
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate mutase
FT                   BT3419 SWALL:AAO78525 (EMBL:AE016940) (504 aa) fasta
FT                   scores: E(): 3.8e-176, 90.27% id in 504 aa, and to
FT                   Methanosarcina acetivorans
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate mutase
FT                   2 Gpmi2 or ma4007 SWALL:GMI2_METAC (SWALL:Q8TIY2) (521 aa)
FT                   fasta scores: E(): 1.4e-91, 50.09% id in 505 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06016"
FT                   /db_xref="GOA:Q5LIL0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIL0"
FT                   /protein_id="CAH06016.1"
FT                   /translation="MSKKALLMILDGWGLGDHGKDDVIFNTATPYWDYLMETYPHSQLQ
FT                   ASGENVGLPDGQMGNSEVGHLNIGAGRVVYQDLVKINLSCRDNSILKNPEIVSAFSYAK
FT                   ENGKNVHFMGLTSDGGVHSSLDHLFKLCDIAKEYNIENTFVHCFMDGRDTDPKSGKGFI
FT                   EQLEAHCAKSAGKVASIIGRYYAMDRDKRWERVKEAYDLLVNGIGKKATDMVQAMQESY
FT                   DEGVTDEFIKPIVNAGVDGTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPEAGMHTIPG
FT                   LQYYCMTPYDASFKGVHILFDKENVVNTLGEYLAANGKKQLHIAETEKYAHVTFFFNGG
FT                   RETPYDNEDRILVPSPKVATYDLKPEMSAYEVKDKLVAAINENKYDFIVVNYANGDMVG
FT                   HTGIYEAIEKAVVAVDACVKDTIEAAKAQGYEAIIIADHGNADHALNEDGTPNTAHSLN
FT                   PVPCVYVTENKEAKVADGRLADVAPTILHILDMVQPAEMTGCNLIK"
FT   misc_feature    266274..266621
FT                   /note="Pfam match to entry PF01676 Metalloenzyme,
FT                   Metalloenzyme superfamily, score 129.0, E-value 7.6e-36"
FT   CDS_pept        266842..267936
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0238"
FT                   /old_locus_tag="BF0242"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="Similar to C terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase BT1597 SWALL:AAO76704 (EMBL:AE016932) (539 aa) fasta
FT                   scores: E(): 5.7e-57, 49.53% id in 325 aa, and to C
FT                   terminus of Bacteroides thetaiotaomicron putative
FT                   two-component system sensor histidine kinase BT1800
FT                   SWALL:AAO76907 (EMBL:AE016933) (616 aa) fasta scores: E():
FT                   1.4e-51, 44.76% id in 315 aa, and to C terminus of
FT                   Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase BT1237 SWALL:AAO76344 (EMBL:AE016931) (641
FT                   aa) fasta scores: E(): 7.5e-43, 41.75% id in 364 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06017"
FT                   /db_xref="GOA:Q5LIK9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK9"
FT                   /protein_id="CAH06017.1"
FT                   /translation="MKQLILSGMFVVCGLSVSLASEKWAVDSINWHRAEQKMQEKDFQD
FT                   AALTYKELITKGDSLFVDYAGRHVEDMREQYSIDELDLQNGMQQKKIWKLVFITILCLV
FT                   VLLFVGLLYLRRAERKLLFSREELQKAKRLAEESVRNKSVFLSNMSHEIKTPLNALAGF
FT                   SEILITPGIDDEVRAQCNDVIRLNSDLLLHLVNDVVDVSCLDVANMRFSVVPHEVVALC
FT                   RNVVEMLRNIKQTSAEMIFETELSALEMETDPCRLQQVLINLLVNATKFTKEGYITLTL
FT                   RINEAGVPEFMVTDTGCGIPLENQEAVFSRFEKLNEGIQGTGLGLPICKLIINRMGGDI
FT                   RVDSTYSKGARFIFTHPLKQEENR"
FT   misc_feature    266842..266901
FT                   /note="Signal peptide predicted for BF0242 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.829 between residues 20 and 21"
FT   misc_feature    267115..267183
FT                   /note="1 probable transmembrane helix predicted for BF0242
FT                   by TMHMM2.0 at aa 92-114"
FT   misc_feature    267262..267462
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 56.5, E-value 4.8e-14"
FT   misc_feature    267595..267918
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 118.7,
FT                   E-value 9.6e-33"
FT   CDS_pept        267933..269876
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0239"
FT                   /old_locus_tag="BF0243"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /note="Similar to C-terminus of Anabaena sp. Two-component
FT                   regulator kinase HepK or ALL4496 SWALL:P70777 (EMBL:U68034)
FT                   (575 aa) fasta scores: E(): 1.5e-06, 28.04% id in 189 aa,
FT                   and to entire Bacteroides thetaiotaomicron putative
FT                   two-component system sensor histidine kinase BT1598
FT                   SWALL:AAO76705 (EMBL:AE016932) (655 aa) fasta scores: E():
FT                   3.9e-41, 26.09% id in 663 aa, and to entire Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase BT1801 SWALL:AAO76908 (EMBL:AE016933) (653 aa) fasta
FT                   scores: E(): 3.4e-32, 23.93% id in 660 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06018"
FT                   /db_xref="GOA:Q5LIK8"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK8"
FT                   /protein_id="CAH06018.1"
FT                   /translation="MKRLVVLLFGLVGAALFMSAANSGDRVLRDSIFHVYRSMPADTTR
FT                   TVFAKEAAMGHVKESWALELLDSALVFAREIKDVEGELELQYGIFRYYTFRMDGENMEK
FT                   TCATLREACYRYKKYDNYFLALHYVLQLKGSEGDTEYAILESRKMREEAVRLHVDRGVF
FT                   LSYITEGKSYVFARNTEKAIEQYLKALEIEGTTFGDKLMVHGYLASSYYLKDKYKEALG
FT                   ELKAQRQLIDGVIKKKPSMLGVYRSTLLTIELMYCKIYLGMVDADPLWIHLNEAAKFYD
FT                   DDCFSATAVNYHFSWAGYYYLRQDWERCFPEFERTLAAFKGTQPMYEIEIRRIMGDAYV
FT                   DAGRYEEAARTYKTAAVMCDSVNKATLRMNEETVEANYRIRKALLDKELGEKRFLQVAV
FT                   VGLSLFVVLLVWGVIRLIRIRGELVKSQKEMAESYAVVVATDKMKEFFLRNITDEIRVP
FT                   LDTVVELSDRLCRETNLKQEKQQEYSATIKKCASKLIGLIFNVLDLARLESGMMKFVVE
FT                   EYDVVQLCTDARLMVEMQTENRTKVDLHTEPDMLLIDVDTTWFMKMLASVLKYPEESEG
FT                   LFRVKFILSRPSEDYLQIKVVNSPIFMTAESEKEFDVLHTINRLYLETFQGSYQLLEES
FT                   GERMIIITYPVS"
FT   misc_feature    order(267945..268004,269115..269183)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0243 by TMHMM2.0 at aa 5-24 and 395-417"
FT   misc_feature    269259..269462
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 37.9, E-value 2e-08"
FT   CDS_pept        270231..270812
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0240"
FT                   /old_locus_tag="BF0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3427 SWALL:AAO78533 (EMBL:AE016940)
FT                   (193 aa) fasta scores: E(): 8.3e-69, 86.01% id in 193 aa,
FT                   and to Chlorobium tepidum hypothetical protein CT1194
FT                   SWALL:Q8KD60 (EMBL:AE012880) (190 aa) fasta scores: E():
FT                   5.1e-20, 35.35% id in 181 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06019"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK7"
FT                   /protein_id="CAH06019.1"
FT                   /translation="MIQIDNVVVSLDVLREKFVCNLDACKGECCIEGDAGAPVELEEVE
FT                   KLEEVLPVVWDELSPEARAVIDKQGVVYTDRDGDLVTSIVNGKDCVFTCYDEKGYCYCA
FT                   IEKAYRGGKTDFYKPVSCHLYPIRVGNYGPYQAVNYHRWDVCKAAVLLGKKENVPVYRF
FT                   LKEPLIRKFGKEWYDELEIAVKELQDRGMI"
FT   CDS_pept        270809..273775
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0241"
FT                   /old_locus_tag="BF0245"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron outer
FT                   membrane assembly protein BT4129 SWALL:AAO79234
FT                   (EMBL:AE016943) (838 aa) fasta scores: E(): 4.5e-17, 20.65%
FT                   id in 983 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06020"
FT                   /db_xref="GOA:Q5LIK6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK6"
FT                   /protein_id="CAH06020.1"
FT                   /translation="MNRQVKKTLKISGITLGTVLLVLLVAIAFVINFIVTPKKLTPVVL
FT                   DAANQTLNAHLDMESVELTFFSTFPQFGLKVKNGSLVSKALNDSSWCKTDSLLSFKECV
FT                   LTVNPIAYLTENRIVVHNLSLEEVAVYAYRNKAGKANWEVTRASADTIPADTASTDFNS
FT                   EIDIRNIELKHANLVFDDRNTDIYSRIDDANLKLRLSLTKGISTLGLKFDNKNILFWQQ
FT                   GELLVNKIATSLRTDIMVDRQTAVWKLKDTELDVNGIRLDVNGTFRRDTVAKTIGMDLE
FT                   YGLHAPSMETVLRMIPKSYVKDSKVSAKGEVTVSGRVRGVYGDKKLPAVSLKIGIKEAS
FT                   AQYKDLPYGIDEVTADFDAYVDLMRHQPSYLNLKIFHFKGAHTEVLADAKVDDLLDDPL
FT                   ITFHTQSTVDLDALAKTFPLQESVTITGKLDADMGMKCRLSTLKKQDIGRMKLGGKLEL
FT                   KDFELKDTAKDFDFLGNATFRFRDNETLQAQMDVRKLVLRSRFLSSDIERLVANVSSTN
FT                   PQDTNRIVSLQCDMEVSKLRASMGDSIKLYSARTKAQAALGPQEVDVTKPAIDFSLRAD
FT                   SLFFSAAGTRMAMNVAGIKMKADKLNDSLWMPKGIVGFNRLRFRTPEFGLPIRMSKTAV
FT                   TVDGPKITLKNASVRIGRSNMTATGDMMGVYRAMTKGEKLTAHLSLTSDLIDCNQLINS
FT                   LSFPEDTTEVLTDSVPSEMKLFVIPRNIDFELQTDLKKVIFEKMLFENVHGAVDIKNQA
FT                   IHLEDLSIRALDADMKAVMVYKAGSPRGGYAGFDFKIRNINIAKLVDFVPALDTIVPML
FT                   RSFKGRVMFDVAADARLDSAMNIRIPTLRSAIHIKGDSLVLMDGETFAEISKMLMFKNK
FT                   KENVFDSISVNVTVHDGNVTVYPFLVEIDRYKAAVGGEQGLDMNFNYHISILKSPLPFK
FT                   AGVNISGNLDKMKFRIGKAKYKDAVTPAAVHRVDSTRMNMGNEIVNRFRRVVLGRQPR"
FT   misc_feature    270809..270898
FT                   /note="Signal peptide predicted for BF0245 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.449 between residues 30 and 31"
FT   CDS_pept        complement(273876..275834)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0242"
FT                   /old_locus_tag="BF0246"
FT                   /product="DNA gyrase subunit B"
FT                   /note="Similar to previously sequenced Bacteroides fragilis
FT                   DNA gyrase B subunit GyrB SWALL:Q9S1B0 (EMBL:AB017713) (653
FT                   aa) fasta scores: E(): 0, 98.77% id in 653 aa, and to
FT                   Bacteroides thetaiotaomicron DNA gyrase subunit B BT3429
FT                   SWALL:AAO78535 (EMBL:AE016940) (653 aa) fasta scores: E():
FT                   0, 95.09% id in 652 aa, and to Bacteroides fragilis DNA
FT                   gyrase B subunit GyrB (fragment) but extended towards the N
FT                   and C termini SWALL:Q9AQL5 (EMBL:AB048185) (477 aa) fasta
FT                   scores: E(): 2.6e-184, 100% id in 477 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06021"
FT                   /db_xref="GOA:Q5LIK5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK5"
FT                   /protein_id="CAH06021.1"
FT                   /translation="MSEEQNPTNNGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHH
FT                   LVYEIVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVAMTV
FT                   LHAGGKFDKGSYKVSGGLHGVGMSCVNALSTHMTTQVFRNGKIYQQEYEIGKPLYPVKE
FT                   VGIADHTGTKQQFWPDDSIFTETIYDYKILASRLRELAYLNAGLRISLTDRRVVNEDGS
FT                   FKHETFYSEEGLREFVRFIESSREHLINDVIYLNTEKQNIPIEVAIMYNTGFSENIHSY
FT                   VNNINTIEGGTHLAGFRRALTRTLKKYAEDSKMLEKVKVEISGDDFREGLTAVISVKVA
FT                   EPQFEGQTKTKLGNNEVMGAVDQAVGEVLNYYLEEHPKEAKAIVDKVILAATARHAARK
FT                   AREMVQRKSPMSGGGLPGKLADCSDKDPQKCELFLVEGDSAGGTAKQGRNRAFQAILPL
FT                   RGKILNVEKAMYHKALESEEIRNIYTALGVTIGTEEDSKAANIDKLRYHKIIIMTDADV
FT                   DGSHIDTLIMTFFFRYMPQIIQNGYLYIATPPLYLCKKGKIEEYCWTDAQRQKFIDTYG
FT                   GGSENAIHTQRYKGLGEMNAQQLWETTMDPENRMLKQVNIDNAAEADYIFSMLMGEDVG
FT                   PRREFIEENATYANIDA"
FT   misc_feature    complement(273909..274097)
FT                   /note="Pfam match to entry PF00986 DNA_gyraseB_C, DNA
FT                   gyrase B subunit, carboxyl terminus, score 147.7, E-value
FT                   1.7e-41"
FT   misc_feature    complement(274212..274457)
FT                   /note="Pfam match to entry PF01751 Toprim, Toprim domain,
FT                   score 23.2, E-value 0.00016"
FT   misc_feature    complement(274509..274535)
FT                   /note="PS00177 DNA topoisomerase II signature."
FT   misc_feature    complement(274626..275138)
FT                   /note="Pfam match to entry PF00204 DNA_gyraseB, DNA gyrase
FT                   B, score 273.1, E-value 3.1e-79"
FT   misc_feature    complement(275292..275723)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 108.1,
FT                   E-value 1.5e-29"
FT   CDS_pept        complement(276015..276269)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BF9343_0243"
FT                   /old_locus_tag="BF0247"
FT                   /product="30S ribosomal protein S20"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi 30S ribosomal protein S20 RpsT or STM0043 or STY0052
FT                   or t0045 SWALL:RS20_SALTY (SWALL:P41787) (86 aa) fasta
FT                   scores: E(): 0.00066, 38.37% id in 86 aa, and to
FT                   Bacteroides thetaiotaomicron ribosomal protein S20 BT3430
FT                   SWALL:AAO78536 (EMBL:AE016940) (84 aa) fasta scores: E():
FT                   5.2e-26, 90.47% id in 84 aa, and to Mycobacterium
FT                   tuberculosis 30S ribosomal protein S20 RpsT or Rv2412 or
FT                   MT2485 or MTCY253.08c SWALL:RS20_MYCTU (SWALL:P71731) (86
FT                   aa) fasta scores: E(): 3.9e-07, 45.34% id in 86 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06022"
FT                   /db_xref="GOA:Q5LIK4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIK4"
FT                   /protein_id="CAH06022.1"
FT                   /translation="MANHKSSIKRIRQEETRRLRNRYYGKTMRNAVRKLRSTTDKAEAT
FT                   AMYPGIVKMVDKLAKTNVIHKNKANNLKSKLAIYINKLA"
FT   misc_feature    complement(276024..276266)
FT                   /note="Pfam match to entry PF01649 Ribosomal_S20p,
FT                   Ribosomal protein S20, score 64.1, E-value 2.5e-16"
FT   tRNA            complement(276306..276380)
FT                   /note="tRNA Glu anticodon TTC, Cove score 50.05"
FT   CDS_pept        276679..277407
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0244"
FT                   /old_locus_tag="BF0248"
FT                   /product="possible DNA repair protein RecO"
FT                   /note="Limited similarity to Bacillus subtilis DNA repair
FT                   protein RecO SWALL:RECO_BACSU (SWALL:P42095) (255 aa) fasta
FT                   scores: E(): 0.00079, 24.03% id in 258 aa, and to
FT                   Bacteroides thetaiotaomicron DNA repair protein BT3431
FT                   SWALL:Q8A275 (EMBL:AE016940) (242 aa) fasta scores: E():
FT                   6.9e-87, 83.05% id in 242 aa, and to Bacteroides forsythus
FT                   hypothetical protein SWALL:AAO33829 (EMBL:AY184490) (208
FT                   aa) fasta scores: E(): 9.1e-33, 43.75% id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06023"
FT                   /db_xref="GOA:Q5LIK3"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIK3"
FT                   /protein_id="CAH06023.1"
FT                   /translation="MLQKTVGIVLHVLKYNDTSNIVEMYTELSGRASFLVTVPRSKKAT
FT                   VKSVLFQPLALIEFEADYRPNTSLFRIKEAKSFSPFTSIPYDPFKSAIALFLAEFLYRA
FT                   IREEAENRPLFAYLQHSILWLDTCKISFANFHLVFLMRLSRFLGLYPNLDDYHAGDYFD
FT                   MLNATFTSVRPQLHSSYIQPDEAGRLLQLMRMNYETMHLFGMNRTERARCLAIINEYYR
FT                   LHLPDFPILKSLDVLKELFD"
FT   misc_feature    276679..277326
FT                   /note="Pfam match to entry PF02565 RecO, Recombination
FT                   protein O, score -37.2, E-value 0.00019"
FT   CDS_pept        complement(277517..277966)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0245"
FT                   /old_locus_tag="BF0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein with a conserved domain BT3443
FT                   SWALL:AAO78549 (EMBL:AE016940) (135 aa) fasta scores: E():
FT                   3.5e-36, 91.85% id in 135 aa, and to Chlorobium tepidum
FT                   hypothetical protein CT0607 SWALL:Q8KES5 (EMBL:AE012834)
FT                   (152 aa) fasta scores: E(): 3e-15, 42.66% id in 150 aa, and
FT                   to Myxococcus xanthus hypothetical 18.5 kDa protein
FT                   SWALL:Q50854 (EMBL:U20669) (175 aa) fasta scores: E():
FT                   3e-14, 43.15% id in 146 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06024"
FT                   /db_xref="GOA:Q5LIK2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK2"
FT                   /protein_id="CAH06024.1"
FT                   /translation="MDLFERVSEDIKNAMKAKDKVALETLRNVKKFFLEAKTAPGANDT
FT                   LTDADALKIVQKLVKQGKDAAEIYIGQGRQDLADAELAQVQVMETYLPKQMSAEELEAA
FT                   LKEIIAEVGATSGKDMGKVMGVASKKLAGLAEGRAISAKVKELLG"
FT   misc_feature    complement(277523..277951)
FT                   /note="Pfam match to entry PF02637 GatB_Yqey, GatB/Yqey
FT                   domain, score 65.9, E-value 7.1e-17"
FT   CDS_pept        complement(278041..279351)
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="BF9343_0246"
FT                   /old_locus_tag="BF0250"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Prevotella albensis cell division protein
FT                   FtsZ SWALL:Q9S344 (EMBL:AJ249201) (438 aa) fasta scores:
FT                   E(): 3.2e-86, 59.55% id in 445 aa, and to Bacteroides
FT                   thetaiotaomicron cell division protein FtsZ BT3444
FT                   SWALL:AAO78550 (EMBL:AE016940) (435 aa) fasta scores: E():
FT                   4.9e-141, 93.8% id in 436 aa, and to Porphyromonas
FT                   gingivalis cell division protein FtsZ SWALL:FTSZ_PORGI
FT                   (SWALL:O08466) (457 aa) fasta scores: E(): 4.2e-68, 52.02%
FT                   id in 419 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06025"
FT                   /db_xref="GOA:Q5LIK1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK1"
FT                   /protein_id="CAH06025.1"
FT                   /translation="MDEIVQFDFPTDSPKIIKVIGVGGGGGNAVNHMYREGIHDVTFVL
FT                   CNTDNQALAESPVPVKLQLGRSITQGLGAGNRPERARDAAEESIEDIKTLLNDGTKMVF
FT                   ITAGMGGGTGTGAAPVIARIAKEMDILTVGIVTIPFIFEGEKKIIQALDGVERIAQHVD
FT                   ALLVINNERLREIYSDLTFMNAFGKADDTLSIAAKSIAEIITMRGTVNLDFADVKTILK
FT                   DGGVAIMSTGFGEGENRVTKAIDDALHSPLLNNNDIFNAKKVMLNVSFCPASELMMEEM
FT                   NEVHEFMSKFREGVEVIWGVAMDNSLDTKVKITVLATGFGVEDVPGMDDLHEKRSQEEE
FT                   ERQLQLEEEKEKNKERIRKAYGESASGIGTRNLRKRRHIYLFNAEDLDNDDIIAMVEDS
FT                   PTYLRDKTTLGKIKAKAALEEEIATEEAIDDSGVITF"
FT   misc_feature    complement(278341..278724)
FT                   /note="Pfam match to entry PF03953 tubulin_C, Tubulin/FtsZ
FT                   family, C-terminal domain, score 35.4, E-value 1.1e-07"
FT   misc_feature    complement(278728..279309)
FT                   /note="Pfam match to entry PF00091 tubulin, Tubulin/FtsZ
FT                   family, GTPase domain, score 264.2, E-value 1.5e-76"
FT   misc_feature    complement(278986..279051)
FT                   /note="PS01135 FtsZ protein signature 2."
FT   CDS_pept        complement(279378..280808)
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BF9343_0247"
FT                   /old_locus_tag="BF0251"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Prevotella albensis cell division protein
FT                   FtsA SWALL:Q9S345 (EMBL:AJ249201) (481 aa) fasta scores:
FT                   E(): 1.6e-60, 44.19% id in 482 aa, and to Bacteroides
FT                   thetaiotaomicron cell division protein FtsA BT3445
FT                   SWALL:AAO78551 (EMBL:AE016940) (483 aa) fasta scores: E():
FT                   7e-110, 73.51% id in 487 aa, and to Porphyromonas
FT                   gingivalis cell division protein FtsA SWALL:FTSA_PORGI
FT                   (SWALL:O07827) (456 aa) fasta scores: E(): 1.2e-25, 28.73%
FT                   id in 449 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06026"
FT                   /db_xref="GOA:Q5LIK0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIK0"
FT                   /protein_id="CAH06026.1"
FT                   /translation="MATTDFIAAIELGSSKIAGIAGKKNSDGSIQVLAYAREDSSSFIR
FT                   KGVIYNLDKTAQSLTSIINKLEGALNNSIAKIYVGIGGQSLRTVRNVVSRDLEEETIIS
FT                   QELVDSICDENLEIPLIDMDILDVAPQEYKIGNNLQADPVGVAGSHIEGRFLNIVARAS
FT                   LKKNLERCFEQAKIEIADLLISPLVTADAVLTESERRSGCALIDFGADTSTISIYKNNI
FT                   LRFLTVLPLGGNSITHDLVSLQMEEEEAERLKIRYGNAFYEEEEGEEPATCQLEDGNRT
FT                   IELGKLNNIIEARTEEIIANVWNQIQLSGYDDKLLAGLIITGGAANLKDLDEVLRKRSK
FT                   IEKVRNARFVRNTIHADEDVVKKDGTQNTLFGLLIAGNENCCLLETPAPQPHIQPQPQP
FT                   EPVNMFEEDESLKEQEAAARAAKKKKEEEEKKRKEEEKQRKLEEKKRREEERRNKPNWF
FT                   KSTFDKLSNEIFSDEDMK"
FT   misc_feature    complement(279687..280223)
FT                   /note="Pfam match to entry PF02491 FtsA, Cell division
FT                   protein FtsA, score 103.9, E-value 2.7e-28"
FT   misc_feature    complement(280227..280790)
FT                   /note="Pfam match to entry PF02491 FtsA, Cell division
FT                   protein FtsA, score 82.0, E-value 1.1e-21"
FT   CDS_pept        complement(280885..281625)
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="BF9343_0248"
FT                   /old_locus_tag="BF0252"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Porphyromonas gingivalis cell division
FT                   protein FtsQ SWALL:O07826 (EMBL:AB004555) (282 aa) fasta
FT                   scores: E(): 1e-21, 27.27% id in 242 aa, and to Bacteroides
FT                   thetaiotaomicron cell division protein FtsQ BT3446
FT                   SWALL:AAO78552 (EMBL:AE016940) (248 aa) fasta scores: E():
FT                   7.6e-77, 78.36% id in 245 aa, and to fragment of Prevotella
FT                   albensis cell division protein FtsQ (fragment) SWALL:Q9S346
FT                   (EMBL:AJ249201) (141 aa) fasta scores: E(): 7.9e-07, 46.61%
FT                   id in 133 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06027"
FT                   /db_xref="GOA:Q5LIJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIJ9"
FT                   /protein_id="CAH06027.1"
FT                   /translation="MIKRILLTIVMLLLIAYLIAAVTVFNDKPAHQVCRDMELVIKDTL
FT                   NAGFVTKNEVAAILQKKGIYPVGKKMDRVHTKTLEKELDKHPLINEAQCYKTPNGKICV
FT                   EVTQRVPILHIMSSNGENYYLDNKGKMMPPDAKCVAHRAIVTGNVEKSFAMKDLYKFGV
FT                   FLQNNPFWEAQIVQINVLPGKEIELVPRVGNHIIYLGKLEHFEDKLKRLKTFYEKGLNQ
FT                   VGWNKYSRISLEFGNQIICTKKKQ"
FT   misc_feature    complement(281554..281613)
FT                   /note="1 probable transmembrane helix predicted for BF0252
FT                   by TMHMM2.0 at aa 5-24"
FT   CDS_pept        complement(281657..283051)
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="BF9343_0249"
FT                   /old_locus_tag="BF0253"
FT                   /product="putative UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Similar to Porphyromonas gingivalis
FT                   UDP-N-acetylmuramate--L-alanine ligase MurC
FT                   SWALL:MURC_PORGI (SWALL:Q51831) (433 aa) fasta scores: E():
FT                   1.6e-91, 54.65% id in 430 aa, and to Bacteroides
FT                   thetaiotaomicron UDP-N-acetylmuramate--alanine ligase
FT                   BT3447 SWALL:AAO78553 (EMBL:AE016940) (467 aa) fasta
FT                   scores: E(): 1.1e-156, 90.02% id in 451 aa, and to
FT                   Haemophilus influenzae UDP-N-acetylmuramate--L-alanine
FT                   ligase MurC or HI1139 SWALL:MURC_HAEIN (SWALL:P45066) (475
FT                   aa) fasta scores: E(): 7.6e-42, 31.55% id in 469 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06028"
FT                   /db_xref="GOA:Q5LIJ8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIJ8"
FT                   /protein_id="CAH06028.1"
FT                   /translation="MNIETIQSVYFVGAGGIGMSALVRYFLSKGKVVAGYDRTPSELTQ
FT                   HLIEEGAQIHYEENIDLIPEACKDKATTLVVLTPAVPQEHAELTYFRDNGFEIQKRAQV
FT                   LGTITRSSKGLCVAGTHGKTTTSTMTAHLFHQSHVGCTAFLGGISKNYGTNLLLSSTSP
FT                   YTVIEADEFDRSFHWLSPYMSVITATDPDHLDIYGTEQAYLESFEHYTTLIQPGGALII
FT                   RKGISLQPKVKEGVKMYTYSRDEGDFHAENIRIGNGEIFIDFVGPDIRIDNIQLGVPVS
FT                   INIENGVAAMALAHLNGVTPEEIKQGMASFRGVDRRFDFKIKNNRIVFLSDYAHHPSEI
FT                   KQSVMSMRELYRDKKITAVFQPHLYTRTRDFYKDFADSLSLLDEVILVDIYPAREQPIP
FT                   GVSSRLIYDNLRPGIEKSMCKKEEILDVLKAKHIEVLITLGAGDIDNYVPGICDLLSRR
FT                   MVPSDN"
FT   misc_feature    complement(281843..282112)
FT                   /note="Pfam match to entry PF02875 Mur_ligase_C, Mur ligase
FT                   family, glutamate ligase domain, score 90.2, E-value
FT                   3.6e-24"
FT   misc_feature    complement(282134..282919)
FT                   /note="Pfam match to entry PF01225 Mur_ligase, Mur ligase
FT                   family, catalytic domain, score 160.5, E-value 2.4e-45"
FT   misc_feature    complement(282968..283027)
FT                   /note="1 probable transmembrane helix predicted for BF0253
FT                   by TMHMM2.0 at aa 9-28"
FT   CDS_pept        complement(283048..284214)
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="BF9343_0250"
FT                   /old_locus_tag="BF0254"
FT                   /product="probable
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="Similar to Bacillus halodurans
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
FT                   MurG or BH2565 SWALL:MURG_BACHD (SWALL:Q9K9T0) (363 aa)
FT                   fasta scores: E(): 1.1e-45, 36.61% id in 366 aa, and to
FT                   Bacteroides thetaiotaomicron
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
FT                   BT3448 SWALL:AAO78554 (EMBL:AE016940) (372 aa) fasta
FT                   scores: E(): 3.2e-113, 83.28% id in 365 aa, and to
FT                   Enterococcus hirae
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
FT                   MurG SWALL:MURG_ENTHR (SWALL:O07670) (360 aa) fasta scores:
FT                   E(): 1.8e-43, 36.48% id in 370 aa."
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06029"
FT                   /db_xref="GOA:Q5LIJ7"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIJ7"
FT                   /protein_id="CAH06029.1"
FT                   /translation="MMLNLKSNMNKENNKEGQGDALRVIISGGGTGGHIFPAVSIANAI
FT                   KELRPDAQILFVGAEGRMEMQRVPDAGYQIIGLPVAGFDRKHLWKNVAVLLKLVRSQWK
FT                   ARNIIRQFRPQVAVGVGGYASGPTLKMAGMMGVPTLIQEQNSYAGVTNKLLAQKARRIC
FT                   VAYDGMEKFFPANKIIMTGNPVRQNLLAEKPEREQAIRSFGLNPEKKTILILGGSLGAR
FT                   TINNTLIAGLQLIRRTTDVQFIWQTGKIYHQQVTEAVKAAGEIPNLFVTDFIKDMAAAY
FT                   AAADLVISRAGAGSISEFCLLNKPVILVPSPNVAEDHQTKNALALVNKQAAIYVKDAEA
FT                   ENKLLPVALETIANAEKLSELSENIAHLALPDSAVVIAKEVIKLAQQS"
FT   misc_feature    complement(283084..283584)
FT                   /note="Pfam match to entry PF04101 Glyco_tran_28_C,
FT                   Glycosyltransferase family 28 C-terminal domain, score
FT                   127.5, E-value 2e-35"
FT   misc_feature    complement(283723..284145)
FT                   /note="Pfam match to entry PF03033 Glyco_transf_28,
FT                   Glycosyltransferase family 28 N-terminal domain, score
FT                   99.8, E-value 4.5e-27"
FT   CDS_pept        complement(284192..285487)
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="BF9343_0251"
FT                   /old_locus_tag="BF0255"
FT                   /product="putative transmembrane rod-shape determining
FT                   protein"
FT                   /note="Similar to Streptococcus thermophilus RodA
FT                   SWALL:Q8L331 (EMBL:AF399832) (416 aa) fasta scores: E():
FT                   5.9e-21, 25.51% id in 392 aa, and to Bacteroides
FT                   thetaiotaomicron rod shape-determining protein RodA BT3449
FT                   SWALL:Q8A257 (EMBL:AE016940) (438 aa) fasta scores: E():
FT                   4.2e-142, 82.67% id in 433 aa, and to Porphyromonas
FT                   gingivalis cell division protein FtsW, putative PG0579
FT                   SWALL:AAQ65766 (EMBL:AE017174) (418 aa) fasta scores: E():
FT                   4.2e-46, 37.89% id in 409 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06030"
FT                   /db_xref="GOA:Q5LIJ6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIJ6"
FT                   /protein_id="CAH06030.1"
FT                   /translation="MDLLKNIFKGDKVIWIIFLCLCLISIIEVFSAASTLTYKSGDHWG
FT                   PITQHSIILMVGAVVVVLMHNIPYKWFQVFPVFLYPISVVLLAFVTLMGVITGDRVNGA
FT                   ARWMSFMGLQFQPSELAKMAVIIAVSFILSKKQDDEGANPKAFKYIMILTGLVCMLIAP
FT                   ENLSTAMLLFGVVVLMMFIGRVAFKKLAMLLGGLALVGCLGAVFLLAIPKDTDIPFLHR
FT                   FDTWKSRITNFTEKEEVPAAKFDIDKDAQIAHARIAIATSNVIGKAPGNSIQRDFLSQA
FT                   FSDFIFAIIIEELGLVGGAFVVILYIWLLVRTGRIAQKCERTFPAFLVMGIALMLVSQA
FT                   ILNMMVAVGLFPVTGQPLPLISKGGTSTLINCAYIGMILSVSRYTAYLEEKKENPAPLL
FT                   TQSEGNETIASEAQTAAEPTAEVLNSDAKFEE"
FT   misc_feature    complement(284327..285457)
FT                   /note="Pfam match to entry PF01098 FTSW_RODA_SPOVE, Cell
FT                   cycle protein, score 204.0, E-value 2e-58"
FT   misc_feature    complement(order(284342..284410,284453..284521,
FT                   284558..284626,284852..284920,284933..284986,
FT                   284999..285052,285089..285157,285200..285268,
FT                   285281..285349,285392..285451))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BF0255 by TMHMM2.0 at aa 13-32, 47-69, 74-96, 111-133,
FT                   146-163, 168-185, 190-212, 288-310, 323-345 and 360-382"
FT   misc_feature    complement(284777..284827)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        complement(285546..286880)
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BF9343_0252"
FT                   /old_locus_tag="BF0256"
FT                   /product="putative UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="Similar to Bacillus subtilis
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD
FT                   SWALL:MURD_BACSU (SWALL:Q03522) (451 aa) fasta scores: E():
FT                   1.3e-43, 35.63% id in 449 aa, and to Bacteroides
FT                   thetaiotaomicron UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase BT3450 SWALL:Q8A256 (EMBL:AE016940) (413 aa) fasta
FT                   scores: E(): 1.1e-143, 91.52% id in 413 aa, and to
FT                   Thermoanaerobacter tengcongensis
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD or
FT                   TTE1647 SWALL:MURD_THETN (SWALL:Q8R9G4) (450 aa) fasta
FT                   scores: E(): 4.7e-48, 38.22% id in 450 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06031"
FT                   /db_xref="GOA:Q5LIJ5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIJ5"
FT                   /protein_id="CAH06031.1"
FT                   /translation="MKRIVVLGAGESGAGAAVLAKVKGFDTFVSDMSAIKDKYKTLLDG
FT                   HGIAWEEGRHTEEQILSADEVVKSPGIPNDAPLILRLREQGTPIISEIEFAGRYTDAKM
FT                   ICITGSNGKTTTTSLIYHIFKSAGLNVGLAGNIGKSLALQVAEEKHDYYVIELSSFQLD
FT                   NMYNFRADIAVLMNITPDHLDRYDHCMQNYINAKFRITQNQTSEDAFIFWNDDPIIKRE
FT                   LDKHGIRAHLYPFSAIKEEGSIAYVEDHEVVITEPIAFNMEQEQLALTGQHNLYNSLAA
FT                   GISANLAGITKEDIRKALSDFQGVEHRLEKVARVRGIDFINDSKATNVNSCWYALQSMT
FT                   TKTVLILGGKDKGNDYTEIEELVREKCSALVYLGLHNEKLHEFFDRLGLPVAEVQTGMK
FT                   DAVEAAYKLAKKGETVLLSPCCASFDLFKSYEDRGEQFKKYVREL"
FT   misc_feature    complement(285735..285968)
FT                   /note="Pfam match to entry PF02875 Mur_ligase_C, Mur ligase
FT                   family, glutamate ligase domain, score 25.2, E-value
FT                   7.1e-05"
FT   misc_feature    complement(285990..286766)
FT                   /note="Pfam match to entry PF01225 Mur_ligase, Mur ligase
FT                   family, catalytic domain, score 168.4, E-value 1e-47"
FT   CDS_pept        complement(287020..288288)
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="BF9343_0253"
FT                   /old_locus_tag="BF0257"
FT                   /product="putative
FT                   UDP-N-acetylmuramoyl-pentapeptide:undecaprenyl-phosphate-ph
FT                   osphatase"
FT                   /EC_number="2.7.8.13"
FT                   /note="Similar to Pasteurella multocida
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase MraY or
FT                   PM0139 SWALL:MRAY_PASMU (SWALL:P57816) (360 aa) fasta
FT                   scores: E(): 7.3e-26, 34.97% id in 426 aa, and to
FT                   Bacteroides thetaiotaomicron
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase BT3451
FT                   SWALL:Q8A255 (EMBL:AE016940) (422 aa) fasta scores: E():
FT                   3.5e-159, 95.02% id in 422 aa, and to Porphyromonas
FT                   gingivalis
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase MraY or
FT                   PG0577 SWALL:AAQ65764 (EMBL:AE017174) (419 aa) fasta
FT                   scores: E(): 8.7e-97, 58.72% id in 424 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06032"
FT                   /db_xref="GOA:Q5LIJ4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIJ4"
FT                   /protein_id="CAH06032.1"
FT                   /translation="MLYYLFEWLHKLNFPGAGMFGYTSFRALMAIILALLISSIWGDKF
FT                   INLLKRKQITETQRDAKIDPFGVNKVGVPSMGGVIIIVAILIPCLLLGKLHNIYMILML
FT                   ITTVWLGSLGFADDYIKIFKKDKEGLHGKFKIIGQVGLGLIVGLTLYLSPDVVIRENIE
FT                   VQKSENEIEVIHGTHDLKSTQTTIPFFKSNNLDYADLVGFMGEHAQTAGWILFVIITIF
FT                   VVTAVSNGANLNDGMDGMAAGNSAIIGLTLGILAYVSSHIEFAGYLNIMYIPGSEELVI
FT                   FICAFIGALIGFLWYNAYPAQVFMGDTGSLTIGGIIAVFAIIIHKELLIPILCGIFLVE
FT                   NLSVLLQRFYYKAGKRKGIKQRLFKRAPIHDHFRTSMSLVEPGCSVKFTKPDQLFHESK
FT                   ITVRFWIVTIVLAAITIITLKIR"
FT   misc_feature    complement(order(287032..287091,287236..287304,
FT                   287314..287382,287401..287454,287512..287571,
FT                   287590..287658,287815..287883,287944..287997,
FT                   288010..288078,288163..288231))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BF0257 by TMHMM2.0 at aa 20-42, 71-93, 98-115, 136-158,
FT                   211-233, 240-259, 279-296, 303-325, 329-351 and 400-419"
FT   misc_feature    complement(287299..287991)
FT                   /note="Pfam match to entry PF00953 Glycos_transf_4,
FT                   Glycosyl transferase, score 148.7, E-value 8.9e-42"
FT   CDS_pept        complement(288374..289831)
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /gene_synonym="murE2"
FT                   /locus_tag="BF9343_0254"
FT                   /old_locus_tag="BF0258"
FT                   /product="probable
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="Similar to Thermoanaerobacter tengcongensis
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase MurE or MurE2 or TTE1649 SWALL:MURE_THETN
FT                   (SWALL:Q8R9G2) (492 aa) fasta scores: E(): 1.9e-61, 39.91%
FT                   id in 486 aa, and to Bacteroides thetaiotaomicron
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase BT3452 SWALL:AAO78558
FT                   (EMBL:AE016940) (482 aa) fasta scores: E(): 3.2e-161,
FT                   90.66% id in 482 aa, and to Clostridium tetani
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase CTC01632 SWALL:AAO36175
FT                   (EMBL:AE015941) (485 aa) fasta scores: E(): 4.1e-65, 42.74%
FT                   id in 489 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06033"
FT                   /db_xref="GOA:Q5LIJ3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIJ3"
FT                   /protein_id="CAH06033.1"
FT                   /translation="MKLKEILTSIQPVKITGNQDIEITGVDIDSRQVESGHLFMAMHGT
FT                   QTDGHAYIPAAVEKGATAILCEELPAELAEGVTYIQVADSEDAVGKAATTFYGNPSSKL
FT                   ELVGVTGTNGKTTIATLLYNTFRYFGYKVGLISTVCNYIDDEAIPTEHTTPDPITLNRL
FT                   LGRMADEGCKYVFMEVSSHSIAQKRISGLRFAGGIFTNLTRDHLDYHKTVENYLKAKKK
FT                   FFDDMPKNSFSLTNLDDKNGLVMTQNTKSKVYTYSLRSLSDFKGRVLESHFEGMLLDFN
FT                   NHELAVQFIGKFNASNLLAVFGAAVLLGKKEEDVLVALSTLHPVAGRFDAIRSPQGYTA
FT                   IVDYAHTPDALVNVLNAIHGVLEGKGKVITVVGAGGNRDKGKRPIMAKEAARASDRVII
FT                   TSDNPRFEEPQDIINDMLAGLDTEDKKKTLSIADRKEAIRTACMLAEKGDVILVAGKGH
FT                   ENYQDIKGVKHHFDDKEVLKEIFSLTV"
FT   misc_feature    complement(288587..288859)
FT                   /note="Pfam match to entry PF02875 Mur_ligase_C, Mur ligase
FT                   family, glutamate ligase domain, score 98.9, E-value
FT                   8.7e-27"
FT   misc_feature    complement(288881..289729)
FT                   /note="Pfam match to entry PF01225 Mur_ligase, Mur ligase
FT                   family, catalytic domain, score 176.7, E-value 3.2e-50"
FT   CDS_pept        complement(289849..291948)
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /gene_synonym="pbpB"
FT                   /locus_tag="BF9343_0255"
FT                   /old_locus_tag="BF0259"
FT                   /product="putative cell division specific
FT                   transpeptidase/penicillin-binding protein"
FT                   /note="Similar to Bacillus subtilis penicillin-binding
FT                   protein PbpB or BSU15160 SWALL:PBPB_BACSU (SWALL:Q07868)
FT                   (716 aa) fasta scores: E(): 1.2e-21, 24.76% id in 735 aa,
FT                   and to Bacteroides thetaiotaomicron penicillin-binding
FT                   protein BT3453 SWALL:Q8A253 (EMBL:AE016940) (708 aa) fasta
FT                   scores: E(): 3.8e-190, 79.83% id in 709 aa, and to
FT                   Porphyromonas gingivalis penicillin-binding protein 2,
FT                   putative PG0575 SWALL:AAQ65762 (EMBL:AE017174) (733 aa)
FT                   fasta scores: E(): 2.3e-77, 38.55% id in 721 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06034"
FT                   /db_xref="GOA:Q5LIJ2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIJ2"
FT                   /protein_id="CAH06034.1"
FT                   /translation="MTRYFFVILLMGLIGVAIVVKAGITMFAERQYWQDVADRFVKENV
FT                   TVKPNRGNIISSDGKLMASSLPEYRIYMDFKAGGVKKDTMLMNHLDEICEGLHKIFPDK
FT                   SASEFKTHLKKGRKQGSRNYLIYPKRISYIQYKEAKRLPVFNLNKYKGGFHELAYNQRK
FT                   KPFGSLAARTLGDLYADTAQGAKNGIELAFDSILKGHDGITHRQKVMNKYLNIVDIPPV
FT                   DGCDLLSTIDVGMQDICEKALTDKLKELNASVGVAVLMEVATGEVKAIVNMTKAGDGNY
FT                   YEMRNNAISDMLEPGSTFKTASIMVALEDGKITPEDGIDTGNGIKMMHGRPMKDWNWYK
FT                   GGYGYLTVTQILEVSSNIGTSSIIEKYYGSNPQKFVDGLKRMSIDQPLQLQIAGEGKPN
FT                   IKGPKERYFAKTTLPWMSIGYETQVPPMNILTFYNAIANNGVMVRPKFVKAAIKNGEIV
FT                   KEYPTEIINPKICSERTLKQIQEILYKVVHEGLAAPAGSKQFAVSGKTGTAQISQGAAG
FT                   YKSGRVNYLVSFCGYFPSEAPKYSCIVSIQKPGLPASGGLMAGSVFSKIAERVYAKDLR
FT                   LDIRNAIDTNTVVIPDVKAGEMIEARQVLEGLNIQTQAEFKAKKNKEVWGHAQAAPKAV
FT                   ILQGKEQLRNFVPSVIGMGAKDAVYLLESKGLKVTLSGVGKVKSQSLPQGTTIKKGQTI
FT                   SIHLN"
FT   misc_feature    complement(289852..290028)
FT                   /note="Pfam match to entry PF03793 PASTA, PASTA domain,
FT                   score 38.0, E-value 1.8e-08"
FT   misc_feature    complement(290242..291243)
FT                   /note="Pfam match to entry PF00905 Transpeptidase,
FT                   Penicillin binding protein transpeptidase domain, score
FT                   182.4, E-value 6.4e-52"
FT   misc_feature    complement(291886..291948)
FT                   /note="Signal peptide predicted for BF0259 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.940) with cleavage site
FT                   probability 0.544 between residues 21 and 22"
FT   CDS_pept        complement(291976..292317)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0256"
FT                   /old_locus_tag="BF0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3454 SWALL:AAO78560 (EMBL:AE016940) (118 aa)
FT                   fasta scores: E(): 8.7e-34, 91.58% id in 107 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06035"
FT                   /db_xref="GOA:Q5LIJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIJ1"
FT                   /protein_id="CAH06035.1"
FT                   /translation="MEDKEAKKKKSNSLKSILGGDILATDFFRRQTKLLVLIMVLIIFY
FT                   IHNRYASQQQQIEIDKLKKELIDIKYDALTRSSELMEKSRQSRIEDYISTKESDLQTST
FT                   HPPYLISTK"
FT   misc_feature    complement(292165..292218)
FT                   /note="1 probable transmembrane helix predicted for BF0260
FT                   by TMHMM2.0 at aa 34-51"
FT   CDS_pept        complement(292346..293260)
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="BF9343_0257"
FT                   /old_locus_tag="BF0261"
FT                   /product="putative S-adenosyl-methyltransferase"
FT                   /note="Similar to Enterococcus faecalis
FT                   S-adenosyl-methyltransferase MraW or EF0989
FT                   SWALL:MRAW_ENTFA (SWALL:O07104) (318 aa) fasta scores: E():
FT                   1.2e-42, 45.25% id in 316 aa, and to Bacteroides
FT                   thetaiotaomicron S-adenosyl-methyltransferase MraW BT3455
FT                   SWALL:AAO78561 (EMBL:AE016940) (304 aa) fasta scores: E():
FT                   1e-103, 91.44% id in 304 aa, and to Enterococcus faecalis
FT                   S-adenosyl-methyltransferase MraW or EF0989 SWALL:AAO80795
FT                   (EMBL:U94707) (319 aa) fasta scores: E(): 3.4e-42, 44.93%
FT                   id in 316 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06036"
FT                   /db_xref="GOA:Q5LIJ0"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIJ0"
FT                   /protein_id="CAH06036.1"
FT                   /translation="MKEEETTYHVPVLLKESVDAMNISPDGTYVDVTFGGGGHSREILS
FT                   RLGDGGRLLGFDQDEDAERNIVNDPHFTFVRSNFRYLHNFLRYHDIGEVDAILADLGVS
FT                   SHHFDDSERGFSFRFDGKLDMRMNKRAGITAADVVNTYEEERLADIFYLYGELKNSRKL
FT                   ASVIVKARTGQKIETIGEFLEIIKPLFGREREKKELAKIFQALRIEVNQEMEALKEMLM
FT                   AATEALKPGGRLVVITYHSLEDRMVKNIMKTGNVEGKTTQDFFGNLQTPFRLVNNKVIV
FT                   PDEDEITRNPRSRSAKLRIAEKK"
FT   misc_feature    complement(292349..293242)
FT                   /note="Pfam match to entry PF01795 Methyltransf_5, MraW
FT                   methylase family, score 415.7, E-value 3.6e-122"
FT   CDS_pept        complement(293257..293733)
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="BF9343_0258"
FT                   /old_locus_tag="BF0262"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Escherichia coli protein MraZ or B0081
FT                   SWALL:MRAZ_ECOLI (SWALL:P22186) (152 aa) fasta scores: E():
FT                   2.8e-08, 30.83% id in 120 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT3456
FT                   SWALL:AAO78562 (EMBL:AE016940) (156 aa) fasta scores: E():
FT                   3e-46, 78.8% id in 151 aa, and to Clostridium tetani MraZ
FT                   protein or CTC01636 SWALL:AAO36179 (EMBL:AE015941) (142 aa)
FT                   fasta scores: E(): 1.4e-09, 33.85% id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06037"
FT                   /db_xref="GOA:Q5LII9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LII9"
FT                   /protein_id="CAH06037.1"
FT                   /translation="MIRFLGNIEAKADAKGRVFIPAQFRRQLQSGSEDKLIMRKDVFQD
FT                   CLVLYPEEVWNEELDELRQRLNKWNANHQLIFRQFVSDVEIITMDGNGRILIPKRYLQI
FT                   TGIQSDVRFIGVDNKIEIWAKERAEKLFMEPKAFGAALEEIMKEERRTTNNELK"
FT   CDS_pept        complement(293840..294340)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0259"
FT                   /old_locus_tag="BF0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3610 SWALL:AAO78715 (EMBL:AE016941)
FT                   (156 aa) fasta scores: E(): 2.6e-09, 33.83% id in 133 aa,
FT                   and to Bacteroides thetaiotaomicron putative DNA-binding
FT                   protein BT0281 SWALL:AAO75388 (EMBL:AE016927) (213 aa)
FT                   fasta scores: E(): 5.9e-05, 26.53% id in 147 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06038"
FT                   /db_xref="GOA:Q5LII8"
FT                   /db_xref="InterPro:IPR005902"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR041607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII8"
FT                   /protein_id="CAH06038.1"
FT                   /translation="MSINYAVTKKVDKSKGIAKERYYATTRALQKKPVNSVQIANQLAE
FT                   RSSLQNGDVLSALTQLSDIIAAHLKEGRTVSIDGLGNFYPSITSEAVDKPEECTANKVW
FT                   VSRICFKAAPAFLNNVRKTDFVSLQLKYGRKSAKSQNGSDKETTDVIPHQQSISEDSSL
FT                   SDE"
FT   CDS_pept        294606..294785
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0260"
FT                   /old_locus_tag="BF0264"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII7"
FT                   /protein_id="CAH06039.1"
FT                   /translation="MLIWQDLYSVSTLMQMFDVILSPDSPVKEKYRAGFDSLREVINQD
FT                   SNPVLLKYRLKNAG"
FT   CDS_pept        complement(294884..295390)
FT                   /transl_table=11
FT                   /gene="sigE"
FT                   /locus_tag="BF9343_0261"
FT                   /old_locus_tag="BF0265"
FT                   /product="putative extracytoplasmic function alternative
FT                   sigma factor"
FT                   /note="Similar to Mycobacterium smegmatis extracytoplasmic
FT                   function alternative sigma factor SigE SWALL:O05767
FT                   (EMBL:U87307) (204 aa) fasta scores: E(): 3.2e-08, 29.41%
FT                   id in 153 aa, and to Bacteroides thetaiotaomicron RNA
FT                   polymerase ECF-type sigma factor BT3457 SWALL:AAO78563
FT                   (EMBL:AE016940) (167 aa) fasta scores: E(): 6.4e-58, 89.82%
FT                   id in 167 aa, and to Bacteroides thetaiotaomicron RNA
FT                   polymerase ECF-type sigma factor BT1197 SWALL:AAO76304
FT                   (EMBL:AE016930) (167 aa) fasta scores: E(): 7.4e-58, 92.16%
FT                   id in 166 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06040"
FT                   /db_xref="GOA:Q5LII6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII6"
FT                   /protein_id="CAH06040.1"
FT                   /translation="MKSLSFRKDLIGVQEELLRFAYKLTTDREEANDLLQETSLKALDN
FT                   EDKYTPDTNFKGWMYTIMRNIFINNYRKVVRDQTFVDQTDNLYHLSLPQESGLDSTESR
FT                   YDLKEMHRIVNSLPKEYKVPFSMHVSGFKYREIAEKLDLPLGTVKSRIFFTRQRLQEEL
FT                   KDFRQ"
FT   misc_feature    complement(294932..294997)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1049.000, SD 2.76 at aa 132-153, sequence
FT                   FKYREIAEKLDLPLGTVKSRIF"
FT   misc_feature    complement(295160..295363)
FT                   /note="Pfam match to entry PF04542 sigma70_r2, Sigma-70
FT                   region 2, score 53.0, E-value 5.4e-13"
FT   CDS_pept        295588..295929
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0262"
FT                   /old_locus_tag="BF0266"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1421 SWALL:AAO76528 (EMBL:AE016931) (104 aa)
FT                   fasta scores: E(): 1.4e-11, 41.23% id in 97 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06041"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII5"
FT                   /protein_id="CAH06041.1"
FT                   /translation="MGVKRNTRHRIWLAWMLLMTFMPLSVVKVFHNHSEETSITCTDAH
FT                   SGKSHHTCETCPICQFMLSPFIETPSTLLTYTPLYVKWESGTFQDKKLSIAFYPHYLRG
FT                   PPPVFYHIV"
FT   misc_feature    295588..295668
FT                   /note="Signal peptide predicted for BF0266 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.846) with cleavage site
FT                   probability 0.505 between residues 27 and 28"
FT   CDS_pept        296004..298163
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0263"
FT                   /old_locus_tag="BF0267"
FT                   /product="putative exported protein"
FT                   /note="Similar to Leptospira interrogans hemin receptor
FT                   LA3149 SWALL:Q8F1I6 (EMBL:AE011477) (777 aa) fasta scores:
FT                   E(): 7.1e-15, 26.54% id in 682 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT1420
FT                   SWALL:AAO76527 (EMBL:AE016931) (718 aa) fasta scores: E():
FT                   1.2e-207, 67.45% id in 719 aa, and to Caulobacter
FT                   crescentus TonB-dependent receptor CC0214 SWALL:Q9ABL3
FT                   (EMBL:AE005695) (687 aa) fasta scores: E(): 1e-13, 24.73%
FT                   id in 744 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06042"
FT                   /db_xref="GOA:Q5LII4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII4"
FT                   /protein_id="CAH06042.1"
FT                   /translation="MRIGFFSGMLGGLCLISTLHAQEPDSLKAVSLSEVVVTESYQHLK
FT                   NKNSTWHMEVVGKEFLREHFTGNLIQTLGTLPGVHSMDIGSGFSKPMIRGMGFNRISVV
FT                   ENGIKQEGQQWGADHGLELDAFNAGQVSIRKGPASLLYGSDAMGGAIELVPLPLPAGNR
FT                   LFGEASLLGKSVNGTLGGSLMLGIKKDAWYTWARYSEQHFGDYRIPTDTIVYLTQRMPV
FT                   YHRRLKNTAGFERDVSWAAGFRKERYVSSYWVSNVFQKTGFFPGAHGIPDVSRLQDDGD
FT                   SRNIELPYSQVNHLKVSTRQSLLYDKWALTWDIGFQKNHREEWSRFHTHYDAQPVPDKD
FT                   PDKELAFTLNTYSSAVKLKLFASAVWQHTAGWDVQYQRNTIAGYSFLLPAYRRFTTGAF
FT                   WMTTYRPGPTLSFSGGLRYDYGKIDASAYTDPYLAIYLREQGYGDEFIRKYEWRSYPVR
FT                   RHFGDYSGSLGLVWSPSGGHLLQVNVGHSFRLPGANELASNGVHHGTFRHEQGDAALAS
FT                   ERGWQFDVSYTYENGPLSVSLSPFVSWFSNYIFLRPTGEWSILPHAGQIYRYTGAEALF
FT                   AGGEAAVGIDFLRHFNYRVSGEYVYTYNCDEHIPLSFSPPASLRNTLTWRYKEFSIYGE
FT                   VQHIAAQHRVARNEDPTPGAQLLNAGVSANLRIGDIWVEVTLSARNLSGAKYFNHLSFY
FT                   RKVEIPEPGRNFQILIKVPFKSLLK"
FT   misc_feature    296004..296066
FT                   /note="Signal peptide predicted for BF0267 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT   misc_feature    296142..298145
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score 87.8, E-value 1.9e-23"
FT   CDS_pept        298160..298663
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0264"
FT                   /old_locus_tag="BF0268"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1419 SWALL:AAO76526 (EMBL:AE016931) (164 aa)
FT                   fasta scores: E(): 2e-33, 59.28% id in 167 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06043"
FT                   /db_xref="InterPro:IPR027829"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII3"
FT                   /protein_id="CAH06043.1"
FT                   /translation="MKTKNYLSIISILFFSFLFVSCSKEDEGDTIKPVIDLLEPEEGAI
FT                   LRIGSSHGVHFEMNLHDNEAIASYKINIHNNFDGHSHTRASEAGITKPFTFERTYTDKA
FT                   GQKDAYVHNHDIKIPADATPGNYHLMVYCLDQSGNETYVVRNIVLSVEGGEEGEHHHDE
FT                   HHHD"
FT   misc_feature    298160..298231
FT                   /note="Signal peptide predicted for BF0268 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.985) with cleavage site
FT                   probability 0.571 between residues 24 and 25"
FT   CDS_pept        298929..299747
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0265"
FT                   /old_locus_tag="BF0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3458 SWALL:AAO78564 (EMBL:AE016940)
FT                   (272 aa) fasta scores: E(): 1.1e-98, 87.13% id in 272 aa,
FT                   and to Shewanella oneidensis acyltransferase family protein
FT                   SO1238 SWALL:Q8EHI3 (EMBL:AE015568) (619 aa) fasta scores:
FT                   E(): 1.2e-13, 25% id in 272 aa, and to Vibrio cholerae
FT                   conserved hypothetical protein/hemolysin, putative VCA0646
FT                   SWALL:Q9KLU5 (EMBL:AE004394) (605 aa) fasta scores: E():
FT                   1.4e-11, 28.72% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06044"
FT                   /db_xref="GOA:Q5LII2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII2"
FT                   /protein_id="CAH06044.1"
FT                   /translation="MADDSLFLIDIDKILQTKAPKHYKYIPKFVVSYLKRIVHQEELNV
FT                   FLRDSKDKVGVDFLGACLEFLDAKLEVKGLENIPKDGLYTFVSNHPLGGQDGVSLGYIL
FT                   GRHFDGKVKYLVNDLLMNLHGLAPLCIPINKTGKQAKDFPKMVEAGFKSDDQLIMFPAG
FT                   LCSRRQNGVIRDLDWKKTFIVKSVQFQRGVIPVHFEGRNSDFFYNLANLCKALGIKFNI
FT                   AMLYLADEMLKNRHKTFTVTFGKPIPWQTFDKSKTPAEWAQYVKDIVYKL"
FT   CDS_pept        299778..300791
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0266"
FT                   /old_locus_tag="BF0270"
FT                   /product="putative hemolysin A"
FT                   /note="Similar to Prevotella melaninogenica hemolysin A
FT                   PhyA SWALL:Q51888 (EMBL:U27587) (332 aa) fasta scores: E():
FT                   2e-91, 69.56% id in 322 aa, and to Bacteroides
FT                   thetaiotaomicron hemolysin A BT3459 SWALL:AAO78565
FT                   (EMBL:AE016940) (337 aa) fasta scores: E(): 1.2e-112,
FT                   82.38% id in 335 aa, and to Shewanella oneidensis
FT                   acyltransferase family protein SO1238 SWALL:Q8EHI3
FT                   (EMBL:AE015568) (619 aa) fasta scores: E(): 9.6e-15, 31.62%
FT                   id in 313 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06045"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII1"
FT                   /protein_id="CAH06045.1"
FT                   /translation="MEEVIEPVSKELIIAELTEDKRLRMTNKSNNQIYIITYQDSPNIM
FT                   REIGRLREIAFRAAGGGTGLSMDIDEYDTMENPYKQLIVWNPEAEEILGGYRYILGTDV
FT                   RFDEHGAPVLATSHMFNFSDRFVKEFLPTTIELGRSFVTLEYQSTRAGSKGLFALDNLW
FT                   DGLGALTVVMPNVKYFFGKVTMYPSYHRQGRDMILYFLKKHFGDKDGLITPMKPLEMET
FT                   DEAELARIFCKDSFKDDYRILNGEIRKLGFNIPPLVNAYMSLSPTMRMFGTAINYGFGD
FT                   VEETGILIAVDEILEEKRMRHIESFVKNDPEDCQITSGVNKVFTPKVVTPQEDCSR"
FT   CDS_pept        complement(300763..302091)
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="BF9343_0267"
FT                   /old_locus_tag="BF0271"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="Similar to Salmonella typhimurium
FT                   deoxyguanosinetriphosphate triphosphohydrolase Dgt or
FT                   STM0208 SWALL:DGTP_SALTY (SWALL:P40733) (504 aa) fasta
FT                   scores: E(): 2.3e-11, 30.45% id in 509 aa, and to
FT                   Bacteroides thetaiotaomicron dGTP triphosphohydrolase
FT                   BT3460 SWALL:AAO78566 (EMBL:AE016940) (450 aa) fasta
FT                   scores: E(): 6.6e-150, 84.22% id in 450 aa, and to
FT                   Pseudomonas aeruginosa deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein Dgt2 or PA3043
FT                   SWALL:DGT2_PSEAE (SWALL:Q9HZG5) (443 aa) fasta scores: E():
FT                   2.9e-53, 37.36% id in 455 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06046"
FT                   /db_xref="GOA:Q5LII0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LII0"
FT                   /protein_id="CAH06046.1"
FT                   /translation="MMDWKRLISAKRFGMEEFHEERQENRSEFQRDYDRLVFSAPFRRL
FT                   QNKTQVFPLPGSIFVHNRLTHSLEVSCVGRSLGNDVSKAILARQPELQDSFLPEIGSIV
FT                   SAACLAHDLGNPPFGHSGEKAISTFFSEGKGAQLQEKLSPMEWNDLTHFEGNANAFRLL
FT                   THQFEGRRKGGFVLTYSTLASIVKYPFSSSLAGNKSKFGFFTTEEEGFRRIATELGLIQ
FT                   LSDRPLKYARHPLVYLVEAADDICYQMMDIEDAHKLKILTTEETKELLLAYFADERQTH
FT                   IRKTFDIVKDTNEQIAYLRSSVIGLLIKECTQVFLNNETEILSGTFEGALIKHISERPG
FT                   KAYKHCSEVSFSKIYRSRDVLDIELAGFRVINTLLELMIDAVTSPEKAYSQLLINRVSG
FT                   QYNIKAPALYERVQAVLDYISGMTDVFALDLYRKINGNSLPAV"
FT   misc_feature    complement(301714..301905)
FT                   /note="Pfam match to entry PF01966 HD, HD domain, score
FT                   19.9, E-value 6.5e-05"
FT   CDS_pept        302193..302627
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="BF9343_0268"
FT                   /old_locus_tag="BF0272"
FT                   /product="putative deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="Similar to Zymomonas mobilis deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut SWALL:DUT_ZYMMO
FT                   (SWALL:Q9X3X5) (146 aa) fasta scores: E(): 7.2e-24, 54.96%
FT                   id in 131 aa, and to Bacteroides thetaiotaomicron
FT                   deoxyuridine 5'-triphosphate nucleotidohydrolase BT3461
FT                   SWALL:AAO78567 (EMBL:AE016940) (144 aa) fasta scores: E():
FT                   3.3e-52, 91.66% id in 144 aa, and to Fusobacterium
FT                   nucleatum deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut or FN1028 SWALL:DUT_FUSNN (SWALL:Q8RER7) (146 aa) fasta
FT                   scores: E(): 1.7e-29, 58.04% id in 143 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06047"
FT                   /db_xref="GOA:Q5LIH9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LIH9"
FT                   /protein_id="CAH06047.1"
FT                   /translation="MNIQVINKSKHPLPAYATELSAGMDIRANISEPISLAPMQRCLVP
FT                   TGLFIALPQGFEAQIRPRSGLALKKGITVLNSPGTIDADYRGEICIILVNLSAETFVIE
FT                   DGERIAQMVIARHEQAVWKEVEVLDETERGAGGFGHTGRG"
FT   misc_feature    302217..302618
FT                   /note="Pfam match to entry PF00692 dUTPase, dUTPase, score
FT                   119.0, E-value 7.7e-33"
FT   CDS_pept        302658..304415
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0269"
FT                   /old_locus_tag="BF0273"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron TPR domain
FT                   protein BT3462 SWALL:Q8A244 (EMBL:AE016940) (584 aa) fasta
FT                   scores: E(): 1.4e-163, 72.94% id in 584 aa, and to
FT                   Porphyromonas gingivalis TPR domain protein PG0954
FT                   SWALL:AAQ66084 (EMBL:AE017175) (579 aa) fasta scores: E():
FT                   2.4e-51, 30.39% id in 556 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06048"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH8"
FT                   /protein_id="CAH06048.1"
FT                   /translation="MKINKLLFGMLLLLLASCGSSRKVEKQSEQVAVQEINLTPEQQRK
FT                   YDYFFLEASRLKVKKEYTAAFDLLQHCLAINPTGSAALYEIAQYYLFLKQAPQGQEALE
FT                   KAVAYAPDNYWYSQALAGLYQQQDQKEKAIGILEKMATRFPAKQDPLFNLLDLYNQKED
FT                   YGKVISTLNRIEEKTGKNEQITMEKFRIYLQMKDDKKAFEEIESLVNEYPMDYRYQVIL
FT                   GDVYMQNGKKQEAYDTYKKVLAAEPDNPMALFSLASYYEQTGQKELFEQQMDTLLLNRK
FT                   VPSDTKVNVMRQFIVQSEQEGKDSTQVIGLFDRMMQMDMDDVQIPMLYAQYLLSKGMEA
FT                   QSIPVLEQVVQIDPTNKAARMTLLGSAIRKNDYEQVIKICEPGIEATPDALEFYFYLVI
FT                   AYNQAEHWDDVLEVSRKALEHVTPESDKQMVSDFYTIIGDVYHTKKLMKEAYAAYDSAL
FT                   VYNPSNIGALNNYAYYLSVERRDLDKAEEMSYKTVKAAPNNATYLDTYAWILFEKGNYA
FT                   EARIYIDDAIKNTKPEEESSVVFEHCGDIYFMTGDVEGALKYWKKALELGTESKTLKQK
FT                   IEKKKYIAE"
FT   misc_feature    302658..302726
FT                   /note="Signal peptide predicted for BF0273 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.686 between residues 33 and 34"
FT   misc_feature    302895..302996
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   12.6, E-value 0.17"
FT   misc_feature    303303..303404
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   23.9, E-value 0.00033"
FT   misc_feature    303948..304049
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   20.4, E-value 0.0035"
FT   misc_feature    304266..304367
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   13.1, E-value 0.15"
FT   CDS_pept        304412..304999
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0270"
FT                   /old_locus_tag="BF0274"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3463 SWALL:AAO78569 (EMBL:AE016940) (193 aa)
FT                   fasta scores: E(): 9.7e-35, 59.14% id in 186 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06049"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH7"
FT                   /protein_id="CAH06049.1"
FT                   /translation="MKGSKLKQTVIKQSYLLPLLLMVVLLAGCKTSKVVKTTPVEPAYL
FT                   SSKLQLTVPNKNGSMTVSGSMKMKSGERIQLSVLMPVFRSEVMRMEVTPDEVLLIDRMN
FT                   KRYVRATRDELKGILPENADFDRLEKLLFKASLPGEKKELTGRELGIPSLEKAKVRLSD
FT                   FSTAEFELIPTEVSSRYTQVALEDLLKMLMKL"
FT   misc_feature    304412..304519
FT                   /note="Signal peptide predicted for BF0274 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.921) with cleavage site
FT                   probability 0.429 between residues 36 and 37"
FT   misc_feature    304466..304498
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        304996..306309
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0271"
FT                   /old_locus_tag="BF0275"
FT                   /product="putative exported peptidase"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   peptidase BT3464 SWALL:AAO78570 (EMBL:AE016940) (435 aa)
FT                   fasta scores: E(): 1.4e-99, 80.77% id in 437 aa, and to
FT                   Chlorobium tepidum zinc metalloendopeptidase CT0558
FT                   SWALL:Q8KEX4 (EMBL:AE012830) (303 aa) fasta scores: E():
FT                   4e-09, 28.57% id in 301 aa, and to Pseudomonas syringae
FT                   peptidase, M23/M37 family PSPTO5328 SWALL:AAO58754
FT                   (EMBL:AE016875) (440 aa) fasta scores: E(): 8.8e-09, 23.04%
FT                   id in 447 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06050"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH6"
FT                   /protein_id="CAH06050.1"
FT                   /translation="MNRFLLILISCLCLTTTISAQSNKLIKELESKRGALQQQIAETES
FT                   LLKNTKKDVGSQLNGLAVLTGQIEERKRYIIAINNDVEAVGREIAGLERQLRGLQRDLK
FT                   DKKKKYESSVQYLYKNKSVEEKLMFIFSAKSLGQTYRRLRYVREYATYQRLQGEEILKK
FT                   QEQVNRKKKELQQVKVAKENLLREREGEKAKLEAQEKEKREIVAGLQKKQKGLQSEISK
FT                   KRREANQLNAKIDKLIAEEIERARKRAEEEARREEAARRKAAAKESKSSSTGGGTVPAK
FT                   KKAEPLERFTMSKADRELSGNFVSNRGKLPMPITGPYIITSHYGQYAVEGLRNVKLDNK
FT                   GIDIQGKPGAQARAIFDGKVAAVFQLNGLFNVLIRHGDYISVYCNLSSASVKSGDTVTT
FT                   RQAIGPIFSDGSDNGRTVLHFQLRRERDKLNPEPWLNR"
FT   misc_feature    304996..305055
FT                   /note="Signal peptide predicted for BF0275 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.813 between residues 20 and 21"
FT   misc_feature    306052..306297
FT                   /note="Pfam match to entry PF01551 Peptidase_M37, Peptidase
FT                   family M23/M37, score 21.6, E-value 9.7e-06"
FT   CDS_pept        306379..310368
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0272"
FT                   /old_locus_tag="BF0276"
FT                   /product="putative two-component system sensor histidine
FT                   kinase/response regulator fusion protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   two-component system sensor histidine kinase/response
FT                   regulator, hybrid BT3465 SWALL:AAO78571 (EMBL:AE016940)
FT                   (1345 aa) fasta scores: E(): 0, 68.97% id in 1331 aa, and
FT                   to Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase/response regulator, hybrid BT2923
FT                   SWALL:AAO78029 (EMBL:AE016938) (1338 aa) fasta scores: E():
FT                   7.8e-173, 37.77% id in 1337 aa, and to Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT2897 SWALL:AAO78003
FT                   (EMBL:AE016938) (1326 aa) fasta scores: E(): 5.5e-164,
FT                   37.48% id in 1358 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06051"
FT                   /db_xref="GOA:Q5LIH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH5"
FT                   /protein_id="CAH06051.1"
FT                   /translation="MRIITLLITLFAFGITPLQAFSYFSFKKYQVEDGLSHNTVWCAMQ
FT                   DSYGFIWLGTSDGLNCYNGRGNKVYRNVLNDKFSLENNFVQALFEEENHNIWVGTNWGL
FT                   YIYDREYDRFTYFDKKTRYGVFISSEIKKIIKSESGLIWIATLGQGLFVYNPQTDVLTQ
FT                   NSLQTSFVWDVCENNSGHIYASSLQEGLLCFDENGKFLQSYPLLSAGNNPDNYRINCLL
FT                   DIRSDIWFGAGSNLLYCLNERTGNLDCYNASHLNFGAIRCLLNYSETELLVGTDNGLYL
FT                   FDLHDKNFSRIDNPSDPRSLSDQSINAMMRDAEGGIWVLTNLGGVNYLAKPTKRFDYYP
FT                   PVYRDGGVAAGKVVGPFCENAAGDIWVGTRDGLCFFDVSTHQLTAYPIGGGVDKKYDIR
FT                   SLLLDGERLWIGTYAEGLKVLDLRTGHVKSYNHLQDTPNTICSDDVLAVYKDRSGDIFV
FT                   GTSWGLCRYNPREDNFSTITTVGSMVSVVDILEDMYDNLWIGTSNSGVFRFNTRNGHWK
FT                   HFQHERNDSTTITNNSVITLFEDLKGTMWVGTNGGGLCSFDPKTETFIDFDPDNTILPN
FT                   RVIYSIEQDKTGDFWISSNAGLITINPITKQHFRQFTVNDGLQGNQFTAQSSLKTASGK
FT                   LYFGGISGFNSFVPDQFMDNQYIPSVYITEIRLPYTTDERLVQDILHLKGPLYRAETIT
FT                   LPYEHNTFSVSFVALSYEDPLKNRYSYRLKGVDKEWVINSEQNTASYTNLPPGKYEFEV
FT                   RGSNNDHKWNDQTTSLLIVVTPPWWLTIWAYCVYTLLLLGLAYYAGWHWNRHVKKKYKR
FT                   RMEEYQTTKEKEVYKSKISFFINLVHEIRTPLSLIRLPLEKLLEDKREGRDAKYLSVID
FT                   RNVNYLLGITNQLLDFQKMENGGVQLSLKKCDINQLVSDVHSQFTSPAELKGISVMLDL
FT                   PEGEIFASVDREKVCKIIVNLIGNAVKYAQSRIDIKLVSSDEGFRVSVSDDGPGIPDVE
FT                   KRKVFEAFYQVKDGKSGAVGTGIGLAFSKSLAEAHHGTLSLEDSVYGGSSFVLTLPWGE
FT                   EAVSEEPEVVIPDGREAADEEQGTELSGSKFTILLVEDNVDLLNLTRESLSTWFKVLKA
FT                   QNGRQALEVLANETVDVIVSDVMMPEMNGLELTAKVKSDIEYSHIPVILLTAKTTLEAK
FT                   VEGFECGADVYIEKPFSIRQLRKQIENLLKLRQAFHKMMAELSGGNGAAPISPVEYSVS
FT                   QKDCELMAKVRAAVEAQLSDENFSVDTLAESLNMSRSNFYRKIKALAGMPPNDYLKTIR
FT                   LNKAAELLKSGVRITEVCEKIGFSSSSYFAKCFKIQFGVLPKDYH"
FT   misc_feature    306379..306438
FT                   /note="Signal peptide predicted for BF0276 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.549 between residues 20 and 21"
FT   misc_feature    308710..308778
FT                   /note="1 probable transmembrane helix predicted for BF0276
FT                   by TMHMM2.0 at aa 778-800"
FT   misc_feature    308860..309057
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 60.3, E-value 3.5e-15"
FT   misc_feature    309193..309519
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 120.7,
FT                   E-value 2.4e-33"
FT   misc_feature    309613..309975
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 121.9, E-value 1e-33"
FT   misc_feature    309622..309687
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1055.000, SD 3.43 at aa 1082-1103, sequence
FT                   LLVEDNVDLLNLTRESLSTWFK"
FT   misc_feature    309622..310185
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1246.000, SD 3.43 at aa 1082-1269, sequence
FT                   LLVEDNVDLLNLTRESLSTWFKVLKAQNGRQALEVLANETVDVIVSDVMMPEMNGLE
FT                   LTAKVKSDIEYSHIPVILLTAKTTLEAKVEGFECGADVYIEKPFSIRQLRKQIENLL
FT                   KLRQAFHKMMAELSGGNGAAPISPVEYSVSQKDCELMAKVRAAVEAQLSDENFSVDT
FT                   LAESLNMSRSNFYRKIK"
FT   misc_feature    310081..310221
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   33.5, E-value 4.1e-07"
FT   misc_feature    310120..310185
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1246.000, SD 3.43 at aa 1248-1269, sequence
FT                   FSVDTLAESLNMSRSNFYRKIK"
FT   misc_feature    310228..310353
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    310240..310365
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   28.9, E-value 1e-05"
FT   CDS_pept        complement(310550..311626)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0273"
FT                   /old_locus_tag="BF0277"
FT                   /product="putative exported protein"
FT                   /note="Similar to Streptomyces chartreusis
FT                   alpha-L-arabinofuranosidase II precursor SWALL:ABF2_STRCX
FT                   (SWALL:P82594) (328 aa) fasta scores: E(): 2.7e-06, 33.33%
FT                   id in 324 aa, and to Bacteroides thetaiotaomicron putative
FT                   glycosylhydrolase BT3515 SWALL:AAO78621 (EMBL:AE016941)
FT                   (389 aa) fasta scores: E(): 2e-115, 73.48% id in 347 aa,
FT                   and to Bacteroides thetaiotaomicron putative
FT                   glycosylhydrolase BT3467 SWALL:AAO78573 (EMBL:AE016940)
FT                   (365 aa) fasta scores: E(): 9.9e-95, 60.57% id in 350 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06052"
FT                   /db_xref="GOA:Q5LIH4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH4"
FT                   /protein_id="CAH06052.1"
FT                   /translation="MKLKHIPLLLLVLTCCPACQNKKASATKEIPSEATYTNPLLAVGA
FT                   EPWAVFHEGKYYYTQGAENKIILWETNDITDLEHAARKEVWIPKEISNSYHLWGPEIHR
FT                   IDGKWYVYFAADDGNMDNHHIYVIENSSPNPLEGEFVMKGRIKTDKDDNWAIHASTFEH
FT                   QGQRYLIWCGWPKRRIETETQCIYIARMENPWTLSSDRVMIAEPEYEWERQWISPDGSK
FT                   TAYPIHVNESPQFFESKNKDKVLIYYCASGSWTPYYCIGLLTADAGSDLTNAASWKKQD
FT                   TPVFEQQPEDSVFGPGSPSFVPTPDEKEWYMLYHARKIPNDAPGATDSRSPRLQKISWD
FT                   ANGMPVLGKPCKEGTQIK"
FT   misc_feature    complement(311564..311626)
FT                   /note="Signal peptide predicted for BF0277 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.991) with cleavage site
FT                   probability 0.537 between residues 21 and 22"
FT   CDS_pept        complement(311708..314206)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0274"
FT                   /old_locus_tag="BF0278"
FT                   /product="putative beta-glucosidase"
FT                   /note="Similar to Agrobacterium tumefaciens
FT                   beta-glucosidase cbg-1 with an N-terminal extension
FT                   SWALL:BGLS_AGRTU (SWALL:P27034) (818 aa) fasta scores: E():
FT                   1.8e-62, 37.88% id in 821 aa, and to Bacteroides
FT                   thetaiotaomicron beta-glucosidase BT3300 SWALL:AAO78406
FT                   (EMBL:AE016940) (825 aa) fasta scores: E(): 0, 61.12% id in
FT                   818 aa, and to Rhizobium etli hypothetical protein BglS
FT                   SWALL:Q8KKX3 (EMBL:U80928) (814 aa) fasta scores: E():
FT                   1.1e-91, 36.66% id in 821 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06053"
FT                   /db_xref="GOA:Q5LIH3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH3"
FT                   /protein_id="CAH06053.1"
FT                   /translation="MKATTSLATSCRRLLLWGVLTLQCLFSTAQKRFTADVEQQAEKIL
FT                   SQMTLDEKLSYIGGINWMYTRPLERFGIPRLKMSDGPQGLGTHGPSTAYPCALMLAATW
FT                   NEQLATEYGSALGKDCRARGVHVLLGPAVNIYRAPMCGRNFEYMGEDPYLTSRMATGYI
FT                   KGVQGQGVMATIKHFIANNSDYDRDHISSDIDERTLNEIYFPSFRAAVQEAEVGAVMSS
FT                   YNLLNGIYTTEHPWLLKDVLRQQWGFKGILMSDWGSTHHCIPAVKGGLDLEMPAGSKMQ
FT                   PEELKYYLRTGDITIETIDEKVRHILQTLLAFGFRETQQPDTHIPLKNPQCAQTALNVA
FT                   SEGLVLLKNTNQILPIRSGKVKTIAVVGKNAQGYVCGGGSGEVHPFQYVSVLDGIRKEA
FT                   AERDIRVEYLDVYDYLPTIIFTDTERKQKGFRAQYFDNMNLEGTPKVEQTETKINYSWS
FT                   GGTGLKEMPKEQFSVRWNGTICPQETDEYLFTLGGDDGYRLYIDGKLIADEWHEGAFRN
FT                   STYRCMLEAGKKYDLKIEYFQKGGGAAVNFIWKQKNASNNLFVEALNRNDLVVACIGFN
FT                   SDTEGEGRDRTFELPEDEAQLLQNTLQSKRPVVGIVNAGGNVEMQSWEPSLKGLLWAWY
FT                   GGQEAGTAIARTLFGELNPSGKLPITFEKRWEDNPTFHSYYDPDGDKHVEYAEGIFVGY
FT                   RGYDKLKREVQYPFGYGLSYTRFKLSAPTVGTPKTDGSVTVTCKLTNTGRTAGAEVVQL
FT                   YVSNKDTTVEHPEKELKGFRKVYLEPGETKSIEITVPAEAFSHYDTGSRRFVIDRGSHD
FT                   ILLGFSSRDIKAKMSVGISR"
FT   misc_feature    complement(312059..313177)
FT                   /note="Pfam match to entry PF01915 Glyco_hydro_3_C,
FT                   Glycosyl hydrolase family 3 C terminal domain, score 119.9,
FT                   E-value 4.1e-33"
FT   misc_feature    complement(313331..314098)
FT                   /note="Pfam match to entry PF00933 Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3 N terminal domain, score 356.4, E-value
FT                   2.6e-104"
FT   misc_feature    complement(313433..313486)
FT                   /note="PS00775 Glycosyl hydrolases family 3 active site."
FT   CDS_pept        complement(314349..315515)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0275"
FT                   /old_locus_tag="BF0279"
FT                   /product="putative glycosylhydrolase"
FT                   /note="Similar to Bacillus circulans alpha-1,6-mannanase
FT                   precursor AmaN6 SWALL:Q9Z4P9 (EMBL:AB024331) (589 aa) fasta
FT                   scores: E(): 1.6e-15, 27.24% id in 345 aa, and to
FT                   Bacteroides thetaiotaomicron putative hydrolase BT2631
FT                   SWALL:AAO77738 (EMBL:AE016936) (385 aa) fasta scores: E():
FT                   2.8e-91, 57.94% id in 390 aa, and to Bacteroides
FT                   thetaiotaomicron putative hydrolase BT3782 SWALL:AAO78887
FT                   (EMBL:AE016942) (387 aa) fasta scores: E(): 2.6e-89, 58.02%
FT                   id in 374 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06054"
FT                   /db_xref="GOA:Q5LIH2"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH2"
FT                   /protein_id="CAH06054.1"
FT                   /translation="MRKSFIALTFLLVPACLSAQLGGKIYLQRADSLLQRVLSLYEVKK
FT                   YGLLMETYPRNPKQQITYTANTGSEVTQQEVSFLWPYSAMVSGCVSLYKTSGNKKYKKL
FT                   MDKQIKPGLDLYWDTTRQPECYQSYPAFAGQNDRYYDDNDWVAIDFCDYYAVTKNKEYL
FT                   KKAIALHDYIYSGWSDELGGGIYWCEQKKESKNTCSNAPATVLCMKLYKLTKDKKYLDQ
FT                   AMATYQWTRDNLRDPSDFVYWDNKNLQGKIGYAKYTYNSGQMIQAGVLLYQATGDEQYL
FT                   KDAQQTAKGSYEHFLKPQPTVKGEMKFFPSSPWFNVILFRGLKALYKVDKNDTYVKAMI
FT                   DNADYAWQYTRDENGLLNNDWSGNRKDKFKSLLENSCMIELYSEISEL"
FT   misc_feature    complement(314385..315362)
FT                   /note="Pfam match to entry PF03663 Glyco_hydro_76, Glycosyl
FT                   hydrolase family 76, score -117.1, E-value 1.4e-07"
FT   misc_feature    complement(315459..315515)
FT                   /note="Signal peptide predicted for BF0279 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.367 between residues 19 and 20"
FT   CDS_pept        complement(315731..317515)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0276"
FT                   /old_locus_tag="BF0280"
FT                   /product="putative exported glycosylhydrolase"
FT                   /note="Similar to Escherichia coli beta-glucuronidase UidA
FT                   or GusA or GurA or B1617 SWALL:BGLR_ECOLI (SWALL:P05804)
FT                   (603 aa) fasta scores: E(): 1.6e-16, 24.44% id in 589 aa,
FT                   and to Bacteroides thetaiotaomicron beta-glucuronidase
FT                   BT3292 SWALL:AAO78398 (EMBL:AE016939) (591 aa) fasta
FT                   scores: E(): 3.3e-122, 56.54% id in 596 aa, and to
FT                   Streptomyces coelicolor putative hydrolase SCO7506 or
FT                   SCBAC17A6.39 SWALL:Q93J91 (EMBL:AL939131) (606 aa) fasta
FT                   scores: E(): 1.2e-73, 43.8% id in 589 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06055"
FT                   /db_xref="GOA:Q5LIH1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH1"
FT                   /protein_id="CAH06055.1"
FT                   /translation="MKKLLAAAMLFMLNSWSCFSADTPRAEYPRPQFEREQWLNLNGTW
FT                   TFDFDFGKSGKDRRLQSAEKFDKNITVPFCPESKLSGVGYTDFIEQMWYQRNITIPSDW
FT                   NGKKIFLNFGAVDYCAEIYVDGKFVQRHFGGSSSFAVDLTRYVTPGKTHNLVVFVQDDL
FT                   RSGLQTGGKQCGNYYSGGCSYTRTTGIWQTVWMEAVSTDGLKSVFVRPDIDQKQLIIEP
FT                   EFYNESANTLEIILKDGNKTVAKKSVNCANSSVVVLPVKNMKLWSPEDPFLYDLVYQVK
FT                   DAKGNVLDEVKSYAGMRKVHTANGRFYLNNQPYFQRLVLDQGFYPEGIWTAPSDEDLKN
FT                   DIVLGKEAGFNGARLHQKVFEERYYYWADKLGYITWGESASWMLDVNKELAARNFLGEW
FT                   SEVVVRDRNHPSLVTWTPFNETWGGGPDAYVRLVRDVYNITKAIDPTRPVNDASGDNHV
FT                   ITDIWSVHNYEQDRAKLTEQLKMEEGKEPYRNARDKDFLAVYEGQPYMVDEFGGIPWMA
FT                   EKDRKNSWGYGGMPENAEAFYKRLEGQIDAFIDSPHVTGFCYTQLTDVEQEKNGIYYYD
FT                   RTPKLDMKRIKAIFEKIK"
FT   misc_feature    complement(315734..316618)
FT                   /note="Pfam match to entry PF02836 Glyco_hydro_2_C,
FT                   Glycosyl hydrolases family 2, TIM barrel domain, score
FT                   -85.8, E-value 1.9e-06"
FT   misc_feature    complement(316622..316669)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   misc_feature    complement(316622..316906)
FT                   /note="Pfam match to entry PF00703 Glyco_hydro_2, Glycosyl
FT                   hydrolases family 2, immunoglobulin-like beta-sandwich
FT                   domain, score 38.2, E-value 1.6e-08"
FT   misc_feature    complement(316916..317461)
FT                   /note="Pfam match to entry PF02837 Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2, sugar binding domain, score
FT                   -36.8, E-value 5e-05"
FT   misc_feature    complement(317456..317515)
FT                   /note="Signal peptide predicted for BF0280 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.987 between residues 20 and 21"
FT   CDS_pept        complement(317632..319668)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0277"
FT                   /old_locus_tag="BF0281"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3531 SWALL:Q8A1X7 (EMBL:AE016941)
FT                   (687 aa) fasta scores: E(): 8.6e-59, 35.53% id in 712 aa,
FT                   and to Arabidopsis thaliana hypothetical protein t24h18_120
FT                   SWALL:Q9LXU4 (EMBL:AL353013) (861 aa) fasta scores: E():
FT                   1.2e-10, 22.77% id in 606 aa, and to Rhizobium meliloti
FT                   hypothetical protein rb1544 or smb20631 SWALL:Q92TH5
FT                   (EMBL:AL603647) (640 aa) fasta scores: E(): 1.5e-10, 24.87%
FT                   id in 575 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06056"
FT                   /db_xref="GOA:Q5LIH0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIH0"
FT                   /protein_id="CAH06056.1"
FT                   /translation="MKKKNTFTYLLIGLGLCFSSLGSGLRADTPENYTNNRYPLVRKPL
FT                   MELPLGSIKAKGWLQEMLVRQKNGATGQMDKLYPLVMGERNGWLGGDGDQWERGPYWID
FT                   GLLPLAYILDDAQLKAKVQPWIEWALKSQREDGFFGPAKDYPGEAGIQRDNSHDWWPRM
FT                   VMLKILQQYYSATNDQRVIRFMTDYFRYQLKTLPEKPLGNWTFWAEFRACDNLQAVYWL
FT                   YNITGDSFLLDLGKLIHQQSFSFVDMVNRGDLKRINTIHCVNLAQGIKEPVIYYQQEPD
FT                   KMYLDAVKRAFRDIRQFHGQPQGMYGGDEALHGNNPTQGSELCSAVELMYSLEKMVEIT
FT                   GDIDFADHLERIAFNALPTQISDDFMTKQYFQQANQVMVSRHRRNFDQDHGGTDNCFGL
FT                   LTGYPCCASNMHQGWPKFTQSLWYATPDGGLAVTAYAPSEVTAKVADGCTVTFSEETYY
FT                   PMDDKISFTLQSMDKKRKEVNFALQLRIPKWCKQAGISVNGQLLQHAEGGRMAIVNRNW
FT                   KKGDRVELHLPMEVTASTWYENSVTIERGPLVFALKMEEKWEKKEFEEPWYGPYYYSVT
FT                   PTEPWNYGLVDFNRNKANEHARVTIHTEKQSSVFPWNKENAPIEIRMKARLVPSWKLYN
FT                   EMAGPQPYSFCSGGEGPETEITLIPYGCTTLRITEFPVVGASR"
FT   misc_feature    complement(319588..319668)
FT                   /note="Signal peptide predicted for BF0281 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.672 between residues 27 and 28"
FT   CDS_pept        complement(319706..321769)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0278"
FT                   /old_locus_tag="BF0282"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3531 SWALL:AAO78637 (EMBL:AE016941)
FT                   (687 aa) fasta scores: E(): 0, 79.03% id in 687 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT1003 SWALL:AAO76110 (EMBL:AE016930) (698 aa) fasta
FT                   scores: E(): 6.7e-13, 31.35% id in 236 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT0137 SWALL:AAO75244 (EMBL:AE016926) (641 aa) fasta
FT                   scores: E(): 6.6e-12, 26.49% id in 453 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06057"
FT                   /db_xref="GOA:Q5LIG9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG9"
FT                   /protein_id="CAH06057.1"
FT                   /translation="MKKMKSLKGGLAGILFTAGLLAASCTSDQSSSAVTIVNRPDCTQT
FT                   NVNYVGNRLPLKPMNFIKLPVGSIQPEGWLKKYLELQKDGLTGHLNEISAWLGKENNAW
FT                   LTKGGDHGWEEVPYWLKGYGNLAYILKDQKMIDEAKVWLEGAFASQQPDGYFGPINERN
FT                   GKRELWAQMIMLWCLQSYYEYSNDQRVIDLMTNYFKWQLSVPDEQFLEDYWENSRGGDN
FT                   LLSVYWLYNRTGDQFLLELAEKIHRNTADWTRPSALPNWHNVNIAQCFREPATYYMMTG
FT                   DSAMLKASYNVHNLIRRTFGQVPGGMFGADENARMGSIDPRQGVETCGLVEQMASDELM
FT                   LCMTGDPLWAEHCEEVAFNSYPAAVMPDFKGLRYITCPNQTVSDSKNHHPGIDNRGPFL
FT                   AMNPFSSRCCQHNHAQGWPYYAEHLILATPDNGVAAAMYAACKATVKVGDGNEITLHEQ
FT                   TNYPFEETIRFTVNTPKAVSFPFYLRIPSWTEGATIFVNGKKVAANPEAGQYACINREW
FT                   KDNDQVEIQLPMQLSMRTWQVNKNSVSVDYGPLTMSLKIDEDYVKKDSRATAIGDSKWQ
FT                   EGADASQWPTYEIYAKTPWNYALVLGKNEPLKDFKVVHKEWPADNFPFTVASTPIEVKA
FT                   IGRKVPSWVIDQYDLCSELPEMDAPKGEKEEITLIPMGAARLRVSAFPNTRE"
FT   misc_feature    complement(321689..321769)
FT                   /note="Signal peptide predicted for BF0282 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.349 between residues 27 and 28"
FT   CDS_pept        322047..323153
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0279"
FT                   /old_locus_tag="BF0283"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   glycosylhydrolase BT3467 SWALL:AAO78573 (EMBL:AE016940)
FT                   (365 aa) fasta scores: E(): 2.2e-113, 68.57% id in 366 aa,
FT                   and to Bacteroides thetaiotaomicron putative
FT                   glycosylhydrolase BT3515 SWALL:AAO78621 (EMBL:AE016941)
FT                   (389 aa) fasta scores: E(): 7.1e-102, 61.64% id in 365 aa,
FT                   and to Bacteroides thetaiotaomicron putative
FT                   glycosyslhydrolase BT2912 SWALL:AAO78018 (EMBL:AE016938)
FT                   (1544 aa) fasta scores: E(): 4.7e-32, 38.33% id in 360 aa,
FT                   and to Clostridium acetobutylicum beta-xylosidase, family
FT                   43 glycosyl hydrolase CAC1529 SWALL:Q97IW1 (EMBL:AE007663)
FT                   (327 aa) fasta scores: E(): 2.4e-18, 38.39% id in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06058"
FT                   /db_xref="GOA:Q5LIG8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG8"
FT                   /protein_id="CAH06058.1"
FT                   /translation="MKTKIYLLFITTLFFCAGCGNKSGGQKQESVSAAKDTYVNPLFPE
FT                   GADPSALFHNGKYYYTHGTEDKIMLWETSDITDMAHAVCKIVWKPQDPSNSCHLWAPEI
FT                   HYINDKWYIYYAADDGNTDNHQLYVLENSSPDPMEGKFEMKGSIITNPEWNWGIQATTF
FT                   EHKGVRYLAWSGWSKRRTNAETQCIYIARMKDPWTLDSPRVLISKPEYEWERQWVNPDG
FT                   SRTAYPIYVNEGPQFFHSKDNKTLILYYAASGSWSPYYCVGMLTADAESDLLDPASWTK
FT                   SSVPVFQQSLENEVYGPGGLSFVPSPDGTEWYMIYHARQVTNGDTGSPETRNPRIQKIG
FT                   WDAHGMPDLGIPVRAGVALPKPSGTLLK"
FT   misc_feature    322047..322118
FT                   /note="Signal peptide predicted for BF0283 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.964) with cleavage site
FT                   probability 0.560 between residues 24 and 25"
FT   CDS_pept        323256..325070
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0280"
FT                   /old_locus_tag="BF0284"
FT                   /product="putative exported glycosylhydrolase"
FT                   /note="Similar to Thermoanaerobacter ethanolicus
FT                   beta-galactosidase LacZ or LacA SWALL:BGAL_THEET
FT                   (SWALL:P77989) (743 aa) fasta scores: E(): 1.9e-13, 25.83%
FT                   id in 391 aa, and to Bacteroides thetaiotaomicron
FT                   beta-galactosidase BT3513 SWALL:AAO78619 (EMBL:AE016940)
FT                   (604 aa) fasta scores: E(): 7e-190, 70.46% id in 606 aa,
FT                   and to Bacteroides thetaiotaomicron beta-galactosidase
FT                   BT2922 SWALL:AAO78028 (EMBL:AE016938) (604 aa) fasta
FT                   scores: E(): 6.2e-185, 69.91% id in 585 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06059"
FT                   /db_xref="GOA:Q5LIG7"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG7"
FT                   /protein_id="CAH06059.1"
FT                   /translation="MKKSILIAVLTASIATSAFAQWKPAGDKIKTKWAEQVNPENVLPE
FT                   YPRPVMERGEWKNLNGLWNYAITEKGAAPSAYEGQILVPFAIESSLSGVGKKVGPDKEL
FT                   WYQRTFTVPASWKGKKVMLNFGAVDWKADIWVNDIKVGQHTGGFTPFSLDITAALATKG
FT                   DNKLVVKVWDPTDRGPQPRGKQVNRPEGIWYTAVTGIWQTVWMEPVAERHITNVRTTSD
FT                   IDRKKLTVDVTTSTSCPSEVVEVKVFDGKQLVATGKGLNGQTIDIQMPADAKLWSPASP
FT                   TLYSMQIALLSNGKVTDKVDSYTAMRKYSTRRDKDGIVRLQLNNEDVFQFGPLDQGWWP
FT                   DGLYTAPTDEALVYDIQKTKDFGFNMIRKHVKVEPARWYTHCDKLGIIVWQDMPNGDRE
FT                   PEWQMYNYFTGNELNRSEESEQIYRKEWKEIMDYLYNYPCIGVWVPFNERWGQFKTEDI
FT                   ATWTKKYDPSRLVNPASGGNHFPCGDILDLHHYPNPSLDFYDAGRATVLGEYGGIGLAL
FT                   NEHLWEPNHNWGYVKFNSPEEVTKQYVEYGNELYRLISRGFSAAVYTQTTDVEMEVNGL
FT                   MTYDRKVIKVNEAQVKAINTKICNSLNK"
FT   misc_feature    323256..323315
FT                   /note="Signal peptide predicted for BF0284 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   misc_feature    323358..323822
FT                   /note="Pfam match to entry PF02837 Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2, sugar binding domain, score
FT                   -25.7, E-value 7.1e-06"
FT   misc_feature    323889..324176
FT                   /note="Pfam match to entry PF00703 Glyco_hydro_2, Glycosyl
FT                   hydrolases family 2, immunoglobulin-like beta-sandwich
FT                   domain, score 20.2, E-value 5.5e-05"
FT   CDS_pept        325166..327676
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0281"
FT                   /old_locus_tag="BF0285"
FT                   /product="putative exported glutaminase"
FT                   /note="Similar to Aspergillus oryzae glutaminase A GtaA
FT                   SWALL:Q9UVX9 (EMBL:AB029552) (690 aa) fasta scores: E():
FT                   1.1e-51, 30.34% id in 603 aa, and to Bacteroides
FT                   thetaiotaomicron glutaminase A BT3477 SWALL:AAO78583
FT                   (EMBL:AE016940) (840 aa) fasta scores: E(): 0, 71.29% id in
FT                   836 aa, and to Bacteroides thetaiotaomicron glutaminase A
FT                   BT3512 SWALL:AAO78618 (EMBL:AE016940) (837 aa) fasta
FT                   scores: E(): 0, 66.74% id in 836 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06060"
FT                   /db_xref="GOA:Q5LIG6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR032515"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG6"
FT                   /protein_id="CAH06060.1"
FT                   /translation="MKKLFTMALAVGMLCNAQAADLYKASRNVALRAPAVPLITSDPYL
FT                   SIWSPTDALNESSTMHWTGTEHPLLGAIRVDGKTYRFMGKDKLNLETLVPMTDTDTWQG
FT                   SYTFDEPAAGWNALSFNAAGWKEGQGAFGTPDMPRVHTRWTTPDIWVRRDFQINDDMNG
FT                   ETIYLKYSHDDVFELYLNGEKLVATDYSWNNDVLLELSDAAKKKLQKGKNVLAAHCHNT
FT                   TGGAYVDFGLYRLNKQTTGFETAAVQKSVSVLPTQTYYTFTCGPVELDLVFTAPLMMDD
FT                   LDLLSTPVNYISYRVRSLDKKQHDVQMYVETTPQLAINELTQPTRSKVIRRNGINYVQA
FT                   GTIDQPILARKGDGICIDWGYAYLAGNIGANTAVSLGNYYGMKNEFVTKGSLLPTQAEC
FT                   VTRRADQMPAMAYTDDLGKVGTDGKSGFLMLGYDDIYAIEYFYQPRMAYWKHDGKVSIF
FT                   DAFERAKANYASVMERCRAYDEMILNDAEKAGGKEYSELCALAYRQVIAAHKLFKDADG
FT                   NLLFFSKENNSNGCINTVDLTYPSAPLFLAYNPELQKGMMTSIFEYSASGRWNKPFPAH
FT                   DLGTYPIANGQVYGGDMPIEEGGNMVVLAAAIAKVEGNADYAKKYWDLLTIWTDYLAEY
FT                   GQDPENQLCTDDFAGHWAHNANLSVKAIMGVAAYSEMARMLGMDDVADRYAAKAKAMAT
FT                   KWEQMAREGDHYRLAFDRENTWSQKYNMVWDKMWNLNLFPNNVIEKEISYYQTKLQNPY
FT                   GLPLDSRKEYTKSDWIMWTAAMSSDKATFEKFISPVYKYANETVSRVPLSDWHHTDSGK
FT                   FVGFKARSVIGGYWMKVLMDKMQK"
FT   misc_feature    325166..325222
FT                   /note="Signal peptide predicted for BF0285 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 19 and 20"
FT   misc_feature    325379..325402
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(327825..330293)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0282"
FT                   /old_locus_tag="BF0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4324 SWALL:AAO79429 (EMBL:AE016944)
FT                   (880 aa) fasta scores: E(): 1.5e-31, 24.88% id in 896 aa,
FT                   and to Bacteroides thetaiotaomicron hypothetical protein
FT                   BT1591 SWALL:AAO76698 (EMBL:AE016932) (910 aa) fasta
FT                   scores: E(): 1.4e-25, 27.28% id in 678 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT1247
FT                   SWALL:AAO76354 (EMBL:AE016931) (863 aa) fasta scores: E():
FT                   3.2e-23, 27.67% id in 831 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06061"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG5"
FT                   /protein_id="CAH06061.1"
FT                   /translation="MTIVADSWNTVSHYYLFSLPLFIMKIHSALTILCLLCTIHCAAAP
FT                   QKAVSDTLLSARFNRYARENPIEKLYLHQDRTNYYAGETIWFKVYQTLSSSATEASRIV
FT                   YIDLSNSKGEIVKQVKYPLADGAASGSLSIPEHLHAGHYQLRAYTRWMQNFDPEFFFHR
FT                   ELTIYGNSEKDNIPQQTTKFKLRFFPEGGNLINGLTSRIAFEVVDANTGKGVQTEGVIL
FT                   NAHGDSIRKFATSHLGKGSFFFIPQKKEKYIARLAGDNTDFKIPSISEQGFVMTVKHLK
FT                   EALRILLTQNIGPSTKNSVYSLILHQEGRLIAVLPVDGSQPRTLFDLPLDKLPTGVFTL
FT                   TLIDEDYHAYCERLVFTHFPETLNLKLSSTISVQEGHRKMSVNIRSTDKKGIPQPGSFS
FT                   LAVAQTFLEQPTIRDNFSTYLFLSSNLKGQTEQPLSYWNPEDTESLSKIELLLLTQGWR
FT                   RYSLEVFNQPDNLPRYPMEQSLILSGKVENINKQKAKSVELQAILRQDSLKQFITCPLD
FT                   GQKRFSLSGISFEGTKEVMLSATDKNGKTYPIKLDDSIPVPSVKYMPSPFAPDSSFHVQ
FT                   WDITKSYIPQKEIDKQLFELGEVKVTARKKDPIEKRRPYSEGFVKTSTQVKASNSFGDV
FT                   RQLLRTVPGITMVPNPDKTKSNLQYAHINGLPGGTVAALVLDGYIAKDPEVVYSMEASR
FT                   IERVEVLQQTSTQFGGFSSYGGTIVLYSRPIQGEVIATNNKICQWIGYNQTKEFYTPTL
FT                   SDHSFFEHSEQRNTLYWNPTVKTDKEGRAQVSFFLNDQENGEYVIHCEGYSEEGLIGTD
FT                   FRVTEVPEHP"
FT   misc_feature    complement(328656..328679)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(330313..333930)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0283"
FT                   /old_locus_tag="BF0287"
FT                   /product="putative glycosylhydrolase"
FT                   /note="Similar to Bacillus sp. GL1 Alpha-D-mannosidase
FT                   SWALL:Q9AJR6 (EMBL:AB026114) (1047 aa) fasta scores: E():
FT                   2e-57, 30.4% id in 855 aa, and to Bacteroides
FT                   thetaiotaomicron alpha-mannosidase BT3774 SWALL:AAO78879
FT                   (EMBL:AE016942) (1198 aa) fasta scores: E(): 0, 70.31% id
FT                   in 1206 aa, and to Clostridium perfringens
FT                   alpha-mannosidase CPE2080 SWALL:Q8XIN5 (EMBL:AP003192)
FT                   (1044 aa) fasta scores: E(): 1.6e-71, 32.5% id in 843 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06062"
FT                   /db_xref="GOA:Q5LIG4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG4"
FT                   /protein_id="CAH06062.1"
FT                   /translation="MKLHIAMLAATLLLSGGASYAQGNKQEKKAKAYMVADAHLDTQWN
FT                   WDVQTTIKEYVWNTINQNLFLLKKYPNYVFNFEGGVKYAWMKEYYPAQYEEMKKYIGEG
FT                   RWHISGSSWDATDALVPSTESFIRNIMLGQQYYRQEFGVESTDIFLPDCFGFGWTLPTI
FT                   ASHCGLIGFSSQKLDWRVHPFYGKSKHPFTIGLWKGIDGSSIMLAHGYDYGRRWNDEDL
FT                   SENEQLKELAGRTPLNTVYRYYGTGDIGGSPTLASVRSVEKGLRGNGPVEIVSATSDQL
FT                   YKDYLPYKNHPELPVFDGELLMDVHGTGCYTSQAAMKLYNRQNELLGDAAERAAVTAEW
FT                   LNQAKYPGSTINEAWKRFIYHQFHDDLTGTSIPRAYEFSWNDELISLKQFSNVLTSSIH
FT                   GIGRELDTRVSGIPVILYNALGFAVTDIAEIELDLPKAPKGITVYDEKGKKVSAQLISY
FT                   TDGKARILVEATVPATGYVVYDIRTSGTGASNVSTNVNTLENSLYKITLDKNGDIVSLT
FT                   DKKNGKELVKAGKAIRLALFTQNKSYNWPAWEVLKETTDRTPVSITDDVKITLVEDGTL
FT                   RKSLCVEKRHGESVFRQYIRLYEGSRAERIDFYNEIDWQSTNALLKAEFPLNLENEKAT
FT                   YDLGIGSIQRGNNTETAYEVYAQYWADLTDRDGSYGVSVMNDSKYGWDKPDNHTIRLTL
FT                   LHTPETRGGYAYQDHQDLGHHTFTYSLIPHQGALDKPATVEKAEKLNQQLKAFRTEKHK
FT                   GNVGKSFSFVASDNRNVLIKALKKAEETDEYVVRVYETEGRKAQSATLTFAGEIISASE
FT                   ANGTEKTIGNATFEGNKLQVNITPYSVRTYKVRLKPSGREASPIEYAALPLDYDRKCAS
FT                   YNEFRGEGDFESGYSFAAELLPDSLIAGQITFRLGEKEIANGMTCEGDTLQLPAGNKYN
FT                   RLYILAASTEGDNQADFRIGKQTASFVVPSYTGFIGQWGHKGHTEGYLKDAEIAYVGTH
FT                   RHASNGDQPYEFTYMFKFGMDIPKGATSVILPRNEKVVLFAATLVAENEPATTVAGTLF
FT                   RTNNVGNAATAGNDEEAVRENILKRAKIIACSGYTNDEEKPDFLLDGKTDTKWCDVSQT
FT                   PNYVDFDLGEAQNISGWKMVNAGQESHSYITNGCFLQGKMNPGDEWTTLDAIDGNHANV
FT                   VSRPLNYDGKVRYIRLLVTRPTQSTGGRDTRIYELEVYK"
FT   misc_feature    complement(332347..333921)
FT                   /note="Pfam match to entry PF01074 Glyco_hydro_38, Glycosyl
FT                   hydrolases family 38, score -33.6, E-value 6.6e-19"
FT   misc_feature    complement(333868..333930)
FT                   /note="Signal peptide predicted for BF0287 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.912 between residues 21 and 22"
FT   CDS_pept        334274..337477
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0284"
FT                   /old_locus_tag="BF0288"
FT                   /product="putative TonB dependent receptor outer membrane
FT                   protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron outer
FT                   membrane protein SusC SWALL:Q45780 (EMBL:L49338) (1038 aa)
FT                   fasta scores: E(): 7.3e-47, 28.5% id in 1084 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT3854
FT                   SWALL:AAO78959 (EMBL:AE016942) (1012 aa) fasta scores: E():
FT                   1.2e-91, 36.21% id in 1041 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT2461 SWALL:AAO77568
FT                   (EMBL:AE016936) (1134 aa) fasta scores: E(): 3.2e-81, 30.7%
FT                   id in 1065 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06063"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG3"
FT                   /protein_id="CAH06063.1"
FT                   /translation="MRKKEQMFWLASRSRMWRIPLCMAAFSLLPSAYSFASAENPATET
FT                   VLAVNSVQQQRTVKGIVIDANGEAVIGANVKEPGSTTGTITDMNGEFSLSVGPKATLEI
FT                   SFIGYTTQKVNVGASNTVKVILKEDTKVLDEVVITGFGMSQKKATLTGAVAAIASTDIE
FT                   RSNATTASGALVGKIAGINTRQNDGRPGASTQLQIRNMGAPLYVIDGVVSDDGQFNNMD
FT                   FNDIESISILKDASAAIYGVRAANGVVVVTSKKGQRNSKNSVSINAYYGWQHNSRYVQP
FT                   AKTKDYVNAYVSAETWAKKADNDRRYNKEEYAKWMAGTEKNYQGFDWSDYIWITAPQSY
FT                   ISANLSGGTDKANYYVAVSHIDQEATVRGYGGFRRTNAQMNIDMNISDRFKIGATMNGR
FT                   IEDRHHPGVPGADDTWLPRFATMKNQPTKRPYANDNPLYPQLVSDQKETNFALLNYDTS
FT                   GKVSDVWRVLQMQTTAEYEILKGLKAKGMLGYYYAYNELDNQEYTFKLYGYNEKTGEYY
FT                   ETAAMDNPYRERNREKVEDQFANFQLNFDRRFGNHSINAVASFEATQRKRPKSWVHSVP
FT                   VANGMDLIRFKEIVEYNDTGNNTEARMGWLGRINYSFADRYLIELIGRWDGSWKFKPEN
FT                   RWGFFPSASLGWRISEENFWKESKIANVFSNLKIRGSYGVVGDDNVSDYAAFDYLPGYK
FT                   YNNGGAVLDGDWVVGTETRGLPNKTLSWMESKILDIGVDMGFFNNRLNAQVDFFQRIRD
FT                   GIPESRYDVLIPNEAGFSLPKENLRSDKHVGFDAMVNWTDHVSDFNYSVGANMTYSRFW
FT                   DWEQYDTRHSNSWDVYRNSIWHRVGYVNWGYEAVGRFTSWEQIATYPIDNDRKGNKTVV
FT                   PGDIMYKDVNGDGVINYMDERPIGYRSDSTPTLNFGINLSASWKGFDLAMDWTGSGMTS
FT                   WQQQYETARPFQNDGNSPEEVFKDAWHLADIWDADSQLIPGKYPLIRLNNEETSAYDKS
FT                   TFWLHNVKYIKLRNLEFGYTLPKRIVAKAGISNLRLYVSGTNLFSISNIPFMDPECIDS
FT                   NGLDYPTMRVVNLGINLKF"
FT   misc_feature    334274..334381
FT                   /note="Signal peptide predicted for BF0288 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.813 between residues 36 and 37"
FT   misc_feature    334274..334570
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        337485..339371
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0285"
FT                   /old_locus_tag="BF0289"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein, putative outer membrane protein
FT                   BT3855 SWALL:AAO78960 (EMBL:AE016942) (643 aa) fasta
FT                   scores: E(): 2.9e-18, 29.32% id in 682 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT0440
FT                   SWALL:AAO75547 (EMBL:AE016927) (627 aa) fasta scores: E():
FT                   4.3e-18, 25.58% id in 598 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06064"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG2"
FT                   /protein_id="CAH06064.1"
FT                   /translation="MKNRYFLMALAAAGVLSLSSCNGFLDTKPNDIMTQDQVYADPALV
FT                   KSVLANFYGRITFGQRNEAVEDYFMLDEAIHYDNNSEENIDRNKWRPYDYTLIRNLNQF
FT                   LQGIKGSTAVDEETKRLYEGEVRYIRAWTYFCIARGLGGIPIVGDDVFDYTGGMDITTI
FT                   QVPRSTEAETYDYIIKECQEAAAMMSKQTNKNNSRANYWVAKMLEARAAITAASLATYN
FT                   TVAEHPQLRTAGGEVGIPADKAEGYYRTALAAAKEVIEGAADGTASPYRLMLAADKTSE
FT                   ALADNFFKAVCEKSGNTEVIWTRDYATPGYGHEFTKNCLPKSIEQDTGSDRMSVLLNLV
FT                   EAYESTDATESERGKAAKFDIGTLDDPKFFDDPMDLFADRDPRLAATVLLPGSTFDGKL
FT                   IELQAGQLNKVNGQWVERTGRRNETDAQGRLITANNGPFGGNEREINRTGFFVRKYLDK
FT                   TPLAGTQGTKSAMWNVYFRISEAYLIAAEASWELSRNNSDVEALKYINAVRERAGIQSL
FT                   TSIDHQKIMHEYQVEFAFEGHRWWDLKRWMEADNIWTGNENDRTAQRLGLWPYRVVADG
FT                   DANNGKWVFVEKNMQTLDLWRKPLKCTDVQYYSEIDNGWINNNPKLVKNPYQ"
FT   misc_feature    337485..337559
FT                   /note="Signal peptide predicted for BF0289 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.640 between residues 25 and 26"
FT   misc_feature    337515..337547
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        339391..340098
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0286"
FT                   /old_locus_tag="BF0290"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3856 SWALL:AAO78961 (EMBL:AE016942) (231 aa)
FT                   fasta scores: E(): 3.5e-10, 26.97% id in 241 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06065"
FT                   /db_xref="InterPro:IPR024278"
FT                   /db_xref="InterPro:IPR041186"
FT                   /db_xref="PDB:3HN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG1"
FT                   /protein_id="CAH06065.1"
FT                   /translation="MKTISKIFSVLLLGAMMFTSCMKDNYDAPESMLTGRVMYNGEALQ
FT                   LRGNEAVQLQLYQHGYAKHDPINVYVNQDGMYSANLFDGEYQMITKSGNGPWTSEGRDT
FT                   INVTVAGNTVQDVEVTPYYLVRDAQMTLEGNKVNASFKVEKVAGGGIDRVFFMLSTTQF
FT                   VNDAEHNVDRYDETDNLDAYDETGKLYTFATRDYTDNSMFQTALKRGTLFGRICIWPKG
FT                   SDQGIYSKVIRLK"
FT   misc_feature    339391..339459
FT                   /note="Signal peptide predicted for BF0290 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.685 between residues 23 and 24"
FT   misc_feature    339421..339453
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        340193..340612
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0287"
FT                   /old_locus_tag="BF0291"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIG0"
FT                   /protein_id="CAH06066.1"
FT                   /translation="MNKSYFIGILIFASMTDIMANTSKNEEVEAIVSSIEQTEFSGYQL
FT                   VLLTGAGSGIIQSVELINNKTIRVSVIRGSHVRIDHRANGLPVYTENFFMDDSSTFEFE
FT                   ATTESFLIEADYNGESSSSGTKRYETRMYDLKWVP"
FT   CDS_pept        340736..341713
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0288"
FT                   /old_locus_tag="BF0292"
FT                   /product="putative exported endo-arabinase"
FT                   /note="Similar to Bacillus subtilis endo-arabinase
FT                   SWALL:O07078 (EMBL:D85132) (324 aa) fasta scores: E():
FT                   1.5e-20, 33.33% id in 312 aa, and to C-terminus of
FT                   Bacteroides thetaiotaomicron arabinan
FT                   endo-1,5-alpha-L-arabinosidase A precursor BT3516
FT                   SWALL:AAO78622 (EMBL:AE016941) (637 aa) fasta scores: E():
FT                   2e-109, 80.78% id in 307 aa, and to Bacteroides
FT                   thetaiotaomicron arabinan endo-1,5-alpha-L-arabinosidase A
FT                   precursor BT2900 SWALL:AAO78006 (EMBL:AE016938) (325 aa)
FT                   fasta scores: E(): 2.4e-100, 70.09% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06067"
FT                   /db_xref="GOA:Q5LIF9"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF9"
FT                   /protein_id="CAH06067.1"
FT                   /translation="MKFFLFSLFTVFSFCVPSIAQQYSNPVINYSLPDPTVIKADDGYY
FT                   YLYATENIRNLPIHRSKDMVNWSFVGTAFTNETRPTFEPKGNLWAPDINKIGDRYVMYY
FT                   SMSVWGGEWTCGIGVATADKPEGPFTDHGKLFRSNEIGIQNCIDPFYIEDGGKKYLFWG
FT                   SFHGIYGAELSDDGLSLKEGMKPQQVAGTAYEGTYIHKRGGYYYLFASIGRCCEGLKST
FT                   YTTVVGRSKYLFGPYVDKKGESMLENHHEVLIDKNEAFVGPGHNSEIVTDDKGADWVFY
FT                   HAVSVANPEGRVLMLDRVNWKKGWPVVEGDTPSLQAKAPVIRHK"
FT   misc_feature    340736..340795
FT                   /note="Signal peptide predicted for BF0292 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.908 between residues 20 and 21"
FT   misc_feature    340796..341701
FT                   /note="Pfam match to entry PF04616 Glyco_hydro_43, Glycosyl
FT                   hydrolases family 43, score 91.9, E-value 8.5e-26"
FT   repeat_region   341922..342434
FT                   /note="hit to rep1 1..513 score: 2565 percent id: 100.00"
FT   CDS_pept        342750..343868
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0289"
FT                   /old_locus_tag="BF0295"
FT                   /product="putative exported glycosylhydrolase"
FT                   /note="Similar to Bacillus circulans alpha-1,6-mannanase
FT                   precursor AmaN6 SWALL:Q9Z4P9 (EMBL:AB024331) (589 aa) fasta
FT                   scores: E(): 8.1e-39, 34.64% id in 381 aa but truncated at
FT                   the C-terminus and to entire protein of Bacteroides
FT                   thetaiotaomicron alpha-1,6-mannanase BT3524 SWALL:AAO78630
FT                   (EMBL:AE016941) (420 aa) fasta scores: E(): 1.7e-27, 44.86%
FT                   id in 419 aa, and to entire protein of Bacteroides
FT                   thetaiotaomicron alpha-1,6-mannanase BT3521 SWALL:AAO78627
FT                   (EMBL:AE016941) (429 aa) fasta scores: E(): 4.5e-25, 39.9%
FT                   id in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06068"
FT                   /db_xref="GOA:Q5LIF8"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF8"
FT                   /protein_id="CAH06068.1"
FT                   /translation="MKNKVLIIVAILLLLPNAMAWAHQPADGNLKHFTKKDATTAMDAF
FT                   HSTFYNPDMKLYAISSDMKGRAAIWVQAIYWDMIMNAYKRTKAPKYRRLIEEVYQGGYE
FT                   QYDKYNWDNKIEWFIYDDMMWWIISLARAYEITNDPKYLAHASSGFYHVWKESYDKERG
FT                   GLWWNFKHDGKMACINYPTTVGAMTLYNVTKDPDYLEKAKSVYAWSRDVFFDKEKGRIA
FT                   DNMHYHFQRQNGMDIDWTTQLYNQATFIGSAVMLYKATGEKAYLDDAVLAADYVRNEMC
FT                   DADGLLPFKNGVEQGIYAAIFAQYIIRLIEDGNQPQYMDWLRHNIDVAWNNRDVNRNVT
FT                   FKDAAKPCPTGVMESYDASGCPALMQVISPFK"
FT   misc_feature    342750..342815
FT                   /note="Signal peptide predicted for BF0295 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.965 between residues 22 and 23"
FT   misc_feature    342822..343829
FT                   /note="Pfam match to entry PF03663 Glyco_hydro_76, Glycosyl
FT                   hydrolase family 76, score -64.7, E-value 2.3e-10"
FT   CDS_pept        343897..346059
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0290"
FT                   /old_locus_tag="BF0296"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3525 SWALL:AAO78631 (EMBL:AE016941) (721 aa)
FT                   fasta scores: E(): 0, 81.02% id in 722 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06069"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF7"
FT                   /protein_id="CAH06069.1"
FT                   /translation="MSKRVLVLIGLFLACGGVYSQTATGTKTNFQTAESWKPETDVRAD
FT                   AVMVYGTLDKKGVTFEQRVQSWRDKGYRAEFMTGVAWGDYQDYFLGKWDGVKDHLKEGQ
FT                   RDREGREIAHGHLIPYIVPTESFIRYMQEKQIKRVIDAGITSIYLEEPEFWMRGGYSEA
FT                   FKSEWQKYYGFPWRAQHESPENTYLSNKLKYYLYYNALNQIFTYAKTYGKSKGLDVKCF
FT                   VPTHSLVNYTSWQIVSPEASLASLDCVDGYIAQVWTGTAREPNYYDGVKKERVFENAFL
FT                   EYGCMKSMTAPLNRKMYFLTDPIEDRAKDWLDYKINYQATFAAQLMYPAVDTYEVMPWP
FT                   DRIYQGLYQVAGTDRKERIPRDYSTQMQIMVNTLNDIRTSETQVSGTHGIGVLMANSLM
FT                   FQRFPGHDGYDDPQFSSFYGQTLPLLKRGIPVELVHMENTPFGDTFKGLKVLVMSYSNM
FT                   KPMEPRYHDFLADWVRKGGALIYCGEDIDPYQSVLEWWNSNGNQYKAPSEHLFEKLGLD
FT                   RVPAAGTYPCGKGMVTVIREDPKHFVLKSGNDWQYFDAVSAAYRKSAGKEVELKNSFLL
FT                   ERGPYTIAAVLDESVSDAPMELSGVYIDLFDKDLPVLTHKVIRPGEQGYLYNVKRISGR
FT                   AKAKVLCGASRIYDEKAGKRSYSFVAKSPLHTTNASRILLPKQPIRVCVNGKEEPQPEK
FT                   LWEERSRTLLLKFENDPAGVQVDIEW"
FT   misc_feature    343897..343956
FT                   /note="Signal peptide predicted for BF0296 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.876 between residues 20 and 21"
FT   CDS_pept        346053..348566
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0291"
FT                   /old_locus_tag="BF0297"
FT                   /product="putative exported glutaminase"
FT                   /note="Similar to Aspergillus oryzae glutaminase A GtaA
FT                   SWALL:Q9UVX9 (EMBL:AB029552) (690 aa) fasta scores: E():
FT                   3.8e-40, 30.36% id in 606 aa, and to Bacteroides
FT                   thetaiotaomicron glutaminase BT3526 SWALL:AAO78632
FT                   (EMBL:AE016941) (825 aa) fasta scores: E(): 0, 79.29% id in
FT                   826 aa, and to Bacteroides thetaiotaomicron glutaminase A
FT                   BT3477 SWALL:AAO78583 (EMBL:AE016940) (840 aa) fasta
FT                   scores: E(): 6e-108, 49.34% id in 837 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06070"
FT                   /db_xref="GOA:Q5LIF6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR032515"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF6"
FT                   /protein_id="CAH06070.1"
FT                   /translation="MVKTIKKESEVMKLKLSTLFLGAAAMLSSCGAPQDVKSEKSEMRA
FT                   PAYPLVMIDPYTSAWSFTDNLYDGPVKHWTGKDFPFLGVAKVDGQIYRFMGTEELELLP
FT                   LVKTSEQGRWTAKYTTKKPADGWQNADFNDAAWKEGEGAFGTMENESTAKTQWGEEYIW
FT                   IRRKADIKDNLQGKNVYLEYSHDDDAIIYVNGVKVVDTGNSAKKHMLAKLPEEAVAALK
FT                   QGENLIAIYCNNRVANGLIDCGLLVEKDNTQNFTQTAVQKSVDVQAMQTNYEFTCGPVD
FT                   LKLAFTSPLFMDNLDLMTRPVSYLTYEVASNDGNKHNVELYFEAGPQWALDQPHQEAVA
FT                   ESFTEGNLLYLKTGSRNQEILGKKGDDVRIDWGYFYMAADKENSSCATGEGKTLRKSFI
FT                   DGKLTSSKTDGSDKLALVRSLGETKKAEGHLLLGYDDLYSIQYFGENLRPYWNRNGNET
FT                   IQSQFAKADKEYDAVMDKCAAFDANLMKEATEVGGRKYAELCALAYRQAIAAHKLVEAP
FT                   NKDLLFLSKENFSNGSIGTVDITYPSAPLFLVYNPELAKGLMNHIFYYSESGKWNKPFA
FT                   AHDVGTYPLANGQTYGGDMPIEESGNMLILSAAIAIVEGNADYAQKHWDVLTTWTDYLA
FT                   QYGLDPENQLCTDDFAGHFAHNANLSIKAILGVASYGYLADKLDKKEVAEKYTQKAKEM
FT                   AAEWVKMADDGDHYRLTFDKPGTWSQKYNLVWDKLMNLQIFPETVAQKEIAYYLGKQNQ
FT                   YGLPLDNRETYTKTDWIMWTATLAPDKATFEKFIDPVYLFMNETTDRVPMSDWVFTDRP
FT                   NQRGFQARSVVGGYYIKMLEKKLKK"
FT   misc_feature    346053..346145
FT                   /note="Signal peptide predicted for BF0297 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.737 between residues 31 and 32"
FT   CDS_pept        348685..350970
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0292"
FT                   /old_locus_tag="BF0298"
FT                   /product="putative exported alpha-1,2-mannosidase"
FT                   /note="Similar to Bacillus sp. M-90 alpha-1,2-mannosidase
FT                   precursor AmaN2 SWALL:Q9WXI8 (EMBL:AB025248) (1976 aa)
FT                   fasta scores: E(): 1.5e-32, 31.44% id in 757 aa, and to
FT                   Bacteroides thetaiotaomicron alpha-1,2-mannosidase BT3527
FT                   SWALL:Q8A1Y1 (EMBL:AE016941) (763 aa) fasta scores: E(): 0,
FT                   86.33% id in 761 aa, and to Bacteroides thetaiotaomicron
FT                   putative alpha-1,2-mannosidase BT3990 SWALL:Q8A0N1
FT                   (EMBL:AE016943) (755 aa) fasta scores: E(): 0, 72.2% id in
FT                   759 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06071"
FT                   /db_xref="GOA:Q5LIF5"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF5"
FT                   /protein_id="CAH06071.1"
FT                   /translation="MKKLALLLVGVLGTAFCTFAKSTTEPVDYVSPLVGTQSKHALSTG
FT                   NTYPAIAMPWGMNFWVAQTGKMGDGWAYTYDADKIRGFKQTHQPSPWINDYGQFAIMPV
FT                   TGKVVFDQDQRASWFSHKAEVAKPYYYKVYLADHDVTTEIAPTSRAAMFRFTFPESKDS
FT                   YVVVDAFDNGSYVKVIPEENKIIGYTTKNSGGVPENFKNYFVLVFDKPFTFTAAVTNGN
FT                   IRPGELESKDKHAGGIIGFSTRRGETVNVRVASSFISPEQAEQNLKELGKDNLEAVAAK
FT                   GRQEWNKVLGRIEVEDDNTDHLRTFYSCLYRSVLFPRSFYELDAKGKPVHYSPYNGKVL
FT                   PGYMFTDTGFWDTFRCLFPFLNLMYPSMNEKMQEGLANTYKESGFLPEWASPGHRGCMV
FT                   GNNSASVVADAYLKGLKGYDIETLWEAVKHGANAVHPQVSSTGRLGYEYYNQLGYVPYN
FT                   VGINENAARTLEYAYDDWCIYQLGKALNKPEEEIAVYAQRAMNYKNLYDKEHKLMRGKN
FT                   KDGQFQSPFNPLKWGDAFTEGNSWHYTWSVFHDPQGLIDLMGGQQGFNQMMDSVFILPP
FT                   VFDDSYYGGVIHEIREMQIMNMGQYAHGNQPIQHMLYLYNYSGQPWKAQHWIREVMDKL
FT                   YTPNADGYCGDEDNGQTSAWYVFSAMGFYPVCPGTDQYVMGTPYFKQMKLHLENGKTVQ
FT                   ISAPGNSDENRYIASMTVNGKTLTRNYLTHKELMNGAKITMKMSSTPNKQRGVRESDFP
FT                   YSFSKEVR"
FT   misc_feature    348685..348744
FT                   /note="Signal peptide predicted for BF0298 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.843 between residues 20 and 21"
FT   CDS_pept        351014..352480
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0293"
FT                   /old_locus_tag="BF0299"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3528 SWALL:AAO78634 (EMBL:AE016941)
FT                   (487 aa) fasta scores: E(): 2.4e-176, 85.97% id in 485 aa,
FT                   and to Xanthomonas axonopodis hypothetical protein Xac3082
FT                   XAC3082 SWALL:Q8PI16 (EMBL:AE011951) (487 aa) fasta scores:
FT                   E(): 4.9e-100, 50.72% id in 483 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06072"
FT                   /db_xref="GOA:Q5LIF4"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF4"
FT                   /protein_id="CAH06072.1"
FT                   /translation="MPGKNSKKMIGACVVTAALLCAPSALKAEGMLSHYTCVADAIQKD
FT                   NRPEPAKRLFRSQAVENEIIRVQKLLRNSKLAWMFTNCFPNTLDTTVHFRKGKDGKPDT
FT                   FVYTGDIHAMWLRDSGAQVWPYVQLANSDPELKTMLAGVINRQFKCINIDPYANAFNDG
FT                   PKGGEWMSDLTDMKPELHERKWEIDSLCYPLRLAYQYWKTTGDASIFDEEWIQAITNIL
FT                   RTFKEQQRKDGVGPYKFQRKTERALDTVTNDGLGNPVKPVGLIVSTFRPSDDATTLQYL
FT                   VPSNFFAVSSLRKAAEILTTVNKKTALANECKALANEVETALKKYAVYNHPKYGKIYAF
FT                   EVDGFGNHMLMDDANVPSLLAMPYLGDVSIDDPIYQNTRRFVWSLDNPYFFKGKAGEGI
FT                   GGPHIGYDMVWPMSIMMKAFTSKDDAEIKSCIEMLMNTDAGTGFMHESFHKDNPEKFTR
FT                   AWFAWQNTLFGELILKLVNEGKVDMLNSIQ"
FT   misc_feature    351014..351094
FT                   /note="Signal peptide predicted for BF0299 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.768 between residues 27 and 28"
FT   CDS_pept        352668..353789
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0294"
FT                   /old_locus_tag="BF0300"
FT                   /product="putative aldose 1-epimerase"
FT                   /note="Similar to Sus scrofa aldose 1-epimerase Mut
FT                   SWALL:Q9GKX6 (EMBL:AB044390) (342 aa) fasta scores: E():
FT                   6.9e-47, 43.21% id in 324 aa, and to Bacteroides
FT                   thetaiotaomicron aldose 1-epimerase precursor BT3532
FT                   SWALL:AAO78638 (EMBL:AE016941) (377 aa) fasta scores: E():
FT                   2.2e-130, 86.21% id in 370 aa, and to Escherichia coli, and
FT                   Shigella flexneri aldose 1-epimerase GalM or B0756 or
FT                   SF0548 SWALL:GALM_ECOLI (SWALL:P40681) (346 aa) fasta
FT                   scores: E(): 9.4e-41, 39.76% id in 337 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06073"
FT                   /db_xref="GOA:Q5LIF3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF3"
FT                   /protein_id="CAH06073.1"
FT                   /translation="MWALGALFVAGCAETEKATTDSGLVKSNFQTEVGGKKTDLYVLRN
FT                   QNNMEVCVTNFGGRIVSVMVPDKEGVMRDVVLGFDSIQDYISKPSDFGASIGRYANRIN
FT                   QGKFTLDGVEYQLPRNNYGHCLHGGPKGFQYQVYDAKQVGPQELELTYLSKDGEEGFPG
FT                   NITCKVIMKLTDDNAIDIKYEAETDKPTIVNMTNHSYFNLDGDAGSNADHLLTIDADAY
FT                   TPVDSTFMTSGEIVTVEGTPMDFRTPTPVGKRINDFDFVQLKNGNGYDHNWVLNAKGDI
FT                   TRKAATLESPKTGIVLDVYTDEPGIQVYAGNFLDGSLTGKKGITYNQRASVCLETQKYP
FT                   DTPNKPEWPSAVLRPGETYNSHCIFKFSVDNGK"
FT   misc_feature    352782..353765
FT                   /note="Pfam match to entry PF01263 Aldose_epim, Aldose
FT                   1-epimerase, score 409.6, E-value 2.5e-120"
FT   misc_feature    353247..353276
FT                   /note="PS00545 Aldose 1-epimerase putative active site."
FT   CDS_pept        353893..355113
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0295"
FT                   /old_locus_tag="BF0301"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein, putative transport protein BT4459
FT                   SWALL:AAO79564 (EMBL:AE016945) (390 aa) fasta scores: E():
FT                   1.3e-48, 36.52% id in 397 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein, putative
FT                   membrane-associated protein BT2780 SWALL:AAO77886
FT                   (EMBL:AE016937) (395 aa) fasta scores: E(): 1.5e-46, 35.84%
FT                   id in 399 aa, and to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT1547 SWALL:AAO76654 (EMBL:AE016932)
FT                   (391 aa) fasta scores: E(): 2.7e-40, 32.39% id in 389 aa,
FT                   and to Xanthomonas campestris transport protein YxaH or
FT                   XCC2581 SWALL:Q8P7N0 (EMBL:AE012370) (414 aa) fasta scores:
FT                   E(): 8.5e-29, 32.16% id in 429 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06074"
FT                   /db_xref="GOA:Q5LIF2"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF2"
FT                   /protein_id="CAH06074.1"
FT                   /translation="MTHTQTITPKKRINSIDALRGFALIGIMLLHCMERFDLTLAPVVE
FT                   SPFWQAIDTAVYDSLYFLFSGKSYAMFSLLFGLSFFMQMESQAAKGVDFRGRFLWRLAL
FT                   LFLFGYINGLVYMGEFFMVYAVLGVFLIPLYKVPTRWLLVLCVLLFLQIPAVISFVSLL
FT                   SDNVANEPTAAAAYMDRLFERAADVFINGSLMDVLSFNTFDGQSAKCLWVFNNFRYLQL
FT                   LGLFIAGMLIGRQGIHKSEEKMVKYSRLFLPYCLAFWAVFYAVAFLLPVWGVDGFALRV
FT                   GQTLFKTYGNLGQMMVYFCGFTLLYYRYKGQKVLDRIAPVGRMSVTNYMAQSIVGVSLF
FT                   YGFGGNFAVEFNYLQSFLLGAAFCVIQIAYSNWWIKRFYYGPMEWLWRSLTWFQVVPLS
FT                   RRKASLG"
FT   misc_feature    353920..354357
FT                   /note="Pfam match to entry PF04171 DUF405, Protein of
FT                   unknown function (DUF405), score 57.3, E-value 2.8e-14"
FT   misc_feature    order(354070..354138,354196..354294,354313..354381,
FT                   354547..354606,354640..354708,354766..354819,
FT                   354853..354921,354949..355017)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BF0301 by TMHMM2.0 at aa 60-82, 102-134, 141-163, 219-238,
FT                   250-272, 292-309, 321-343 and 353-375"
FT   misc_feature    354622..355074
FT                   /note="Pfam match to entry PF04235 DUF418, Protein of
FT                   unknown function (DUF418), score 63.6, E-value 3.5e-16"
FT   CDS_pept        355163..358156
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0296"
FT                   /old_locus_tag="BF0302"
FT                   /product="putative exported carbohydrate-binding protein"
FT                   /note="C-terminus is similar to Streptomyces sioyaensis
FT                   endo-1,3-beta-glucanase SWALL:Q9L816 (EMBL:AF217415) (478
FT                   aa) fasta scores: E(): 3.8e-06, 35% id in 140 aa, and the
FT                   C-terminus of BF0302 is similar to the C-terminus of
FT                   Ralstonia solanacearum putative transmembrane protein
FT                   RSP0881 or RS01652 SWALL:Q8XRH3 (EMBL:AL646081) (767 aa)
FT                   fasta scores: E(): 7.4e-16, 36.15% id in 213 aa, and the
FT                   C-terminus of BF0302 is similar to the C-terminus of
FT                   Bacteroides thetaiotaomicron endo-1,4-beta-xylanase D
FT                   precursor BT3675 SWALL:AAO78780 (EMBL:AE016941) (333 aa)
FT                   fasta scores: E(): 2.7e-15, 27.95% id in 347 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06075"
FT                   /db_xref="GOA:Q5LIF1"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF1"
FT                   /protein_id="CAH06075.1"
FT                   /translation="MFINSLRKSPFSCSPGLILLGAFTLLSVPVYGQQIQQAERQVQQV
FT                   PFLQFNFDEQGGETARNSGRGGSKYDARINGGTVEWGPGLQQGAARLSNKGHFKLPDGV
FT                   LAHVKDFTLSVWVYLNEQSDNQTVCTFACGTDRYLILTTQRGNEENGVSLVMTKTQESG
FT                   NHTDKEERIAYTRQKGKLSANAWHHLAFTLKGSVGTLYVDGVKAEIKTDFTVNPSLLGN
FT                   TTDNYIGRPTWPDPYLNGGIDDFRLYDYALTDRQVYELASVADGRLVQEDRDGLSLGDL
FT                   SAVTTDLVLPSSGKSGTTISWSSAQGQYISDSGKLYRPDAGTGNKKATLTATVRKGDVA
FT                   LTKDFVLTVKDIGTEPEDVNVFSMQTGNPTVPAYLADASFYYDDRTKTFYAFGTNDGAG
FT                   GENVYPAQMWYSKDCKEWKNEVIAFPKSWTDYAGTLCVWAPSIEYNPDTKKYYLMYSIA
FT                   SNTFVGMADDLLGPWEDANGAAPGKMLFKGYDGQFFMDDDRTMYIVTDSWHFKIMKLKF
FT                   DEAGKIYIDNSDPVFAKSDSNPFIGTYHYTQIEEIKNAFEASFIFKRNNLYYLMWSFNG
FT                   SENYNVRYAVADKITGPYREINRSMTVPVLQRDDANRILGPGHHSMFCYGGRTFIAYHR
FT                   QHYPFVDSKRQTCIDEVFFNEDGSIRPITPTHKGVTVAPDVPGDHRTNLALGKQTLTSS
FT                   ARVYDDSEFAPRYRTHGISFCYAGNFAVDENYGTHWDPGVGAHKPWLIVDLGSECKVDE
FT                   IETIFEFTSRTYKYKLEYLSQKEAGSLDAASGSHLWKVFADRSTDGVGQSPVTDTKPGN
FT                   SPVKARFIRLTILEGVDIPLRADGLDKKNAENALSIFELKVFGEDRSDDLNRIFKAESF
FT                   HNLYGIALEKNAAENGFIMGQIDNNDYLLYRNVDLGKGAGTFTAKVASGTEGGKIEVYL
FT                   GSLKGKPIGVLEVGNTGGDQSWEIKSTSLERIARGRQEKLYLLFKGKTGTENLLKLDWF
FT                   QFTKDRMK"
FT   misc_feature    355163..355258
FT                   /note="Signal peptide predicted for BF0302 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.965 between residues 32 and 33"
FT   misc_feature    357215..357670
FT                   /note="Pfam match to entry PF00754 F5_F8_type_C, F5/8 type
FT                   C domain, score -43.0, E-value 0.0089"
FT   misc_feature    357761..358141
FT                   /note="Pfam match to entry PF03422 CBM_6, Carbohydrate
FT                   binding module (family 6), score 104.4, E-value 1.9e-28"
FT   CDS_pept        358188..359156
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0297"
FT                   /old_locus_tag="BF0303"
FT                   /product="putative exported glycosylhydrolase"
FT                   /note="Similar to Butyrivibrio fibrisolvens
FT                   xylosidase/arabinosidase [includes: beta-xylosidase (EC
FT                   3.2.1.37) (1,4-beta-d-xylan xylohydrolase) (xylan
FT                   1,4-beta-xylosidase); alpha-l- arabinofuranosidase (EC
FT                   3.2.1.55) (arabinosidase)] XylB SWALL:XYLB_BUTFI
FT                   (SWALL:P45982) (517 aa) fasta scores: E(): 9.2e-10, 29.41%
FT                   id in 289 aa, and to Bacteroides thetaiotaomicron
FT                   endo-1,4-beta-xylanase D precursor BT2898 SWALL:AAO78004
FT                   (EMBL:AE016938) (327 aa) fasta scores: E(): 6.6e-52, 49.24%
FT                   id in 266 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06076"
FT                   /db_xref="GOA:Q5LIF0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIF0"
FT                   /protein_id="CAH06076.1"
FT                   /translation="MGKKKISTGVWLLGLLIVFCSYTGVAGAKNRSKTKTVTKSVPLGD
FT                   PFILLHDGTYYAYGTHAADGIEVYTSKDLRKWKLHGLALHKDDVWADSRFWAPEIYEID
FT                   GKFYMYYTADEHICVAIADSPLGPFRQNEKKPMVAGEKMIDSSLFIDEDGKPYLFFVRF
FT                   NDGNNVWVAELEDDYMTIKTETMRPCIHVSQAWEEVWPRVNEGSYVLKHNGLYYMTYSG
FT                   NSFESPFYGIGCATATDIMGEWTKYQENPILQKPGNLQGVGHSAMFKDKKGRLRIVYHA
FT                   HKDKEHIHPRGMYIGKVYFEKVDGIDRMRINKEYIAAELVE"
FT   misc_feature    358188..358271
FT                   /note="Signal peptide predicted for BF0303 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.859 between residues 28 and 29"
FT   misc_feature    358380..358664
FT                   /note="Pfam match to entry PF04616 Glyco_hydro_43, Glycosyl
FT                   hydrolases family 43, score 21.3, E-value 3.1e-06"
FT   CDS_pept        359630..359923
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0298"
FT                   /old_locus_tag="BF0305"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE9"
FT                   /protein_id="CAH06077.1"
FT                   /translation="MKKFVFIAAVLGFTNVFVAMTQQKNSPIPLHNNGIETFTVYEADG
FT                   SNYCYNGGRGATSCSISGGIDIKGGGASAACDVSCQTGYYACCGIRCTCEKY"
FT   misc_feature    359630..359686
FT                   /note="Signal peptide predicted for BF0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.417 between residues 19 and 20"
FT   CDS_pept        359929..360993
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0299"
FT                   /old_locus_tag="BF0306"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:AAO75771 (EMBL:AE016928) (382 aa)
FT                   fasta scores: E(): 1.8e-05, 26.44% id in 276 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE8"
FT                   /protein_id="CAH06078.1"
FT                   /translation="MRKIVILSLGLLFFLFSCQREQKNVTQRIEVDLSHIDTVKISASR
FT                   IINLETVDSSLLYDICALFKQDDRYFIWSRDNAYVFNDKGDFLFNISCKGQGPGEYLSF
FT                   GCMFMEDGEVCIFDQDKQQILRFDINGKFMGVQKVLLDEDAPSPSMIIPIGTERYLSTN
FT                   RFGGDYRKMPVLSFWNKDFSSQQIVKGRFMNDGIHFPDAFFVGEEGRRVLYWEPLKDTL
FT                   FTVTDNFLVPEYKIDFGTYAIPEEEGAKDIYARIMYLNKPENQSCASVARFYQIDGYYI
FT                   YFTFMWYDRVYLCRYSEKTKKSEIFAILTDEMQLKECSFFKILGDDIVIAFEDKGNLEK
FT                   NPSLCVFNKKILDI"
FT   misc_feature    359929..359988
FT                   /note="Signal peptide predicted for BF0306 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.451 between residues 20 and 21"
FT   misc_feature    359950..359982
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        361079..361501
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0300"
FT                   /old_locus_tag="BF0307"
FT                   /product="hypothetical protein"
FT                   /note="Limited similarity to Bacteroides thetaiotaomicron
FT                   endo-1,4-beta-xylanase D precursor BT2898 SWALL:AAO78004
FT                   (EMBL:AE016938) (327 aa) fasta scores: E(): 0.00028, 50% id
FT                   in 48 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06079"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE7"
FT                   /protein_id="CAH06079.1"
FT                   /translation="MKIREILEDSLLIVRFSVYSCRDCLNFLISELDCSKKQSKIKMAM
FT                   LIANIPVRDLHVKCKEFDNPRLYRVDSLSFDFDYSLTPYVFKHKELYYMAYSGNSFESP
FT                   FYGVGCATATDIIGKWTKYDENLILQNPGAFAGCRV"
FT   CDS_pept        361899..362135
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0301"
FT                   /old_locus_tag="BF0309"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06080"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE6"
FT                   /protein_id="CAH06080.1"
FT                   /translation="MFHNREIILLLLFLVDKHRRLLSDFPKALYFCEKQTRVLLLSPLG
FT                   VHCVVKTSGFLQYDKRKNEIETIFSTNPTNVLK"
FT   CDS_pept        362322..363353
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0302"
FT                   /old_locus_tag="BF0310"
FT                   /product="hypothetical lipoprotein"
FT                   /note="Limited similarity to Bacteroides thetaiotaomicron
FT                   hypothetical protein BT0659 SWALL:AAO75766 (EMBL:AE016928)
FT                   (345 aa) fasta scores: E(): 0.066, 23.51% id in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06081"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE5"
FT                   /protein_id="CAH06081.1"
FT                   /translation="MVKLLLICLATIVMISCGSEQEKLTVYIPDTCTDTLQYEIYLPEE
FT                   EGLNIFYDLCVTDSFCAFLDTRNDTLLKIFTATIPPALVGLGMKGEGPDDFLFPFFEKS
FT                   IGREGKGKLSFIELNSWNKKIVAIHSAASPAPVAVSVVEAQQLPEMPVVRDYNETDSCV
FT                   YGIDVDMQHGLFFIYDKHTARVKTVDYHRDIRSGYPEGHLSYLYESCLMVNQDAKAACM
FT                   GLLNLNSLCFYDLKGNLMKEIVIGKELKSPEYDPEFLDFPNAPKYFISLCGTPNYLYAL
FT                   YNGFPGTSGKSKIMVFTWQGAPVAIYQTDVKLERIAVAPSGRYVLGLNITEEGGSDVLK
FT                   FEL"
FT   misc_feature    362322..362387
FT                   /note="Signal peptide predicted for BF0310 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.952) with cleavage site
FT                   probability 0.324 between residues 22 and 23"
FT   misc_feature    362340..362372
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        363368..363499
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0303"
FT                   /old_locus_tag="BF0311"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE4"
FT                   /protein_id="CAH06082.1"
FT                   /translation="MLKNILTNVLFGLSEVPVEQFMQSSNAFSEIGFFHNESCSEFT"
FT   CDS_pept        complement(363588..364742)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0304"
FT                   /old_locus_tag="BF0312"
FT                   /product="putative transmembrane acyltransferase protein"
FT                   /note="Similar to Agrobacterium tumefaciens protein 2 in
FT                   PicA locus SWALL:PIC2_AGRTU (SWALL:P29113) (191 aa) fasta
FT                   scores: E(): 4.4e-11, 35.75% id in 193 aa, and to
FT                   Bacteroides thetaiotaomicron acyltransferase BT2367
FT                   SWALL:AAO77474 (EMBL:AE016935) (382 aa) fasta scores: E():
FT                   2e-108, 67.27% id in 385 aa, and to Bradyrhizobium
FT                   japonicum Blr2157 protein SWALL:BAC47422 (EMBL:AP005942)
FT                   (405 aa) fasta scores: E(): 3.2e-21, 30.89% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06083"
FT                   /db_xref="GOA:Q5LIE3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE3"
FT                   /protein_id="CAH06083.1"
FT                   /translation="MSNISSTVFADTKPHYHLLDGLRGVAALMVIWYHVFEGYAFAGGT
FT                   TIDTFNHGYLAVDFFFILSGFVIGYAYDDRWGKNFTMKDFIKRRLIRLHPMVIMGAIVG
FT                   AITFYIQGSVQWDGTHIGISMVMLSLLCTIFFIPAMPGVGYEVRGNGEMFPLNGPCWSL
FT                   FFEYIGNILYALFIRRLSNKALTIVVVLLGVALASFAIFNVSGYGNIGVGWTLDGVNFI
FT                   GGLLRMLFPFSMGMLLSRNFKPMKLRGAFWICTLVMIALFAVPYLEGTESICTNGIYEA
FT                   FCIIIAFPILLWIGASGTTTDKKSTQICKFLGDISYPIYVIHYPFMYLFYAWLIKNQLF
FT                   TLGETWQVALCVYAWNILFAYLCLKLYDEPVRKYLAKRFLNKKQ"
FT   misc_feature    complement(363621..364703)
FT                   /note="Pfam match to entry PF01757 Acyl_transf_3,
FT                   Acyltransferase family, score 61.5, E-value 1.5e-15"
FT   misc_feature    complement(order(363642..363710,363738..363797,
FT                   363855..363914,363942..363995,364029..364097,
FT                   364125..364193,364212..364271,364314..364382,
FT                   364401..364469,364527..364595,364614..364673))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BF0312 by TMHMM2.0 at aa 24-43, 50-72, 92-114, 121-143,
FT                   158-177, 184-206, 216-238, 250-267, 277-296, 316-335 and
FT                   345-367"
FT   CDS_pept        complement(364839..365402)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0305"
FT                   /old_locus_tag="BF0313"
FT                   /product="putative cAMP-binding DNA-binding protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein, putative regulatory protein with a
FT                   cAMP-binding domain BT1545 SWALL:Q8A7H9 (EMBL:AE016932)
FT                   (187 aa) fasta scores: E(): 1.3e-30, 47.31% id in 186 aa,
FT                   and to Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein BT2366 SWALL:Q8A576 (EMBL:AE016935) (187 aa) fasta
FT                   scores: E(): 2.5e-26, 43.31% id in 187 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT1389 SWALL:Q8A7Y5 (EMBL:AE016931) (187 aa) fasta scores:
FT                   E(): 1.4e-15, 31.52% id in 184 aa, and to Bacteroides
FT                   thetaiotaomicron putative cAMP-binding domain, regulatory
FT                   protein BT2102 SWALL:Q8A5Y4 (EMBL:AE016934) (187 aa) fasta
FT                   scores: E(): 1e-12, 32.08% id in 187 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06084"
FT                   /db_xref="GOA:Q5LIE2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE2"
FT                   /protein_id="CAH06084.1"
FT                   /translation="MKNIINKIRQLYPVSDEALQALQANMQVKYYPKDTYIVQSGITDR
FT                   LVYFIEEGVTRSVFHHNGQDTTTWFSQEGDVTFGMDSLYYKQPSIESIETLSDCKIYVL
FT                   HIDELNALYEKYIDIANWGRILHQDVNKELSHMFVERLQLSPKERYEQFNRRYPGLINR
FT                   VKLKYVAAFLGISIYTLSRVRAKK"
FT   misc_feature    complement(364848..364913)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1141.000, SD 3.07 at aa 169-190, sequence
FT                   VKLKYVAAFLGISIYTLSRVRA"
FT   misc_feature    complement(365049..365330)
FT                   /note="Pfam match to entry PF00027 cNMP_binding, Cyclic
FT                   nucleotide-binding domain, score 31.3, E-value 1.9e-06"
FT   CDS_pept        365705..367087
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0306"
FT                   /old_locus_tag="BF0314"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06085"
FT                   /db_xref="InterPro:IPR021533"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE1"
FT                   /protein_id="CAH06085.1"
FT                   /translation="MKSFYPVLYLCFLFGLLPFLGSCSEENESSGTIEMNQLPGTAQSF
FT                   LSNYFPGQTPEKIERTNTDQENARLLYRVVFPNEVKVEFSENGGWKRLMIPDQKLPGSL
FT                   DSLWGKIIEYVQQLFPDDPFIGIENACYGDCVLLSSGKKIAFYYDGTCIGYEMDIKDES
FT                   GVPQPVRDFVATYFPDGVFQAVVEHIPNENVTAGYSFWLENGFKCVLNDRGQWTEVNGG
FT                   TELLPVSILETLPAKVTEQLYRDYPAAQVTYIRLEGTCYTIQVSKTVYVTIDPESKPIV
FT                   VPVMQAQALAEEYFGKLRSISISHPLHTDVLNFKVCLPNGFNMLVNEDASEWLNIDGNG
FT                   FAFPEKLVASLPEKITEYISAHSNSEITRVDRSVAASFLVELTNGDGLMFDSQGGFLGK
FT                   EKIELSISEKTYRYMRHQFPDDLNMYFSSYSIEGWIYKLGDGSQVRFDRDGNFVEMIAA
FT                   AK"
FT   misc_feature    365705..365776
FT                   /note="Signal peptide predicted for BF0314 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.808) with cleavage site
FT                   probability 0.423 between residues 24 and 25"
FT   CDS_pept        complement(367248..368225)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0307"
FT                   /old_locus_tag="BF0315"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   transcriptional regulator BT2096 SWALL:AAO77203
FT                   (EMBL:AE016934) (325 aa) fasta scores: E(): 7.6e-90, 73.23%
FT                   id in 325 aa, and to Bacteroides thetaiotaomicron sensor
FT                   FucR or BT1272 SWALL:Q9RQ14 (EMBL:AF137263) (331 aa) fasta
FT                   scores: E(): 7.8e-34, 33.95% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06086"
FT                   /db_xref="GOA:Q5LIE0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIE0"
FT                   /protein_id="CAH06086.1"
FT                   /translation="MKRNESKYKQVVNHVIDGINNGSYKKGDWILSINEFRKNYNLSRD
FT                   TVFAGLSELKSKGIIDSTPGVGYYIATTRIAQKLNIFLLFNEFNEFKEDLYNSFISSIR
FT                   KTANVDLYFHNYNRKVFETLINEANYKYTTYILMPGKFTNIAPLLESLSGRVFLLDHFH
FT                   PELAGKYSSVAQNFEKDTYEALVYGLPHLKKYDHIIMVQKEEKEPIERYNGLCAFCEEY
FT                   HFTHEYTDSVRNREIRQGETFMVVNDRDLVDLLKQAQLQNFAPGKDFGIISYNDTPLKE
FT                   ILAGGITTLSTDFKQMGQTMASLITQKEIKTIENPWKLDIRNSL"
FT   CDS_pept        368437..370524
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0308"
FT                   /old_locus_tag="BF0316"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT2097 SWALL:AAO77204 (EMBL:AE016934)
FT                   (687 aa) fasta scores: E(): 1.6e-184, 61.93% id in 683 aa,
FT                   and to Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein BT3674 SWALL:AAO78779 (EMBL:AE016941) (668 aa)
FT                   fasta scores: E(): 1.1e-54, 35.89% id in 677 aa, and to
FT                   Rhizobium loti hypothetical protein Mlr2247 SWALL:Q98IU3
FT                   (EMBL:AP002999) (662 aa) fasta scores: E(): 1.5e-34, 32.48%
FT                   id in 711 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06087"
FT                   /db_xref="GOA:Q5LID9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID9"
FT                   /protein_id="CAH06087.1"
FT                   /translation="MRTYRFMFPVLLAMTATGSLTAGPSDKGSSGIRFPEVNQVKIEDT
FT                   FWKPKLNLWQKVTVNDVFDKFEGKHLEHPGEFCNTFENFDRVAKGERNIGRHAGAPWFD
FT                   GLVYETIRGVADLMARQSDAALEKRVDGYIDRIAVAQASEPNGYIDTYTQLMEADHQWG
FT                   ERGGMLRWQHDVYNAGMLVEAGVHYYNATGKTKLLEVATRCANLMAEYMGTFPKKNVVP
FT                   AHSGPEEALVKLYTLYRDNPGLKKQINVPVVEREYLRLAEFWIEGRGKHCGFPLWGTWG
FT                   NPAAEQWIRDRKYEAPEFGNHTRPSWGDYAQDSIPLFEQKTIEGHAVRATLFATGATAA
FT                   ALENRSPEYIAAVSRLWDNMIGKRMFITGGVGAVHFDEKFGPDYFLPTDAYLETCAAVG
FT                   AGFFSQRMNELTGDAKYMDELERTLYNNVLTGISLSGTQYTYQNPLNSAKHARWGWHDC
FT                   PCCPPMFLKMMSAMPGFIYSQKGDDIYVNLFIGSETELSLSDQSRIRLTQKTGYPWDGS
FT                   VVMTVEPEKEKTFLLKVRIPGWAQGVENPYDLYRSEVKSAVNLKVNGKSIAMKIFKGYA
FT                   EIQRKWKKGDRVELTLPVQPRLVTANEAVADLQNKVAIAAGPFVYCLEGCDNEGVADLR
FT                   LDTRAPLSMTFEKELLNGVNVIKGQALDKTGKKVSVSAIPYYALGNRQDKGYVVWMPAN
FT                   K"
FT   misc_feature    368437..368502
FT                   /note="Signal peptide predicted for BF0316 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.836 between residues 22 and 23"
FT   CDS_pept        370526..372952
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0309"
FT                   /old_locus_tag="BF0317"
FT                   /product="putative exported carbohydrate-binding protein"
FT                   /note="C-terminus is similar to Bacteroides ovatus
FT                   arabinosidase AsdI SWALL:Q59218 (EMBL:U15178) (660 aa)
FT                   fasta scores: E(): 2.5e-08, 24% id in 575 aa, and the
FT                   C-terminus is similar to Aspergillus niger
FT                   alpha-L-arabinofuranosidase A precursor AbfA
FT                   SWALL:ABFA_ASPNG (SWALL:P42254) (628 aa) fasta scores: E():
FT                   1.2e-07, 24.37% id in 599 aa, and the C-terminus is similar
FT                   to Bacteroides thetaiotaomicron alpha-L-arabinofuranosidase
FT                   A precursor BT0368 SWALL:AAO75475 (EMBL:AE016927) (660 aa)
FT                   fasta scores: E(): 1.2e-07, 25.04% id in 575 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06088"
FT                   /db_xref="GOA:Q5LID8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID8"
FT                   /protein_id="CAH06088.1"
FT                   /translation="MNEHKHNYNMKINCLLALALSASSLAAQDAVIRVDAGKVENKITP
FT                   YLYGACMEDVNHEIYGGLYDQKIFGESFEEPVSMDNFIGFTRCEGVWKLQDGQLSVQAH
FT                   PGAKLVYDDTQLSDGTVGVDLKFTNGTSSSNNAGLLLRVGEYGGGADNFDGYEVSLFAD
FT                   GKRLLLGKHLHNWQELKTTPVDVDPMQWNRMEVKLDGDELVILLNDCEVLRFEDRDTGL
FT                   RNGKVAFRNWGADVSYRSLTIGSNTPVKLLTKATPQVSGMWDAFADLTAAAVYKQIADK
FT                   PFHGRYAQEIEYLVGTGKVGIANRSLNRWGISVRQGEKKTGSLYLKGKAEVRVALQSVD
FT                   GEKEYAVQCIRANAGDWKKYTFELTPDKTDENARLAIYLEEKGRIQVDMVTLMNGADRQ
FT                   FCGLPLRNDIGQAMVDQGLRFLRYGGTMVNAPEYRFKKMIGDRAERPPYKGHWYTYSTN
FT                   GFGIEDFLHFCEKAGFMPAYAVNVEESAQDMADMIEYLNGSVDTKWGKKRAENGHPEPY
FT                   GLKYLEIGNEEVIWGDIEADYQHYIDRFNDIYEAVHAKDPEVQFIHSAWWRPESPNMEK
FT                   VFKALDGKAAYWDYHPWTDDLGSHVNIDRELTDMKAKFLKWNPKTSMRCAIFEENGNLH
FT                   NVQRAIVHATVQNVVRRHGDFILTTCAANALQPYLQNDNGWDQGQIFFTSGQVWGMPTF
FT                   YAQQMSSAHHHPLRLWSETVGELDMTATTNEARDEVILHVVNTSSEVRETQVSLSGFIP
FT                   KGNMEIYTLSGELNDENLPDTPTWILPKATWKQAPGSDFTYSFPGYSYTIVVLKK"
FT   misc_feature    370526..370606
FT                   /note="Signal peptide predicted for BF0317 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.521 between residues 27 and 28"
FT   misc_feature    371543..371710
FT                   /note="Pfam match to entry PF02018 CBM_4_9, Carbohydrate
FT                   binding domain, score 21.5, E-value 2.3e-06"
FT   CDS_pept        372962..375601
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0310"
FT                   /old_locus_tag="BF0318"
FT                   /product="putative exported rhamnosidase protein"
FT                   /note="Similar to Bacillus sp. GL1 rhamnosidase A RhaA
FT                   SWALL:Q93RE8 (EMBL:AB046705) (886 aa) fasta scores: E():
FT                   1.1e-63, 32.91% id in 878 aa, and to Bacteroides
FT                   thetaiotaomicron alpha-rhamnosidase BT2524 SWALL:AAO77631
FT                   (EMBL:AE016936) (881 aa) fasta scores: E(): 2.4e-140,
FT                   38.77% id in 882 aa, and to Streptomyces coelicolor
FT                   hypothetical protein SCO0488 or SCF34.07 SWALL:Q9RK18
FT                   (EMBL:AL939105) (1138 aa) fasta scores: E(): 4.3e-84,
FT                   34.05% id in 781 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06089"
FT                   /db_xref="GOA:Q5LID7"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID7"
FT                   /protein_id="CAH06089.1"
FT                   /translation="MKIGYLKPGILLLVLLFSFRQDLFAKKRITSLKCEYIEAPLGLDV
FT                   QRPRLMWKVDTSDVPSRQTAYRILVSSTPELLRQGEADIWDSGKQKSDEQLVSYAGSTL
FT                   RPHTRYWWRVEVWLNNKKVVSEPMWFETGKFSATDWEASWITDGYDKDYEPSPMFRKVF
FT                   DVSKEVASARCYISGLGYYRLSFNGKAVNDHALDPGFTDYSKRVLYLTYDISGLLRHGK
FT                   NCIGVQLGNGWFNEQTPAVWHFHEAPWRKRPQMIAEIHLCYTDGSKDIITTDTSWKTST
FT                   GPLLFDNLYVGSFYDARLEQKGWDTELFDDVSWQHAKLTAAPAPLIEAQKMPSITTADT
FT                   LSVVSVNCISDTCYVFDMGINTAGVPRLEIKGERGTRIRLRHSEMLQKDGNIDQRNIDM
FT                   HLRPRNKREIIQTDEYVLKGEGVETFIPPFTYHGFRYIELTSDRPLTVADVKLQTLRMH
FT                   SDVAEVGSFKCSDQLLNTIFNICRNSYLSNLFGIPTDCPTREKNGWMADGFMVQEAGMF
FT                   NYDSRNVYAKWVKDMIDTQEANGNVAGIAPTSRRWDSNWAGPLWDAAIFIVPSYLYRYT
FT                   GDIETMRQVYPAAERYLKYIETTEDERGLINHGLGDWLFYKAETPVDFMATGFVYWDNL
FT                   MMAQMAELTGRVEDRQKYLAKAEELKKRINDHFFDSQTVSYANKTQLSYALPLYLHIVP
FT                   EAYRERLAENLHKIIAANDYSLDFGFIGSVMVPDVLAETGYAETAYRMLTKTTLPSWGY
FT                   WIKETGATSLYETWDVTRRIGDASLNHPSMGAVSAWMYKYPAGIRLSPDAPAFKKILIQ
FT                   PCFLSDLDFVEASHESMYGTIRVDWRREEGKIRLHLVLPSTAMATVVLPGQKPKAVKGG
FT                   EHIFVIPE"
FT   misc_feature    372962..373021
FT                   /note="Signal peptide predicted for BF0318 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.633) with cleavage site
FT                   probability 0.403 between residues 20 and 21"
FT   CDS_pept        complement(375781..376842)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0311"
FT                   /old_locus_tag="BF0319"
FT                   /product="putative peptidase/deacetylase"
FT                   /note="Similar to Escherichia coli acetylornithine
FT                   deacetylase ArgE or B3957 SWALL:ARGE_ECOLI (SWALL:P23908)
FT                   (383 aa) fasta scores: E(): 5e-10, 25.2% id in 373 aa, and
FT                   to Bacteroides thetaiotaomicron acetylornithine deacetylase
FT                   BT3549 SWALL:AAO78655 (EMBL:AE016941) (355 aa) fasta
FT                   scores: E(): 2.2e-126, 86.81% id in 349 aa, and to
FT                   Mycobacterium tuberculosis DapE or Rv1202 or MTCI364.14 or
FT                   mt1240 SWALL:O05303 (EMBL:Z93777) (354 aa) fasta scores:
FT                   E(): 1.1e-17, 27.64% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06090"
FT                   /db_xref="GOA:Q5LID6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID6"
FT                   /protein_id="CAH06090.1"
FT                   /translation="MIDESITSEAVGLLKSLISIPSLSREEEKAADYLQNYIEAEGMTT
FT                   GRKGNNIWCLSPMFDLKKPTILLNSHIDTVKPVNGWRKDPFTPREENGKLYGLGSNDAG
FT                   ASVVTLLQVFLQLCRKQQSYNLIYLASCEEEVSGKGGIESVLPGLPPISFAVVGEPTEM
FT                   QPAIAEKGLMVLDVTATGKAGHAARNEGDNAIYKVLDDIAWFRDYRFAKESPLLGPVKM
FT                   SVTVINAGTQHNVIPDRCSFVVDVRSNELYSNEELFTEIQKHISCKAEARSFRLNSSRI
FT                   EESHPFVQKAKKLGRVPFGSPTLSDQALMVFPSVKIGPGRSSRSHTADEYIMIKEIEEA
FT                   LELYLKILDGLEI"
FT   misc_feature    complement(375784..376803)
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40, score 181.8, E-value 9.7e-52"
FT   misc_feature    complement(376618..376647)
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / YscS family
FT                   signature 1."
FT   CDS_pept        377031..378836
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0312"
FT                   /old_locus_tag="BF0320"
FT                   /product="putative AMP binding long chain acyl-CoA
FT                   synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /note="Similar to Arabidopsis thaliana long chain acyl-CoA
FT                   synthetase 7 LacS7 SWALL:Q8LKS5 (EMBL:AF503757) (700 aa)
FT                   fasta scores: E(): 7.3e-40, 29.12% id in 625 aa, and to
FT                   Bacteroides thetaiotaomicron putative
FT                   long-chain-fatty-acid--CoA ligase BT3550 SWALL:AAO78656
FT                   (EMBL:AE016941) (601 aa) fasta scores: E(): 2.6e-207,
FT                   87.52% id in 601 aa, and to Vibrio parahaemolyticus
FT                   putative long-chain-fatty-acid-CoA ligase VP0351
FT                   SWALL:BAC58614 (EMBL:AP005074) (602 aa) fasta scores: E():
FT                   2.7e-91, 41.3% id in 598 aa, and to Vibrio cholerae
FT                   long-chain-fatty-acid--CoA ligase, putative VC2484
FT                   SWALL:Q9KP89 (EMBL:AE004318) (601 aa) fasta scores: E():
FT                   3.5e-91, 41.09% id in 601 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06091"
FT                   /db_xref="GOA:Q5LID5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID5"
FT                   /protein_id="CAH06091.1"
FT                   /translation="MTYHHLSVLVHRQAEKYGDKTALKYRDYEKAQWIPISWNEFSQTV
FT                   RQAANAMVELGVQEEENIGIFSQNKPECLFTDFAAFANRAVTIPLYATSSPAQAQYIIN
FT                   DAQIRFLFVGEQFQYDAAFSVFGFCPSLVQLIIFDPAVVKDPRDMSSIYYDEFLAKGKD
FT                   LPHNEVVEERTARASAEDLANILYTSGTTGEPKGVMLHHSCYLEAFRIHDIRLVDMTDK
FT                   DVSMNFLPLTHVFEKAWTYLCVHKGVQVCINLRPADIQTTIKEIRPTLMCSVPRFWEKV
FT                   YAGVQEKIAETTGIKKMLMLDAIKVGRIHNLDYLRVGKTPPRMIQLKYKFYEKTIYALL
FT                   KKTIGIENGNFFPTAGAAVPDEICEFVHSVGIDMLVGYGLTESTATVSCTSKTGYDIGS
FT                   VGQVMPEVEVKIGEDNEILLRGKTITKGYYKKAEATAAAIDEEGWFHTGDAGYFKNGQL
FT                   YLTERIKDLFKTSNGKYIAPQALETKLVIDRYIDQIAIIADQRKFVSALIVPVYGFVKQ
FT                   YAKEKGIEYKDMAELLEHPKITALFRARIDTLQQQFAHYEQIKRFTLLPEPFSMEKGEL
FT                   TNTLKLKRPVVARNYKEVIDKMYEE"
FT   misc_feature    377139..378518
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 236.0, E-value 4.5e-68"
FT   misc_feature    377583..377618
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        379054..380013
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0313"
FT                   /old_locus_tag="BF0321"
FT                   /product="putative peptide chain release factor"
FT                   /note="Similar to Escherichia coli peptide chain release
FT                   factor 2 PrfB or SupK or B2891 SWALL:RF2_ECOLI
FT                   (SWALL:P07012) (365 aa) fasta scores: E(): 2.4e-45, 46.6%
FT                   id in 309 aa, and to Bacteroides thetaiotaomicron peptide
FT                   chain release factor Rf-2 BT3552 SWALL:AAO78658
FT                   (EMBL:AE016941) (319 aa) fasta scores: E(): 1.7e-112,
FT                   93.41% id in 319 aa, and to Lactococcus lactis peptide
FT                   chain release factor 2 PrfB or ll0971 SWALL:RF2_LACLA
FT                   (SWALL:Q9CGX1) (365 aa) fasta scores: E(): 2.4e-45, 45.45%
FT                   id in 308 aa. CDS is truncated at the N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06092"
FT                   /db_xref="GOA:Q5LID4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID4"
FT                   /protein_id="CAH06092.1"
FT                   /translation="MKLVKGLQKWIEGYNDVKTLTDELELAFDFYKDELVTEQEVDEAY
FT                   AKALEHVENLELQNMLRDEADQMSCVLKINSGAGGTESQDWASMLMRMYLRYAETNGYK
FT                   ATMANLQEGDEAGIKTCTIQIEGDYAYGYLKGENGVHRLVRVSPYNAQGKRMTSFASVF
FT                   VTPLVDDSIEVNILPACISWDTFRSGGAGGQNVNKVESGVRLRYQYKDPYTGEEEEILI
FT                   ENTETRDQPKNRENAMRQLRSILYDKELQHRMAEQAKVEAGKKKIEWGSQIRSYVFDDR
FT                   RVKDHRTNFQTSDVNGVMDGKIEGFIKAYLMEFSSEEA"
FT   misc_feature    379126..379464
FT                   /note="Pfam match to entry PF03462 PCRF, PCRF domain, score
FT                   132.0, E-value 9.6e-37"
FT   misc_feature    379552..379914
FT                   /note="Pfam match to entry PF00472 RF-1, Peptidyl-tRNA
FT                   hydrolase domain, score 134.6, E-value 1.6e-37"
FT   CDS_pept        380166..380300
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0314"
FT                   /old_locus_tag="BF0322"
FT                   /product="hypothetical membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06093"
FT                   /db_xref="GOA:Q5LID3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID3"
FT                   /protein_id="CAH06093.1"
FT                   /translation="MSKNKKKVTHSKKEEEQAKKVVKIVFVSLVILALAMIIGFSLLG"
FT   misc_feature    380226..380294
FT                   /note="1 probable transmembrane helix predicted for BF0322
FT                   by TMHMM2.0 at aa 21-43"
FT   CDS_pept        380417..381736
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0315"
FT                   /old_locus_tag="BF0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein CC0911 SWALL:Y911_CAUCR (SWALL:P33976) (493 aa)
FT                   fasta scores: E(): 1.9e-17, 27.19% id in 364 aa, and to
FT                   Xanthomonas axonopodis polyphosphate-selective porin O OprO
FT                   or XAC3472 SWALL:Q8PGZ0 (EMBL:AE011995) (390 aa) fasta
FT                   scores: E(): 1.6e-12, 27.96% id in 354 aa, and to Xylella
FT                   fastidiosa polyphosphate-selective porin O OprO or PD0270
FT                   SWALL:AAO28156 (EMBL:AE012554) (389 aa) fasta scores: E():
FT                   2.9e-12, 26.46% id in 359 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06094"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID2"
FT                   /protein_id="CAH06094.1"
FT                   /translation="MNKQLITIFSIFSITCLGMVSAQESKSFLPEVKKESLTFSSEDNK
FT                   FKLTFNGRIQADGAMFFGEDYQPIGNGVGFRRVRLGATAAFGKRLSGKIEMDLTDGGFS
FT                   LKDCFIKYAFPNGLYFRAGNFKESFGMAAMTSSGDLWFMEKANVVSAFAPEYHIGVQGT
FT                   WEHDQFLGVAGVHFKKIEGNKEKDYSESNNKAGEDEGISVTARAVWQPVSADKVKGLHL
FT                   GIAASYRTPKTTVGSLMPNTVRYSTRSLSYINKIKFLDTSPIASVSHDWLAGAELAGFY
FT                   RGFRFQGEYIMNNTVRMEGLATEKFNGFYVQAAYLLFGGQQRYSKSRGAFSQPSFGRSW
FT                   GDIELAARFDRIDLNGTEVMGGSSNGWTFGVNYYATRNLKFQLNYSYVDNDKYANAFGQ
FT                   AAVGYKSNGEIAYKPEEVDESLGKGGNAYGILGLRIQLNF"
FT   CDS_pept        381744..382214
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0316"
FT                   /old_locus_tag="BF0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3554 SWALL:AAO78660 (EMBL:AE016941)
FT                   (155 aa) fasta scores: E(): 4e-51, 86.45% id in 155 aa, and
FT                   to Anabaena sp. hypothetical protein ALL4694 SWALL:Q8YN76
FT                   (EMBL:AP003597) (153 aa) fasta scores: E(): 7.3e-22, 48.07%
FT                   id in 156 aa, and to Xylella fastidiosa hypothetical
FT                   protein Xf2357 SWALL:Q9PAY8 (EMBL:AE004045) (165 aa) fasta
FT                   scores: E(): 1.8e-20, 46.62% id in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06095"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID1"
FT                   /protein_id="CAH06095.1"
FT                   /translation="MSQEIERKFLVSGDYKSQAFDQSRIVQGYISSARGRTVRVRIRDG
FT                   KGYLTIKGASDASGISRYEWEKELSLAEAEELMKLCEPGVIDKTRYLVRSGKHIFEVDE
FT                   FYGENEGLVVAEVELGSEDEVFVKPGFIGEEVTGDIRYYNSQLMKKPYTTWL"
FT   misc_feature    381747..382190
FT                   /note="Pfam match to entry PF01928 CYTH, CYTH domain, score
FT                   57.3, E-value 2.9e-14"
FT   CDS_pept        382271..383566
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0317"
FT                   /old_locus_tag="BF0325"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3555 SWALL:AAO78661 (EMBL:AE016941)
FT                   (430 aa) fasta scores: E(): 1.9e-145, 86.04% id in 430 aa,
FT                   and to Vibrio parahaemolyticus hypothetical protein vp2084
FT                   SWALL:BAC60347 (EMBL:AP005080) (424 aa) fasta scores: E():
FT                   4.3e-27, 27.08% id in 432 aa, and to Vibrio vulnificus
FT                   predicted membrane protein VV20031 SWALL:Q8D7W5
FT                   (EMBL:AE016808) (423 aa) fasta scores: E(): 7.4e-24, 25.72%
FT                   id in 381 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06096"
FT                   /db_xref="GOA:Q5LID0"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LID0"
FT                   /protein_id="CAH06096.1"
FT                   /translation="MEQLYNYLPEKLVTFILVTLFSLLIGLSQRKISLKREGETTLFGT
FT                   DRTFTFIGMLGYLLYILDPEEMHLFMGGGLILGILLGLNYYVKQSQFHVFGVTTIIIAL
FT                   ITYCIAPIVSTQPSWFYVMVIVTVLLLTELKHTFTEIAQRMKNDEMITLAKFLAISGII
FT                   LPMLPNENIIPDINLTPYTIWLATVVVSGISYLSYLLKRYVFRESGVLVSGIIGGLYSS
FT                   TATISVLARKSRNAHSQEASEYVAAMLLAVSMMFLRFMILILIFSSTIFTSIYPYLLIM
FT                   AAVAAGVAWFIHTRRKRTPDADLVEEEDDSSNPLEFKVALIFAGLFVIFTVLTHYTLIY
FT                   AGTGGLNLLSFVSGFSDITPFILNLLQGTGSVAATVVMACTMQAIISNIVVNMCYALFF
FT                   SGKQSKLRSWILGGFGCVIAANVVVLFFFYLI"
FT   misc_feature    order(382283..382351,382388..382456,382469..382531,
FT                   382544..382612,382625..382684,382721..382774,
FT                   382802..382870,382889..382957,383000..383068,
FT                   383087..383146,383225..383293,383312..383380,
FT                   383390..383458,383492..383560)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BF0325 by TMHMM2.0 at aa 5-27, 40-62, 67-87, 92-114,
FT                   119-138, 151-168, 178-200, 207-229, 244-266, 273-292,
FT                   319-341, 348-370, 374-396 and 408-430"
FT   CDS_pept        383737..386313
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0318"
FT                   /old_locus_tag="BF0326"
FT                   /product="putative TonB-dependent receptor exported
FT                   protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   TonB-dependent receptor BT3565 SWALL:AAO78671
FT                   (EMBL:AE016941) (853 aa) fasta scores: E(): 0, 72% id in
FT                   861 aa, and to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4568 SWALL:AAO79673 (EMBL:AE016945)
FT                   (811 aa) fasta scores: E(): 4.9e-25, 23.22% id in 775 aa,
FT                   and to Cytophaga johnsonae hypothetical 65.5 kDa protein
FT                   SWALL:O30490 (EMBL:AF007381) (578 aa) fasta scores: E():
FT                   1.1e-17, 24.5% id in 551 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06097"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC9"
FT                   /protein_id="CAH06097.1"
FT                   /translation="MRNKLLLLLLLMFMTSGMMYAQQQKTQQSQQRTAAPSYTLKGVLL
FT                   DSLTQEGEPYATIKIAKKNAPQKALKMAVTDLNGKFQEKLTVAPGEYIITLSSVGKVTI
FT                   VKDFTVKASEKVIDLGKLNMAEATNELKGIEVVAQKPLVKVDVDKIEYNIEDDPDSKTN
FT                   TVMEMLRKVPLVTVDGEDNIKVNGSSSFKIHVNGKPNNMMSNNPKDVLKSMPANTIKHI
FT                   EVITSPGAKYDAEGVGGILNIVTVGGGFEGYTATFRASGSNRGAGAGGYATIKSGKLTI
FT                   TGNYNYNYDTSPKSYSDSYRENYDSEDQKYLESKSSSDYNGSFQYGNLEASYEIDTLRL
FT                   LTASFGMYGGANDNKSDGLTTMWNAQRDRLAYQYRSLSDGDGSWYSMRGNVDYQRTSKK
FT                   NKDRMITLSYKISTQPQNSDYYTDYKDIKDPFEMDIVKKFLLNNSHSDGKTNTTEHTFQ
FT                   VDYTTPIGKLHTIEAGAKYIIRNNLSDNKLFEAEGVSDNYEYNNDRSSKYKHLNDILAA
FT                   YLGYTLRYKTFSFKPGVRYEYTSQDVKYLAGAIGPEADFSTSYNDFVPSVTMGIKIGKT
FT                   QNLRGGYNMRIWRPGIWNLNPYFDDRNPMFISQGNSNLESEKSHSFNLSYSMFSMKFNV
FT                   NISLRHSFGNNGIERVSRLIGKGGEEFPGGHHAPEGALYSTYENIGKNRNTGLSLYGNW
FT                   NASPNTRIYLNGDGSYVDIKSPAQGLHNYGWNASLYGGIQHTFPLKIRASLNAGGSTPY
FT                   ISLQGKGSGYYYYSLGVNRSFIKDRFTVSAYVSNIFEKYRSYNNTTMGENFLSKSSSRY
FT                   QSRSFGISLSYRIGELKASVKKAARSINNDDVKGGGGQGGQGGGAN"
FT   misc_feature    383737..383805
FT                   /note="Signal peptide predicted for BF0326 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.872 between residues 23 and 24"
FT   misc_feature    384151..386211
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score -4.6, E-value 0.00023"
FT   CDS_pept        complement(386594..387814)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0319"
FT                   /old_locus_tag="BF0327"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT2916 SWALL:AAO78022 (EMBL:AE016938)
FT                   (407 aa) fasta scores: E(): 4.1e-84, 50.97% id in 410 aa,
FT                   and to Thermotoga maritima hypothetical protein Tm1061
FT                   SWALL:Q9X0F1 (EMBL:AE001766) (387 aa) fasta scores: E():
FT                   6.1e-69, 46.89% id in 386 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT3021
FT                   SWALL:AAO78127 (EMBL:AE016938) (450 aa) fasta scores: E():
FT                   4.5e-64, 42.82% id in 418 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06098"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC8"
FT                   /protein_id="CAH06098.1"
FT                   /translation="MKRIILSIVWGLLTGWAAVPCLWAQSRTGTADREIWVKTLVRLAD
FT                   PVLSNLANETLKKEMPYESLAPNRQRFSYLEAVGRTVCGIAPWLELGEDDTPEGQLRKK
FT                   YIELTVKGISNAVNPSSPDYLIFGEPSQPLVDAAFLAEGLLRAPKQLWGNLSPAARKQV
FT                   VTELKRSRVIKPNESNWLLFASIVEAALQEFTGECDTTRLNYGVRKFRDLWYKGDAQYG
FT                   DGAEFHLDYYNSFVIHPMLTDVLVVMQKHRMPESEFLNVQQKRLGRYAEQLERFISPEG
FT                   TYPVIGRSIVYRTGVFHALGQAALLHLLPQQIVPAQVRCGMTKVIENQFRSAANFDTKG
FT                   WLKIGFSGNQVQMSESYINTGSTYLCLTGFLPLGLPADDPFWSAPPAEWTNLKAWSGKE
FT                   MPADHSL"
FT   misc_feature    complement(387743..387814)
FT                   /note="Signal peptide predicted for BF0327 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.837 between residues 24 and 25"
FT   CDS_pept        complement(387814..389901)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0320"
FT                   /old_locus_tag="BF0328"
FT                   /product="putative beta-galactosidase"
FT                   /note="Similar to Thermoanaerobacter mathranii
FT                   beta-galactosidase Lac SWALL:Q93IM1 (EMBL:AJ316558) (751
FT                   aa) fasta scores: E(): 5.2e-31, 26.92% id in 702 aa, and to
FT                   Bacteroides thetaiotaomicron beta-galactosidase BT0757
FT                   SWALL:AAO75864 (EMBL:AE016929) (682 aa) fasta scores: E():
FT                   2.2e-207, 72.25% id in 656 aa, and to Bacteroides
FT                   thetaiotaomicron beta-galactosidase BT2969 SWALL:AAO78075
FT                   (EMBL:AE016938) (702 aa) fasta scores: E(): 1.7e-81, 37.62%
FT                   id in 699 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06099"
FT                   /db_xref="GOA:Q5LIC7"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="PDB:3CMG"
FT                   /db_xref="PDB:5Z1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC7"
FT                   /protein_id="CAH06099.1"
FT                   /translation="MKQQKCNYFPSLWWRGREKGLSTFLFLLLFSISLHAQRQDILLNN
FT                   NWNFRFSHQVQGDTRRVDLPHTWNAQDALAGKIDYKRGIGNYEKALYIRPEWKGKRLFL
FT                   RFDGVNSIADVFINRKHIGEHRGGYGAFIFEITDLVKYGEKNSVLVRANNGEQLDIMPL
FT                   VGDFNFYGGIYRDVHLLITDETCISPLDYASPGVYLVQEVVSPQEAKVCAKVNLSNRAA
FT                   DGTAELQVLVTDGTKVICKESRNVSLKQGADILEQLPLLIQKPRLWNGCEDPFMYQVSI
FT                   SLHKDGKQIDSVTQPLGLRYYHTDPDKGFFLNGKHLPLHGVCRHQDRAEVGNALRPQHH
FT                   EEDVALMREMGVNAIRLAHYPQATYMYDLMDKHGIVTWAEIPFVGPGGYADKGFVDQAS
FT                   FRENGKQQLIELIRQHYNHPSICFWGLFNELKEVGDNPVEYVKELNALAKQEDPTRPTT
FT                   SASNQDGNLNFITENIAWNRYDGWYGSTPKTLATFLDRTHKKHPELRIGISEYGAGASI
FT                   YHQQDSLKQPSASGWWHPENWQTYYHMENWKIIAERPFVWGTFVWNMFDFGAAHRTEGD
FT                   RPGINDKGLVTFDRKVRKDAFYFYKANWNKQEPMIYLAEKRCRLRYQPEQTFMAFTTAP
FT                   EAELFVNGVSCGKQKADTYSTVVWKNVKLTSGENIIRVTTPGKKPLTDEVTVEYKEDRP
FT                   L"
FT   misc_feature    complement(388078..388983)
FT                   /note="Pfam match to entry PF02836 Glyco_hydro_2_C,
FT                   Glycosyl hydrolases family 2, TIM barrel domain, score
FT                   42.5, E-value 7.1e-15"
FT   misc_feature    complement(389002..389313)
FT                   /note="Pfam match to entry PF00703 Glyco_hydro_2, Glycosyl
FT                   hydrolases family 2, immunoglobulin-like beta-sandwich
FT                   domain, score 3.5, E-value 0.0015"
FT   misc_feature    complement(389353..389832)
FT                   /note="Pfam match to entry PF02837 Glyco_hydro_2_N,
FT                   Glycosyl hydrolases family 2, sugar binding domain, score
FT                   14.2, E-value 6.5e-09"
FT   CDS_pept        complement(389958..391493)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0321"
FT                   /old_locus_tag="BF0329"
FT                   /product="putative exported beta-hexosaminidase"
FT                   /note="Similar to Porphyromonas gingivalis
FT                   beta-hexosaminidase precursor NahA SWALL:HEXA_PORGI
FT                   (SWALL:P49008) (777 aa) fasta scores: E(): 1.1e-50, 36.4%
FT                   id in 467 aa, and to Bacteroides thetaiotaomicron
FT                   beta-hexosaminidase precursor BT3598 SWALL:AAO78703
FT                   (EMBL:AE016941) (537 aa) fasta scores: E(): 8e-90, 49.53%
FT                   id in 428 aa, and to Bacteroides forsythus HexA
FT                   SWALL:AAO33832 (EMBL:AY184490) (782 aa) fasta scores: E():
FT                   4.6e-53, 39.05% id in 443 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06100"
FT                   /db_xref="GOA:Q5LIC6"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC6"
FT                   /protein_id="CAH06100.1"
FT                   /translation="MKRTNRTLFIHNTARGRIKFLLLALFAFQGLQAQKLFPAPSAIET
FT                   HKGTFSYDEVSAKCVRTTISKSLPAIGIEYSDEAYQLEITPDSIFIDATSAKGAFYARQ
FT                   AIKQLARHERGKIRCCRIYSSPRYAWRGFMLDESRHFFGKEKVKQYLDLMALLHLNVFH
FT                   WHLTDEPGWRIEIKKYPKLTEIGAVGNWHDAQAAPQFYTQDDIREIVAYAAERQIMVVP
FT                   EFDMPGHATAVCRAYPEVSGGGEGRWKHFTFHPCKEETYRFISDVLDEIVALFPAPYIH
FT                   IGGDEVHYGNQNWFTDPEIQNFIKEKGLINETGLEHYFIRRAADLVAAKGKKMIGWDEI
FT                   VDAGISPSKALVMWWRHDRKYQLLKALEQGYQVVLTPRRPLYGDFVQDASHKVGRYWDG
FT                   FNPLQDIYAFPEPISHLFKGYEDQILGMQFTLWTERIADGKRLDFMTFPRLIALAESAW
FT                   TSPKEKDWSRFCMRLPSFLEYLKEQGIYYFDVIHPQETPEPGGPEKADVLQNG"
FT   misc_feature    complement(390108..391112)
FT                   /note="Pfam match to entry PF00728 Glyco_hydro_20, Glycosyl
FT                   hydrolase family 20, catalytic domain, score 238.6, E-value
FT                   7.4e-69"
FT   misc_feature    complement(391116..391478)
FT                   /note="Pfam match to entry PF02838 Glyco_hydro_20b,
FT                   Glycosyl hydrolase family 20, domain 2, score 3.1, E-value
FT                   0.00025"
FT   misc_feature    complement(391395..391493)
FT                   /note="Signal peptide predicted for BF0329 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.788 between residues 33 and 34"
FT   CDS_pept        complement(391524..392435)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0322"
FT                   /old_locus_tag="BF0330"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3023 SWALL:AAO78129 (EMBL:AE016938)
FT                   (305 aa) fasta scores: E(): 2.5e-76, 64.59% id in 305 aa,
FT                   and to Pseudomonas putida hypothetical protein PP0968
FT                   SWALL:AAN66593 (EMBL:AE016777) (413 aa) fasta scores: E():
FT                   9.1e-11, 25.15% id in 318 aa, and to Lactobacillus
FT                   plantarum cell surface protein precursor LP_3001
FT                   SWALL:CAD65183 (EMBL:AL935260) (1074 aa) fasta scores: E():
FT                   3e-07, 22.5% id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06101"
FT                   /db_xref="GOA:Q5LIC5"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC5"
FT                   /protein_id="CAH06101.1"
FT                   /translation="MKTQLFKFACLIICLLTIAPNCHAGSKWKAKHVVLIGLDGWGAYS
FT                   VEKANIPHIKQLMNDGSYTLTKRSVLPSSSAVNWASMFMGAGPELHGYTTWNSSTPDLP
FT                   SKELSKNGIFPTIFQLLREADPKAEIGTFYEWVGIKYLVDTLAVNKYNQGINYEKYPTE
FT                   LCEKAVKYIKEKKPTLTLIAWDNPDHVGHKEGHDTPAYYHKLEEIDGYIGKVMNAVKEA
FT                   GILDETIFIITSDHGGINKGHGGKTMQEMETPFIISGKNIKKGHEIQASMMQFDVAATV
FT                   AAIFKLKQPQVWIGRPIMEVFK"
FT   misc_feature    complement(391725..391919)
FT                   /note="Pfam match to entry PF01663 Phosphodiest, Type I
FT                   phosphodiesterase / nucleotide pyrophosphatase, score 21.4,
FT                   E-value 3.3e-06"
FT   misc_feature    complement(392364..392435)
FT                   /note="Signal peptide predicted for BF0330 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   CDS_pept        complement(392456..393667)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0323"
FT                   /old_locus_tag="BF0331"
FT                   /product="putative exported hydrolase"
FT                   /note="Similar to Bacillus sp. GL1 unsaturated glucuronyl
FT                   hydrolase Ugl SWALL:Q9RC92 (EMBL:AB019619) (377 aa) fasta
FT                   scores: E(): 2.8e-28, 33.33% id in 375 aa, and to
FT                   Bacteroides thetaiotaomicron putative unsaturated
FT                   glucuronyl hydrolase BT3348 SWALL:AAO78454 (EMBL:AE016940)
FT                   (400 aa) fasta scores: E(): 7.1e-106, 63.11% id in 404 aa,
FT                   and to Bacteroides thetaiotaomicron unsaturated
FT                   glucuronylhydrolase BT2913 SWALL:AAO78019 (EMBL:AE016938)
FT                   (402 aa) fasta scores: E(): 1.7e-67, 46.56% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06102"
FT                   /db_xref="GOA:Q5LIC4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC4"
FT                   /protein_id="CAH06102.1"
FT                   /translation="MNLKPLLGAACAMICVACSNHKPTVPSFITENVEFAKAQLGLAID
FT                   TIEASGKCLNPVTLNRDGSVYYCGYADWRSGFFPGSIWYLYELTGDTSYLPLARKYTEA
FT                   IRPAEHLTWHHDIGFIINCSFGNGLRLAPDTAAYKNVMIQAAKSLCTRFRPNAGVIQSW
FT                   DVKGNSWQSERGWECPVIIDNMMNLELLFEATKLSGDSTFYKVAVAHADRTLSEHFRPD
FT                   GSCYHVVDYNISDGSVRHKQTAQGYADESVWSRGQAWAIYGFTICYRETKDRKYLDQAL
FT                   KTFNRMKNDPHMPEDLIPYWDMDAPNIPNEPRDASSASCIASALYEISTYAVSDAASYK
FT                   AYADRIMHSLASPDYRAALGTNGNFILMHSVGSIPHNSEIDVPLNYADYYFLEALKRRK
FT                   DLDK"
FT   misc_feature    complement(393617..393667)
FT                   /note="Signal peptide predicted for BF0331 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.967) with cleavage site
FT                   probability 0.379 between residues 17 and 18"
FT   CDS_pept        complement(393671..395578)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0324"
FT                   /old_locus_tag="BF0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT4410 SWALL:AAO79515 (EMBL:AE016945) (644 aa)
FT                   fasta scores: E(): 1.8e-164, 57.96% id in 640 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical protein
FT                   BT2963 SWALL:AAO78069 (EMBL:AE016938) (980 aa) fasta
FT                   scores: E(): 3e-18, 21.26% id in 536 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06103"
FT                   /db_xref="GOA:Q5LIC3"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC3"
FT                   /protein_id="CAH06103.1"
FT                   /translation="MKKLLIFTLLLCCTVKALSYTERNYLQKQANVSSLQEVLILNQQW
FT                   VTYPAYTDRTGWDTFLGSFKNECILRGEKQLNYQWQVVKATDYMEFERSGNRSVMETPF
FT                   ANNNNAIADLLLAELAEGKGRFIDQLINGVYHSCEMTSWALAAHLNAQQSHRSLPDFKE
FT                   NIIDLTAGDLGSLLAWTYYYMHKEFDKLNPAISERLRHTLQQRILDPYMNNDHFWWMAV
FT                   NYRPGMLVNNWNPWCNSNALMCFMLLENDKEMLAKAIYRSMVSVDKFINYTHTDGACEE
FT                   GPSYWGHAAGKMFDYLELLSAVTGGTVSIFDNPMIKNMGEYISRSYVGKGWVVNFADAS
FT                   AKGSGDAPLIFRYGKAVNSNEMKGFAAMINTNKLPSGRDIYRTLAAIKIANELKETQAA
FT                   HLTPPFSWYPETEFCYITDNKGNFLAAKGGYNDESHNHNDAGTFSFWIDQTPFLIDAGV
FT                   GTYTRQTFSKDRYTIWTMQSNYHNLPLINGVPQRYGATYKATQVQADKRKNTFTANIAT
FT                   AYPAEAEVESWIRSYSLQKGQLRISDSFRLTTAKQPNQINFMTWGQVNTEIPGKIQLEV
FT                   KGKKAVIEYDKQLFDVKTEIIPLTDTRLSNVWGKSICRITLTATNIYKTGNYSFTIKKQ
FT                   "
FT   misc_feature    complement(395522..395578)
FT                   /note="Signal peptide predicted for BF0332 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.952 between residues 19 and 20"
FT   CDS_pept        complement(395930..397777)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0325"
FT                   /old_locus_tag="BF0333"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides fragilis putative outer
FT                   membrane protein FrrH SWALL:Q8VTA8 (EMBL:AF329100) (495 aa)
FT                   fasta scores: E(): 1.6e-05, 23.94% id in 355 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein, putative outer membrane protein BT3953
FT                   SWALL:AAO79058 (EMBL:AE016942) (631 aa) fasta scores: E():
FT                   2.2e-13, 24.05% id in 661 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT0191 SWALL:AAO75298
FT                   (EMBL:AE016926) (463 aa) fasta scores: E(): 1.6e-10, 25.61%
FT                   id in 285 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06104"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC2"
FT                   /protein_id="CAH06104.1"
FT                   /translation="MKLLNKLFILTATAIAISSCQGDLLDTKPYDKASSGSMWSNENFC
FT                   TMGVASIYATLREGYVAKEAYLMEAFSVGATCRDNDYPLLAGTASIGSGIFSDYWKQHY
FT                   AGIYRANDAIVHLPDAPISESVKGKLLSEAKVLRAFYYYKLNAVFRGVPYYNTPMELDQ
FT                   ADKPRESEENIWNFCIQDLTDAINDPNFPDRIATGKAEWGHVTKSVAYALRGKIYLWTK
FT                   EWSKAEADFRKVGELGHSLFQDGYKQLFKEANEQSDEAIFSLQCIDNNGSTYGNSMSFR
FT                   YGGRTTFGSCWNTMLASVDFVETYENIDGSKFNWDEYIPGFSSLDIKDREVFFLRNTDP
FT                   VTVKAQYREIGFDGTEEALDDMVKKIKAKVDGRLEKLSDKAKALYLPAGNEARIKAAYD
FT                   SRDPRLAQTVITPYATYDGSGNSVDHTFTSRWPYYGADTDYPYDLRTDTQSHLYYLFRK
FT                   FVAEGSSEMTNREQSPIDLPIIRYATVVIGLAEALNEQGKTDEAIEWLNKVRQRAGVAL
FT                   LNSNTATMVQGQEDMRVRIQNEFRWETAGEGVDFYEELRWKTWKESKFNNADGTAGMKD
FT                   VWGTITYPYTWGGDQYYVWPIPKHETDMNKSLTQNSGWN"
FT   misc_feature    complement(396281..396304)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(397712..397777)
FT                   /note="Signal peptide predicted for BF0333 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.942 between residues 22 and 23"
FT   CDS_pept        complement(397795..401148)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0326"
FT                   /old_locus_tag="BF0334"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides fragilis outer membrane
FT                   receptor FrrG SWALL:Q8VTA9 (EMBL:AF329100) (1137 aa) fasta
FT                   scores: E(): 4.8e-43, 32.65% id in 1139 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT0754
FT                   SWALL:AAO75861 (EMBL:AE016929) (1138 aa) fasta scores: E():
FT                   5e-84, 32.22% id in 1145 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT2196 SWALL:AAO77303
FT                   (EMBL:AE016935) (1120 aa) fasta scores: E(): 7.9e-73,
FT                   32.02% id in 1096 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06105"
FT                   /db_xref="GOA:Q5LIC1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC1"
FT                   /protein_id="CAH06105.1"
FT                   /translation="MRKSKLHLLPLSSKRVLVSTSLIMLLSGSAWAVSSQETVENGDAI
FT                   TAVPQQRRTVKGIVKDANGEPIIGANVIVKGNKTIGVITNLNGEFSLEVPSNATLQISY
FT                   IGYLNKEVKVSGNQVSFNIQLEEDSKTLDEVVVVGYGTQKKANLTGAVSSVDFEEQTKS
FT                   RPITTVSSALAGLSPGLQASSGSAMPGEDNTTLRVRGNGTMNNASPLIIIDGMEGSLNA
FT                   INPQDIENISILKDAASCAIYGARAANGVILVTTKSGDRDKIQVNYSGRISFNSPTRMI
FT                   ETMSNYADYMELMNESCENVGSGTLFDQKYIDLWREKSKDPNGVNENGVPNYIAYPNTN
FT                   WLKELYSGGMIHEHNLSVSGGSNKIRFLLSARYQDNEGIVDNTANKTYSVRANIEANPT
FT                   QWLTLGTRTYASQMDREVGDFSNANTFLRQSTAGTYPEWNGSFGYPECPDERATANNPL
FT                   YKLARNDGFKRYNRFNTTLFSKVKFFKDLSWDFNFNYNRYIYETRQWGVPAYQTRFSDG
FT                   VIVDGITPPSQLSTSFGYESNYSYTLENLLNYHHTFAQKHDVSALLGYQEFYKNYYTVD
FT                   AAKKGLIDESLNQFDEATEMTSTKGATQDYATRSVFGRVNYAYNSRYLFEANFRYDGSS
FT                   RFHKDHRWGFFPSLSGAWRISEESFMENTRIWLDNLKVRASWGKLGNSEIGNYEYMSVY
FT                   STTNAVFGNALNSALYMGAIANSLLKWESTTSVNFGIDVNLLKNRLSISADLYQKKTDG
FT                   ILYRPTIPYVFGTMTAPRQNLAKVSNKGVELSLGWRDNIGGVSYSINGNFSYNKSNIDA
FT                   YNGTYERTWVEDPNNKLTGGKWEDNIGKVSSGGTTPIVEGRMMNEYYLRNVYHGNGSYY
FT                   NADGSVNPQGGPKTGMIRTEKDMAWVKDMIAAGYEFQPGKTVAKNKIWYGDYIYADSNN
FT                   NGVYGDDNDYTFQKTSNKPKYNFGFQASAAWKGFDLSMVWAGAAGFSIYWGATTGYNAA
FT                   STEWGSTIAQRVAENHYFYNPENPDDPRTNINAKYPRMAYIDGYVQNRHGNTTLWLYKG
FT                   DYIKLKNLSLGYTLPKNWVSKIAMQNARVYVSAENLLTITGFEGQDPESATGMGYSPFR
FT                   TIAIGANITF"
FT   misc_feature    complement(397798..400713)
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score -10.3, E-value 0.00031"
FT   misc_feature    complement(401053..401148)
FT                   /note="Signal peptide predicted for BF0334 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 32 and 33"
FT   repeat_region   401491..401514
FT                   /note="inverted repeat region P"
FT   repeat_region   401492..403339
FT                   /note="invertible region P; active in shotgun"
FT   CDS_pept        401513..403162
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0327"
FT                   /old_locus_tag="BF0335"
FT                   /product="putative two-component system sensor histidine
FT                   kinase"
FT                   /note="Similar to C-terminus of Pseudomonas putida bZIP
FT                   histidine kinase TobS SWALL:Q9EVJ0 (EMBL:AF180147) (978 aa)
FT                   fasta scores: E(): 1.4e-35, 31.26% id in 419 aa, and to
FT                   C-terminus of Bacteroides thetaiotaomicron two-component
FT                   system sensor histidine kinase/response regulator, hybrid
FT                   BT3334 SWALL:AAO78440 (EMBL:AE016940) (1354 aa) fasta
FT                   scores: E(): 2.8e-93, 47.58% id in 559 aa, and to
FT                   C-terminus of Bacteroides thetaiotaomicron two-component
FT                   system sensor histidine kinase/response regulator, hybrid
FT                   BT2971 SWALL:AAO78077 (EMBL:AE016938) (1346 aa) fasta
FT                   scores: E(): 1.3e-88, 47.98% id in 546 aa. Note: CDS is
FT                   present on invertible region P which when inverted from
FT                   this conformation may form an entire sensor histidine
FT                   kinase gene"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06106"
FT                   /db_xref="GOA:Q5LIC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIC0"
FT                   /protein_id="CAH06106.1"
FT                   /translation="MSLEKERIEKEHIEEMNQAKLRFFTNVSHEFRTPLTLIISQVELM
FT                   LQKNTIPPSLHNSIFRIRKHAQQMKLLISELLDFRKFDQNYIQLKLSEQSLNTFLEEVY
FT                   LSFSAYASQKSISYHLKLLEQDISIWIDDWQMRKVLFNLLSNAFKHVPDKGEISILTST
FT                   TPDQVVIAVKDSGNGISKEEQERIFDRFYQADNRNKAIHVGTGIGLALTKSIIQLHHGT
FT                   IEVESELNEGSCFIVKLPKTRDCFEKDTEVVFLESPEKEPMVQENTIPDENFMKKDDST
FT                   FETPLIDEREGKRKVLLVEDNVELLQVLKEIFSSLYQVVTAANGEEGLKQAFAEVPDLI
FT                   VSDVMMPVMTGTEMCLKIKNNINLCHIPVVLLTALDTVDQNIEGLRRGADDYITKPFNA
FT                   KILITRCNNLIRNRLLMQSRFAKDQILEINLLAANPIDKGFLDRVIKVVDKHIDNEDFD
FT                   IGMLCQELGMGRTLLHTKFKALTGMTPNEFILNHRLKIASLMLKNEPYLQVAEISDRLG
FT                   FGSPRYFSRCFKNQYNVTPMEYRKGAKQENLK"
FT   misc_feature    401567..401767
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 61.9, E-value 1.2e-15"
FT   misc_feature    401903..402238
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 134.6,
FT                   E-value 1.6e-37"
FT   misc_feature    402392..402751
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 105.9, E-value 6.9e-29"
FT   misc_feature    402842..402982
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   30.2, E-value 4.1e-06"
FT   misc_feature    402998..403135
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   53.0, E-value 5.6e-13"
FT   CDS_pept        complement(403256..405694)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0328"
FT                   /old_locus_tag="BF0336"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /note="Similar to N-terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT0958 SWALL:AAO76065
FT                   (EMBL:AE016929) (1329 aa) fasta scores: E(): 6.4e-17,
FT                   22.23% id in 805 aa, and to N-terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT0981 SWALL:AAO76088
FT                   (EMBL:AE016929) (1472 aa) fasta scores: E(): 4.8e-14,
FT                   23.02% id in 808 aa, and to N-terminus of Bacteroides
FT                   thetaiotaomicron two-component system sensor histidine
FT                   kinase/response regulator, hybrid BT3786 SWALL:AAO78891
FT                   (EMBL:AE016942) (1345 aa) fasta scores: E(): 5.9e-14,
FT                   22.36% id in 845 aa. CDS is truncated at the C-terminus and
FT                   may be able to form an intact protein on inversion of the
FT                   adjacent invertible region P"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06107"
FT                   /db_xref="GOA:Q5LIB9"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB9"
FT                   /protein_id="CAH06107.1"
FT                   /translation="MNRHKLALSLIGIFIVQLSYAGYFKHIGREEGLSQSSVMAIYQDK
FT                   LGRMWFGTREGVNIYNSNKMAVYKAWIQNGNRPDQKILIGNEVSAITGSQNGDVFLIVD
FT                   HALLKYDIRKETFERLRQGSVYALTSHAGEIWCAGHDSIFRYNPQNNQLDFQLKTGISS
FT                   INYLTINGNRFYIGAKEGLYTTENKGRVQCLIPKVDVYRIFQSSCQELWVGCRTQGLYR
FT                   INRNGRINRIPYDPSSPNGISSEQIREFVEDQQGNIWFGTFDGLQKYDPSTQTYSLIKQ
FT                   EQRPGGLSHSSIFSLYQDVQGTIWIGSYYGGVNYFNPDNNAFNYYTYNPDRSDCLNYPF
FT                   AGAMTEDKDHHLWICTDGGGLACLDRQAGHFTTYTAGGPNSLPHNNLKSICYDPKRDCL
FT                   YIGTHMGGLSRFDRKTGRFYNYLNHSTKGLKEPNDVIFQVSFYNDQLIVSARNGVFSMN
FT                   PDTNEFRLLYDGYYYQTFTIDPKGFLWLSAGTNLYSINLKHPEEVKSFSLPASIGQFGI
FT                   SKILKGNNQYLYIATLGSGLFCYNEQTQTCINYTPEQNQLLSNYCYNLLQTSTDNILIT
FT                   SDRGITLFNPTTESFRSIELDNGLSLSSIINGCGVWMCSDHTIFIGGTGGLSSFLEKDL
FT                   NKEYPKPKLYFSSLSVNNARISPDDKSRILTEGLPFVREINLNATQNNLTVEFASSNYV
FT                   DILNNTWYEYQLEGFDKQWSLTSQTSLKYTNLDPGDYVLHVRQKGNSLKMRKAQEILLQ
FT                   IHINTPWYLTWWAWLSYITISISVTYFIWREKSSRRTLAILRQSLSSLTYHQILFNPAI
FT                   "
FT   repeat_region   complement(403317..403340)
FT                   /note="inverted repeat region P"
FT   misc_feature    complement(order(403349..403417,405623..405676))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0336 by TMHMM2.0 at aa 7-24 and 760-782"
FT   misc_feature    complement(405566..405631)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1043.000, SD 2.74 at aa 22-43, sequence
FT                   GYFKHIGREEGLSQSSVMAIYQ"
FT   CDS_pept        complement(405834..406577)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0329"
FT                   /old_locus_tag="BF0337"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein Xac0836 SWALL:Q8PP52 (EMBL:AE011715) (214 aa) fasta
FT                   scores: E(): 1.2e-15, 29.79% id in 198 aa, and to
FT                   Xanthomonas campestris hypothetical protein Xcc0781
FT                   SWALL:Q8PCF3 (EMBL:AE012178) (233 aa) fasta scores: E():
FT                   3.5e-14, 27.23% id in 235 aa, and to Agrobacterium
FT                   tumefaciens hypothetical protein atu5455 or agr_pat_668
FT                   SWALL:Q8UJM1 (EMBL:AE008966) (217 aa) fasta scores: E():
FT                   1.1e-11, 28.64% id in 192 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06108"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB8"
FT                   /protein_id="CAH06108.1"
FT                   /translation="MIKSILIALCTVLLCWNSIPAEAQTPQDSVRFIGYLPVRHTDPTK
FT                   WITRYQSEIDRYQTENQMLKDTSCDVLFLGSSSINLWDNIYRDMAPLKILRRSYGGAAL
FT                   RDMLYNYDVIARGYHPRSIVIYVENDLAGTPEDLTVGETFDFFRLLTNRLQRDYPDIPI
FT                   FILSYKPSLARKEMIPKHEIINALLQEYASKRGGLTYIDVASCLYDNNGKLRKDIFKQD
FT                   GLHMNQNGYDLWTAILKPKILESIR"
FT   misc_feature    complement(406509..406577)
FT                   /note="Signal peptide predicted for BF0337 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 23 and 24"
FT   CDS_pept        complement(406578..407933)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0330"
FT                   /old_locus_tag="BF0338"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3566 SWALL:AAO78672 (EMBL:AE016941)
FT                   (454 aa) fasta scores: E(): 2e-160, 82.39% id in 443 aa,
FT                   and to Agrobacterium tumefaciens hypothetical protein
FT                   atu3054 or agr_l_3503 SWALL:Q8UBG2 (EMBL:AE009236) (425 aa)
FT                   fasta scores: E(): 8.3e-60, 40.09% id in 409 aa, and to
FT                   Xylella fastidiosa hypothetical protein Xf2449 SWALL:Q9PAP6
FT                   (EMBL:AE004053) (544 aa) fasta scores: E(): 9.3e-22, 30.79%
FT                   id in 513 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06109"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="PDB:3EU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB7"
FT                   /protein_id="CAH06109.1"
FT                   /translation="MNIQLVTHNSKLLFVLFALFLFVACKPKEKPSSATSLTDDALMDT
FT                   VQRRTFNYFWDAAEPNSGLARERYHMDGEYPAGGPEIVTSGGSGFGIMAILAGIDRGYV
FT                   SREEGLRRMEKIVGFLEKADRFKGAYPHWWNGETGHVQPFGQKDNGGDLVETAFLMQGL
FT                   LAVHQYYAEGSAEEKKLAGRIDKLWREVDWNWYRHGGQNVLYWHWSPEYGWEMNFPVHG
FT                   YNECLIMYILAAASPTHGVPAAVYHEGWAQNGAIVSPHKVEGIELHLRYQGGEAGPLFW
FT                   AQYSFLGLDPVGLKDEYCPSYFNEMRNLTLVNREYCIRNPKHYKGYGPDCWGLTASYSV
FT                   DGYAAHGPLERDDRGVISPTAALSSIVYTPDQSLQVMHHLYEMGDKVFGPYGFYDAFSE
FT                   TADWYPKRYLAIDQGPIAVMIENYRTGLLWKLFMSHPDVQNGLKKLGFNVKK"
FT   misc_feature    complement(407862..407933)
FT                   /note="Signal peptide predicted for BF0338 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.698) with cleavage site
FT                   probability 0.291 between residues 24 and 25"
FT   CDS_pept        complement(408099..410399)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0331"
FT                   /old_locus_tag="BF0339"
FT                   /product="putative exported beta-glucosidase"
FT                   /note="Similar to previously sequenced Bacteroides fragilis
FT                   beta-glucosidase BlgX (BF4170) SWALL:O31356 (EMBL:AF006658)
FT                   (764 aa) fasta scores: E(): 0, 80.74% id in 748 aa, and to
FT                   Bacteroides thetaiotaomicron periplasmic beta-glucosidase
FT                   precursor BT3567 SWALL:Q8A1U1 (EMBL:AE016941) (771 aa)
FT                   fasta scores: E(): 0, 81.58% id in 771 aa, and to
FT                   Flavobacterium meningosepticum beta-glucosidase Bgl
FT                   SWALL:O30713 (EMBL:AF015915) (726 aa) fasta scores: E():
FT                   2.4e-182, 64.47% id in 729 aa. Note:"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06110"
FT                   /db_xref="GOA:Q5LIB6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB6"
FT                   /protein_id="CAH06110.1"
FT                   /translation="MNKKYSLLILLALLLPLGLQAQKPPQDMDRFLDNLLKRMTLEEKI
FT                   GQLNLPVTGEITTGQAKSSDIATKIKRGEVGGLFNLKGVDKIRDVQHLAVENSRLGIPL
FT                   LFGMDVIHGYETIFPIPLGLSCTWDIPAIEESARIAAVEASADGISWTFSPMVDISRDP
FT                   RWGRVSEGSGEDPFLGALIARAMVRGYQGKDMSRNDEIMACIKHFALYGAAEAGRDYNT
FT                   VDMSRQRMFNDYMLPYQAGVEAGAGSVMASFNEVEGVPATANKWLMTDVLRGAWGFNGF
FT                   VVTDFTGISEMIEHGIGDLQTVSARAINAGVDMDMVSEGFIGTLKKSVEEGKVSVETVN
FT                   TACRRILEAKYKLGLFDNPYKYCDLKRPARDIFTKEHRAAARKIAGESFVLLKNEGLSP
FT                   TLAPVLPLSPTGTIAVIGPLANTRSNMPGTWSVAAVLDKSPSLVEGLTEWVGNQGKILY
FT                   AKGSNLIGDAAYEERATMFGRSLNRDNRTDQQLLDEALKIASQADVIVAALGESSEMSG
FT                   ESSSRTNLNLPDVQHTLLEALLKTGKPVVLVLFTGRPLVLNWEQEHVPAILNVWFGGSE
FT                   AGPAIGDVLFGAVNPGGKLTMTFPKSVGQIPLYYAHKNTGRPLKEGKWFEKFRSNYLDV
FT                   DNDALYPFGYGLSYTTFRFSDITLNRSSIGMDNELVASVTVTNTGDRAGSEVVQLYIRD
FT                   LVGSVTRPVKELKGFEKIYLQPNESRTVRFTIAPEMLKFYNADLKFVAEPGDFDVMIGP
FT                   DSRNVKTARFTLH"
FT   misc_feature    complement(408447..409235)
FT                   /note="Pfam match to entry PF01915 Glyco_hydro_3_C,
FT                   Glycosyl hydrolase family 3 C terminal domain, score 302.0,
FT                   E-value 6.4e-88"
FT   misc_feature    complement(409404..410318)
FT                   /note="Pfam match to entry PF00933 Glyco_hydro_3, Glycosyl
FT                   hydrolase family 3 N terminal domain, score 428.2, E-value
FT                   6.3e-126"
FT   misc_feature    complement(410337..410399)
FT                   /note="Signal peptide predicted for BF0339 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.988 between residues 21 and 22"
FT   CDS_pept        complement(410502..412022)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0332"
FT                   /old_locus_tag="BF0340"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides fragilis fragilis regulatory
FT                   region FrrH SWALL:Q8VTA8 (EMBL:AF329100) (495 aa) fasta
FT                   scores: E(): 1.6e-06, 25.53% id in 419 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT3568
FT                   SWALL:AAO78674 (EMBL:AE016941) (509 aa) fasta scores: E():
FT                   2.3e-159, 72.69% id in 509 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT3089 SWALL:AAO78195
FT                   (EMBL:AE016938) (496 aa) fasta scores: E(): 4.2e-27, 30% id
FT                   in 520 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06111"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB5"
FT                   /protein_id="CAH06111.1"
FT                   /translation="MKLNKYILPIALAVSALSFSSCNDFLDRHPQGQFTEDDNPGALAE
FT                   GKVFNIYTMMRNYNITAGIPAFAIEYFRSEDSEKGSTASDGADQAAMYDDFQYNASNGL
FT                   IKAYWSQNYAVIYQCNDVIETIEKGNLTEENDLRNKGEALFFRAYCYFNLVRAFGEVPL
FT                   VTFKVNDASEANVPKTTAEEIYKQIDSDLTQAEGLLPRQWQSAYLGRLTWGSARALHAR
FT                   TYMMRNDWQNMYTAATDVMNSGQYNLNTPYDVIFTDEGENSSESVFELQCASTAALPAS
FT                   DKIGSQFCEVQGVRGSGQWDLGWGWHMGTELMGEAFEPGDPRKDATLLYFRRSDTDPIT
FT                   PENTNKPYGESPVSQADGTYFNKKAYTNPALREEFTRHGFWVNIRIIRYGDVVLMAAES
FT                   ANELGKTGEASNYLEMVRARARGNNPDILPKVTSLDQTVLRDAIRHERRVELGLESGRF
FT                   YDLVRWGIASQVLHAAGKTGYQPKNALLPLPQDEIDKSKGVLVQNPDY"
FT   misc_feature    complement(411954..412022)
FT                   /note="Signal peptide predicted for BF0340 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.964) with cleavage site
FT                   probability 0.554 between residues 23 and 24"
FT   CDS_pept        complement(412034..415084)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0333"
FT                   /old_locus_tag="BF0341"
FT                   /product="putative TonB-dependent outer membrane exported
FT                   protein"
FT                   /note="Similar to Bacteroides CACcae tonB-linked outer
FT                   membrane protein OmpW SWALL:Q93FV1 (EMBL:AF305878) (947 aa)
FT                   fasta scores: E(): 0, 83.42% id in 947 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT3569
FT                   SWALL:AAO78675 (EMBL:AE016941) (1021 aa) fasta scores: E():
FT                   0, 82.67% id in 1016 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT4724 SWALL:AAO79829
FT                   (EMBL:AE016946) (1139 aa) fasta scores: E(): 4.4e-69,
FT                   29.77% id in 1068 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06112"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB4"
FT                   /protein_id="CAH06112.1"
FT                   /translation="MKTKPLRLLRQKRASWLKSVFVLTCLLLSTSVAMAQTKTVTGTVT
FT                   DSFNEPLIGASILVKGTSTGAVTDMDGKYSISVTPNDVLVFSYVGYEKQEIKVGQQTVI
FT                   NVTLKDDSQMLAETVIIGYGSAKKRDLTGSITNIKGSEIANKPATNPLSSLQGKIAGVQ
FT                   IVNSGQAGADPEIRIRGTNSINGYKPLYVVDGLFNDNINFLNPEDIESMEVLKDPSSLA
FT                   IFGVRGANGVIIVTTKRAKEGQTLVNINTSFGWKSVVDKIKMVNAPQFKELYNEQMANQ
FT                   GNALFDFSNWNANTDWQDEIFQTGFITNNNVSITGASEKHSFYLGVGYSHEQGNIKHEK
FT                   YSKVTINASNDYKITKDIKVGFQFNGARMLPADSKTVLNAIRTTPVAPVYNEEYGLYTS
FT                   LPEFQKAQMNNPMVDVNLRANTTRAVNYRASGSIYGEVDFLKHFTFKAMFSMDYATNDS
FT                   RTYKPIIKVYDATVAGNVATLGNGKTEVSQNKQNETKVQSDYLLTYQNSFADGTHNLTA
FT                   TAGFTTYYNSLSGLDASRGQGIGLVIPNNPDKWFVSIGDLATATNGSTQWERTTVSMLA
FT                   RIIYNYKGKYLFNGSFRRDGSSAFAYTGNQWQNFYSIGAGWLMTEEEFMKDITWLDMLK
FT                   LKGSWGTLGNQNMDKAYPAEPLLENAFAAVFGKPAIIYPGYQLAYLPNPRLRWEKVEAW
FT                   ETGFETNMFRNRFHFEGVYYKKNTKDLLATVPGLSGTVPGIGNLGEIENKGVELMASWR
FT                   DQIGDWGYSVSANLTTISNKVKSLVQDGYSIIAGDKSQSYTMAGYPIGYFYGYKVAGVY
FT                   QNQAEIDASPVNTLATVTPGDLKFADVNGDGKITPDDRTKIGDPTPDVTYGISLGLSYK
FT                   NWELSMEMMGQGGNQIYRTWDNYNWAQFNYMEQRLDRWHGEGTSNTQPLLNTKHAINSE
FT                   NSEYFIEDGSFFRIRNLQLAYSFDKTLLSKIRMQALKVYVNIQNLKTWKHNTGYTPEIG
FT                   GSAIAFGVDNGTYPVPAVYTFGINLTF"
FT   misc_feature    complement(412226..414700)
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score -15.7, E-value 0.00043"
FT   misc_feature    complement(413633..413656)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(414980..415084)
FT                   /note="Signal peptide predicted for BF0341 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.994 between residues 35 and 36"
FT   CDS_pept        415615..415926
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0334"
FT                   /old_locus_tag="BF0342"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06113"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB3"
FT                   /protein_id="CAH06113.1"
FT                   /translation="MTTLANTSFAATSGKGGTISGVPSSAQYLYFMANIKTDVGQVFPA
FT                   VEGTTSADARLRLNRLQGTAPSDWTANAFVDYCTPLASALSFYPDVTISTPRYPRMSE"
FT   CDS_pept        complement(416057..416350)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0335"
FT                   /old_locus_tag="BF0343"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4733 SWALL:AAO79838 (EMBL:AE016946)
FT                   (101 aa) fasta scores: E(): 0.0043, 36.25% id in 80 aa, and
FT                   to Acinetobacter lwoffii Cro-like protein Cro SWALL:Q8GMU5
FT                   (EMBL:AJ250245) (100 aa) fasta scores: E(): 0.045, 28.23%
FT                   id in 85 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06114"
FT                   /db_xref="GOA:Q5LIB2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB2"
FT                   /protein_id="CAH06114.1"
FT                   /translation="MMDITTLDQFKDEIYGVKGTPRRDNLERELETLRIGVQIRNARQK
FT                   KEMTQAQLAERINKKRTFISKVENDGGNLTLKTLIDIVERGLGGKLNIEVKI"
FT   misc_feature    complement(416072..416236)
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 32.3, E-value 9.3e-07"
FT   misc_feature    complement(416144..416209)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1582.000, SD 4.58 at aa 48-69, sequence
FT                   MTQAQLAERINKKRTFISKVEN"
FT   CDS_pept        complement(416350..416634)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0336"
FT                   /old_locus_tag="BF0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT4732 SWALL:AAO79837 (EMBL:AE016946)
FT                   (110 aa) fasta scores: E(): 7.3e-12, 48.31% id in 89 aa,
FT                   and to Vibrio cholerae hypothetical protein s045
FT                   SWALL:Q8KQX9 (EMBL:AY055428) (107 aa) fasta scores: E():
FT                   0.00032, 37.34% id in 83 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06115"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB1"
FT                   /protein_id="CAH06115.1"
FT                   /translation="MEQSPKVQNKITKILEYIECIPTKYLKHMESTDGLYEMRITLGSD
FT                   IFCVFCFFDKGRLVVLLSGFQKKTQKTPKKEIDKAVRLMAQYYDDKKRR"
FT   CDS_pept        417101..417817
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0337"
FT                   /old_locus_tag="BF0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   DNA-binding protein p5482_33 SWALL:Q8ABW5 (EMBL:AY171301)
FT                   (276 aa) fasta scores: E(): 2.2e-33, 56.89% id in 232 aa,
FT                   and to Methanosarcina mazei hypothetical protein Mm2203
FT                   MM2203 SWALL:Q8PUX5 (EMBL:AE013460) (344 aa) fasta scores:
FT                   E(): 8.1e-23, 41.48% id in 229 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT3040
FT                   SWALL:Q8A3B4 (EMBL:AE016938) (338 aa) fasta scores: E():
FT                   4.1e-22, 43.52% id in 193 aa. Possible alternative start
FT                   site at codon 6"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06116"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIB0"
FT                   /protein_id="CAH06116.1"
FT                   /translation="MANTNMEHGEIILYQPDNTIKLEVRIENETVWLTQAQIVNLFQSS
FT                   KANISEHIRNIYDSDELSAESTVRKFRTVRMEGNRKVTRILEYYNLDMIISVGYRVNSK
FT                   RGVQFRQWSTGVLKEYLLKGYAINQRVEQLENKANTHDRQLEELTNKVDFFVRTSLPPI
FT                   EGVFFNGQIFDAYVFSAQLIKSAKSSLVLIDNFVDESVLLLLSKRLPGVTSIIYTKQVT
FT                   PQLELDLTKHNSQYPQ"
FT   CDS_pept        complement(417879..418103)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0338"
FT                   /old_locus_tag="BF0346"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA9"
FT                   /protein_id="CAH06117.1"
FT                   /translation="MGEHTKVHIISGITSAAPTHSFPFFLNIHQDTDGQPTCPCVNKDY
FT                   NKSVIILAGISILEKAKSFLPRSLSEAPI"
FT   CDS_pept        418625..418975
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0339"
FT                   /old_locus_tag="BF0347"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06118"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA8"
FT                   /protein_id="CAH06118.1"
FT                   /translation="MGKPIIKILYFHRRRTNASGWYRLEYIFQRGKKTLRYVLSTRDPE
FT                   YLVCFCSPCMVERSEMIVFVAELLLEIHKVKYSHLKVTPSYAYATPKYKSRINQMCKKS
FT                   RYHKTPVIIDGL"
FT   repeat_region   419454..419889
FT                   /note="hit to rep1 1..437 score: 2026 percent id: 96.11"
FT   tRNA            complement(419981..420065)
FT                   /note="tRNA Leu anticodon TAG, Cove score 67.89"
FT   CDS_pept        420462..423521
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0340"
FT                   /old_locus_tag="BF0349"
FT                   /product="putative TonB dependent outer membrane exported
FT                   protein"
FT                   /note="Similar to Porphyromonas gingivalis receptor antigen
FT                   RagA SWALL:Q9ZA60 (EMBL:AJ130872) (1017 aa) fasta scores:
FT                   E(): 2.7e-74, 31.53% id in 1059 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT2364 SWALL:AAO77471
FT                   (EMBL:AE016935) (1025 aa) fasta scores: E(): 0, 73.76% id
FT                   in 1014 aa, and to Bacteroides thetaiotaomicron putative
FT                   outer membrane protein, probably involved in nutrient
FT                   binding BT3103 SWALL:AAO78209 (EMBL:AE016939) (1061 aa)
FT                   fasta scores: E(): 2.8e-72, 30.74% id in 1067 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT1440
FT                   SWALL:AAO76547 (EMBL:AE016931) (1042 aa) fasta scores: E():
FT                   3e-60, 32.47% id in 1081 aa, and to Bacteroides fragilis
FT                   FrrG frrG SWALL:Q8VTA9 (EMBL:AF329100) (1137 aa) fasta
FT                   scores: E(): 2.7e-54, 29.34% id in 1053 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06119"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA7"
FT                   /protein_id="CAH06119.1"
FT                   /translation="MRNLKAILIVLLCLCGIHVQAQQLEIKGLVTSSEDKQPLIGATVA
FT                   VKGVPGRGVVTDMDGRYTLKIEPSDKILVISYIGMKSSEVKVPKNGVLNVVLQPESLNL
FT                   DEVVVTGYGNFSKSSFTGSANTLRADMLKNVPVLSVEQKLQGMTTGVNITSGSGQPGAN
FT                   QSIRIRGMGSFNASNEPLFVIDGIPVTSGSMGAGTGADAAYMNNAKTNVMSTLNPADIE
FT                   NITVIKDAAAASLYGSRAANGVILITTKKGAVGRTKVTLSASGGFSNAAVNFRPTLNGE
FT                   QRREMIYEGLYNSAVDKGLQSPEAYANANIDTYAGIPELGYTDWRKELIRTAHNQNYEV
FT                   TASGGNERTTFYASLGFNRQEGLVENSNLDRYSARLNMTHKIGSRVEVGGNMMFTQISQ
FT                   EMNEERGSNINPFLCVAVSATPSMPVRDASGNYVGSYAGTNVNPLRDIRTDYNRSRMTR
FT                   MFSTGYASVDIIKGLKLKETLSYDYTVQKDSRYLNPLSGAGPKSGSDAQTSKGFTEYGK
FT                   LLSSTSLNYTHTFAAKHHLDILAAYELESYQSDKAMGEKAKLPSDVLLEPDNAAVLKSF
FT                   VSSTQAYRMISYLSRLNYDYDNRYYIAGSYRRDGSSRLAPESRWGDFWSVSGMWHLSSE
FT                   PFMEAVKPVLNDVKIRASYGVNGNQPGAFYGYMGLYSYGQNYMGAAGSYESAQANPKLK
FT                   WEKNYNLNIGLSLTFIDRIFVNLEYYNRDTKDLLYNRPISSTTGFLNYLANIGQLNNKG
FT                   VEFELRTINFAGPDFNWTSVLNLTHNRNKIVALDGDIKQSVEGSWFIHKIGLPYNSFYV
FT                   KEFAGVDPSTGKGLYYLNTQDEKGNYNREMTDDASKAQAIPYKSADPKISGGFTNILSY
FT                   KWFDLGLTFTYSLGGYSFDKTGTLIETDGSKEKSYNLPVYALDRWQKPGDRTDVPRFVL
FT                   EQGAGPQNSSRYIHSTDHIRLKNLTLGFTLPGRWVQKALIENARVYFSGSNLLTWAKWK
FT                   QYDPEVPVNGEVFCEAPPMRTFNFGVEITF"
FT   misc_feature    420462..420524
FT                   /note="Signal peptide predicted for BF0349 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.958 between residues 21 and 22"
FT   misc_feature    420807..423518
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score -1.0, E-value 0.00018"
FT   misc_feature    423129..423149
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   CDS_pept        423550..425037
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0341"
FT                   /old_locus_tag="BF0350"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   outer membrane protein, probably involved in nutrient
FT                   binding BT2365 SWALL:AAO77472 (EMBL:AE016935) (497 aa)
FT                   fasta scores: E(): 1.4e-113, 58.4% id in 500 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT2269
FT                   SWALL:AAO77376 (EMBL:AE016935) (469 aa) fasta scores: E():
FT                   3.1e-22, 33.66% id in 505 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT3311 SWALL:AAO78417
FT                   (EMBL:AE016940) (506 aa) fasta scores: E(): 3.1e-12, 24.13%
FT                   id in 522 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06120"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA6"
FT                   /protein_id="CAH06120.1"
FT                   /translation="MKRTLIYMFAAMSLVGSSCSGDWLNLNPSTSVTTPQAIRTLEEAQ
FT                   IALNGIYRIAASHSYYGDNYLYYADCRGEDVQARVSKGAGKRVSPYYEFNVTADDALNI
FT                   TRVWNQPYSVIHQANSLLERIESGAVVTDDAVALNCIKAEALALRGLALFDLTRLFAMP
FT                   YTLNNGTSLGVPIEIKTTLPTHQPARNTVAECYQQVIDDMTGALKLSALSADKKNGYLN
FT                   VWSVKALLSRVYLYMNDNEKALALAKEVMNNGGLYQLFTHDEYPTVWGKDFSSESLFEF
FT                   YYTLSEPDGGTGGEGAPMVYADNVKDWNNLVLTKAFLDLLGEDPDDVRHSLNRLPEKPE
FT                   EDILPEGSKGYPKYLNKYPGKTGDNPQDNDICIIRLSEVYLNAAEAAFKLGGAENLKFS
FT                   LDCLNAIVSRANPVKSVKETELSLERILKERRKELVGEGHAFFDAMRNGLSVSRTGGWH
FT                   LPSVAAAAVISPSDPRVALPIPQAEIDANPNMVQNPH"
FT   misc_feature    423550..423612
FT                   /note="Signal peptide predicted for BF0350 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.598 between residues 21 and 22"
FT   CDS_pept        complement(425193..426224)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0342"
FT                   /old_locus_tag="BF0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3577 SWALL:AAO78683 (EMBL:AE016941)
FT                   (340 aa) fasta scores: E(): 3.4e-92, 65.21% id in 345 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc2028
FT                   SWALL:Q9A6Q6 (EMBL:AE005876) (462 aa) fasta scores: E():
FT                   1.8e-09, 25.81% id in 306 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06121"
FT                   /db_xref="GOA:Q5LIA5"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA5"
FT                   /protein_id="CAH06121.1"
FT                   /translation="MKNPIIYRILQQGFCLIFCLGLLSSCIREEEFVNNPQGNFEQLWK
FT                   IIDEQYCFLDYKQIDWDEIHTRYQKLITPNMGSEGLFEVLSEMLYELQDGHVNLASAHN
FT                   VSYYDAWYQDYPRNFRADLLEDSYLGRASTDYRTAAGLKYKILKDNIGYIRYESFADPV
FT                   GNGNLDEVLSYLSVCNGLIIDVRDNGGGNATNSARIASRFTNEKILTGYISHKTGTGHN
FT                   DFSKPYAIYLEPANGVRWQKKVVVLTNRRSFSATNDFVNHMRCLPNVTTIGDKTGGGSG
FT                   MPFTSELPNGWSVRFSASPHFDAEMNHIEFGIEPDIKADMLQEDELRGKDTLIEMARKL
FT                   LSE"
FT   CDS_pept        complement(426237..427106)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0343"
FT                   /old_locus_tag="BF0352"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3578 SWALL:AAO78684 (EMBL:AE016941) (286 aa)
FT                   fasta scores: E(): 3.9e-92, 82.75% id in 261 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06122"
FT                   /db_xref="InterPro:IPR016879"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA4"
FT                   /protein_id="CAH06122.1"
FT                   /translation="MKVKTSILLLLMIATALPSFGGNGNGNGTDSLQATRYVTRATMYG
FT                   VGYTNVFDTYLSPQEYKGIEFRISRETMRMTTLGDGNVSVQNFFQANLAYTHNRVDNNN
FT                   TFAGLVNWNYGLHYQFRITDNFKLLAGGMGDFNGGFVYNLRNTNNPASARAYINLDASG
FT                   MAIWHTKIKNYPLALRYQVNLPVIGVMFSPHYGQSYYEIFTLGHASGVIRFTSLHNQPA
FT                   LRQMLSVDFPIRYTKMRLSYLCDLQQSKLNGIKTHTYSQVFMVGFVHDLFRIRNKNGTP
FT                   LPPAVRAY"
FT   misc_feature    complement(427044..427106)
FT                   /note="Signal peptide predicted for BF0352 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.901 between residues 21 and 22"
FT   CDS_pept        complement(427131..429686)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0344"
FT                   /old_locus_tag="BF0353"
FT                   /product="putative topoisomerase"
FT                   /note="Similar to Borrelia burgdorferi topoisomerase IV
FT                   subunit A ParC or BB0035 SWALL:PARC_BORBU (SWALL:O51066)
FT                   (626 aa) fasta scores: E(): 2.8e-83, 39.08% id in 632 aa,
FT                   and to Bacteroides thetaiotaomicron topoisomerase IV
FT                   subunit A BT3579 SWALL:Q8A1S9 (EMBL:AE016941) (850 aa)
FT                   fasta scores: E(): 0, 88.13% id in 851 aa, and to
FT                   Chlamydophila caviae topoisomerase, subunit A, putative
FT                   CCa00026 SWALL:AAP04778 (EMBL:AE016994) (479 aa) fasta
FT                   scores: E(): 3.3e-63, 42.29% id in 461 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06123"
FT                   /db_xref="GOA:Q5LIA3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA3"
FT                   /protein_id="CAH06123.1"
FT                   /translation="MYQNWFLDYASYVILERAVPHINDGLKPVQRRILHSMKRMDDGRY
FT                   NKVANIVGHTMQFHPHGDASIGDALVQLGQKDLLVDCQGNWGNILTGDGAAAPRYIEAR
FT                   LSKFALDVVFNPKTTEWKLSYDGRNKEPITLPVKFPLLLAQGVEGIAVGLSSKILPHNF
FT                   NELCDASISYLRNEEFKLYPDFQTGGSIDVSKYNDGERGGAVKIRSKINKVDNKTLAIT
FT                   EIPYGRTTTSVIDSILKAVDKGKIKIRKVDDNTAANVEILVHLAPGTSSDKTIDALYAF
FT                   TDCEVSISPNCCVIDDQKPHFLTISHVLRKSADNTLSLLRQELEIKKDELQENLHFASL
FT                   EKIFIEERIYKDKEFEQSKDMDAACEHIDRRLTPFYSQFIREVTKDDILRLMEIKMGRI
FT                   LKFNSDKAEEAIARMNEDIAEINNHLANIVEYTIQWYRMLKEKYGKNFPRRTELRNFDT
FT                   IEAAKVVEANEKLYINREEGFIGTSLKKDEFVACCSDIDDVIIFYRDGRYMVTPVADKK
FT                   FVGKNVIYVNVFKKNDKRTIYNVAYRDGAEGTHYIKRFAVTSIVRDREYDVTQGKPDSR
FT                   ISYFSANPNGEAEIIKVTLKPNPRVRRIIFERDFSEVTIRSRQSQGVILTRLPVHKIVL
FT                   KQRGGSTLGGRKVWFDRDVLRLNYDGRGEYLGEFQSDDNILVVLNTGEFYTSNFDLSNH
FT                   YEDNVSIVEKFDPNKIWTVALYDADQQNYPYLKRFCFEATTRKQNYLGENKHNRLILMT
FT                   DEYYPRLEIIFGGHDSFRDPVVVDAEEFIAVKGFKAKGKRLTTYTVETINELEPTRFPD
FT                   PPQNNEEDDTGEEPENLDPDSDKTENDILDEMTGQMKLF"
FT   misc_feature    complement(428355..429638)
FT                   /note="Pfam match to entry PF00521 DNA_topoisoIV, DNA
FT                   gyrase/topoisomerase IV, subunit A, score 198.6, E-value
FT                   8.3e-57"
FT   CDS_pept        429964..431505
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BF9343_0345"
FT                   /old_locus_tag="BF0354"
FT                   /product="putative glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Leptospira interrogans glycyl-tRNA
FT                   synthetase GlyS or La1388 SWALL:Q8F6C0 (EMBL:AE011318) (464
FT                   aa) fasta scores: E(): 2.7e-70, 47.7% id in 501 aa, and to
FT                   Bacteroides thetaiotaomicron glycyl-tRNA synthetase BT3611
FT                   SWALL:AAO78716 (EMBL:AE016941) (513 aa) fasta scores: E():
FT                   2.9e-201, 95.9% id in 513 aa, and to Chlorobium tepidum
FT                   glycyl-tRNA synthetase GlyS or CT2255 SWALL:Q8KAB1
FT                   (EMBL:AE012970) (470 aa) fasta scores: E(): 9.2e-76, 53.02%
FT                   id in 496 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06124"
FT                   /db_xref="GOA:Q5LIA2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA2"
FT                   /protein_id="CAH06124.1"
FT                   /translation="MAQEDVFKKLVSHCKEYGFVFPSSDIYDGLGAVYDYGQMGVELKN
FT                   NIKKYWWDSMVLLHENIVGIDSAIFMHPTIWKASGHVDAFNDPLIDNKDSKKRYRADVL
FT                   IEDQLAKYDDKINKEVAKAAKRFGEAFDEAQFRSTNGRVLEHQAKRDALHERFAKALND
FT                   NNLEELRQIIVDEEIACPISGTKNWTEVRQFNLMFSTDMGSTADGSMKIYLRPETAQGI
FT                   FVNYLNVQKTGRMKVPFGIAQIGKAFRNEIVARQFIFRMREFEQMEMQFFVRPGSELEY
FT                   FKKWKEIRLKWHKALGFGDDHYRFHDHDKLAHYANAATDIEFLMPFGFKEVEGIHSRTN
FT                   FDLSQHEKFSGKSIKYFDPELNESYTPYVIETSIGVDRMFLSIMSAAYCEEQLENGESR
FT                   VVLKLPAALAPVKLAVMPLVKKDGLPEKAREIIDNLKFHFHCQYDEKDSIGKRYRRQDA
FT                   IGTPYCVTVDHQTLEDNCVTLRNRDTMEQERVAISELNNIIADRVSITSLLKTIQ"
FT   misc_feature    430057..430863
FT                   /note="Pfam match to entry PF00587 tRNA-synt_2b, tRNA
FT                   synthetase class II core domain (G, H, P, S and T), score
FT                   189.3, E-value 5.3e-54"
FT   misc_feature    430705..430767
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   misc_feature    431182..431469
FT                   /note="Pfam match to entry PF03129 HGTP_anticodon,
FT                   Anticodon binding domain, score 92.8, E-value 6e-25"
FT   CDS_pept        431517..432068
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0346"
FT                   /old_locus_tag="BF0355"
FT                   /product="putative fkbp-type 22 kDa peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /note="Limited similarity to C-terminus of Escherichia
FT                   coli, and Shigella flexneri fkbp-type 22 kDa
FT                   peptidyl-prolyl cis-trans isomerase FklB or B4207 or SF4279
FT                   SWALL:FKBB_ECOLI (SWALL:P39311) (205 aa) fasta scores: E():
FT                   0.00019, 41.28% id in 109 aa, and to Bacteroides
FT                   thetaiotaomicron putative fkbp-type peptidyl-prolyl
FT                   cis-trans isomerase FkpA BT3612 SWALL:AAO78717
FT                   (EMBL:AE016941) (196 aa) fasta scores: E(): 2.6e-29, 49.2%
FT                   id in 189 aa, and to Pseudomonas putida peptidyl-prolyl
FT                   cis-trans isomerase, fkbp-type fklb-1 or PP0684
FT                   SWALL:AAN66309 (EMBL:AE016776) (205 aa) fasta scores: E():
FT                   1.2e-06, 39.45% id in 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06125"
FT                   /db_xref="GOA:Q5LIA1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA1"
FT                   /protein_id="CAH06125.1"
FT                   /translation="MNKKIYLLPLLLLALIFVSCEETKEATKFDNWRARNEGYIDSLKT
FT                   VFDEKTDPELKAFEPEINPKLRIYYKKKISNDTGAIPLYTDSVNVFYRGSFIFGETFDQ
FT                   NFTGADPGPFDSPTKFVIQTFITVGGVSGWAEILQRMRVGERWLVYIPWELAYGASGTD
FT                   DIPGYSTLIFDMQLEEILDE"
FT   misc_feature    431517..431573
FT                   /note="Signal peptide predicted for BF0355 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.365 between residues 19 and 20"
FT   misc_feature    431544..431576
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    431745..432050
FT                   /note="Pfam match to entry PF00254 FKBP, FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase, score 58.8, E-value
FT                   1e-14"
FT   misc_feature    431784..431831
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT   CDS_pept        complement(432180..433061)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0347"
FT                   /old_locus_tag="BF0356"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LIA0"
FT                   /protein_id="CAH06126.1"
FT                   /translation="MKTISKLFLLLSIILLSSCDETELDQTVTNQVNPQKEEDSRIVFN
FT                   SAKEFYNTLDTLSYMTYEEQTEWIRASGIKYPLYKDLEFCEDEIMTEMPRAFQALFNHK
FT                   MEMQINDTVIAFEKGNMYVKSIKEKILPVPVLYGQVGVNQEESEVTTRTVYETKYGKIG
FT                   TSYQYEFKIPEGKSKYKYVHELKSVIIKENLPPYKSWSNLFLVLKLEWKGKKKWKVAEK
FT                   EERNISIDLNVCKRNLAKVKYNQEIRIDVQNMDSKSHSINIEGYIIHEVVGIPSTKMFN
FT                   GWSYPLVEWQPR"
FT   misc_feature    complement(433008..433061)
FT                   /note="Signal peptide predicted for BF0356 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.668 between residues 18 and 19"
FT   CDS_pept        complement(433121..433501)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0348"
FT                   /old_locus_tag="BF0357"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Limited similarity to Bacteroides thetaiotaomicron
FT                   hypothetical protein BT3571 SWALL:AAO78677 (EMBL:AE016941)
FT                   (118 aa) fasta scores: E(): 0.17, 24.39% id in 123 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06127"
FT                   /db_xref="InterPro:IPR021638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI99"
FT                   /protein_id="CAH06127.1"
FT                   /translation="MKKLTCLITLFLFISVGYINAETMASRKKIKMKVETQHHQRSLPP
FT                   PCPAEAFICGNTVDLIFRETNKTAVVTIMNLDTGEAIHYNVSTNDCSISIDLGNNQSES
FT                   NYNIELILDGKAYTGEFTTNEI"
FT   misc_feature    complement(433439..433501)
FT                   /note="Signal peptide predicted for BF0357 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.987 between residues 21 and 22"
FT   CDS_pept        complement(433650..435347)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0349"
FT                   /old_locus_tag="BF0358"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   TPR-repeat-containing proteins BT3570 SWALL:Q8A1T8
FT                   (EMBL:AE016941) (566 aa) fasta scores: E(): 1.8e-32, 32.31%
FT                   id in 557 aa, and to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT0240 SWALL:Q8AB71 (EMBL:AE016926)
FT                   (584 aa) fasta scores: E(): 5.7e-23, 25.82% id in 577 aa,
FT                   and to Bacteroides thetaiotaomicron TPR-repeat-containing
FT                   protein BT3220 SWALL:Q8A2T5 (EMBL:AE016939) (578 aa) fasta
FT                   scores: E(): 1.1e-19, 24.73% id in 570 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06128"
FT                   /db_xref="GOA:Q5LI98"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI98"
FT                   /protein_id="CAH06128.1"
FT                   /translation="MRQYLLNIILLFLGFTIIYSCSRHQQINRTIFLADSIMEYQPDSA
FT                   FKLLKTINQTDLSVSENAKYALLLAQAQDKAGHQLINDSLILIAINHYDHLSKDNNKAK
FT                   AYFYLGRFYQNNNDYAKAINSYLIAEKATSDHDTLLTLIYDNLGTCYKNQDFYDKALEV
FT                   YKDAYYIYKQYNSKNILYPLRGMASIYAIQEQFEKALKYYQTALTIASSTNDSTWQSIL
FT                   FCDISRIYDNKNLYEAAYSYIVRSIQYAPRSSDLSAMYFWKGEILHNLNQLDSAFYYIN
FT                   LAKKSSDLNTQASAYQALYEIKKEQGELNDAILYNDTSLILYDSIQDLNHSAEISHILK
FT                   QHATETLQQAEVIKRQKHTAFLIVTTLLLIACITFIFLYKDNKRKKVYIKIQCELRNNQ
FT                   IEKDELKEKIKTLIDSNTYIAERNKELKKEELKQQQVELWKRTLQICTRLFHTSTSYKK
FT                   LHAIETAKFKKEREEKQKEINSIQKEINEVFIEAIQKLREQYPKLTQEDLFYCILQYLR
FT                   LSTSTIKFCMRVESNQALTQRKYRIKKQISPQTFSIIFNESSPSEGVL"
FT   misc_feature    complement(434211..434270)
FT                   /note="1 probable transmembrane helix predicted for BF0358
FT                   by TMHMM2.0 at aa 323-342"
FT   CDS_pept        435432..435935
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0350"
FT                   /old_locus_tag="BF0359"
FT                   /product="putative nitroimidazole resistance-like protein"
FT                   /note="Similar to Bacteroides fragilis nitroimidazole
FT                   resistance protein NimE SWALL:Q9L4E6 (EMBL:AJ244018) (153
FT                   aa) fasta scores: E(): 8.2e-14, 38.41% id in 151 aa, and to
FT                   Clostridium tetani 5-nitroimidazole antibiotic resistance
FT                   protein CTC00899 SWALL:AAO35491 (EMBL:AE015939) (154 aa)
FT                   fasta scores: E(): 1.2e-20, 46.71% id in 152 aa, and to
FT                   Clostridium acetobutylicum possible 5-nitroimidazole
FT                   antibiotics resistance protein, NimA-family CAC2475
FT                   SWALL:Q97G94 (EMBL:AE007746) (154 aa) fasta scores: E():
FT                   2.2e-15, 42.76% id in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06129"
FT                   /db_xref="GOA:Q5LI97"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI97"
FT                   /protein_id="CAH06129.1"
FT                   /translation="MEYINDLIRRKDRLLSEDEAMSLLENGEYGVLSISSTEEGVYGIP
FT                   INYVWDKQQSIYFHCAPEGHKLCILQNCNQASFCVVGRTRVVSNQFSTEYESIVINGTM
FT                   ICQLEETEKRKALELLLDKYSPEDKKVGLKYIEKSFHRTHVLKLVIKVISGKCKKINQP
FT                   CQDY"
FT   CDS_pept        436077..436664
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0351"
FT                   /old_locus_tag="BF0360"
FT                   /product="putative NapC/NirT cytochrome c-type protein"
FT                   /note="Similar to Wolinella succinogenes cytochrome c-type
FT                   protein NrfH SWALL:NRFH_WOLSU (SWALL:Q9S1E6) (177 aa) fasta
FT                   scores: E(): 4.8e-22, 38.18% id in 165 aa, and to
FT                   Bacteroides thetaiotaomicron quinol oxidase BT1418
FT                   SWALL:AAO76525 (EMBL:AE016931) (198 aa) fasta scores: E():
FT                   1.4e-63, 73.71% id in 194 aa, and to Sulfurospirillum
FT                   deleyianum quinol oxidase NrfH SWALL:Q8VM54 (EMBL:AJ133037)
FT                   (177 aa) fasta scores: E(): 5.2e-24, 40.25% id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06130"
FT                   /db_xref="GOA:Q5LI96"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017571"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI96"
FT                   /protein_id="CAH06130.1"
FT                   /translation="MKVKEYIQWLLPSRKWRVLAIIITGVIVGGGALFLYMLRAHTYLA
FT                   DDPSACVNCHIMGPYYATWFHSSHSRNATCNDCHVPHENPVKKWVFKGMDGMRHVAVFL
FT                   TRGEKDVLRANKESAEVIMNNCIRCHTLLNTEFVNTGRIDYMMSQVGEGKACWDCHRDV
FT                   PHGGSNSAASTPDALVPYPDSPTPEWLRKMIE"
FT   misc_feature    436077..436211
FT                   /note="Signal peptide predicted for BF0360 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.830) with cleavage site
FT                   probability 0.608 between residues 45 and 46"
FT   misc_feature    436107..436586
FT                   /note="Pfam match to entry PF03264 Cytochrome_NNT,
FT                   NapC/NirT cytochrome c family, N-terminal region, score
FT                   44.8, E-value 1.7e-10"
FT   misc_feature    436227..436244
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    436299..436316
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        436688..438169
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="BF9343_0352"
FT                   /old_locus_tag="BF0361"
FT                   /product="putative exported cytochrome c552"
FT                   /EC_number="1.7.2.2"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 cytochrome c552 precursor NrfA or B4070 or Z5669 or
FT                   ECS5052 SWALL:NRFA_ECOLI (SWALL:P32050) (478 aa) fasta
FT                   scores: E(): 5.1e-82, 46% id in 450 aa, and to Bacteroides
FT                   thetaiotaomicron cytochrome c552 precursor BT1417
FT                   SWALL:AAO76524 (EMBL:AE016931) (493 aa) fasta scores: E():
FT                   1.3e-170, 83.53% id in 492 aa, and to Pasteurella multocida
FT                   cytochrome c552 precursor NrfA or pm0023 SWALL:NRFA_PASMU
FT                   (SWALL:Q9CPL4) (510 aa) fasta scores: E(): 2.2e-87, 48.77%
FT                   id in 449 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06131"
FT                   /db_xref="GOA:Q5LI95"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017570"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI95"
FT                   /protein_id="CAH06131.1"
FT                   /translation="MEKKLKSWQGWLLFCGAMAVVFVLGLVVSSLMERRAETVSVFNNK
FT                   RVEITGIEARNEVFGENYPRQYETWKETAKTDFKSEFNGNEAVDVLEQRPEMVVLWAGY
FT                   AFSKDYSTPRGHMHAIEDITHSLRTGAPMDDKSGPQPSTCWTCKSPDVPRMMEAIGVDS
FT                   FYNNKWGAFGSEIVNPIGCADCHEPTNMKLHISRPALREAFARQGKDIDKATPQEMRSL
FT                   VCAQCHVEYYFKGDGKYLTFPWDKGFSVEDMEAYYDEADFADYTHALSKARILKAQHPD
FT                   YEISQMGIHAQRGVSCADCHMPYKSEGGMKFSDHHIQSPLAMIDRTCQVCHRESEETLR
FT                   NNVYDRQRKANEIRGRLEQELAKAHIEAKFAWDKGATDVQMAEALKLIRQAQWRWDFGV
FT                   ASHGGAFHAPQEIQRILGHGLDKALQARLAISKVLAQHGYTADVPMPDISTKEKAQEYI
FT                   GLDMEKERKAKDKFLKTIVPEWLEKARANGRLAKL"
FT   misc_feature    436688..436792
FT                   /note="Signal peptide predicted for BF0361 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.901) with cleavage site
FT                   probability 0.206 between residues 35 and 36"
FT   misc_feature    436829..438157
FT                   /note="Pfam match to entry PF02335 cytochr_c552, Cytochrome
FT                   c552, score 687.9, E-value 4.1e-204"
FT   misc_feature    437231..437248
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    437357..437374
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    437576..437593
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    437669..437686
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        438173..439414
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0353"
FT                   /old_locus_tag="BF0362"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT1416 SWALL:AAO76523 (EMBL:AE016931)
FT                   (411 aa) fasta scores: E(): 7e-102, 61.25% id in 413 aa,
FT                   and to Chlorobium tepidum hypothetical protein CT1560
FT                   SWALL:Q8KC66 (EMBL:AE012912) (414 aa) fasta scores: E():
FT                   1.6e-32, 28.67% id in 408 aa, and to Bacteroides
FT                   thetaiotaomicron conserved hypothetical protein BT1604
FT                   SWALL:AAO76711 (EMBL:AE016932) (292 aa) fasta scores: E():
FT                   2.3e-12, 26.4% id in 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06132"
FT                   /db_xref="GOA:Q5LI94"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI94"
FT                   /protein_id="CAH06132.1"
FT                   /translation="MWQKPWGYKEGFAICGGLFLTGTFLQITIGKCELSILSYPMNVCV
FT                   GVLYLVILLLIYAFSQKSYFIRWMGSCQAAVSSMVSVAMLTVVMGLIRQVKSDVPLLGA
FT                   ESWLGFSQMLSACSFVLLFLWMITLLGLTTIRRIHHFRWCDFPFVLNHLGLFLALTGAI
FT                   LGNADMERLRMTTKTGQAEWRALDENQKMRELPLAIELQDFTIDEYPPKLMLINNETGE
FT                   ALPSKKPENLLIEENFHTGRLLDWEIGIEKKIPLAASVATQDTLNFVEFHSMGATYAVY
FT                   LKAVNNKTGQQREGWVSCGSFMFPYKAIRLDDQTSLVMPEREPRRFASEVKVYTESGCR
FT                   DSATIEVNKPFELEGWKIYQLSYDESKGRWSDISVFELVRDPWLPVVYTGIWMMIAGAV
FT                   CLFALSQKRKEDNT"
FT   misc_feature    order(438206..438259,438287..438355,438392..438451,
FT                   438509..438577,438614..438673,439319..439387)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BF0362 by TMHMM2.0 at aa 12-29, 39-61, 74-93, 113-135,
FT                   148-167 and 383-405"
FT   CDS_pept        439411..440202
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0354"
FT                   /old_locus_tag="BF0363"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /note="C-terminus is similar to Chlamydomonas reinhardtii
FT                   cytochrome c biogenesis protein CcsA SWALL:CCSA_CHLRE
FT                   (SWALL:P48269) (353 aa) fasta scores: E(): 4.6e-13, 31.03%
FT                   id in 232 aa, and to Bacteroides thetaiotaomicron
FT                   cytochrome c biogenesis protein CcsA BT1415 SWALL:AAO76522
FT                   (EMBL:AE016931) (263 aa) fasta scores: E(): 3e-92, 80.98%
FT                   id in 263 aa, and to Bacteroides thetaiotaomicron
FT                   cytochrome c biogenesis protein BT1605 SWALL:AAO76712
FT                   (EMBL:AE016932) (261 aa) fasta scores: E(): 1.4e-62, 57.57%
FT                   id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06133"
FT                   /db_xref="GOA:Q5LI93"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI93"
FT                   /protein_id="CAH06133.1"
FT                   /translation="MSWDQFVIFAIVALLCWGIGAVAAWRGKRQWMVYTATLAGLAVFF
FT                   AFILGMWISLERPPMRTMGETRLWYSFFLPLAGIITYSRWRYKWILSFSFILSLVFVCI
FT                   NLFKPEIHNKTLMPALQSPWFAPHVIVYMFAYAMLGAAAVMAVYLLWIKKKTPEEREME
FT                   LCDNLVNVGLAFMTLGMLFGALWAKEAWGHYWSWDPKETWAAATWLGYLCYIHFRMNRR
FT                   QKVRTALVGLLICFVLLQMCWYGINYLPSAQGTSVHTYNLN"
FT   misc_feature    order(439423..439482,439501..439569,439612..439665,
FT                   439678..439737,439795..439863,439912..439971,
FT                   440014..440070,440089..440157)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BF0363 by TMHMM2.0 at aa 5-24, 31-53, 68-85, 90-109,
FT                   129-151, 168-187, 202-220 and 227-249"
FT   misc_feature    439597..440112
FT                   /note="Pfam match to entry PF01578 CytC_asm, Cytochrome C
FT                   assembly protein, score 24.9, E-value 0.00016"
FT   CDS_pept        440235..441500
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0355"
FT                   /old_locus_tag="BF0364"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1414 SWALL:AAO76521 (EMBL:AE016931) (428 aa)
FT                   fasta scores: E(): 1.9e-102, 58.29% id in 434 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06134"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI92"
FT                   /protein_id="CAH06134.1"
FT                   /translation="MRITNLFWTVVLLAPLSVFAQQQKENLFTIDAQIRTRGEYRNGVL
FT                   NPRPEGEEPTFFVNERARLSLGYQRDRLQMRLSAQHVGVWGQDPQIDKNGRFILHEAWA
FT                   RLDFSKGLFAQLGRQPLSYDDERLLGGLDWNVAGRFHDALKLGYESKLHKLHLILAFNQ
FT                   NDENRSYGGTYYASGAQPYKTMQTVWYNGHWAKDFTVSLLFMNTGFETGTEGNGKTANM
FT                   QTMGTYWVYTPGAWLFNGSAYYQFGKNKADKKVSAYMFSLKAGYKIDPKWSVSLGTDYL
FT                   SGDPDSKKVSTFDPLYGTHHKFYGGMDYFYASAYNKGLWDKILSVDFKPTKKLSFSLNY
FT                   HHFSTTYDVMATDGKEGRCLGSELDMQVDYTLMKDVKLTAGYSTMLGTKYMDIVKGGNH
FT                   KSWQDWGWLTLNINPRILFTKW"
FT   misc_feature    440235..440294
FT                   /note="Signal peptide predicted for BF0364 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   misc_feature    440868..440891
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        441547..442233
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0356"
FT                   /old_locus_tag="BF0365"
FT                   /product="putative FNR-family transcriptional regulatory
FT                   protein"
FT                   /note="Similar to Pseudomonas stutzeri FNR family DnrE
FT                   protein SWALL:Q9X7J7 (EMBL:AJ131716) (231 aa) fasta scores:
FT                   E(): 4.3e-05, 22.82% id in 184 aa, and to Bacteroides
FT                   thetaiotaomicron putative transcription regulator BT1413
FT                   SWALL:AAO76520 (EMBL:AE016931) (229 aa) fasta scores: E():
FT                   1.9e-42, 51.73% id in 230 aa, and to Bacteroides
FT                   thetaiotaomicron cAMP-binding domain BT0688 SWALL:AAO75795
FT                   (EMBL:AE016928) (222 aa) fasta scores: E(): 1.9e-17, 31.22%
FT                   id in 205 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06135"
FT                   /db_xref="GOA:Q5LI91"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI91"
FT                   /protein_id="CAH06135.1"
FT                   /translation="MVKVEFTDEYQKILWQISLFKDMDNSLQRRLPQELELSVYEVARK
FT                   EIVLKQDTYCNHLYVLLKGELEVNIVDVAGNLVKVEDIRAPRAFATPHLFGDKNLLPAT
FT                   FTASEDSVLLMATRSSVFKLISSVPDLLHRFLCVTGNCNKCTVTRLRILSYKMLRSRLV
FT                   YYFMEHKISPDTALLEHNQVQLAEYLGVTRPALSKEINKMMKEGLISINKKVVTLEDMA
FT                   ALKEYI"
FT   misc_feature    441652..441936
FT                   /note="Pfam match to entry PF00027 cNMP_binding, Cyclic
FT                   nucleotide-binding domain, score 23.6, E-value 0.00025"
FT   misc_feature    442084..442149
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1862.000, SD 5.53 at aa 180-201, sequence
FT                   HNQVQLAEYLGVTRPALSKEIN"
FT   CDS_pept        complement(442245..444128)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0357"
FT                   /old_locus_tag="BF0366"
FT                   /product="putative beta-lactamase/acylhydrolase"
FT                   /note="Similar to the C-terminus of Bacteroides fragilis
FT                   sialate O-acetylesterase EstA SWALL:BAC56897
FT                   (EMBL:AB102772) (220 aa) fasta scores: E(): 8e-27, 41.82%
FT                   id in 208 aa, and to the N-terminus of Escherichia coli
FT                   hypothetical protein YfeW precursor or B2430
FT                   SWALL:YFEW_ECOLI (SWALL:P77619) (434 aa) fasta scores: E():
FT                   3.3e-26, 31.6% id in 386 aa, and to the N-terminus of
FT                   Salmonella typhi hypothetical protein YfeW precursor or
FT                   STY2716 or t0381 SWALL:AAO68099 (EMBL:AL627274) (432 aa)
FT                   fasta scores: E(): 2.9e-25, 31.38% id in 427 aa. CDS may be
FT                   a fusion protein."
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06136"
FT                   /db_xref="GOA:Q5LI90"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI90"
FT                   /protein_id="CAH06136.1"
FT                   /translation="MENKINFSPPSTREGKGVRFLLTTFSILLCSLQAVAQSLPRVAPE
FT                   QVGMDSHRLLHADEAIHRAIDHKEIPGAVLAVIRHGKMAYLKAYGNKRIYPNVEPMEIN
FT                   TVFDMASCSKSMSTAVSVMILVERGQLRLLDRVSFYLPDFQEWRGENGEKKDIRIIDLM
FT                   THTSGLPPYAPVSELQEKYGSPNPKGLMEYISTCKREFKPQTKFQYSCLNYITLQHIIE
FT                   TITGQSLRDFAKENIFDILGMQYTDYLPTIQQQDGKWINTVACPWMDRIAPTEKQKDGS
FT                   VLCGQVHDPLARILNGGISGNAGIFSNANDIGILAAALLNGGEYNGHRILSPLGVKTMC
FT                   TVPRELTAFGRTPGWDIFSPYASNKGDLFSPNTFGHTGYTGTSIIIDPDNDTAVILLVN
FT                   AVHPEDRHSIVRLRSLVANAVAASICPPAQVYTDHYYKRFLQFETETPISPKDIVMVGN
FT                   SLTENGGNWSKRLNKKNIRNRGIIGDEALGICQRLFQILPGTPQKLFLMAGINDVSHDL
FT                   STDSVVSLITKVIEKIQTESPRTKLYIQSLLPINESFGRYKTMTGKTDLIPEINRKLEA
FT                   LAKEKKIPFIHLFPLFTEKNSNVMRKELTTDGLHLTEEGYRIWSKALKRYL"
FT   misc_feature    complement(442260..442772)
FT                   /note="Pfam match to entry PF00657 Lipase_GDSL, GDSL-like
FT                   Lipase/Acylhydrolase, score 37.4, E-value 2.8e-08"
FT   misc_feature    complement(442875..443960)
FT                   /note="Pfam match to entry PF00144 beta-lactamase,
FT                   Beta-lactamase, score 218.9, E-value 6.3e-63"
FT   CDS_pept        complement(444161..445006)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0358"
FT                   /old_locus_tag="BF0367"
FT                   /product="putative glucokinase/SIS domain protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   sugar phosphate isomerase BT0133 SWALL:AAO75240
FT                   (EMBL:AE016926) (277 aa) fasta scores: E(): 4.4e-82, 84.64%
FT                   id in 267 aa, and to Thermoanaerobacter tengcongensis
FT                   predicted sugar phosphate isomerase TTE0212 SWALL:Q8RD35
FT                   (EMBL:AE012994) (306 aa) fasta scores: E(): 4.3e-42, 50.79%
FT                   id in 252 aa, and to Salmonella typhi putative phophosugar
FT                   binding protein STY2817 or t0286 SWALL:AAO68011
FT                   (EMBL:AL627275) (297 aa) fasta scores: E(): 4.9e-41, 48.3%
FT                   id in 265 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06137"
FT                   /db_xref="GOA:Q5LI89"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI89"
FT                   /protein_id="CAH06137.1"
FT                   /translation="MNSNIEKSDKPSFIKISEQPSLYDDLEKKSVREILEDINKEDQKV
FT                   AIAVQKAIPQIEKLVTQIVPRMKQGGRIFYMGAGTSGRLGVLDASEIPPTFGMPPTLII
FT                   GLIAGGDTALRNPVENAEDNTTRGWEELTEHNINDKDTVIGIAASGTTPYVIGAMHAAR
FT                   EHGILTGCITSNPNSPMAAEADIPIEMIVGPEYVTGSSRMKSGTGQKMILNMITTSVMI
FT                   QLGRVKGNKMVNMQLSNRKLVDRGTRMIIEELGLEYDKAKALLLMHGSVKKAIDAYKAG
FT                   "
FT   misc_feature    complement(444341..444817)
FT                   /note="Pfam match to entry PF01380 SIS, SIS domain, score
FT                   32.5, E-value 8.1e-07"
FT   misc_feature    complement(444377..444430)
FT                   /note="PS01272 Glucokinase regulatory protein family
FT                   signature."
FT   CDS_pept        complement(445030..445866)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0359"
FT                   /old_locus_tag="BF0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3618 SWALL:AAO78723 (EMBL:AE016941)
FT                   (283 aa) fasta scores: E(): 1.6e-73, 67.14% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06138"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI88"
FT                   /protein_id="CAH06138.1"
FT                   /translation="MILIADSGSTKTDWCVVEHGQLIQQISTKGTNPFFQSEEEISNEI
FT                   ATALIPQLKTNKFEAVHFYGAGCAFPDKIETMRKAIASHLQVSGEIEVSTDMLAAARSL
FT                   CGHQPGIACIMGTGSNSCYYDGKNIVTNVSPLGFILGDEGSGAVLGKLLVGDILKNQMT
FT                   PGLKEKFLEQFNLTPAEIIDRVYRKPFPNRFLASFSPFLVQHLDEPVIRELVLNSFKKF
FT                   LKRNVMQYDYQHAPVHFIGSVAFYYRELLSEACKIMGVHLGTIIQSPMEGLIKFHE"
FT   CDS_pept        complement(445863..447026)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0360"
FT                   /old_locus_tag="BF0369"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Leptospira interrogans conserved
FT                   hypothetical protein La0773 SWALL:Q8F816 (EMBL:AE011263)
FT                   (381 aa) fasta scores: E(): 1.5e-17, 34.39% id in 407 aa,
FT                   and to Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein BT3619 SWALL:AAO78724 (EMBL:AE016941) (372 aa)
FT                   fasta scores: E(): 6.7e-75, 71.13% id in 388 aa, and to
FT                   Anabaena sp. hypothetical protein ALL1887 SWALL:Q8YVT7
FT                   (EMBL:AP003587) (375 aa) fasta scores: E(): 5e-32, 34.66%
FT                   id in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06139"
FT                   /db_xref="GOA:Q5LI87"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI87"
FT                   /protein_id="CAH06139.1"
FT                   /translation="MNQTVNKRLLALDVLRGITIAGMIMVNNPGSWSYVYAPLGHAAWI
FT                   GLTPTDLVFPFFMFIMGISTYISLRKYNFEFSHSAALKILKRTIVIFAIGLGIAWFSMF
FT                   CRTWNSLSGEDISFFSRLYESVWTFGHIRILGVMQRLALCYGATAIIALIMKHKYIPYL
FT                   IAILLIGYFIILINGNGFEYNSSNILSIVDRTVLGEAHMYKDNGIDPEGLLSTIPSIAH
FT                   VLIGFCVGKLLMEVKDIHEKIERLFLIGTILTFAGFLLSYGCPISKKIWSPTFAIVTCG
FT                   LASSFLALLVWIIDVRGYTRWSRFFESFGVNPLFIYVMGAVLSILLGSILIPYDGGSIS
FT                   LHGFVYNAILQPVLGDYPGSLAFAILFVGLNWCIGYILYKKKIYIKI"
FT   misc_feature    complement(order(445890..445958,446016..446084,
FT                   446145..446204,446232..446291,446325..446393,
FT                   446484..446552,446565..446633,446697..446765,
FT                   446826..446894,446922..446990))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BF0369 by TMHMM2.0 at aa 13-35, 45-67, 88-110, 132-154,
FT                   159-181, 212-234, 246-265, 275-294, 315-337 and 357-379"
FT   CDS_pept        complement(447035..449905)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0361"
FT                   /old_locus_tag="BF0370"
FT                   /product="putative FAD-binding oxidoreductase"
FT                   /note="Similar to Vibrio vulnificus Fe-S oxidoreductase
FT                   VV20801 SWALL:Q8D5V2 (EMBL:AE016810) (946 aa) fasta scores:
FT                   E(): 4e-154, 45.02% id in 944 aa, and to Vibrio cholerae
FT                   oxidoreductase/iron-sulfur cluster-binding protein VCA0985
FT                   SWALL:Q9KKW5 (EMBL:AE004425) (959 aa) fasta scores: E():
FT                   6.9e-151, 44.14% id in 956 aa, and to Pseudomonas
FT                   aeruginosa probable ferredoxin PA4772 SWALL:Q9HV36
FT                   (EMBL:AE004890) (938 aa) fasta scores: E(): 1e-118, 44.86%
FT                   id in 954 aa, and to Pseudomonas putida D-lactate
FT                   dehydrogenase, putative PP4737 SWALL:AAN70309
FT                   (EMBL:AE016791) (936 aa) fasta scores: E(): 2.4e-118, 45.4%
FT                   id in 958 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06140"
FT                   /db_xref="GOA:Q5LI86"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI86"
FT                   /protein_id="CAH06140.1"
FT                   /translation="MKMERNYSAFLQDIGRFIPRDRLFTDELHRLAWGTDAGFYRLIPQ
FT                   IVIHSINDDEVIEIIYLADRYNIPVTFRAAGTSLSGQAISDSVLIIAGKGWENYELSPD
FT                   HEKIYLEPGIVGQRVNEILAPYGRKFAPDPASIKSAMVGGIVMNNASGMNCGTHANSDK
FT                   MLLSVHIIFPDGYYLNTDSQESRENFKEDYPEFLQRICELRDQIRSNEKLSARIRHKYS
FT                   IKNVTGLNILPFLVYDDPFDIIAHLMVGSEGTLAFLAGVTMKTEYDYPYKASAMLYFSD
FT                   IKEACRAVVAMKRLVNANGEWIVKGAELLDWKSLASVNDPTGEGLTAVLTETKACTQEE
FT                   LNQNIAIIEEALKAFDTYIPVHFTDQPEEYSKYWAIRAGIFPSVGGTRPSGTTCLIEDV
FT                   AFHIEDLPEATAELQQLIARHGYDDACIYGHALEGNYHFIINQSFSSEAEVKRYEALMN
FT                   DVIDLVVDKYDGSLKAEHGTGRNMAPFVEYEWGEEAYAIMKEVKQLFDPKGLFNPGVIF
FT                   NDDPQCHIKHFKPLSPLTIGQDTQVTRQIDRCIECGFCEVNCLSCGFTLSSRQRIVIQR
FT                   EISRLKKSGENPQLLETLSELYRYSGNRTCAGDGLCAMSCPMGINTGDLTHILRQAEFP
FT                   PGSTGYRAGKFAANHFAGIKSTLRPVLSLANAAHSLLGTSTMTSITRKMHSAWGLPQWT
FT                   PAMPKSYKIRKSDQTPAMNNKVVYFPSCINQTMGLAKDSPVDQPLVKQMLSLLQKAGYE
FT                   VIFPPKMEKLCCGTIWESKGMLDIADSKSTELEAALWEASEQGRYPVLCDQSPCLHRMR
FT                   ATIQKIKLYEPAEFIYTFLRDKLEFTPTDRPIAIHITCSMRKMGLANILISLAKLCSTQ
FT                   VFIPEEVGCCGFAGDKGFTQPELNTYALRKLRPQLTKAGIGIGYSNSRTCEIGLATNTG
FT                   IPYVSIAYLVDQCTRPIKQENNLTLK"
FT   misc_feature    complement(448358..449104)
FT                   /note="Pfam match to entry PF02913 FAD-oxidase_C, FAD
FT                   linked oxidases, C-terminal domain, score 162.9, E-value
FT                   4.8e-46"
FT   misc_feature    complement(449144..449776)
FT                   /note="Pfam match to entry PF01565 FAD_binding_4, FAD
FT                   binding domain, score 120.0, E-value 3.8e-33"
FT   CDS_pept        complement(449941..451215)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0362"
FT                   /old_locus_tag="BF0371"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein OB1304 SWALL:Q8ERJ8 (EMBL:AP004597) (509
FT                   aa) fasta scores: E(): 1.8e-64, 45% id in 420 aa, and to
FT                   Bacillus halodurans hypothetical protein BH0674
FT                   SWALL:Q9KF23 (EMBL:AP001509) (418 aa) fasta scores: E():
FT                   3.1e-63, 43.26% id in 423 aa, and to Bacillus subtilis
FT                   hypothetical protein YbbC precursor SWALL:YBBC_BACSU
FT                   (SWALL:P40407) (414 aa) fasta scores: E(): 9.8e-63, 43.02%
FT                   id in 423 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06141"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="PDB:4K05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI85"
FT                   /protein_id="CAH06141.1"
FT                   /translation="MTYRRSILKLLLTFFVFMTSTLLSRGAEPGARPPRIRIKTGIEVL
FT                   KEQNFKCLEGKRVGLITNPTGVDNHLISTIDILHEAPNVNLVALYGPEHGVRGDVHAGD
FT                   KVDNANDSSTGLPVYSLYGKTRKPTPEMLKDIDVLVYDIQDIGCRSFTYISTMGVAMEA
FT                   AAENNKEFIVLDRPNPIGGLKIEGNVVEDGYISFVSQFKIPYLYGLTCGELALMLNGEQ
FT                   MLSKPCNLHVVKMKGWKRKMDYVQTGLQWIPSSPHIPHPHSAFFYPVSGILGELGYMSI
FT                   GVGYTIPFQMFAARWVEAEKLADNLNRLHLPGVIFRPMHLKPFYSVGKEEHLQGVQVHI
FT                   VDFNKASLSEIQFYVMQEVTALYPDRAVFDHADKERFHMFDLVSGSKEIRERFSQRNRW
FT                   EDVRDYWYKDVDDFRRLSQKYYLYK"
FT   misc_feature    complement(451138..451215)
FT                   /note="Signal peptide predicted for BF0371 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.596 between residues 26 and 27"
FT   CDS_pept        complement(451257..452555)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0363"
FT                   /old_locus_tag="BF0372"
FT                   /product="putative transmembrane permease"
FT                   /note="Similar to Pseudomonas aeruginosa permease for AmpC
FT                   beta-lactamase expression AmpG or pa4393 SWALL:Q9X3S5
FT                   (EMBL:AF082985) (594 aa) fasta scores: E(): 9.5e-09, 29.61%
FT                   id in 260 aa, and to Bacteroides thetaiotaomicron AmpG
FT                   protein, beta-lactamase induction signal transducer BT3620
FT                   SWALL:AAO78725 (EMBL:AE016941) (393 aa) fasta scores: E():
FT                   7.2e-94, 59.28% id in 393 aa, and to Bacteroides
FT                   thetaiotaomicron putative signal transducer BT1034
FT                   SWALL:AAO76141 (EMBL:AE016930) (443 aa) fasta scores: E():
FT                   2.3e-26, 36.32% id in 435 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06142"
FT                   /db_xref="GOA:Q5LI84"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI84"
FT                   /protein_id="CAH06142.1"
FT                   /translation="MKNKNISPWAWIPTLYFAQGLPYVAVMTISVIMYKNLGISNTDIA
FT                   LYTSWLYLPWVIKPFWSPFVDLLKTKRWWIVSMQLLVGAGLAGIAFTIPMSNFFQTTLA
FT                   IFWLVAFSSATHDIAADGFYMLALNVQDQALYVGIRSTFYRIATIAGQGLLVMLAGGLE
FT                   IWTGSIKYGWSITFFILAGLFLAFCLYHKCILPKPDSDKAVVGENSASAIFSGFIETFA
FT                   SFFRKKQAGVAILFMLFYRFPEAQLVKLINPFLLDPIDKGGLGLTTAEVGLVYGTIGII
FT                   GLTLGGIIGGICAAKGGLQKWLWPMAWSLSLTCLTFVYLGYFQPQNFVIINLCVFIEQF
FT                   GYGFGFTAYMLYLIYYSDGEHKTAHYAICTAFMALGMMLPGMAAGWLQELIGYENFFIW
FT                   VMVCCTATIAVCAFIKIDPNYGKKAEGIPQKTK"
FT   misc_feature    complement(order(451314..451370,451398..451466,
FT                   451485..451553,451596..451652,451671..451739,
FT                   451881..451949,451986..452045,452088..452156,
FT                   452175..452243,452271..452339,452373..452426,
FT                   452454..452522))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BF0372 by TMHMM2.0 at aa 12-34, 44-61, 73-95, 105-127,
FT                   134-156, 171-190, 203-225, 273-295, 302-320, 335-357,
FT                   364-386 and 396-414"
FT   CDS_pept        complement(452571..453926)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0364"
FT                   /old_locus_tag="BF0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis amidase enhancer
FT                   precursor LytB or CwbA SWALL:CWBA_BACSU (SWALL:Q02113) (705
FT                   aa) fasta scores: E(): 9.5e-06, 23.26% id in 374 aa, and to
FT                   Bacteroides thetaiotaomicron amidase enhancer precursor
FT                   BT3621 SWALL:AAO78726 (EMBL:AE016941) (459 aa) fasta
FT                   scores: E(): 2e-85, 64.66% id in 467 aa, and to
FT                   Synechococcus elongatus Tll0391 protein SWALL:Q8DLT7
FT                   (EMBL:AP005370) (389 aa) fasta scores: E(): 4.5e-08, 29.1%
FT                   id in 378 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06143"
FT                   /db_xref="GOA:Q5LI83"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI83"
FT                   /protein_id="CAH06143.1"
FT                   /translation="MKEPKVQVGILFEPQIKFILLTPYHINGEEVSGKQVVTYDNGHIL
FT                   WQGHSYDELLFEPLHEKSDAFELQDVTIGINFHWERKENQRFIGALKIIVENKKLTGIN
FT                   VIHVEDYLTSVISSEMSATASLELLKAHAVISRSWLLAGLSLPYSKDREKSNTTPEKVP
FT                   YSTSSFPPLAQEAENKILIRWYERDAHTHFDVCADDHCQRYQGITRASTDMVRQAISAT
FT                   RGEVLMSEGTICDARFSKCCGGAFEEFQYCWENIRHPYLSKQRDSKKATDLPDLCKEAE
FT                   AERWIRTSPEAFCNTKDKKVLSQVLNNYDQETTDFYRWKVEYEQEELSKLILKRSGIDY
FT                   GQILDLVPVERGTSGRLVRLKIIGTKRTMIIGKELEIRRTLSPSHLYSSAFIIDKVDVT
FT                   NGIPDRFILTGAGWGHGVGLCQIGAAVMGEQGYTYDTILLHYYIGATIDKLY"
FT   CDS_pept        complement(join(453926..454855,454855..456318))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0365"
FT                   /old_locus_tag="BF0375"
FT                   /product="putative glycosyltransferase (pseudogene)"
FT                   /note="Pseudogene. Similar to Bacteroides thetaiotaomicron
FT                   putative glycosyltransferase BT3622 SWALL:Q8A1N7
FT                   (EMBL:AE016941) (814 aa) fasta scores: E(): 4.1e-158,
FT                   51.72% id in 814 aa, and to C-terminus of Methanosarcina
FT                   mazei glycosyltransferase from codon 240 MM0652
FT                   SWALL:Q8PZ42 (EMBL:AE013289) (307 aa) fasta scores: E():
FT                   6.2e-07, 27.82% id in 230 aa, and to C-terminus of
FT                   Pyrococcus abyssi glycosyl transferase pyrab11600 or
FT                   pab0772 from codon 242 SWALL:Q9UZI6 (EMBL:AJ248286) (298
FT                   aa) fasta scores: E(): 1.1e-06, 30.43% id in 207 aa. Note:
FT                   This CDS contains a frameshift after residue 488"
FT   misc_feature    complement(455077..455580)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 86.8, E-value 3.7e-23"
FT   CDS_pept        complement(456342..458207)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0366"
FT                   /old_locus_tag="BF0376"
FT                   /product="putative PQQ-binding exported phosphoesterase"
FT                   /note="N-terminus is similar to the C-terminus of
FT                   Methanobacterium thermoautotrophicum serine/threonine
FT                   protein kinase related protein MTH1485 SWALL:O27529
FT                   (EMBL:AE000909) (407 aa) fasta scores: E(): 3.3e-16, 23.98%
FT                   id in 321 aa, and N-terminus is similar to the C-terminus
FT                   of Methanosarcina acetivorans cell surface protein ma3699
FT                   SWALL:Q8TJS8 (EMBL:AE011080) (2523 aa) fasta scores: E():
FT                   2.3e-11, 28.14% id in 302 aa, and N-terminus is similar to
FT                   the C-terminus of Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein with conserved domains BT3030
FT                   SWALL:AAO78136 (EMBL:AE016938) (824 aa) fasta scores: E():
FT                   7.6e-11, 27.76% id in 353 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06145"
FT                   /db_xref="GOA:Q5LI82"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI82"
FT                   /protein_id="CAH06145.1"
FT                   /translation="MNRRLSIFVIILFFLLPVAARAQVTGSFRFAQLTDIHLNPNNPKP
FT                   TEDLKRSVEQINATPGVDFVLVTGDLTEEGDRTTMLVVKSILDRLKVKYYVIPGNHETK
FT                   WSDSGCTAFSEIFGGERFKFEHKGFLFLGFNSGPLMRMAYGHVVPQDITWMKQEMDKVG
FT                   KDKPVILVTHYPMQDGDVDNWYDVTDAVRPYNIRTFIGGHYHRNRFLSYDGIPGILTRS
FT                   NLRDKNGSSGYSIFDITPDSIITYEQRIDEPMKRWTALSLTKSYYNRTGKAVKYPSFSV
FT                   NKEYPQVKIGWQVQTGVGIYCSPALWKGRVYVGDDLGFLTCYTLKEGRKLWSFQSGKRI
FT                   VGTPAATDGIVVFGSADHNIYGLDAVTGKERWRVTVAQPVLGAVTIEKGIAYIGGSDST
FT                   FRAIRIKNGKVVWTYTGIKGYIETKPLVEGDKVIFGAWDNTLYALNKSNGKELWKWTGG
FT                   LTRMHFSPAAVWPVAAHGKVFITDPQRAMTAISLKTGKTVWRTFQSMVRETIGLSANKN
FT                   QIYSKTMNDSVVCYSTISDTPKEIWASNVGFGYEHAPSMQMEKDGIVFSSTKEGLIFAL
FT                   DASTGQVLWKHKIGNSLINTVLPISRHQVLFTATSGETGLLEWKE"
FT   misc_feature    complement(456411..456524)
FT                   /note="Pfam match to entry PF01011 Bacterial_PQQ, PQQ
FT                   enzyme repeat, score 31.2, E-value 2e-06"
FT   misc_feature    complement(456846..456920)
FT                   /note="Pfam match to entry PF01011 Bacterial_PQQ, PQQ
FT                   enzyme repeat, score 24.6, E-value 2e-06"
FT   misc_feature    complement(457050..457163)
FT                   /note="Pfam match to entry PF01011 Bacterial_PQQ, PQQ
FT                   enzyme repeat, score 32.7, E-value 7.1e-07"
FT   misc_feature    complement(457587..458126)
FT                   /note="Pfam match to entry PF00149 Metallophos,
FT                   Calcineurin-like phosphoesterase, score 75.4, E-value
FT                   9.9e-20"
FT   misc_feature    complement(458142..458207)
FT                   /note="Signal peptide predicted for BF0376 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.973 between residues 22 and 23"
FT   CDS_pept        complement(458303..461374)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0367"
FT                   /old_locus_tag="BF0377"
FT                   /product="possible exported xanthan
FT                   lyase/N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Similar to Bacteroides thetaiotaomicron xanthan
FT                   lyase BT0257 SWALL:AAO75364 (EMBL:AE016926) (970 aa) fasta
FT                   scores: E(): 3.8e-79, 44.54% id in 1035 aa, and limited
FT                   similarity to C-terminus of Bacillus sp. GL1 xanthan lyase
FT                   Xly SWALL:Q9AQS0 (EMBL:AB037178) (930 aa) fasta scores:
FT                   E(): 0.022, 31.48% id in 108 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06146"
FT                   /db_xref="GOA:Q5LI81"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI81"
FT                   /protein_id="CAH06146.1"
FT                   /translation="MKPILTSLILLLTAGLFPQAAATQELSKELRSQIGDFLNETARKE
FT                   ISVGKIHIDSVNTEGNDLILFANINCSYIPFRTDNVSKIYQGIKALLPPELAKRKLQIR
FT                   TDHHAIEELIPLALRNTRGRKIPTFSYKADTPLITRLSVPYTHTNGLQNRHIALWQSHG
FT                   FYYESKLTRWEWQRARIFQTVEDLYTQSYVLPFLVPMLENAGATVLLPRERDPQTVEII
FT                   VDNDRCRDGHSVYSELNGSKMWKNGEEAGFAHLKRMYKDFENPFREGTYRQVETTKKGT
FT                   VSVAEWIPEIPRAGRYAVYISYKTVNNSTEDALYTVYHQGGKSQFKVNQQMGGGTWIYL
FT                   GNFSFGIGKTDCKIVLSNQSAKEGRLVTADAVKIGGGYGNIARSISEEGATVNTKSSDT
FT                   MITDTYHPKVQVNYPYEISGYPRFCEAARYWMQWAGIPDSVYSDSHGKNDYTDDYKSRG
FT                   IWVNYLAGGSAANPTEKGLNIPVDMAFAFHSDAGTTYGDTIIGTLGIFHTSAYNGAYAN
FT                   GASRYASRDLCDLVQSNIVKDVRTLYEPEWTRRGMWNQSYYEARVPRVPTMLLELLSHQ
FT                   NFADMRYGLDPRFRFTVSRAIYKGILQFICSQYKMEYVVQPLPVDHMSLRFEEGNRIKL
FT                   SWQPVDDPLETTAKADQYIVYTRIGDSDFDNGVIVNSPTYQTVIPSGVVCSFKVTALNK
FT                   GGESFPSEILSIGKTFNDKGTVLIINGFDRVCAPADFTADADTLAGFLDELDHGVPYKT
FT                   DISYIGPMKEFRRQIPWMDDDASGFGDSYGTHETMVIAGNTFDYPAIHGEAILKAGYSF
FT                   TSCSDESIVHPDSSPKERETQICMNDYKYVDLILGKQCQTKMGRGGIRPLEFKTFSKEM
FT                   QNAITNYCQAGGNFFVSGAYVASDLWDNRLVKANEEDKKFAMEVLKYKWRVGQAARNGK
FT                   VKSVASPFPEITGSYTYYQDLNPESYVVESPDALEPAAQGAFTILRYSENNLSAGIAYK
FT                   GNYKTCVLGFPFEAIRTVTERELLMKAILTFFEH"
FT   misc_feature    complement(459557..459958)
FT                   /note="Pfam match to entry PF01520 Amidase_3,
FT                   N-acetylmuramoyl-L-alanine amidase, score -4.6, E-value
FT                   0.00017"
FT   misc_feature    complement(461306..461374)
FT                   /note="Signal peptide predicted for BF0377 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.657 between residues 23 and 24"
FT   CDS_pept        complement(461377..462834)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0368"
FT                   /old_locus_tag="BF0378"
FT                   /product="putative cation symporter"
FT                   /note="Similar to Homo sapiens sodium/iodide cotransporter
FT                   slc5a5 or Nis SWALL:SL55_HUMAN (SWALL:Q92911) (643 aa)
FT                   fasta scores: E(): 1.6e-18, 21.42% id in 406 aa, and to
FT                   Bacteroides thetaiotaomicron sodium/iodide co-transporter
FT                   BT3623 SWALL:AAO78728 (EMBL:AE016941) (495 aa) fasta
FT                   scores: E(): 2.1e-156, 81.66% id in 480 aa, and to
FT                   Bacteroides thetaiotaomicron Na+/solute symporter BT1082
FT                   SWALL:AAO76189 (EMBL:AE016930) (438 aa) fasta scores: E():
FT                   9.6e-84, 49.07% id in 434 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06147"
FT                   /db_xref="GOA:Q5LI80"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI80"
FT                   /protein_id="CAH06147.1"
FT                   /translation="MTPVAVLITIAPYFLILFTISYIAGRKADNEGFFVGNRKSAWYVV
FT                   AFAMIGSSISGVTFVSVPGMVGISNFSYLQMVLGFVTGQIIIAFVLIPLFYRMNLVSIY
FT                   EYLENRFGTSSYKTGAWFFFISKILGAAVRLYLVCLTLQLLVFEPFHMPFIMNVILTVA
FT                   LVWLYTFRGGVKSLIWTDSLKTFCLIVSVVLCIYYISTDLKLSFTEMFSTVSDSALSHM
FT                   FFFDNVNDKRYFFKQFLAGVFTMIAMTGLDQDMMQRNLSCKNFKDSQKNMITSGISQFF
FT                   IILLFLMLGVLLYTFTSHQGITNPAKSDELFPMIATGGYFPIIVGILFIIGLISSAYSA
FT                   AGSALTALTTSFTVDILGIKGKTEDTVRKTRKKVHVGMAIVMGIVIFIFNLLNNTSVID
FT                   AVYILASYTYGPILGLFAFGILTKRQVRDRYIPLVSILSPILCFILQKNSETWFHGYQF
FT                   SYELLIFNALFTFIGLCFLIKKTINLT"
FT   misc_feature    complement(order(461401..461469,461497..461550,
FT                   461569..461637,461647..461715,461827..461895,
FT                   461953..462021,462082..462138,462232..462291,
FT                   462325..462378,462421..462480,462541..462609,
FT                   462637..462705,462766..462825))
FT                   /note="13 probable transmembrane helices predicted for
FT                   BF0378 by TMHMM2.0 at aa 4-23, 44-66, 76-98, 119-138,
FT                   153-170, 182-201, 233-251, 272-294, 314-336, 374-396,
FT                   400-422, 429-446 and 456-478"
FT   misc_feature    complement(461551..462738)
FT                   /note="Pfam match to entry PF00474 SSF, Sodium:solute
FT                   symporter family, score -54.5, E-value 5.7e-07"
FT   CDS_pept        complement(462875..464044)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0369"
FT                   /old_locus_tag="BF0379"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT2135 SWALL:AAO77242 (EMBL:AE016934)
FT                   (387 aa) fasta scores: E(): 2.7e-68, 49.22% id in 386 aa,
FT                   and to Clostridium acetobutylicum uncharacterized membrane
FT                   protein, YbbC B.subtilis ortholog CAC0185 SWALL:Q97ML1
FT                   (EMBL:AE007531) (382 aa) fasta scores: E(): 2.2e-37, 36.76%
FT                   id in 389 aa, and to Bacillus subtilis hypothetical protein
FT                   YbbC precursor SWALL:YBBC_BACSU (SWALL:P40407) (414 aa)
FT                   fasta scores: E(): 1.5e-36, 40.15% id in 391 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06148"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="PDB:4JJA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI79"
FT                   /protein_id="CAH06148.1"
FT                   /translation="MKKILLIVVLLCSTLFAQAQKSDVIIGAEQTKAYFPILKNKRIAI
FT                   FSNHTGMVGNKHLLDILLENNFNVVAIFSPEHGFRGNADAGEHVSSTIDSKTGVPILSL
FT                   YNGKSKKPSEASMKKFDILIVDIQDVGLRFYTYYISMVRLMDACAEYDRKILILDRPNP
FT                   NGHYVDGPILDMKYKSGVGGLPIPIVHGMTLGELALMVNGERWLPSSRICDVTVIPCKN
FT                   YTHQTMYRLPIPPSPNLPNMKAIYLYPSICLFEGTPVSLGRGTTLPFQVYGHPNMTGYN
FT                   YNFTPRSIPGAKNPPQLNKLCHGVNLSNLSDEEIWKKGINLDYLIDAYHNLNMGDRFFR
FT                   PFFELLVGTDYVRKMIEGGKSADEIKARWKRDVERFKIQRKPYLLYQDN"
FT   misc_feature    complement(463988..464044)
FT                   /note="Signal peptide predicted for BF0379 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 19 and 20"
FT   CDS_pept        complement(464265..465962)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0370"
FT                   /old_locus_tag="BF0380"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT1620 SWALL:AAO76727 (EMBL:AE016932) (618 aa)
FT                   fasta scores: E(): 4.4e-22, 28.28% id in 640 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT0030
FT                   SWALL:AAO75137 (EMBL:AE016926) (609 aa) fasta scores: E():
FT                   9.2e-22, 28.93% id in 636 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT0755 SWALL:AAO75862
FT                   (EMBL:AE016929) (601 aa) fasta scores: E(): 1.3e-16, 30.21%
FT                   id in 609 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06149"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI78"
FT                   /protein_id="CAH06149.1"
FT                   /translation="MKKIKYIACLLSLAVVSGCDSILDKGPLDSFTNDNFWTGEGNISG
FT                   YANAFYEQFLGYGNGNGYGDFYFKTLSDDQAGMSFAKWTYPDNAPSTSAAWKNGWIEVR
FT                   RANIMLENVPTVASLDEATKNHWLGVARLMRAWQYYHLVRMYGNLPWIDKALNINDEGE
FT                   IYGNREDRDMVMDKVLEDLDFAVTNIKDIPSKTTWSRSLANAMKAEVCLYEGTFRKYRK
FT                   NEDGQQAPDATGAARYLTACKEACLAVMSKGYKLNTSYQGNYNSTDLSSNPEMILYKAY
FT                   KEGLLMHSTIDYTCSSTQISGMSKNAFESYLFKDGKPMALTSLNKSDEAPFQYGHLSLK
FT                   AILAVRDKRLAQTIDTVLLYNGRGFTRFNTGMESTSSTGYGVAKYDNEAIPEGFRSQSG
FT                   KNYTHAPLFWLSVIYLNYAEACAELGNITQDDLDKSINLLKDRAGLPHLNPIVGFSDPA
FT                   NNHGVSDLIWEIRRERRCELMFDNDNRYWDLIRWHQLDKLDTTKYPDIILGANVANDMD
FT                   GCEANKVGKYIDGSKDGSRIYDKKHYLYPIPTGQIALNPQLAPNNPGW"
FT   misc_feature    complement(465906..465938)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(465909..465962)
FT                   /note="Signal peptide predicted for BF0380 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.944 between residues 18 and 19"
FT   CDS_pept        complement(465992..469327)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0371"
FT                   /old_locus_tag="BF0381"
FT                   /product="putative exported protein"
FT                   /note="Similar to Bacteroides fragilis fragilis regulatory
FT                   region FrrG SWALL:Q8VTA9 (EMBL:AF329100) (1137 aa) fasta
FT                   scores: E(): 2.2e-37, 28.34% id in 1122 aa, and to
FT                   Bacteroides thetaiotaomicron putative outer membrane
FT                   protein, probably involved in nutrient binding BT2805
FT                   SWALL:AAO77911 (EMBL:AE016937) (1083 aa) fasta scores: E():
FT                   2.3e-116, 36.57% id in 1091 aa, and to Bacteroides
FT                   thetaiotaomicron putative outer membrane protein, probably
FT                   involved in nutrient binding BT4357 SWALL:AAO79462
FT                   (EMBL:AE016945) (1178 aa) fasta scores: E(): 3e-91, 36.88%
FT                   id in 1109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06150"
FT                   /db_xref="GOA:Q5LI77"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI77"
FT                   /protein_id="CAH06150.1"
FT                   /translation="MNEDRKKRGLANSNLLIAMAITALIIGSSNAMANQTASGSSYKVT
FT                   EQMQIQTVTGVVVDANGEPIIGASVVEKGTTNGIVTDMDGKFSLNVKVGTTLQITFVGY
FT                   QPQDVKATKSMKVVLKEDNELLDEVVVVGYGTQKKANLTGAVSTVDVSKTLEARPQSDV
FT                   SKALQGVVPGLTITNTSGKLNSKPTMTIRGTGTLSNSATSNPLIVVDGVPMDDISYLNT
FT                   QDIDNISVLKDAASTSIYGTRAAFGVILVTTKSAKKTDKVTINYTNNFSWDTPTILPNY
FT                   PDVATQARALRAANTRANLENELFGMYMDDNFIAKAEAWKQRHGGKKAGYREMIPGDDF
FT                   DLGEDGSALYYADWDVVGIMFRDWKPAQSHNISIQGTSGKTSYFLSVGYNHEEGVMTFN
FT                   PDKLNKYNANMNVTSDITNWLQIGGRFSYSDKAYTTPNTRRNTYTYMWRWGSFFGPYGT
FT                   YQGIDMKNDIAYLKQAGDDKTNDSYTRIGAFLKATIIKGLTLNADYTFNINNKTTKSVG
FT                   LPVICWNSWGGKLNTPTTAAGANGDTWVYQNSVRDNSYALNVFANYELTVAKDHHFNFM
FT                   IGANAEEGEYQNHWSQRKGLLDDKLPEFNLATGDQTVGGTHNEWGTAGWFGRINYDYNG
FT                   IWLLELNGRYDGSSKFPSSDRWAFFPSGSVGYRISEEKFFEPIKKVVSNTKIRASYGEI
FT                   GNQAVGSNMYISTVSKRTDGNTHWLNGSNKVVAYDLPSLVSPTLKWERIQTLDIGGDFG
FT                   FFNNELNISFDWYQRTTKDMLAPGQTMPDVLGAGAPKINAGTLRTRGWELSIDWRHHFN
FT                   EVNVYANASIGDFKTVITKWDNDSQLLNENYSGKVYGDIWGFETDRYFTKDDFNADGSY
FT                   KEGIASQKKLEQDGFVYGPGDIKFKDLNNDKEINGGEGTVKDHGDLKVIGNTTPRYQYG
FT                   FRLGGEWKGIDIDMFFQGVGKCDAWTQSAFVMPMMRGADAIYANQANYWTDENPDPNAD
FT                   FPRMWPGNAGKGTVSVLDLGNHNFYPQSKYLVNMAYLRFKNLTIGYTLPKDWTRKVYMD
FT                   KVRVYFSANNICELINKSNAPVDPEVNTSEAIANGGSSDYGNGTWGRVDPMYRTVSFGL
FT                   QVTF"
FT   misc_feature    complement(465995..468907)
FT                   /note="Pfam match to entry PF00593 TonB_dep_Rec, TonB
FT                   dependent receptor, score -12.5, E-value 0.00036"
FT   misc_feature    complement(469229..469327)
FT                   /note="Signal peptide predicted for BF0381 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.987 between residues 33 and 34"
FT   CDS_pept        complement(469789..470637)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0372"
FT                   /old_locus_tag="BF0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3618 SWALL:AAO78723 (EMBL:AE016941)
FT                   (283 aa) fasta scores: E(): 6.6e-48, 46.4% id in 278 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI76"
FT                   /protein_id="CAH06151.1"
FT                   /translation="MKLIAESGSTRTEWALVEDNHLVQRVFTEGLNPFFQTRREISRSV
FT                   RLGLPESFFKKKLDQVYYYGAGCSSYEKKNILGASLVAQFKTPIQVESDLLAAARGLFK
FT                   CEAGIACILGTGSNSCFYDGKIIVKNVKAAGYILGDEGSGAVLGKLFLADLLKGLAPKE
FT                   LANEFHEKFRISVNDVMESVYNLPFPNRFLGTIAYFLGDYMDNEYVYNLLTNNLRSFFN
FT                   RNVCQYDYINYPIRFVGSLAYAYPDILQEVAQEFGVEIDVIEETPMNGLIEFHSMNIEE
FT                   S"
FT   CDS_pept        complement(470937..471947)
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BF9343_0373"
FT                   /old_locus_tag="BF0384"
FT                   /product="putative aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="Similar to Legionella pneumophila
FT                   aspartate-semialdehyde dehydrogenase Asd SWALL:DHAS_LEGPN
FT                   (SWALL:O31219) (347 aa) fasta scores: E(): 1.2e-54, 48.06%
FT                   id in 335 aa, and to Bacteroides thetaiotaomicron
FT                   aspartate-semialdehyde dehydrogenase BT3636 SWALL:AAO78741
FT                   (EMBL:AE016941) (335 aa) fasta scores: E(): 8e-120, 96.41%
FT                   id in 335 aa, and to Aquifex aeolicus
FT                   aspartate-semialdehyde dehydrogenase AsD or AQ_1866
FT                   SWALL:DHAS_AQUAE (SWALL:O67716) (340 aa) fasta scores: E():
FT                   5.1e-69, 58.45% id in 337 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06152"
FT                   /db_xref="GOA:Q5LI75"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI75"
FT                   /protein_id="CAH06152.1"
FT                   /translation="MKVAIVGVSGAVGQEFLRVLDERNFPLDELVLFGSKRSAGTKYTF
FT                   RGKQIEVKLLQHNDDFKGVDIAFTSAGAGTSKEFEKTITRYGAVMIDNSSAFRMDADVP
FT                   LVVPEVNAADAKDRPRGVIANPNCTTIQMVVALKAIEELSHIKTVHVSTYQAASGAGAA
FT                   AMDELYEQYRQVLANEPVTVEKFAYQLAFNLIPQIDVFTENGYTKEEMKMYNETRKIMH
FT                   SDVKVSATCVRVPALRAHSESIWVETERPISIEEAREAFAKGEGLVLQDNPAEKEYPMP
FT                   LFLAGKDPVYVGRIRKDLTNDCGLTFWIVGDQIKKGAALNAVQIAEYLIKEGNIG"
FT   misc_feature    complement(471000..471551)
FT                   /note="Pfam match to entry PF02774 Semialdhyde_dhC,
FT                   Semialdehyde dehydrogenase, dimerisation domain, score
FT                   261.9, E-value 7.3e-76"
FT   misc_feature    complement(471576..471947)
FT                   /note="Pfam match to entry PF01118 Semialdhyde_dh,
FT                   Semialdehyde dehydrogenase, NAD binding domain, score
FT                   169.6, E-value 4.5e-48"
FT   CDS_pept        472145..474280
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0374"
FT                   /old_locus_tag="BF0385"
FT                   /product="putative Na+/H+ antiporter"
FT                   /note="Similar to Lactococcus lactis Na+/H+ antiporter
FT                   homolog Nah SWALL:Q48731 (EMBL:X73329) (379 aa) fasta
FT                   scores: E(): 3.5e-17, 24.54% id in 387 aa, and to
FT                   Bacteroides thetaiotaomicron Na+/H+ anti-porter BT3638
FT                   SWALL:AAO78743 (EMBL:AE016941) (711 aa) fasta scores: E():
FT                   0, 89.59% id in 711 aa, and to Chlorobium tepidum Na+/H+
FT                   antiporter, putative CT1144 SWALL:Q8KDB0 (EMBL:AE012875)
FT                   (784 aa) fasta scores: E(): 7.1e-95, 37.86% id in 721 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06153"
FT                   /db_xref="GOA:Q5LI74"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI74"
FT                   /protein_id="CAH06153.1"
FT                   /translation="MHWFDLSLQLPITDPTWVFFLVLIIILFAPMILGRLHIPHIIGMI
FT                   LAGVVIGEYGFNVLERDSSFELFGKVGLYYIMFLAGLEMDMEDFKKNRTKGLVFGWFTF
FT                   IIPMALGVWSSMELLGYGFTTAVLLASMYASHTLIAYPIISRYGLSRLRSVNITIGGTA
FT                   VTVTLALIILAVIGGMYKGTVDGMFWVLLVVKVAFLSFLIVFFFPRIGRWFFRKYDDSV
FT                   MQFVFVLAMVFLGSGLMEFVGMEGILGAFLAGLVLNRLIPHVSPLMNRLEFVGNALFIP
FT                   YFLIGVGMIIDVRTLFTGGEALKVAVVMTVFATLSKWLAAWITQKIYHMQPNERSMMFG
FT                   LSNAQAAATLAAVLIGHEIIMENGERLLNDDVLNGTVVMILFTCVISSLVTERSARRFA
FT                   LHEEMQFEDNKEKTEQEQILIPVANPDTIEDLINLALVIRDTKQKKELIALNVINDNNN
FT                   SENKELQGKRNLEKAAMIAASADVSVNMVSRYDLNIASGIIHTIKEYDATDVVIGLHRK
FT                   ANIVDSFFGNLAESLLKGTHREVIIAKFLMPVNTLRRIIIAVPPKAEYETGFSKWVEHF
FT                   CRMGSLLGCRVHFFANEQTLMRLQQLVKKKHGSTPTEFSRLDEWDDLLLLTGQVNFDHL
FT                   LVVISARRGSISYDPSFERLPNQLGKYFSNNSLIILYPDQFGEPQEIVSFSDPRGYNES
FT                   QHYDKVGKWFYKWLKKN"
FT   misc_feature    order(472187..472255,472430..472483,472511..472579,
FT                   472604..472672,472700..472768,472805..472858,
FT                   472868..472927,472961..473029,473057..473110,
FT                   473159..473227,473255..473314)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BF0385 by TMHMM2.0 at aa 15-37, 96-113, 123-145, 154-176,
FT                   186-208, 221-238, 242-261, 273-295, 305-322, 339-361 and
FT                   371-390"
FT   misc_feature    472190..473350
FT                   /note="Pfam match to entry PF00999 Na_H_Exchanger,
FT                   Sodium/hydrogen exchanger family, score 119.0, E-value
FT                   7.8e-33"
FT   CDS_pept        474280..474990
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0375"
FT                   /old_locus_tag="BF0386"
FT                   /product="putative ThiF family protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron ThiF family
FT                   protein, putative dinucleotide-utilizing enzyme involved in
FT                   molybdopterin and thiamine biosynthesis BT3639
FT                   SWALL:AAO78744 (EMBL:AE016941) (238 aa) fasta scores: E():
FT                   3.3e-78, 87.17% id in 234 aa, and to Fusobacterium
FT                   nucleatum molybdopterin biosynthesis MoeB protein FN0725
FT                   SWALL:Q8RFH3 (EMBL:AE010583) (234 aa) fasta scores: E():
FT                   6.3e-27, 40.61% id in 229 aa, and to Staphylococcus aureus
FT                   hypothetical protein sav1628 or sa1455 or mw1578
FT                   SWALL:Q99TM1 (EMBL:AP003363) (257 aa) fasta scores: E():
FT                   2.1e-25, 35% id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06154"
FT                   /db_xref="GOA:Q5LI73"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI73"
FT                   /protein_id="CAH06154.1"
FT                   /translation="MENWQQRTELLLGAEKMERLRKSHVLVVGLGGVGAYAAEMICRAG
FT                   VGRMTIVDADIVQPTNINRQLPATHATLGMEKAKVLEARFRDINPEIELTVLPVYLKDD
FT                   NIPELLDAARYDFIVDAIDTISPKCYLIYHALQRRIKIISSMGAGAKSDITQVRFADLW
FT                   DTYHCGLSKAVRKRLQKMGVKRKLPVVFSTEQADSKAVLLTDDERNKKSTCGTVSYMPA
FT                   VFGCYLAEYVIKRL"
FT   misc_feature    474340..474750
FT                   /note="Pfam match to entry PF00899 ThiF, ThiF family, score
FT                   149.9, E-value 3.8e-42"
FT   misc_feature    474352..474420
FT                   /note="1 probable transmembrane helix predicted for BF0386
FT                   by TMHMM2.0 at aa 25-47"
FT   CDS_pept        474995..475645
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0376"
FT                   /old_locus_tag="BF0387"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron lipoprotein
FT                   releasing system ATP-binding protein BT3640 SWALL:AAO78745
FT                   (EMBL:AE016941) (218 aa) fasta scores: E(): 8.9e-64, 88.37%
FT                   id in 215 aa, and to Methanosarcina mazei ABC transporter,
FT                   ATP-binding protein MM2833 SWALL:Q8PT84 (EMBL:AE013533)
FT                   (227 aa) fasta scores: E(): 3.2e-34, 48.62% id in 218 aa,
FT                   and to Chlorobium tepidum ABC transporter, ATP-binding
FT                   protein CT1474 SWALL:Q8KCE8 (EMBL:AE012904) (247 aa) fasta
FT                   scores: E(): 5.8e-34, 50.66% id in 225 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06155"
FT                   /db_xref="GOA:Q5LI72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI72"
FT                   /protein_id="CAH06155.1"
FT                   /translation="MIHLEGITKSFGSLQVLKGIDLEITQGEVVSIVGPSGAGKTTLLQ
FT                   IMGTLDSPDAGMINIDGTNVSRMKEKELSAFRNKHIGFVFQFHQLLPEFTALENVMIPA
FT                   FIAGVPTKEASMRAMEILDFMGLKERASHKPNELSGGEKQRVAVARALINQPAVILADE
FT                   PSGSLDSHNKEELHQLFFDLRNRFGQTFVIVTHDEALAKITDRTIHMVDGNII"
FT   misc_feature    475073..475633
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 206.1, E-value 4.5e-59"
FT   misc_feature    475094..475117
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    475406..475450
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(475646..476548)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0377"
FT                   /old_locus_tag="BF0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3641 SWALL:AAO78746 (EMBL:AE016941)
FT                   (309 aa) fasta scores: E(): 3.9e-53, 53.39% id in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06156"
FT                   /db_xref="GOA:Q5LI71"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI71"
FT                   /protein_id="CAH06156.1"
FT                   /translation="MWKDFFYFTRAERQGILILAVLCILVFVAGWLIPVKENTAKNDTE
FT                   KFKKEYAGFMSSIREKEQKIYSHNNRFQPPRTVRLTTFDPNITDSVGFLDLGLPAWMAK
FT                   NILKYRNKGGKFRRAEDFRKVYGLTQEQYEMLLPYIYIATLAKPKDTLRLYTRKIEEDT
FT                   LNFFKYAAGTVVELNSADTTELKKIPGIGSGIAQMITGYRNRLGGFYDIAQLKEIHLDV
FT                   EKLRPWFNVATSNTRRLNINRTGIERLKAHPYINFYQAKIIVEYRKKKGILKSLKQLSL
FT                   YEEFTPQDLERISHYICFE"
FT   misc_feature    complement(475943..476032)
FT                   /note="Pfam match to entry PF00633 HHH, Helix-hairpin-helix
FT                   motif, score 23.6, E-value 0.00039"
FT   misc_feature    complement(476444..476512)
FT                   /note="1 probable transmembrane helix predicted for BF0388
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(476551..477918)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0378"
FT                   /old_locus_tag="BF0389"
FT                   /product="putative sodium-dependent transporter"
FT                   /note="Similar to Staphylococcus epidermidis
FT                   sodium-dependent transporter se2326 SWALL:Q8CMR4
FT                   (EMBL:AE016752) (416 aa) fasta scores: E(): 2.8e-52, 38.22%
FT                   id in 429 aa, and to Bacteroides thetaiotaomicron
FT                   Na+-dependent transporter BT3642 SWALL:AAO78747
FT                   (EMBL:AE016941) (456 aa) fasta scores: E(): 5.6e-164,
FT                   89.45% id in 455 aa, and to Vibrio parahaemolyticus
FT                   putative sodium-dependent transporter vp1184 SWALL:BAC59447
FT                   (EMBL:AP005077) (476 aa) fasta scores: E(): 2.9e-76, 44.42%
FT                   id in 448 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06157"
FT                   /db_xref="GOA:Q5LI70"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI70"
FT                   /protein_id="CAH06157.1"
FT                   /translation="MTKKERGNFGSKLGVILASAGSAVGLGNIWRFPYETGNHGGAAFI
FT                   LIYLGCILLLGLPIMIAEFLIGRHSQANTARAYQILAPGTQWRWVGRMGVLAGFLILGY
FT                   YSVVAGWTLEYIFEAVSNSFAGKTPAEFISSFQSFSSNPWRPALWLTLFLLATHFIIVK
FT                   GVEKGIEKSSKIMMPTLFIIILILVGCSVTLPGAGKGIEFLLKPDFSKVDGNVFLGAMG
FT                   QAFFSLSLGMGCLCTYASYFSKNTNLTRTAFSVGIIDTFVAVLAGFIIFPAAFSVGIQP
FT                   DAGPSLIFITLPNVFQQAFSGIPILAYIFSVMFYVLLALAALTSTISLHEVVTAYLHEE
FT                   FNFTRGKAARLVTTGCILLGILCSLSLGVTKEFTIFGLGMFDLFDFVTAKLMLPLGGLL
FT                   ISIFTGWYLDKKLVWSEITNNGTLKVPTYKLIIFILKYVAPIAISVIFINELGLLK"
FT   misc_feature    complement(476554..477903)
FT                   /note="Pfam match to entry PF00209 SNF,
FT                   Sodium:neurotransmitter symporter family, score 19.1,
FT                   E-value 1.1e-21"
FT   misc_feature    complement(order(476572..476640,476698..476766,
FT                   476809..476877,476938..477006,477097..477165,
FT                   477202..477270,477328..477396,477433..477486,
FT                   477568..477636,477718..477786,477829..477882))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BF0389 by TMHMM2.0 at aa 13-30, 45-67, 95-117, 145-162,
FT                   175-197, 217-239, 252-274, 305-327, 348-370, 385-407 and
FT                   427-449"
FT   CDS_pept        478023..478415
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0379"
FT                   /old_locus_tag="BF0390"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3643 SWALL:AAO78748 (EMBL:AE016941)
FT                   (130 aa) fasta scores: E(): 5.7e-49, 79.23% id in 130 aa,
FT                   and to Neisseria meningitidis hypothetical protein NMB0794
FT                   SWALL:Q9K030 (EMBL:AE002433) (120 aa) fasta scores: E():
FT                   1e-05, 32.52% id in 123 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06158"
FT                   /db_xref="GOA:Q5LI69"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI69"
FT                   /protein_id="CAH06158.1"
FT                   /translation="MLSYIKKYPVSLFIILAVIYLSFFKPPSTEISKIPNIDKVVHICM
FT                   YFGMSGMLWLEFLRAHRRDHTPVWHAWVGAFICPVLFSGCVELLQEYCTTYRGGDWMDF
FT                   AANTTGAVLASLIGYFIVRPRILSKK"
FT   misc_feature    order(478041..478094,478137..478205,478224..478292,
FT                   478335..478388)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BF0390 by TMHMM2.0 at aa 7-24, 39-61, 68-90 and 105-122"
FT   CDS_pept        complement(478420..479718)
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BF9343_0380"
FT                   /old_locus_tag="BF0391"
FT                   /product="putative
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-d-alanine ligase"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-d-alanyl-d-alanyl ligase BT3644
FT                   SWALL:AAO78749 (EMBL:AE016941) (432 aa) fasta scores: E():
FT                   7.2e-140, 82.87% id in 432 aa, and to Cytophaga johnsonae
FT                   MurF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase UDP-MurNAc-pentapeptide synthetase)SWALL:Q8KRM7
FT                   (EMBL:AF527793) (428 aa) fasta scores: E(): 1.6e-63, 43.93%
FT                   id in 437 aa, and to Escherichia coli
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-d-alanine ligase
FT                   MurF or Mra or B0086 SWALL:MURF_ECOLI (SWALL:P11880) (452
FT                   aa) fasta scores: E(): 2.1e-39, 36.53% id in 438 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06159"
FT                   /db_xref="GOA:Q5LI68"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI68"
FT                   /protein_id="CAH06159.1"
FT                   /translation="MKLSALYKIFLDCAVVTTDSRNCPAGSLFIALKGESFNGNAFAAQ
FT                   ALKDGCAYAIVDEAEYAPENNRHIILVDNCLQTLQQLANYHRRQLGTKVIGITGTNGKT
FT                   TTKELISAVLSKSHNVLYTEGNLNNHIGVPMTLLRLKAEHELAVIEMGANHPGEIKFLV
FT                   HIAEPDYGMITNVGKAHLEGFGSFEGVIRTKGELYDYLREKEDSTVFIHHDNAYLMDIA
FT                   HGLNLIPYGSEDALYVNGHVTGNSPYLTFEWKAGKDGDLHKVQTQLIGEYNFPNALAAV
FT                   TIGRFFGVEAGKIDEALAGYTPRNNRSQLKKTADNTLIIDAYNANPTSMMAALQNFRNM
FT                   TVKKKMLILGDMRELGAESAAEHRKIVDFLQECSFEKVLLVGEQFTATHPPYHTYANAQ
FT                   EVIKELQTEKPKDYTILIKGSNGIKLSTVVEFL"
FT   misc_feature    complement(478537..478815)
FT                   /note="Pfam match to entry PF02875 Mur_ligase_C, Mur ligase
FT                   family, glutamate ligase domain, score 42.1, E-value
FT                   1.1e-09"
FT   misc_feature    complement(478831..479646)
FT                   /note="Pfam match to entry PF01225 Mur_ligase, Mur ligase
FT                   family, catalytic domain, score 143.3, E-value 3.7e-40"
FT   CDS_pept        complement(479761..480996)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0381"
FT                   /old_locus_tag="BF0392"
FT                   /product="putative transporter/antibiotic resistance
FT                   protein"
FT                   /note="Similar to Staphylococcus epidermidis quinolone
FT                   resistance protein se0466 SWALL:Q8CQ24 (EMBL:AE016745) (387
FT                   aa) fasta scores: E(): 1.3e-09, 23.39% id in 359 aa, and to
FT                   Bacteroides thetaiotaomicron putative sugar transporter
FT                   BT2568 SWALL:AAO77675 (EMBL:AE016936) (410 aa) fasta
FT                   scores: E(): 2e-110, 69.34% id in 411 aa, and to
FT                   Streptococcus mutans conserved hypothetical protein SMU.145
FT                   SWALL:Q8DWC0 (EMBL:AE014866) (394 aa) fasta scores: E():
FT                   2.5e-13, 24.61% id in 386 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06160"
FT                   /db_xref="GOA:Q5LI67"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI67"
FT                   /protein_id="CAH06160.1"
FT                   /translation="MRIQTGHGTIPLITLIGIWSISALNALPGLAVSPILGKLSAIFPH
FT                   STELDIQMLSSLPSLLIIPFILLAGKLTERVNFIRLLQAGLAIFALSGVLYLLSGQMWQ
FT                   LIAVSALLGVGSGLIVPLSTGLISKYFVGSYRVKQFGLSSAITNITLVVATAVTGYLAE
FT                   VNWHLPFVVYLLPIISLVLSVYLQRSMASEGSTSLTNDKAPADKEEDVDTGNSKYGIHV
FT                   RHLAGIMGVYGLATFLVLVVSFNLPFLMEEYHFTSGNSGIMISLFFLAIMTPGFFLNRI
FT                   VGTLKEKTKFYSFLSIGIGLALIWISPKEWVIAPGCILVGLGYGVIQPVVYNQTTHTAI
FT                   SRKVTLALAFVMAMNYLAILLCPFIIDFFQSTVFHIKSQQFAFVFNLCISIVMLVISYT
FT                   KRNSFLFNDNLK"
FT   misc_feature    complement(order(479803..479856,479899..479967,
FT                   480004..480063,480073..480126,480145..480213,
FT                   480256..480324,480439..480498,480511..480579,
FT                   480616..480684,480697..480765,480784..480852,
FT                   480895..480963))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BF0392 by TMHMM2.0 at aa 12-34, 49-71, 78-100, 105-127,
FT                   140-162, 167-186, 225-247, 262-284, 291-308, 312-331,
FT                   344-366 and 381-398"
FT   CDS_pept        481258..482700
FT                   /transl_table=11
FT                   /gene="gadB"
FT                   /locus_tag="BF9343_0382"
FT                   /old_locus_tag="BF0393"
FT                   /product="putative glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /note="Similar to Listeria monocytogenes glutamate
FT                   decarboxylase beta GadD or LMO2363 SWALL:DCEB_LISMO
FT                   (SWALL:Q9EYW9) (464 aa) fasta scores: E(): 2.1e-79, 46.52%
FT                   id in 432 aa, and to Bacteroides thetaiotaomicron glutamate
FT                   decarboxylase BT2570 SWALL:AAO77677 (EMBL:AE016936) (481
FT                   aa) fasta scores: E(): 1.1e-188, 94.72% id in 474 aa, and
FT                   to Synechocystis sp. glutamate decarboxylase Gad or sll1641
FT                   SWALL:P73043 (EMBL:D90903) (467 aa) fasta scores: E():
FT                   3e-86, 49.63% id in 415 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06161"
FT                   /db_xref="GOA:Q5LI66"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI66"
FT                   /protein_id="CAH06161.1"
FT                   /translation="MEDLNFRKGDAKTEAFGSNRMLQPSPVEKIPDGPTTPEIAYQMVK
FT                   DETFAQTQPRLNLATFVTTYMDDYATKLMNEAININYIDETEYPRIAVMNGKCINIVAN
FT                   LWNSPEKDTWKTGALAIGSSEACMLGGVAAWLRWRKKRQAQGKPFDKPNFVISTGFQVV
FT                   WEKFAQLWQIEMRQVPLTLDKTTLDPEEALKMCDENTICVVPIQGVTWTGLNDDVEALD
FT                   KALDAYNAKTGYDIPIHVDAASGGFILPFLYPDTKWDFRLKWVLSISVSGHKFGLVYPG
FT                   LGWVVWKGKEYLPEEMAFSVNYLGANITQVGLNFSRPAAQILGQYYQFIRLGFQGYKEV
FT                   QYNSLQIAKYIHSQIAKMTPFVNYSEDVVNPLFIWYMKPEYAKNAKWTLYDLQDKLAQH
FT                   GWMVPAYTLPAKLQDYVVMRVVVRQGFSRDMADMLLGDIKNAIAELEKLEYPTSTRIAQ
FT                   EKNLPVEAKVFNHTGKPQAAKK"
FT   misc_feature    481357..482391
FT                   /note="Pfam match to entry PF00282 pyridoxal_deC,
FT                   Pyridoxal-dependent decarboxylase conserved domain, score
FT                   224.2, E-value 1.7e-64"
FT   CDS_pept        482716..483681
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BF9343_0383"
FT                   /old_locus_tag="BF0394"
FT                   /product="putative glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="Similar to Rhizobium etli thermolabile glutaminase
FT                   GlsA SWALL:GLSA_RHIET (SWALL:O87405) (309 aa) fasta scores:
FT                   E(): 2.1e-27, 31.71% id in 309 aa, and to Bacteroides
FT                   thetaiotaomicron putative glutaminase BT2571 SWALL:AAO77678
FT                   (EMBL:AE016936) (321 aa) fasta scores: E(): 4.6e-105,
FT                   84.11% id in 321 aa, and to Shigella flexneri putative
FT                   glutaminase YbaS or SF0430 SWALL:AAN42085 (EMBL:AE015075)
FT                   (310 aa) fasta scores: E(): 1.5e-49, 44.51% id in 310 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06162"
FT                   /db_xref="GOA:Q5LI65"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI65"
FT                   /protein_id="CAH06162.1"
FT                   /translation="MDKKISISQIKEVVQQAYEQVKGNTGGKNADYIPYLANIDKNLFG
FT                   ISVCLLNGQTITVGDFDYRFGIESVSKVHTAILILRQYGAQKVLEMIGADATGLPFNSI
FT                   IAILLENDHPSTPLVNAGAISACSMVTPIGNSDKKWDAIVQNITDLCGSAPQLIEELYK
FT                   SETATNFNNRSIAWLLKNYNRIYDDPNMSLDLYTRQCSLGVTAQMLSVAAGTVANGGVN
FT                   PVTKKQVFDAELTPKITSMIATVGFYEHSGDWMYTSGIPAKTGVGGGVMGVLPGVFGVS
FT                   AFAPPLDGSGNSVKAQLAIKYIMNKLGLNVFNGARVTIVD"
FT   misc_feature    482794..483651
FT                   /note="Pfam match to entry PF04960 Glutaminase,
FT                   Glutaminase, score 344.8, E-value 8.3e-101"
FT   CDS_pept        complement(483767..485782)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0384"
FT                   /old_locus_tag="BF0395"
FT                   /product="putative two-component system sensor histidine
FT                   kinase"
FT                   /note="Similar to Bacteroides thetaiotaomicron
FT                   two-component system sensor histidine kinase BT3645
FT                   SWALL:AAO78750 (EMBL:AE016941) (671 aa) fasta scores: E():
FT                   2e-99, 43.24% id in 666 aa, and to Bacteroides
FT                   thetaiotaomicron two-component sensor histidine kinase
FT                   BT0654 SWALL:AAO75761 (EMBL:AE016928) (660 aa) fasta
FT                   scores: E(): 6.8e-36, 39.93% id in 308 aa, and to
FT                   Bacteroides thetaiotaomicron two-component system sensor
FT                   histidine kinase BT1802 SWALL:AAO76909 (EMBL:AE016933) (685
FT                   aa) fasta scores: E(): 1.9e-31, 27.23% id in 639 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06163"
FT                   /db_xref="GOA:Q5LI64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI64"
FT                   /protein_id="CAH06163.1"
FT                   /translation="MSSKPYRHFIALLLVLFCSRFEAQAEDLFAKTDSTLQQYLIRCKA
FT                   QIKDPDFLQTNDTLTRMAQEKNDKRMQVIAVALKLDYYYYQNNPDSILVMVDRVKKISR
FT                   RNNELKYFYFAWGSRLIIYYIKQHQTNTAIYEARKMLQSAEADNFIPGIVQCYRTLGTV
FT                   YMTQSNPKLAYENFRKQIALIEENEIEDINLPTQYASLAQCALEMHRPDEALKALEKGS
FT                   KCTRSSYQIFTVQKAYILYYLETKEYEKARKTLVELEQLFEKDKSLTLYKSGLFYIQIE
FT                   YYRNTGQYRKALDVIEEIKNDSSSINKYLDYTLTQKQGDIYWEMNQKARAAQYYRDYIL
FT                   ATDSIRSQEIQNSTNEFYTIMEVEQLHKEKNELLLHMQEEKLQKINIALVSLVIILVAG
FT                   TMLLFHISKLNKKLKRSEAKVIQQNKELVENGEELRKAKEQAENASRMKTTFIQSMSHE
FT                   IRTPLNSIVGFSQVLSNYFKEEDNDEIREFASIIEISSSNLLRLINDVLDISYLDQSEI
FT                   LPYDKPEDINNCCLLSIERTRNSIKKEVSLRFEPSCGPLMILTNPERVAQILTHLLHNA
FT                   IKFTDKGNITLAYTISPTEKQIVYTVTDTGKGIPVEQQEYVFERFAKLNDFSQGTGLGL
FT                   PICRIIAEKLGGSLIIDKTYTKGCRFILTLPLIKAD"
FT   misc_feature    complement(483779..484105)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 109.7,
FT                   E-value 4.7e-30"
FT   misc_feature    complement(484238..484444)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 76.4, E-value 5.1e-20"
FT   misc_feature    complement(484562..484630)
FT                   /note="1 probable transmembrane helix predicted for BF0395
FT                   by TMHMM2.0 at aa 385-407"
FT   misc_feature    complement(485708..485782)
FT                   /note="Signal peptide predicted for BF0395 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.939 between residues 25 and 26"
FT   CDS_pept        485894..486754
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /gene_synonym="dhpS"
FT                   /locus_tag="BF9343_0385"
FT                   /old_locus_tag="BF0396"
FT                   /product="putative dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Shigella flexneri dihydropteroate synthase FolP or DhpS
FT                   or B3177 or C3933 or SF3217 SWALL:DHPS_ECOLI (SWALL:P26282)
FT                   (282 aa) fasta scores: E(): 1e-37, 44.11% id in 272 aa, and
FT                   to Bacteroides thetaiotaomicron dihydropteroate synthase
FT                   BT3646 SWALL:AAO78751 (EMBL:AE016941) (287 aa) fasta
FT                   scores: E(): 5.8e-89, 83.27% id in 275 aa, and to Vibrio
FT                   cholerae dihydropteroate synthase vc0638 SWALL:Q9KU85
FT                   (EMBL:AE004149) (278 aa) fasta scores: E(): 1.2e-38, 41.69%
FT                   id in 271 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06164"
FT                   /db_xref="GOA:Q5LI63"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI63"
FT                   /protein_id="CAH06164.1"
FT                   /translation="MDSTIFKSLNVNGRLLDLSIPQVMGILNVTPDSFYAGSRSRTEAD
FT                   IAARARQILDEGASMIDIGAYSSRPNAEHISPEEEMRRLRTGLEILNRNHPGAIISVDT
FT                   FRAGVAEECVKEYGVAIINDISAGEMDEQMFPTVARLNVPYIMMHMQGTPQNMQKEPHY
FT                   ENLLKEVFIYFARKVQQLRDLGVKDIILDPGFGFGKTLEHNYELMAHLEEFGIFELPLL
FT                   VGVSRKSMIYRLFGTTPQEALNGTTVLDTVALMKGADILRVHDVREAVESVRLIEKLKS
FT                   VSACS"
FT   misc_feature    485969..486697
FT                   /note="Pfam match to entry PF00809 Pterin_bind, Pterin
FT                   binding enzyme, score 334.2, E-value 1.3e-97"
FT   CDS_pept        486789..487553
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0386"
FT                   /old_locus_tag="BF0397"
FT                   /product="putative transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3647 SWALL:Q8A1L4 (EMBL:AE016941)
FT                   (228 aa) fasta scores: E(): 3.4e-70, 84.64% id in 228 aa,
FT                   and to Clostridium perfringens hypothetical protein CPE2351
FT                   CPE2351 SWALL:Q8XHX5 (EMBL:AP003194) (285 aa) fasta scores:
FT                   E(): 7e-33, 43.19% id in 257 aa, and to Staphylococcus
FT                   aureus conserved hypothetoical protein sav2163 or sa1967 or
FT                   mw2090 SWALL:Q9RL70 (EMBL:Y09927) (269 aa) fasta scores:
FT                   E(): 5.5e-30, 43.9% id in 246 aa. Possible alternative
FT                   start site at codon 27"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06165"
FT                   /db_xref="GOA:Q5LI62"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI62"
FT                   /protein_id="CAH06165.1"
FT                   /translation="MFFEFGIKDFIDILLVAFLLYYTYKLMKASGSINVFTGILVFILI
FT                   WLVVSQVLEMKLLGSIFDKLVSVGVLALIVLFQDEIRRFLLTLGSHQHASALVRFLTGN
FT                   KKEKLQHDDIMPIVMACISMGKQKVGALIVMERNVPLDDVIRTGEIIDANINQRLIENI
FT                   FFKNSPLHDGAMVISKKRIKAAGCILPVSHNLDIPKELGLRHRAAMGISQVSDALAIIV
FT                   SEETGAISVAWRGQFYLRQSAEELESLLTKES"
FT   misc_feature    order(486816..486860,486879..486947)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0397 by TMHMM2.0 at aa 10-24 and 31-53"
FT   misc_feature    487137..487502
FT                   /note="Pfam match to entry PF02457 DUF147, Domain of
FT                   unknown function DUF147, score 190.1, E-value 3e-54"
FT   repeat_region   complement(487578..488064)
FT                   /note="hit to rep1 27..513 score: 2228 percent id: 95.28"
FT   CDS_pept        488177..488437
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0387"
FT                   /old_locus_tag="BF0400"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI61"
FT                   /protein_id="CAH06166.1"
FT                   /translation="MVIILFIKVCDMGEIKLISSLFVQGKRSLGNCVKSNESIVYLHVA
FT                   QLDNVRLLLIRFIDETGGRKIIFYLQSTLFLIFFAKENDEQ"
FT   CDS_pept        488434..489504
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0388"
FT                   /old_locus_tag="BF0401"
FT                   /product="putative transmembrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06167"
FT                   /db_xref="GOA:Q5LI60"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI60"
FT                   /protein_id="CAH06167.1"
FT                   /translation="MKFIYSILFALLWIGVTITFGSYLYRMGLPIVNASAQKLLLRTID
FT                   EDLECRFRKLKPNQAYVTGKKHTKNKKVTLTDKSGTHNVRQFAIDTVYTDTSFVHRVKQ
FT                   SYLIERNSINVDSLNQKWQLKLRMDGICANTGIKLTNSLKNGERISASSGLNEPDCFLL
FT                   AYSTGVGYGIKMDAFIRPFWATVVLKAHWNNIWTWNYVLFSLIFCLFYVPGVRLFLVQV
FT                   LSKFRIVDNHVKSSQPLAQQKGEFVWEVDGLTFDYLQRSITYHDQTCILRKQVAEVLLA
FT                   FLKAPGHLLLNEDLKKLFWKELDNVDSFMERRNRLITDLRTDLRKIGANLSVTLVNGGY
FT                   QLHFSLENSKKSVKNQ"
FT   misc_feature    order(488443..488511,489025..489093)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0401 by TMHMM2.0 at aa 4-26 and 198-220"
FT   CDS_pept        489570..489797
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0389"
FT                   /old_locus_tag="BF0402"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06168"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI59"
FT                   /protein_id="CAH06168.1"
FT                   /translation="MKNAKITIGLIGLLLIGLVSVRKEGKVQEAGLLLQNVEALATGEP
FT                   FPDGDIACIGDGSVDCPFTYLKVEVVYREE"
FT   CDS_pept        489797..490684
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0390"
FT                   /old_locus_tag="BF0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to C-terminus of Bacteroides
FT                   thetaiotaomicron hypothetical protein BT1085 SWALL:AAO76192
FT                   (EMBL:AE016930) (131 aa) fasta scores: E(): 1.1e-09, 35.48%
FT                   id in 124 aa, and the N-terminus is similar to the
FT                   C-terminus of Bacteroides thetaiotaomicron hypothetical
FT                   protein BT4048 SWALL:AAO79153 (EMBL:AE016943) (373 aa)
FT                   fasta scores: E(): 6.7e-08, 26.92% id in 130 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06169"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI58"
FT                   /protein_id="CAH06169.1"
FT                   /translation="MGRPIKIIGYLCFLMALCSCKETKEQQISRLIHEWEGRTIVYPAD
FT                   MTFSVLGKDSAGYSFPQNEYTIMTYVDSVGCTSCKLQLPTWKYFISMVDTMANGKVSFL
FT                   FAFHPKNKKEISFLLKRDRFLYPVFIDEKGGFDALNHFPSDVNFQTFLLDSQNKVIAIG
FT                   NPVHNKKVRDLYLQIITGRQTGVATSSQTKVVLDKNLDEMGDFDWKTPQTATFSLRNLG
FT                   DHLLIIEDINASCGCTSVAYSKEPVSPRKSADIQVTYRAEHPEHFEKTITVYCNTPTSP
FT                   IRLKIRGNAIDEEY"
FT   CDS_pept        490815..491081
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0391"
FT                   /old_locus_tag="BF0404"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06170"
FT                   /db_xref="GOA:Q5LI57"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI57"
FT                   /protein_id="CAH06170.1"
FT                   /translation="MKKKVKAMIAFIAVIAVSFIGYNVYKVQSTELLSDIAMANVEALA
FT                   NTGEGGSSTTYCCGNYGDCMKVMLPNGTTTVIKGIRLNSPCIN"
FT   misc_feature    490815..490877
FT                   /note="Signal peptide predicted for BF0404 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.971) with cleavage site
FT                   probability 0.445 between residues 21 and 22"
FT   CDS_pept        491253..492329
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0392"
FT                   /old_locus_tag="BF0405"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0659 SWALL:AAO75766 (EMBL:AE016928) (345 aa)
FT                   fasta scores: E(): 2.4e-10, 21.73% id in 345 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06171"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI56"
FT                   /protein_id="CAH06171.1"
FT                   /translation="MIKRPYLSFTLLLLLSMCILEGCEKEKSHTVLELFSESQSLSPKK
FT                   DFYVNEDSIAIIEGLSCDGKNLIVNDYHSGCCYTLFDKKSGEYIARFGTIGQGPAELPS
FT                   PCYGYLTESDFTVFDDQTRIVMKYSLDSLRNSRKKDGSPVRLAQYKIPEAQISKLIAID
FT                   DTTFLCAGTYKSRYQYLLFNKNDSVLDYGVDVYNAADSAFQTYTRYLSNQGNLVMNPEK
FT                   HTFAGSINFSSNIDFFEIVNNKIELIKSLRLGDPINKPVNEEGIYYVDLTENTQTGYID
FT                   LSATSKYVYALYSDKKMYENNRKSDTVLVFDWDGNPIKKYSLDTDAYYIAVDSTQQSLF
FT                   AAVKNSSSGWKIICYALD"
FT   misc_feature    491253..491318
FT                   /note="Signal peptide predicted for BF0405 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.932) with cleavage site
FT                   probability 0.896 between residues 22 and 23"
FT   CDS_pept        492490..493629
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0393"
FT                   /old_locus_tag="BF0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0664 SWALL:Q8AA01 (EMBL:AE016928) (382 aa) fasta
FT                   scores: E(): 2e-08, 24.18% id in 244 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT0661 SWALL:Q8AA04
FT                   (EMBL:AE016928) (408 aa) fasta scores: E(): 1.2e-05, 29.53%
FT                   id in 149 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06172"
FT                   /db_xref="GOA:Q5LI55"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI55"
FT                   /protein_id="CAH06172.1"
FT                   /translation="MVMAVFTGYNFYIMKNFSLIVVGILFIYCVSSCRKQVDKGFEMTV
FT                   DLSISNPYLPMSVLVDTIESVRLQLPSPYFWGMVDNVISKDSCYYISDRKQEMAFRFSK
FT                   NGTFLNAIGQRGEGPGEYREMDSFFVGKDCVYVCDMSKRTIYSYSFDGKFLHSLSFPYS
FT                   LVFNDVVELPDGRFLCHRPSQSENCKGLWILDQKGRRVKNLLEYEKGTPCKNSYWNTLC
FT                   AQEDGTIKIYNPVDGSYYQYDAVNDTVVRTMRQKSNLPMLADFHCSDRELYETKEECTY
FT                   SLFTVDGKNLVFSLWSFNSPNKGMWSVYFKKDGRIEQGNLTKMDIPGYSEMGRPVSSNI
FT                   PNTFVTVYTDEFPDDAFPSAYQQQEINEQTAILSLLRLK"
FT   misc_feature    492490..492549
FT                   /note="1 probable transmembrane helix predicted for BF0406
FT                   by TMHMM2.0 at aa 21-43"
FT   CDS_pept        join(493878..493988,493990..494154)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0394"
FT                   /old_locus_tag="BF0408"
FT                   /product="putative hypothetical protein (pseudogene)"
FT                   /note="Pseudogene. Similar to C-terminus of Bacteroides
FT                   thetaiotaomicron hypothetical protein BT1085 SWALL:Q8A8T2
FT                   (EMBL:AE016930) (131 aa) fasta scores: E(): 4.9e-09, 38.29%
FT                   id in 94 aa, and to a fragment of Bacteroides
FT                   thetaiotaomicron hypothetical protein BT4048 SWALL:Q8A0H3
FT                   (EMBL:AE016943) (373 aa) fasta scores: E(): 2.7e-08, 31.11%
FT                   id in 90 aa. Note: This CDS has a frameshift after residue
FT                   37"
FT   CDS_pept        494291..494599
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0395"
FT                   /old_locus_tag="BF0409"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06174"
FT                   /db_xref="InterPro:IPR025905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI54"
FT                   /protein_id="CAH06174.1"
FT                   /translation="MKTRMKITIAFVAVMVLSFTGYNVYKTQKAIQLSDVAMANVEALA
FT                   DGEGTNAGYCYLEDTWSTKRGYKYFCDSKTDKNTIYPCPSSMESGWYDDNKQDRCTK"
FT   misc_feature    494291..494359
FT                   /note="Signal peptide predicted for BF0409 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.959) with cleavage site
FT                   probability 0.407 between residues 23 and 24"
FT   CDS_pept        494781..495902
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0396"
FT                   /old_locus_tag="BF0411"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06175"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI53"
FT                   /protein_id="CAH06175.1"
FT                   /translation="MHIIKVIFSLALILNICVSCHENDDTAYFNGKIQTIEDSIKDTKK
FT                   ATLKILPLDGANFGWLSTYDSLMFFMNPKLPDRFYNIFNIDTGKEIGTFCYRGSGPGEV
FT                   AALGPIFHFFKEKGDLKTLLFAPNEEKLFIWNITQSIKRDTTVMDKQISYPWREENGGA
FT                   PYYLMFLKDENTLITELQSFPLNDKEATLPAYQKRTLDTNKLLKSFSSYKKSIRNDEAS
FT                   ILPESFFYSNDAIKPDGTKVVQAMVHLAQLNILDLETGHVSGYRLEGEPDFSVFKSDEK
FT                   IKSYFTRVQADDNYIYAVYWGKERWERFETPHMNIIHVYDWDGNLVQKIETDYSIGQMW
FT                   IDPIRNRLYVTNPQIDDVLYLDLDDFLVPNTGL"
FT   misc_feature    494781..494846
FT                   /note="Signal peptide predicted for BF0411 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.732) with cleavage site
FT                   probability 0.731 between residues 22 and 23"
FT   misc_feature    494829..494846
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        496011..497924
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0397"
FT                   /old_locus_tag="BF0412"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT0668 SWALL:AAO75775 (EMBL:AE016928) (649 aa)
FT                   fasta scores: E(): 1.1e-152, 57.05% id in 645 aa, and to
FT                   Bacteroides thetaiotaomicron hypothetical protein BT3420
FT                   SWALL:AAO78526 (EMBL:AE016940) (508 aa) fasta scores: E():
FT                   3.9e-24, 25.62% id in 523 aa, and to Bacteroides
FT                   thetaiotaomicron hypothetical protein BT3542 SWALL:AAO78648
FT                   (EMBL:AE016941) (400 aa) fasta scores: E(): 7.9e-17, 27.75%
FT                   id in 400 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06176"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI52"
FT                   /protein_id="CAH06176.1"
FT                   /translation="MKYVLFILLVLTLAACQSEKDRRLEYALEFAGDNRVELEKVLEHY
FT                   RTDPEKLEAARFLIRNMPGWYSYEGNELDSIHHLLVGVCEGRSISKREKNKWNRISFDS
FT                   LSKIYDAQVITAEYLIDNIDLAFEVWRKYPWNRNLPFDDFCELILPYRIADEPLSDWRK
FT                   LYYEDYGTLLDSLYKGDDVIEASKIIDGKLRKLYYIYNTDFRVPHLNAVFLYHNRIGYC
FT                   REACDLTIYAMRACGIPVATDYFVYSPDYQHYHCWTMLRDTTGTFLQFGFNEFEASRDT
FT                   LRHDGRKKGKVYRYCFGMQADKNSGTSGNRQLSPVLKNRFVKDVTSEYFGSNDTTIPIQ
FT                   MSGEQYIYLGIFSPGGWIPIDMALGSAGKVTFRDIEPDVIYQTLYQGDGGKLYPAGYPF
FT                   ISKTGGGFVLLKPNIDLMEEAILKRKMPQQKTIAEWAYRAIIGAKVEAADDLAFMQADL
FT                   LWQFEDTLTTNYCVLTPLLRKKYRYVRYVAPIGKRMELAELALFKDSLCKEKVRLGRIN
FT                   SIEPIAKLEYVTDGNILTYFQARDTSCYLAYDLGESTLIERIVFSPRNDDNYIWPGDNY
FT                   ELFYQDGINGWKSLGSKVATEREIDFLVPQNALLWLRNRTKGREEQVFIYKNGRQYFAF
FT                   DL"
FT   CDS_pept        498026..498319
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0398"
FT                   /old_locus_tag="BF0413"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06177"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI51"
FT                   /protein_id="CAH06177.1"
FT                   /translation="MLDFVYKGNAYSLFYSKTNDEVPVVDIKGCQLENKNSFGFWGAIG
FT                   VEGEALVNAVEASWVKAEVGRLNPVVVEKLGLNKWNSIQESDNPVLAFYRFK"
FT   CDS_pept        498507..499709
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0399"
FT                   /old_locus_tag="BF0414"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Limited similarity to Bacteroides thetaiotaomicron
FT                   hypothetical protein BT0661 SWALL:AAO75768 (EMBL:AE016928)
FT                   (408 aa) fasta scores: E(): 0.094, 21.46% id in 410 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06178"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI50"
FT                   /protein_id="CAH06178.1"
FT                   /translation="MNNFTKEVMDKVSIVLLLVLICGCSSMNQKMNDGIERIPIDVHNV
FT                   SRDASLFIDKIELVPLETNDSSLLHKYRKVMYDKETDVYAVYTREQVIFTFSGNGAFIS
FT                   NSKKMQGQGPDEYHMAIDVKFNPYLQGLDLLNPYGTIYTYSLDFKLLAKRKIKPEFPID
FT                   HLIAFNTEEYIFTYPSLWTDQEVAFANLRTQQIYNANYNGTISSGNSMDKECFYKIGDN
FT                   FYFIPPGINYYFYRIDTKEMKFTPMIYLDFGDSEIKEEGLPGRAAGKRTDLDEERLRVV
FT                   KEMQDRSQFLKHSNNHFVPLIKFFNEDYVYVYFVKSTQGFGSNFIYNRKTKESFLTNEG
FT                   KPFIMNCCFAIVDNILLSIHQPEYVSRLVDQRFMSSEEIRKMEQIKEDDNPVIIKYYLK
FT                   R"
FT   misc_feature    498507..498590
FT                   /note="Signal peptide predicted for BF0414 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.768) with cleavage site
FT                   probability 0.412 between residues 28 and 29"
FT   misc_feature    498546..498578
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(499757..500776)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0400"
FT                   /old_locus_tag="BF0415"
FT                   /product="possible acetyltransferase"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   acetyltransferase BT3688 SWALL:AAO78793 (EMBL:AE016941)
FT                   (339 aa) fasta scores: E(): 6.4e-78, 55.42% id in 341 aa,
FT                   and to Fusobacterium nucleatum acetyltransferase FN1041
FT                   SWALL:Q8R651 (EMBL:AE010611) (391 aa) fasta scores: E():
FT                   1.8e-09, 24.36% id in 316 aa, and to Bacillus halodurans
FT                   hypothetical protein BH1812 SWALL:Q9KBW2 (EMBL:AP001513)
FT                   (386 aa) fasta scores: E(): 2.9e-05, 24.92% id in 317 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06179"
FT                   /db_xref="GOA:Q5LI49"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI49"
FT                   /protein_id="CAH06179.1"
FT                   /translation="MIKEQVKSLWKLCFDDSEAFIELYFRLRYNNEVNLAIQSGEEVIA
FT                   ALQMLPYPMTFCNKIVPTSYISGACTHPDYRAKGVMRELLSQSFARMLRNGVLFSTLIP
FT                   AEPWLFGYYAKTGYTPAFRISHKVFSLSELTIGPEPDTMIEETTEYQEDYYQYLTGKLS
FT                   ERACCLQHTPTDFKVVLADLALTQNTVLIARKDNRVTGIAVVYKHDDSSYINELFADNE
FT                   AVRAQLLYRAGLRNGTERIILQLPPVESLPSVPLGMARIIDARAVLQLYAAGCPEVEMN
FT                   IELTDEQLSVNNGYYYLCKGKCMTSEVRLPGVHTRMTIAELSEKILGEMQPYMSLMMN"
FT   CDS_pept        complement(500786..501703)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0401"
FT                   /old_locus_tag="BF0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3689 SWALL:AAO78794 (EMBL:AE016941)
FT                   (305 aa) fasta scores: E(): 4.8e-106, 81.63% id in 305 aa,
FT                   and to Clostridium tetani conserved protein CTC00813
FT                   SWALL:AAO35411 (EMBL:AE015938) (303 aa) fasta scores: E():
FT                   2.8e-33, 35.43% id in 302 aa, and to Helicobacter pylori
FT                   J99 putative jhp0277 SWALL:Q9ZME3 (EMBL:AE001465) (290 aa)
FT                   fasta scores: E(): 3.8e-30, 34.7% id in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06180"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI48"
FT                   /protein_id="CAH06180.1"
FT                   /translation="MIAFRDITIQDKDTITAYTMNSCRRNCDLSFSNLCSWRFLYHTKF
FT                   AIINNFLVFKFWAGDELAYMMPVGEGNLEEVLNELIEDARQEGEPFCMLGVCSCMREDL
FT                   EAIMPGQFGFTVDRDYADYIYLRSDLATLKGKKFQSKRNHINKFRNTYPDYEYSPITKD
FT                   RIQECLELEAKWCKANDCDQQEGTGNERRALIYALNHFEELGLTGGILHVNGQIVAFTF
FT                   GMPINKETFGVHVEKADTSIDGAYAMINYEFANHIPEQYIYINREEDLGIEGLRKAKLS
FT                   YHPETILEKYMACLKEQPVEMIKW"
FT   CDS_pept        complement(501759..502454)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0402"
FT                   /old_locus_tag="BF0417"
FT                   /product="putative LrgB family transmembrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   membrane protein BT3690 SWALL:AAO78795 (EMBL:AE016941) (231
FT                   aa) fasta scores: E(): 3.9e-73, 90.47% id in 231 aa, and to
FT                   Neisseria meningitidis hypothetical inner membrane protein
FT                   NMA0436 SWALL:Q9JWD1 (EMBL:AL162753) (230 aa) fasta scores:
FT                   E(): 4.4e-34, 44.78% id in 230 aa, and to Neisseria
FT                   meningitidis hypothetical protein NMB2004 NMB2004
FT                   SWALL:Q9JXJ9 (EMBL:AE002550) (230 aa) fasta scores: E():
FT                   5.1e-34, 44.78% id in 230 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06181"
FT                   /db_xref="GOA:Q5LI47"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI47"
FT                   /protein_id="CAH06181.1"
FT                   /translation="MNYLENEFFLLAITFGIYFFAKLLQKKTGILLLNPILLTIAVIII
FT                   FLKLTNISFETYNQGGHLIEFWLKPAVVALGVPLYLQLETIKKQLLPIILSQLAGCIVG
FT                   VISVVLIAKLMGASQEVILSLAPKSVTTPIAMEVTKTLGGIPSLTAAVVVCVGLLGAVL
FT                   GFKTMKIMHVGSPIAQGLSMGTAAHAVGTSTAMDISSKYGAYASLGLTLNGIFTALLTP
FT                   TILRLLGIL"
FT   misc_feature    complement(501768..502454)
FT                   /note="Pfam match to entry PF04172 LrgB, LrgB-like family,
FT                   score 330.7, E-value 1.5e-96"
FT   misc_feature    complement(order(501780..501848,501960..502028,
FT                   502119..502187,502206..502274,502317..502373,
FT                   502392..502445))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BF0417 by TMHMM2.0 at aa 4-21, 28-46, 61-83, 90-112,
FT                   143-165 and 203-225"
FT   CDS_pept        complement(502451..502789)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0403"
FT                   /old_locus_tag="BF0418"
FT                   /product="putative transmembrane holin-like protein LrgA"
FT                   /note="Similar to Staphylococcus aureus holin-like protein
FT                   LrgA or sav0262 or sa0252 SWALL:Q99WW2 (EMBL:AP003358) (145
FT                   aa) fasta scores: E(): 1.1e-06, 30.55% id in 108 aa, and to
FT                   Bacteroides thetaiotaomicron conserved hypothetical
FT                   protein, putative membrane protein BT3691 SWALL:AAO78796
FT                   (EMBL:AE016941) (147 aa) fasta scores: E(): 3.7e-40, 89.28%
FT                   id in 112 aa, and to Neisseria meningitidis hypothetical
FT                   inner membrane protein NMA0437 SWALL:Q9JWD0 (EMBL:AL162753)
FT                   (114 aa) fasta scores: E(): 1e-17, 46.84% id in 111 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06182"
FT                   /db_xref="GOA:Q5LI46"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI46"
FT                   /protein_id="CAH06182.1"
FT                   /translation="MIRQCAILFGCLALGELIVYLTGIKLPSSIIGMLLLTLFLKLGWI
FT                   KLHWVQGMSDFLVANLGFFFIPPGVALMLYFDIIAAQFWPIVIATLVSTLLVLVITGWV
FT                   HQLTRKLK"
FT   misc_feature    complement(502460..502789)
FT                   /note="Pfam match to entry PF03788 LrgA, LrgA family, score
FT                   165.2, E-value 9.4e-47"
FT   misc_feature    complement(order(502475..502543,502553..502621,
FT                   502640..502708,502718..502777))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BF0418 by TMHMM2.0 at aa 5-24, 28-50, 57-79 and 83-105"
FT   CDS_pept        502998..503681
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0404"
FT                   /old_locus_tag="BF0420"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06183"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI45"
FT                   /protein_id="CAH06183.1"
FT                   /translation="MKKSLLISVFATLAMMISLNALAQEKATGKAYKAIQKDEKVINKD
FT                   LQKKAIKEARKQAKELTKEGFKTPVGKLPLDKQLENSWEKQMEIDMNGNPYWYIATSRV
FT                   IGGNQSAAAMQATNTAKIDIAGQVQTKVTQLIESKVANDDMGQEEAASLSSAVAAGKSI
FT                   ISGTLGRTIPLVEVYRTLPNKNVEVMVTIGYSLEAANKVAVKALSEELAKKSPELAKEL
FT                   DKLAQ"
FT   misc_feature    502998..503066
FT                   /note="Signal peptide predicted for BF0420 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 23 and 24"
FT   misc_feature    503007..503066
FT                   /note="1 probable transmembrane helix predicted for BF0420
FT                   by TMHMM2.0 at aa 4-23"
FT   CDS_pept        503707..504504
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0405"
FT                   /old_locus_tag="BF0421"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI44"
FT                   /protein_id="CAH06184.1"
FT                   /translation="MNVNRLLGILAILLLTAANALYAQKPVKVKGVQGRWQVSDDITLK
FT                   QAEERAFMEAKKAALQKAGVMENVWSVFGQITQEDGQELHEAYSQMNVLAIGGMVNVTN
FT                   KKVEEVWDTDTRSLYKVVTIDAEVRKEDKSDSSYALEVKGVETLYREGDVFHCKLTIHG
FT                   TDSYLKFFWFDSNGGALLYPNSYEPNTLLKAGKEYAIPFSNAVDYRMEKQHGKESEKIN
FT                   MMMVATKEDIPFTKEVTYQNVLEWVYSIPAVQRCAFYDMVLIK"
FT   misc_feature    503707..503775
FT                   /note="Signal peptide predicted for BF0421 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.938 between residues 23 and 24"
FT   CDS_pept        504546..506102
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0406"
FT                   /old_locus_tag="BF0422"
FT                   /product="hypothetical exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI43"
FT                   /protein_id="CAH06185.1"
FT                   /translation="MMKTKHYFSFVFASLFLIPSVITAQDVNYQKEFDTFQEKQQKEYK
FT                   EFKNKADEEFATFLKEAWQKYNASMEDSMPTRPEPVKPTLFDKKKPVPAPVEIKPAVPK
FT                   IPIADKPGVGGEVNVEVKKQDLPVVADKPAPGVYVPGKPYTPVKVDIPAPLPGSSAHRN
FT                   AIEFYGTRFEVATDVIDGFELGGTSESKVAGAWSRLCKADHEQLINDCIRLKKEHQMND
FT                   WAFLMFIKQLGVQVCGVAKKDDVAFLQMFILNKCGYKVRLSKINDKLKLLVAPAGTIFG
FT                   IPYITFKGVKYYVFEADKDGSMAVYTYSQDFANAKNLVCMDLSAVPQFGMQEFSKTVSP
FT                   SEKSLLKVNTAVNKNLMDFYKDYPQCEVAVYYKTPMSKELKSALYPPLQAAIKGKSEKD
FT                   AANILIDFVQNSFQYQTDGEQFGYEKPFFMDENFYYPACDCEDRAILFSNLVKDLLGLD
FT                   AVLLDYPNHIASAVRFNEDISGDYILLDGKKYLICDPTYIGAPIGMCMDRFKSVPPEII
FT                   R"
FT   misc_feature    504546..504617
FT                   /note="Signal peptide predicted for BF0422 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.971 between residues 24 and 25"
FT   misc_feature    504564..504632
FT                   /note="1 probable transmembrane helix predicted for BF0422
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        506236..507255
FT                   /transl_table=11
FT                   /gene="ptaA"
FT                   /gene_synonym="pta"
FT                   /locus_tag="BF9343_0407"
FT                   /old_locus_tag="BF0423"
FT                   /product="putative phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="Similar to Clostridium thermosaccharolyticum
FT                   phosphate acetyltransferase Pta or PtaA SWALL:PTA_CLOTS
FT                   (SWALL:Q59330) (328 aa) fasta scores: E(): 3.3e-58, 52.55%
FT                   id in 333 aa, and to Bacteroides thetaiotaomicron phosphate
FT                   acetyltransferase BT3692 SWALL:AAO78797 (EMBL:AE016941)
FT                   (339 aa) fasta scores: E(): 1.5e-107, 88.49% id in 339 aa,
FT                   and to Thermoanaerobacter tengcongensis
FT                   phosphotransacetylase Pta or TTE1482 SWALL:Q8R9V3
FT                   (EMBL:AE013105) (331 aa) fasta scores: E(): 1.9e-66, 57.65%
FT                   id in 333 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06186"
FT                   /db_xref="GOA:Q5LI42"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI42"
FT                   /protein_id="CAH06186.1"
FT                   /translation="MLNLINSIVARAQANRQRIVLPEGTEERTLKAANQILTDEVADLI
FT                   LLGNPEEINAAAAKWGLGNINRATIIDPENHPKKEEYAQLLCELRKKKGMTIEEARKLV
FT                   LDPLYLGCLIIKSGDADGQLAGARNTTGDVLRPALQIIKTSPGITCVSGAMLLLTHAPE
FT                   CGQNGLLVMGDVAVTPVPDASQLAQIAVCTARTAQAVAGIAEPKVAMLSFSTKGSAKHE
FT                   NVDKVVEALKLAKEMAPDLNIDGEMQADAALVPSVGASKAPGSPVAGEANVLIVPSLEV
FT                   GNISYKLVQRLGHADAVGPILQGIARPVNDLSRGCSIEDVYRMIAITANQAIAAKNGK"
FT   misc_feature    506242..507222
FT                   /note="Pfam match to entry PF01515 PTA_PTB, Phosphate
FT                   acetyl/butaryl transferase, score 521.9, E-value 3.9e-154"
FT   CDS_pept        507274..508470
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BF9343_0408"
FT                   /old_locus_tag="BF0424"
FT                   /product="putative acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="Similar to Thermotoga maritima acetate kinase AckA
FT                   or TM0274 SWALL:ACKA_THEMA (SWALL:Q9WYB1) (403 aa) fasta
FT                   scores: E(): 5.1e-89, 59.85% id in 401 aa, and to
FT                   Bacteroides thetaiotaomicron acetate kinase BT3693
FT                   SWALL:AAO78798 (EMBL:AE016941) (399 aa) fasta scores: E():
FT                   5.5e-130, 83.96% id in 399 aa, and to Clostridium
FT                   thermosaccharolyticum acetate kinase AckA SWALL:ACKA_CLOTS
FT                   (SWALL:Q59331) (400 aa) fasta scores: E(): 3.2e-88, 58.29%
FT                   id in 398 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06187"
FT                   /db_xref="GOA:Q5LI41"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI41"
FT                   /protein_id="CAH06187.1"
FT                   /translation="MKVLVLNCGSSSIKYKLFDMDSKEVIAQGGIEKIGLKDSFLKLTL
FT                   PNGEKKILEKDIPEHTVGVEFILNTLVSPEYGAIQSLEEINAVGHRMVHGGERFSKSVL
FT                   LTKEVLEAFAACNDLAPLHNPANLKGVDAITAILPNVPQIGVFDTAFHQTMPEHAYLYA
FT                   IPYELYKKYGVRRYGFHGTSHRYVSQRVCEYLGIKPEGLKLITCHIGNGGSIAAIKDGK
FT                   CIDTSMGLTPLEGLMMGTRSGDIDAGAVTFIMDKEGLTTTGISNLLNKKSGVAGMMNGS
FT                   SDMRDLEAAVAKGDPQAILTEQMYFYRIKKYIGAYAAALGGVDVILFTGGVGENQATCR
FT                   AGVCEGLEFLGVKLDPEKNKVRGEEAIISTDDSRVKVVVIPTDEELLIASDTMAILDK"
FT   misc_feature    507277..508443
FT                   /note="Pfam match to entry PF00871 Acetate_kinase,
FT                   Acetokinase family, score 716.4, E-value 1.1e-212"
FT   misc_feature    507280..507315
FT                   /note="PS01075 Acetate and butyrate kinases family
FT                   signature 1."
FT   misc_feature    507883..507936
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT   CDS_pept        508693..510093
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0409"
FT                   /old_locus_tag="BF0425"
FT                   /product="putative alkaline phosphatase"
FT                   /note="Similar to Bacillus subtilis alkaline phosphatase IV
FT                   precursor PhoA or PhoAIV SWALL:PPB4_BACSU (SWALL:P19406)
FT                   (461 aa) fasta scores: E(): 6.4e-29, 33.76% id in 459 aa,
FT                   and to Bacteroides thetaiotaomicron alkaline phosphatase
FT                   III precursor BT3708 SWALL:AAO78813 (EMBL:AE016941) (467
FT                   aa) fasta scores: E(): 2.4e-144, 81.15% id in 467 aa, and
FT                   to Bacillus subtilis alkaline phosphatase III precursor
FT                   PhoB or PhoAIII SWALL:PPB3_BACSU (SWALL:P19405) (462 aa)
FT                   fasta scores: E(): 3.9e-28, 33.99% id in 456 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06188"
FT                   /db_xref="GOA:Q5LI40"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI40"
FT                   /protein_id="CAH06188.1"
FT                   /translation="MKRLFYFFLFVCVAVIANAQAKYVFYFIGDGMGVNQVNGTEMYRA
FT                   EIQKGRIGVEPLLFTQFPVGTMATTFSATNSVTDSSAAGTALSTGEKTYNGSIGMDDQK
FT                   NPLQTVAEKAKKAGKRVGVTTSVSVDHATPAAFYAHQPDRNMYYEIATDLPKAGFDFYA
FT                   GAGFLKPTTTYDKKEAPSIFPMFEEAGYTIARGYNDYKAKAAAAGKMILIQEEGADTGS
FT                   LPYAIDSKEGDLTLAQITESAIDFLTKGKNKGFFLMVEGGKIDWACHGNDAATVFHEVA
FT                   DMDNAIKVAYEFYKKHPKETLIVVTADHETGGIALGTGKYALNLKALENQKASAEVLSK
FT                   KISDLRKAKNNHVAWEDIKNLLSEEMGFWSVLPITWAQEKKLRDEYEKSFVRNKVEFAE
FT                   SMYAKTEPMAAKAKEVMDQIAMVGWTSGGHSAGYVPVFAIGAGSDLFIGKMDNTEIPKR
FT                   IAKAGGYK"
FT   misc_feature    508693..508749
FT                   /note="Signal peptide predicted for BF0425 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.650 between residues 19 and 20"
FT   misc_feature    508711..508779
FT                   /note="1 probable transmembrane helix predicted for BF0425
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    508735..509730
FT                   /note="Pfam match to entry PF00245 alk_phosphatase,
FT                   Alkaline phosphatase, score 108.2, E-value 1.4e-29"
FT   misc_feature    508921..508947
FT                   /note="PS00123 Alkaline phosphatase active site."
FT   CDS_pept        510152..510487
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0410"
FT                   /old_locus_tag="BF0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3696 SWALL:AAO78801 (EMBL:AE016941)
FT                   (103 aa) fasta scores: E(): 3.7e-32, 86.4% id in 103 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc1859
FT                   SWALL:Q9A767 (EMBL:AE005860) (118 aa) fasta scores: E():
FT                   5.4e-16, 51.02% id in 98 aa, and to Methanosarcina
FT                   acetivorans hypothetical protein Ma2398 SWALL:Q8TN95
FT                   (EMBL:AE010931) (98 aa) fasta scores: E(): 3.2e-15, 52.22%
FT                   id in 90 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06189"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI39"
FT                   /protein_id="CAH06189.1"
FT                   /translation="MNFQRNTDMTKFEIEEKIVDMLKTVFDPEIPVNVYDLGLIYKIDV
FT                   SEDGEVSIDMTLTAPNCPAADFIMEDVRQKVESIDGVNSATINLVFEPEWDKDMMSEEA
FT                   KLELGFL"
FT   misc_feature    510191..510418
FT                   /note="Pfam match to entry PF01883 DUF59, Domain of unknown
FT                   function DUF59, score 114.2, E-value 2.2e-31"
FT   CDS_pept        510533..511297
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0411"
FT                   /old_locus_tag="BF0427"
FT                   /product="putative UDP-2,3-diacylglucosamine hydrolase"
FT                   /note="Similar to Escherichia coli
FT                   UDP-2,3-diacylglucosamine hydrolase LpxH or B0524
FT                   SWALL:LPXH_ECOLI (SWALL:P43341) (240 aa) fasta scores: E():
FT                   3.1e-09, 26.75% id in 228 aa, and to Bacteroides
FT                   thetaiotaomicron UDP-2,3-diacylglucosamine hydrolase BT3697
FT                   SWALL:AAO78802 (EMBL:AE016941) (254 aa) fasta scores: E():
FT                   1.3e-101, 92.52% id in 254 aa, and to Chlorobium tepidum
FT                   hypothetical protein CT1989 SWALL:Q8KB09 (EMBL:AE012949)
FT                   (243 aa) fasta scores: E(): 6.1e-24, 34.81% id in 247 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06190"
FT                   /db_xref="GOA:Q5LI38"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI38"
FT                   /protein_id="CAH06190.1"
FT                   /translation="MKNVYFLSDAHLGSRAIEHGRTQERRLVNFLDSIKHKAAAVYLLG
FT                   DMFDFWYEFRLVVPKGYTRFLGKLSELTDMGVEVHFFTGNHDIWCGDYLTKECGVTIHR
FT                   EPVTTEIYGKEFYLAHGDGLGDPDKKFKLLRTMFHSRTLQTLFSAIHPRWSIDLGLNWA
FT                   KHSRLKREGGKEPDYMGENKEFLVLYTKEYLKSHPNINFFIYGHRHIELDLMLSATARI
FT                   LILGDWINFFSYAVFDGENLFLENYIEGETQL"
FT   misc_feature    510536..511165
FT                   /note="Pfam match to entry PF00149 Metallophos,
FT                   Calcineurin-like phosphoesterase, score 30.5, E-value
FT                   3.4e-06"
FT   CDS_pept        complement(511327..512019)
FT                   /transl_table=11
FT                   /gene="radC1"
FT                   /locus_tag="BF9343_0412"
FT                   /old_locus_tag="BF0428"
FT                   /product="putative DNA repair protein"
FT                   /note="Similar to Bacillus subtilis DNA repair protein RadC
FT                   homolog SWALL:RADC_BACSU (SWALL:Q02170) (231 aa) fasta
FT                   scores: E(): 4.3e-21, 33.77% id in 225 aa, and to
FT                   Bacteroides thetaiotaomicron putative DNA repair protein
FT                   BT3695 SWALL:AAO78800 (EMBL:AE016941) (231 aa) fasta
FT                   scores: E(): 7.2e-68, 72.48% id in 229 aa, and to
FT                   Methanosarcina acetivorans DNA repair protein RadC homolog
FT                   or MA1979 SWALL:RADC_METAC (SWALL:Q8TPD4) (229 aa) fasta
FT                   scores: E(): 5.2e-25, 32.17% id in 230 aa. Note: Also
FT                   similar to BF1221 (151 aa) fasta scores: E(): 7.1e-17,
FT                   41.221% identity in 131 aa overlap and to BF1780 (148 aa)
FT                   fasta scores: E(): 2.3e-14, 35.556% identity in 135 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06191"
FT                   /db_xref="GOA:Q5LI37"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI37"
FT                   /protein_id="CAH06191.1"
FT                   /translation="MNKQKLNIKQWSKADRPREKMMTKGSEALSDAELLGILIGSGNTE
FT                   ESAVELMRRILATCDNNLNELGKWEVRNFSSFKGMGPAKSLTIMAALELGKRRKLQESK
FT                   EREQIRCSEDIYKLFHPLMCDLPQEEFWILLLNQACKVINKLRISTGGIDGTYADVRTI
FT                   LREALIGRATQIALIHNHPSGHAKPSQEDKRLTGAIQKASQTMNITLVDHVIVCDGCFY
FT                   SFADEGLI"
FT   misc_feature    complement(511330..511704)
FT                   /note="Pfam match to entry PF04002 RadC, RadC, DNA repair
FT                   protein, score 115.4, E-value 9.2e-32"
FT   misc_feature    complement(511468..511485)
FT                   /note="PS01302 DNA repair protein radC family signature."
FT   CDS_pept        complement(512062..513090)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0413"
FT                   /old_locus_tag="BF0429"
FT                   /product="putative glycosyltransferase"
FT                   /note="Similar to Streptococcus pneumoniae glycosyl
FT                   transferase Cap33fj or Cap37J SWALL:O86893 (EMBL:AJ006986)
FT                   (323 aa) fasta scores: E(): 3.8e-10, 30.05% id in 183 aa,
FT                   and to Bacteroides thetaiotaomicron glycosyltransferase
FT                   BT3694 SWALL:AAO78799 (EMBL:AE016941) (404 aa) fasta
FT                   scores: E(): 6.3e-93, 74.72% id in 368 aa, and to
FT                   Methanosarcina mazei dolichyl-phosphate mannose synthase
FT                   related protein MM1139 SWALL:Q8PXS7 (EMBL:AE013343) (339
FT                   aa) fasta scores: E(): 2.3e-17, 26.64% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06192"
FT                   /db_xref="GOA:Q5LI36"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI36"
FT                   /protein_id="CAH06192.1"
FT                   /translation="MPILNMKINYTYMMRYSVIIPVYNRPDEVDELLQSLTAQHFKDFE
FT                   VVVVEDGSSVPCEKIVNQYQGKLDIHYYNKPNSGPGQTRNYGAERSNGEYLIILDSDCI
FT                   LPEGYLDAVEKELQTAPADAFGGPDRAHSSFTDIQKAINYSMTSFFTTGGIRGGKKKMD
FT                   KFYPRSFNMGVRREVYQALGGFSNMRFGEDIDFSIRIFKGGYQCRLFPDAWVYHKRRTD
FT                   FKKFFKQVHNSGIARINLYKKYPESLKVVHLLPAVFTLGVALLLLCTPFCLFSLVPILL
FT                   YALLVCLDSALQNKSLRIGIYSIAASFIQLIGYGTGFWRAWWERCILGRNEFEAFRKNF
FT                   YK"
FT   misc_feature    complement(order(512122..512190,512233..512301))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BF0429 by TMHMM2.0 at aa 264-286 and 301-323"
FT   misc_feature    complement(512542..513042)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 120.4, E-value 2.9e-33"
FT   CDS_pept        complement(513514..514080)
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="BF9343_0414"
FT                   /old_locus_tag="BF0431"
FT                   /product="putative elongation factor P"
FT                   /note="Similar to previously sequenced Bacteroides fragilis
FT                   elongation factor P Efp SWALL:EFP_BACFR (SWALL:P70889) (185
FT                   aa) fasta scores: E(): 8.5e-68, 98.4% id in 188 aa, and to
FT                   Bacteroides thetaiotaomicron elongation factor P Efp or
FT                   BT3709 SWALL:AAO78814 (EMBL:AE016941) (188 aa) fasta
FT                   scores: E(): 9.3e-70, 97.87% id in 188 aa, and to
FT                   Mycobacterium tuberculosis elongation factor P Efp or
FT                   Rv2534c or MT2609 or MTCY159.22 SWALL:EFP_MYCTU
FT                   (SWALL:P95019) (187 aa) fasta scores: E(): 9.6e-32, 46.03%
FT                   id in 189 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06193"
FT                   /db_xref="GOA:Q5LI35"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI35"
FT                   /protein_id="CAH06193.1"
FT                   /translation="MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVV
FT                   SGYVLERRFNIGEKLEDVRVERRPYQYLYKEGEDYIFMNQETFDQHPIAHDLINGVDFL
FT                   LEGAVVEVVSDASTETVLYADMPIKVQMKVTYTEPGLKGDTATNTLKPATVESGATVRV
FT                   PLFISEGETIEIDTRDGSYVGRVKA"
FT   misc_feature    complement(513523..514080)
FT                   /note="Pfam match to entry PF01132 EFP, Elongation factor P
FT                   (EF-P), score 404.0, E-value 1.2e-118"
FT   misc_feature    complement(513571..513630)
FT                   /note="PS01275 Elongation factor P signature."
FT   CDS_pept        514274..514435
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0415"
FT                   /old_locus_tag="BF0432"
FT                   /product="50S ribosomal protein L34"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   Escherichia coli O157:H7, Salmonella typhimurium,
FT                   Salmonella typhi, and Shigella flexneri 50S ribosomal
FT                   protein L34 SWALL:RL34_ECOLI (SWALL:P02437) (46 aa) fasta
FT                   scores: E(): 2.1e-10, 75.55% id in 45 aa, and to
FT                   Bacteroides thetaiotaomicron 50S ribosomal protein L34
FT                   BT3710 SWALL:AAO78815 (EMBL:AE016941) (53 aa) fasta scores:
FT                   E(): 3.2e-19, 96.15% id in 52 aa, and to Chlorobium tepidum
FT                   50S ribosomal protein L34 RpmH or CT0003 SWALL:RL34_CHLTE
FT                   (SWALL:Q8KGG5) (53 aa) fasta scores: E(): 8.3e-14, 73.07%
FT                   id in 52 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06194"
FT                   /db_xref="GOA:Q5LI34"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI34"
FT                   /protein_id="CAH06194.1"
FT                   /translation="MKRTFQPSNRKRKNKHGFRERMATANGRRVLAARRAKGRKKLTVS
FT                   DEYNGVKA"
FT   misc_feature    514274..514405
FT                   /note="Pfam match to entry PF00468 Ribosomal_L34, Ribosomal
FT                   protein L34, score 74.6, E-value 1.7e-19"
FT   misc_feature    514277..514336
FT                   /note="PS00784 Ribosomal protein L34 signature."
FT   CDS_pept        514647..515288
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0416"
FT                   /old_locus_tag="BF0433"
FT                   /product="putative transmembrane PASTA-domain protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3711 SWALL:AAO78816 (EMBL:AE016941)
FT                   (216 aa) fasta scores: E(): 1e-54, 68.51% id in 216 aa, and
FT                   to Thermoanaerobacter tengcongensis probable
FT                   serine/threonine-protein kinase Sps1 or TTE1500
FT                   SWALL:PKN1_THETN (SWALL:Q8R9T6) (625 aa) fasta scores: E():
FT                   2.9e-06, 28.12% id in 192 aa, and to Corynebacterium
FT                   glutamicum probable serine/threonine protein kinase Cgl0041
FT                   SWALL:PKN1_CORGL (SWALL:Q8NU98) (646 aa) fasta scores: E():
FT                   2.5e-05, 29.81% id in 161 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06195"
FT                   /db_xref="GOA:Q5LI33"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI33"
FT                   /protein_id="CAH06195.1"
FT                   /translation="MTIKEFFSFKANRFFWINIIAMVVVAVLIVVGTLKGLDIYTRHGE
FT                   AVIVPDVKGMSVSEAEKMFRNHGLTCVVSDSSYVKNKPSGIILDLNPSVGQKVKEGRTI
FT                   YLTINTLSTPLSVVPDVADNSSVRQAQAKLIAAGFKLTENRMVSGEKDWVYGVIYQGRQ
FT                   LQIGDKAPIGATLTLMVGDGVQSTATDSVDMVENAAMSVEDSGTDDDSWF"
FT   misc_feature    514680..514748
FT                   /note="1 probable transmembrane helix predicted for BF0433
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    514773..514976
FT                   /note="Pfam match to entry PF03793 PASTA, PASTA domain,
FT                   score 43.8, E-value 3.3e-10"
FT   CDS_pept        515318..516391
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /gene_synonym="sfhB"
FT                   /locus_tag="BF9343_0417"
FT                   /old_locus_tag="BF0434"
FT                   /product="ribosomal large subunit pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="Similar to Escherichia coli ribosomal large subunit
FT                   pseudouridine synthase D RluD or SfhB or B2594
FT                   SWALL:RLUD_ECOLI (SWALL:P33643) (326 aa) fasta scores: E():
FT                   1.9e-34, 40.97% id in 327 aa, and to Bacteroides
FT                   thetaiotaomicron ribosomal large subunit pseudouridine
FT                   synthase D BT3712 SWALL:AAO78817 (EMBL:AE016941) (357 aa)
FT                   fasta scores: E(): 3.9e-134, 93.52% id in 355 aa, and to
FT                   Chlorobium vibrioforme hypothetical 36.7 kDa protein in
FT                   BchI 5'region SWALL:YBC5_CHLVI (SWALL:O50310) (327 aa)
FT                   fasta scores: E(): 2.4e-53, 47.66% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06196"
FT                   /db_xref="GOA:Q5LI32"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI32"
FT                   /protein_id="CAH06196.1"
FT                   /translation="MIEELPDDIEQDELDDIEPVGDENQLYEHFRVVVDKGQAMVRVDK
FT                   YLFERIVNASRNRIQKAAEDGFVMANGKPVKSSYKVKPLDVITVMMDRPRYDNEIIPED
FT                   IPLHIVYEDKYLMVVNKPAGLVVHPGHGNYHGTLVNAIAWHLKDNPDYDANDPHVGLVH
FT                   RIDKDTSGLLVIAKTPDAKTNLGVQFFNKTTKRRYRALVWGIVDQDEGTIVGSIARNPK
FT                   DRMQMAVMADPTQGKHAVTHYRVLERLGYVTLVECILETGRTHQIRVHMKHIGHVLFND
FT                   ERYGGHEILKGTHFSKYKQFVNNCFDTCPRQALHAMTLGFVHPVTGEEMHFTSELPDDM
FT                   TRLIEKWRGYISNRDLE"
FT   misc_feature    515438..515578
FT                   /note="Pfam match to entry PF01479 S4, S4 domain, score
FT                   35.0, E-value 1.5e-07"
FT   misc_feature    515660..516136
FT                   /note="Pfam match to entry PF00849 PseudoU_synth_2, RNA
FT                   pseudouridylate synthase, score 231.6, E-value 9.7e-67"
FT   misc_feature    515801..515845
FT                   /note="PS01129 Rlu family of pseudouridine synthase
FT                   signature."
FT   CDS_pept        516388..517362
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BF9343_0418"
FT                   /old_locus_tag="BF0435"
FT                   /product="putative D-Alanine-D-Alanine-Ligase"
FT                   /note="Similar to Enterococcus faecalis VanE SWALL:Q93A46
FT                   (EMBL:AF430807) (352 aa) fasta scores: E(): 3.3e-28, 31.85%
FT                   id in 339 aa, and to Bacteroides thetaiotaomicron
FT                   D-Alanine--D-Alanine ligase BT3713 SWALL:AAO78818
FT                   (EMBL:AE016941) (324 aa) fasta scores: E(): 8.6e-113,
FT                   88.58% id in 324 aa, and to Neurospora crassa hypothetical
FT                   protein B19a17.060 SWALL:CAD70534 (EMBL:BX284763) (346 aa)
FT                   fasta scores: E(): 5.6e-42, 42.51% id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06197"
FT                   /db_xref="GOA:Q5LI31"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI31"
FT                   /protein_id="CAH06197.1"
FT                   /translation="MKRNIAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGR
FT                   RWEVQLQDGSKTPVDRNDFSFMNGAEKVVFDFAYITIHGTPGEDGRLQGYFDMIRIPYS
FT                   CCGVLAAAITYDKFVCNQYLKAFGVRISESLLLRQGQAVSDEDVVEKIGLPCFIKPNLG
FT                   GSSFGVTKVKTREQIQPAIAKAFSEAEEVMIEAFMGGTELTCGCYKTKEKSVVFPLTEV
FT                   VTHNEFFDYDAKYNGQVDEITPARISEELTRRVQTLTSAIYDILGCSGIIRVDYIITEG
FT                   EKINLLEVNTTPGMTATSFIPQQVRAAGLDIKDVMTDIIENKF"
FT   misc_feature    516388..517350
FT                   /note="Pfam match to entry PF01820 Dala_Dala_ligas, D-ala
FT                   D-ala ligase, score 255.3, E-value 7e-74"
FT   misc_feature    516634..516669
FT                   /note="PS00843 D-alanine--D-alanine ligase signature 1."
FT   CDS_pept        517503..518651
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0419"
FT                   /old_locus_tag="BF0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3714 SWALL:AAO78819 (EMBL:AE016941)
FT                   (382 aa) fasta scores: E(): 3.9e-126, 80.89% id in 382 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein Pa4636
FT                   SWALL:Q9HVF5 (EMBL:AE004878) (386 aa) fasta scores: E():
FT                   8.4e-32, 32.66% id in 398 aa, and to Pseudomonas putida
FT                   conserved hypothetical protein PP0756 SWALL:AAN66381
FT                   (EMBL:AE016776) (423 aa) fasta scores: E(): 9.4e-31, 32.91%
FT                   id in 395 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06198"
FT                   /db_xref="GOA:Q5LI30"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI30"
FT                   /protein_id="CAH06198.1"
FT                   /translation="MNTTEFDEIRPYNDEELSGVFEELIADPAFQKVVAGVIPDVPFEM
FT                   LAQKMRACRTKLEFQKTFCYGLLWKLAGDCTDGISLDHTAIPDKSKAYTYISNHRDIIL
FT                   DSGFLSVLLVDQGMDTVEIAIGDNLLIYPWIKKFVRVNKSFIVQRALTMRQMLESSARM
FT                   SRYMHYTIGEKNQSIWIAQREGRAKDSNDRTQDSVLKMLAMGGEGDVVSRLMEMNIAPL
FT                   AISYEYDPCDYLKAQEFQLKRDIEGYKKTMADDLKNMQTGLFGYKGRVHFQTGACLNDL
FT                   LSTVDRSLPKPELFARISTWIDQRIHSNYRLYPGNYVAHDLLTGKNDFESHYTLAEKER
FT                   FEAYVEKQLEKIEIPNKDISFLREKLLLMYANPLTNYLAARQ"
FT   CDS_pept        518648..519343
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0420"
FT                   /old_locus_tag="BF0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3715 SWALL:AAO78820 (EMBL:AE016941) (237 aa)
FT                   fasta scores: E(): 3.5e-30, 45.02% id in 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06199"
FT                   /db_xref="InterPro:IPR024299"
FT                   /db_xref="InterPro:IPR035376"
FT                   /db_xref="InterPro:IPR038143"
FT                   /db_xref="InterPro:IPR038179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI29"
FT                   /protein_id="CAH06199.1"
FT                   /translation="MRIWTLHIVLSVLFSVFLFSCNEDDGAPYPSVRLEFLTAESGADG
FT                   RLQTLVTDKGERLVVAEDRTESELLPNSSSRVVSNYEVLSSVGGRKEIRIYALANTVSP
FT                   VPLPAGEFRNGLKFDPVDMLSIWMGRDYLNMTLSIRAQNARHTFHFIQESVERDAVTGK
FT                   LKVHLMLYHDDGGDVEAYAKRAYVSVPLRQYTSDIGESVIIYFSFHTYDGEVQTYQFEY
FT                   VPSHLTINY"
FT   CDS_pept        519348..519743
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0421"
FT                   /old_locus_tag="BF0438"
FT                   /product="conserved hypothetical rhodanese-domain protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT3716 SWALL:AAO78821 (EMBL:AE016941)
FT                   (130 aa) fasta scores: E(): 9.1e-34, 74.61% id in 130 aa,
FT                   and to Oceanobacillus iheyensis hypothetical conserved
FT                   protein ob1901 SWALL:Q8EQ22 (EMBL:AP004599) (124 aa) fasta
FT                   scores: E(): 2.9e-07, 34.71% id in 121 aa, and to
FT                   Shewanella oneidensis GlpE protein or so4672 SWALL:Q8E8J2
FT                   (EMBL:AE015899) (101 aa) fasta scores: E(): 3.3e-07, 37.62%
FT                   id in 101 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06200"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI28"
FT                   /protein_id="CAH06200.1"
FT                   /translation="MSKMNSMLMGICFLLSSLFSCQQSKGNFKTVPVKEFASLIEDASV
FT                   QRLDVRTMAEYSEGHIPGTININVLDDSFAVMADSTLQKDKPVALYCRSGKRSKKAAAI
FT                   LSEKGYKVYELDKGFNAWQEAGEKVEK"
FT   misc_feature    519441..519722
FT                   /note="Pfam match to entry PF00581 Rhodanese,
FT                   Rhodanese-like domain, score 59.0, E-value 8.5e-15"
FT   CDS_pept        complement(519842..520798)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0422"
FT                   /old_locus_tag="BF0439"
FT                   /product="putative ornithine carbamoyltransferase"
FT                   /note="Similar to Pseudomonas aeruginosa ornithine
FT                   carbamoyltransferase, anabolic ArgF or pa3537
FT                   SWALL:OTCA_PSEAE (SWALL:P11724) (304 aa) fasta scores: E():
FT                   1.9e-09, 25.46% id in 326 aa, and to Bacteroides
FT                   thetaiotaomicron ornithine carbamoyltransferase BT3717
FT                   SWALL:Q8A1E9 (EMBL:AE016941) (318 aa) fasta scores: E():
FT                   3.8e-121, 93.37% id in 317 aa, and to Bacteroides forsythus
FT                   transcarbamylase SWALL:AAO33834 (EMBL:AY184490) (177 aa)
FT                   fasta scores: E(): 6.9e-48, 76.1% id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06201"
FT                   /db_xref="GOA:Q5LI27"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="PDB:2FG6"
FT                   /db_xref="PDB:2FG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI27"
FT                   /protein_id="CAH06201.1"
FT                   /translation="MKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFN
FT                   SSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYC
FT                   DIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKK
FT                   TARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYD
FT                   QMKAFEGADFIYAKNWAAYTGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNM
FT                   IVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP"
FT   misc_feature    complement(519857..520243)
FT                   /note="Pfam match to entry PF00185 OTCace,
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain, score -40.0, E-value 0.00015"
FT   misc_feature    complement(520313..520795)
FT                   /note="Pfam match to entry PF02729 OTCace_N,
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain, score 6.0, E-value 7.2e-09"
FT   CDS_pept        complement(520852..521580)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0423"
FT                   /old_locus_tag="BF0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT1832 SWALL:AAO76939 (EMBL:AE016933)
FT                   (215 aa) fasta scores: E(): 5.3e-52, 71.84% id in 206 aa,
FT                   and to Vibrio parahaemolyticus hypothetical protein vpa1091
FT                   SWALL:BAC62434 (EMBL:AP005087) (213 aa) fasta scores: E():
FT                   5.4e-35, 50% id in 216 aa, and to Chlorobium tepidum
FT                   hypothetical protein CT1863 CT1863 SWALL:Q8KBC6
FT                   (EMBL:AE012937) (208 aa) fasta scores: E(): 1.1e-30, 48.69%
FT                   id in 191 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06202"
FT                   /db_xref="InterPro:IPR032676"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI26"
FT                   /protein_id="CAH06202.1"
FT                   /translation="MQKVFLFLLLFLLPLAEVPNHAPASEPVSVASTPETDEIDQLFDD
FT                   MQLDGIVSYTAFRQAVTGYQKIEQKSKSIMTLIDFSKPSTEKRLYVLDMKNKKLLYTSV
FT                   VSHGKNSGGNYATSFSNKNGSYKSSLGFYLTENTYQGRNGYSLVLNGLEKGINDQAKQR
FT                   AIVMHGAAYANPNITASAGRLGRSLGCPALPQALAKPIIDTIKKGSVLFIYANNKDYLA
FT                   NSTFLSPRQTEYLSWAQPAN"
FT   misc_feature    complement(521533..521580)
FT                   /note="Signal peptide predicted for BF0440 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.970) with cleavage site
FT                   probability 0.536 between residues 16 and 17"
FT   CDS_pept        complement(521619..522641)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0424"
FT                   /old_locus_tag="BF0441"
FT                   /product="conserved hypothetical exported protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron conserved
FT                   hypothetical protein BT1831 SWALL:AAO76938 (EMBL:AE016933)
FT                   (348 aa) fasta scores: E(): 6.9e-94, 71.21% id in 330 aa,
FT                   and to Fusobacterium nucleatum hypothetical protein Fn0336
FT                   FN0336 SWALL:Q8RGG2 (EMBL:AE010545) (240 aa) fasta scores:
FT                   E(): 2.3e-09, 31.25% id in 176 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06203"
FT                   /db_xref="GOA:Q5LI25"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI25"
FT                   /protein_id="CAH06203.1"
FT                   /translation="MKQTAYIYLLTLSCLLCACNRENRTNLPQPQVTGVADSLETVPPE
FT                   EKPKAISAEQIEIKKDLLYDKYTLEDTYPYKDTTRSFQWDKIKERLALLENIQQTPSQW
FT                   GILQNYKNRNGEAPLVRHYKRNAYKRIADTLGIERYQSVPLYLLTDTLVPERYGEDGSL
FT                   VRFLADGENFVKVSPIYIGEEWYVPKRYVKVLPDTTHFIKTIMIDRRDQNIMTLEQTGE
FT                   AQWTVRSMNPATTGRHRPPYAQETPLGIFVLQEKKTRMIFLKDGSTATGGFAPYASRFS
FT                   DGGYIHGVPVNEPRKALIEYSPSLGTTPRSHMCVRNATSHSKFIFDWAPVNETIIFVLE
FT                   "
FT   CDS_pept        complement(523129..524376)
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BF9343_0425"
FT                   /old_locus_tag="BF0443"
FT                   /product="putative gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="Similar to Streptococcus pneumoniae gamma-glutamyl
FT                   phosphate reductase ProA or sp0932 SWALL:PROA_STRPN
FT                   (SWALL:Q97R94) (420 aa) fasta scores: E(): 1.2e-63, 45.08%
FT                   id in 417 aa, and to Bacteroides thetaiotaomicron
FT                   gamma-glutamyl phosphate reductase BT3718 SWALL:AAO78823
FT                   (EMBL:AE016941) (417 aa) fasta scores: E(): 2.3e-135,
FT                   83.29% id in 413 aa, and to Chlorobium tepidum
FT                   gamma-glutamyl phosphate reductase ProA or CT1473
FT                   SWALL:Q8KCE9 (EMBL:AE012904) (420 aa) fasta scores: E():
FT                   4.4e-94, 61.33% id in 406 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06204"
FT                   /db_xref="GOA:Q5LI24"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LI24"
FT                   /protein_id="CAH06204.1"
FT                   /translation="MNLNDTFAAVQAAGRHLALLPDDRINQILNAVAEAALEQTSYILS
FT                   ENRKDLERMSPDNPKYDRLRLTEERLRGIASDIRNVATLPSPLGRILKESIRPNGMRLT
FT                   KISVPFGVIGIIYEARPNVSFDVFSLCLKSGNACILKGGSDADYSNRAIVEVIHQVLRQ
FT                   FNIDTHMVELLPADREATRELLHATGYVDLIIPRGSSALINFVRQNATIPVIETGAGIC
FT                   HTYFDEYGDTAKGAAIIHNAKTRRVSVCNALDCVIVHESRLSDLPLLCEKLKADKVIIY
FT                   ADPSAYQALEGHYPAGLLKPATPESFGTEFLDYKMAIKTVNSFENALGHIQEYSSRHSE
FT                   SIVTENPERAALFTRMVDAACVYTNVSTAFTDGAQFGLGAEIGISTQKLHARGPMGLEE
FT                   ITSYKWIIEGDGQTRQ"
FT   misc_feature    complement(523351..523416)
FT                   /note="PS01223 Gamma-glutamyl phosphate reductase
FT                   signature."
FT   CDS_pept        complement(524389..525471)
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BF9343_0426"
FT                   /old_locus_tag="BF0444"
FT                   /product="putative glutamate kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="Similar to Bacillus subtilis glutamate 5-kinase 2
FT                   ProJ SWALL:PROJ_BACSU (SWALL:O07509) (371 aa) fasta scores:
FT                   E(): 1.6e-35, 33.43% id in 338 aa, and to Bacteroides
FT                   thetaiotaomicron glutamate 5-kinase BT3719 SWALL:Q8A1E7
FT                   (EMBL:AE016941) (360 aa) fasta scores: E(): 1.5e-113,
FT                   85.27% id in 360 aa, and to Chlorobium tepidum glutamate
FT                   5-kinase ProB or CT1457 SWALL:PROB_CHLTE (SWALL:Q8KCG4)
FT                   (361 aa) fasta scores: E(): 6.7e-58, 49.44% id in 358 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06205"
FT                   /db_xref="GOA:Q5LI23"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI23"
FT                   /protein_id="CAH06205.1"
FT                   /translation="MKKEFTRIAIKVGSNVLTRQDGTLDVTRMSALTDQIAALHKAGVE
FT                   VILISSGAVASGRSEIRTLRKLDSVDQRQLFSAVGQAKLINRYYELFRDHGIAVGQVLT
FT                   TKENFGTRRHYLNQKNCMTVMLENGVIPIVNENDTISVTELMFTDNDELSGLIASMMNA
FT                   QALIILSNIDGIYNGSPSDPDSLVIREIGQGKDLSNYIQTSKSSFGRGGMLTKTNIARK
FT                   VADEGITVIIANGKRDNILINLIEHPEETVCTRFIPASQPVSSIKKWIAHSEGFAKGEI
FT                   HINEQATEVLNSDKAVSILPVGITRIEGEFEKDDIVRIIDYRGTPVGVGKVNCDSMQAR
FT                   DSIGKHGKKAVVHYDYLYIE"
FT   misc_feature    complement(524404..524637)
FT                   /note="Pfam match to entry PF01472 PUA, PUA domain, score
FT                   28.3, E-value 1.5e-05"
FT   misc_feature    complement(524770..525456)
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 150.2, E-value 3.1e-42"
FT   CDS_pept        complement(525585..525821)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0427"
FT                   /old_locus_tag="BF0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron hypothetical
FT                   protein BT3721 SWALL:AAO78826 (EMBL:AE016941) (77 aa) fasta
FT                   scores: E(): 5e-12, 53.24% id in 77 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06206"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI22"
FT                   /protein_id="CAH06206.1"
FT                   /translation="MKEDKDTRVVEVFTGSPWEAEFIKGLLESNGIESILKDGGGLAAL
FT                   APYYIGQEIAVLVNEDDYENAMEIVRNREKANE"
FT   CDS_pept        complement(525898..526740)
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /gene_synonym="glr"
FT                   /locus_tag="BF9343_0428"
FT                   /old_locus_tag="BF0446"
FT                   /product="putative glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="Similar to Bacillus subtilis var. natto glutamate
FT                   racemase MurI or Glr SWALL:MURI_BACNA (SWALL:O82826) (271
FT                   aa) fasta scores: E(): 1.6e-28, 36.99% id in 273 aa, and to
FT                   Bacteroides thetaiotaomicron glutamate racemase BT3722
FT                   SWALL:AAO78827 (EMBL:AE016941) (280 aa) fasta scores: E():
FT                   1.1e-96, 81.07% id in 280 aa, and to Bacillus subtilis
FT                   glutamate Racemase 1 RacE SWALL:MUI1_BACSU (SWALL:P94556)
FT                   (272 aa) fasta scores: E(): 1.4e-28, 36.99% id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BF9343_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAH06207"
FT                   /db_xref="GOA:Q5LI21"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LI21"
FT                   /protein_id="CAH06207.1"
FT                   /translation="MKQSLPYQPGPIGVFDSGYGGLTILSKIREALPEYDYIYLGDNAR
FT                   TPYGTRSFEIVYEFTLQAVNKLFEMGCHLVILACNTASAKALRTIQMNDLPNIDPDRRV
FT                   LGVIRPTAECIGSMTQTRHVGILATAGTIKSESYPLEVHKLFEDIKVSGEACPMWVPLV
FT                   ENNEANGEGADFFIRKYIDNLLAKDRQIDTLVLGCTHYPILLPKIQKFIPQGVKVVAQG
FT                   EYVATSLKDYLHRHPEMDMKCTREGKCRFYTTEAEDKFIESASMFLNENITVQRITLE"
FT   misc_feature    complement(526039..526710)
FT                   /note="Pfam match to entry PF01177 Asp_Glu_race,
FT                   Asp/Glu/Hydantoin racemase, score 211.9, E-value 8.5e-61"
FT   misc_feature    complement(526129..526161)
FT                   /note="PS00924 Aspartate and glutamate racemases signature
FT                   2."
FT   misc_feature    complement(526489..526515)
FT                   /note="PS00923 Aspartate and glutamate racemases signature
FT                   1."
FT   CDS_pept        complement(526843..527352)
FT                   /transl_table=11
FT                   /locus_tag="BF9343_0429"
FT                   /old_locus_tag="BF0447"
FT                   /product="putative outer membrane protein"
FT                   /note="Similar to Bacteroides thetaiotaomicron putative
FT                   outer membrane protein OmpH BT3723 SWALL:Q8A1E3
FT                   (EMBL:AE016941) (157 aa) fasta scores: E(): 3.6e-36, 80.89%
FT                   id in 157 aa, and limited similarity to Chlorobium tepidum
FT                   outer membrane protein OmpH or CT0254 SWALL:Q8KFR8
FT                   (EMBL:AE012804) (183 aa) fasta scores: E(): 0.0046, 28.65%
FT                   id in 171 aa. Possible alternative start site at codon 15"
FT                   /db_xref="Ensem