(data stored in ACNUC31183 zone)

EMBL: CR627427

ID   CR627427; SV 1; linear; mRNA; HTC; HUM; 6610 BP.
XX
AC   CR627427;
XX
DT   03-AUG-2004 (Rel. 80, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA; cDNA DKFZp686O238 (from clone DKFZp686O238)
XX
KW   HTC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6610
RG   The German cDNA Consortium
RA   Poustka A., Albert R., Moosmayer P., Schupp I., Wellenreuther R.,
RA   Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S.;
RT   ;
RL   Submitted (22-SEP-2004) to the INSDC.
RL   MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY
XX
DR   MD5; 187862ef833fe7207e44d94eb82716c1.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
CC   Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research
CC   Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
CC   sequenced by DKFZ (German Cancer Research Center, Heidelberg/Germany)
CC   within the cDNA sequencing consortium of the German Genome Project.
CC   This clone (DKFZp686O238) is available at the RZPD Deutsches
CC   Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
CC   Please contact RZPD for ordering:
CC   http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp686O238
CC   Further information about the clone and the sequencing project is
CC   available at http://mips.gsf.de/projects/cdna/
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6610
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="686 (synonym: hlcc3). Vector pSport1_Sfi; host
FT                   DH10B; sites SfiIA + SfiIB"
FT                   /clone="DKFZp686O238"
FT                   /tissue_type="cervix"
FT                   /note="GTPase-activating protein GARNL4, differentially
FT                   spliced"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        60..2207
FT                   /codon_start=1
FT                   /gene="DKFZp686O238"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000306195.12"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAH10514.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPEN
FT                   VGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGN
FT                   LILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFN
FT                   PVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGD
FT                   TITLQDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHI
FT                   GNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGP
FT                   PLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQ
FT                   AMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGIS
FT                   HNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTP
FT                   KTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGE
FT                   GEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNS
FT                   PRSNLKFRFDKLSHASPGAGH"
XX
SQ   Sequence 6610 BP; 1424 A; 1853 C; 1839 G; 1494 T; 0 other;
     gacagccccg gggacgtcgt tgggacatcg ctgggacccc gggctctgca gccacaacca        60
     tgtttggccg gaagcgcagt gtctcctttg ggggcttcgg atggatcgac aagaccatgc       120
     tggcaagtct gaaggtcaag aagcaggagc tggccaacag ctcggatgcg accctcccag       180
     accggccgct ctcccctcct ctcacggcac ctcccaccat gaagtcgtcg gagttctttg       240
     agatgctgga gaaaatgcag gacgactata tcccataccc cagcatcgac gaggttgtgg       300
     agaagggagg cccgtaccct caggtcatcc tgccacagtt tgggggctat tggatcgagg       360
     acccggagaa cgtgggcacc ccaacatcgc tggggagcag catctgtgag gaggaggaag       420
     aggacaacct cagccccaac acatttggct acaagctcga gtgcaagggt gaagccaggg       480
     cctaccggag gcacttcctg gggaaggatc atctaaactt ttactgtacc ggcagcagcc       540
     tggggaactt gatcctgtcc gtcaagtgcg aggaagcaga ggggatcgag tacctccggg       600
     tcatcctcag gtccaaactg aagacggtac atgagcggat ccccttggct ggactgagca       660
     agcttcccag tgtccctcag attgcaaagg ctttctgtga tgatgcagtg ggactgagat       720
     tcaatcctgt cctgtacccc aaggcctccc aaatgattgt gtcctatgat gagcatgaag       780
     tcaacaacac attcaaattc ggagtcattt atcaaaaagc caggcagacc ctggaggagg       840
     agctatttgg gaacaatgag gagagcccag cttttaagga gttcttggac ctgctggggg       900
     acacgatcac actgcaggat ttcaaaggtt tccgaggagg cctggacgtg acccacggac       960
     agacaggggt ggaatcagtg tacacaacat tccgggacag ggagatcatg tttcacgttt      1020
     ccacaaagct gccatttacc gacggagacg cccagcagct ccagagaaag agacacattg      1080
     gaaatgacat cgtggccatc atcttccaag aggaaaacac gccgtttgtc ccagacatga      1140
     tagcctccaa tttcttacat gcctacatcg tcgtgcaggt cgagacccca ggcacagaga      1200
     ccccatccta caaggtctct gtcactgcgc gggaagatgt gcccaccttt ggtccacctc      1260
     tgcccagtcc ccccgttttc cagaagggcc cggaattcag ggagtttctg ctcaccaagc      1320
     tcaccaatgc cgagaacgcc tgctgcaagt cggacaagtt tgcaaagctg gaggaccgga      1380
     ccagggctgc cctcctggac aaccttcacg atgagctcca cgcccacaca caggccatgc      1440
     tgggactggg cccagaggag gacaagtttg agaatggagg ccacgggggg ttcctggagt      1500
     cttttaagag ggccatccgc gtacgcagcc actccatgga gaccatggtg ggcggccaga      1560
     agaagtcgca cagtgggggc atccctggca gcctcagcgg gggcatctcc cacaacagca      1620
     tggaggtcac caagaccacc ttctcgcctc cagtggtggc ggcaacggtg aagaaccagt      1680
     cacggagtcc catcaagcga cgctcggggc tcttcccccg cctgcacacg ggctcagaag      1740
     gccagggcga cagccgggca cgatgtgaca gcacatccag cacacccaag accccagatg      1800
     gtggacactc ctctcaggag ataaagtctg agacctcatc caatcccagc tctccagaaa      1860
     tctgccccaa caaggagaag cccttcatga agttgaagga aaacggccgc gccatctccc      1920
     gctcctcctc cagcaccagc agcgtcagca gcactgcagg ggagggcgag gccatggagg      1980
     agggcgacag tgggggcagc cagccgtcca cgacctcacc cttcaagcag gaggtgtttg      2040
     tctacagccc gtccccgagc agcgagagcc ccagcctggg ggcagctgcc accccaatca      2100
     tcatgagccg gagtcccaca gatgccaaaa gcagaaactc cccgagatcg aacctgaaat      2160
     tccgctttga caagctcagc catgccagcc ctggtgcggg tcactaatgt gaaagtggag      2220
     tccttcgcct gtccaaggga atcccctctt ctgtcctgga aaaggctcct gtaccagcag      2280
     tttgggagtg ccgtccacga ccctgacagt cccagccctg ctgccccatg gccacgtgcc      2340
     cacagatgtg ctgttggtcc aggtgtccca gtctggccac agccctgcct ccgccctcac      2400
     ctacatgccc tcccagcccc tcccatctct ggacgaggcc tccttcctca ggttcctcct      2460
     gctcctgacc tcccagtgtg atgtccgggt cctttatcat cctattcatc ctggagagga      2520
     aaagtgtcgg gcaaaggggg atctgggggg agctcagcag tgactgggga gctggtctgc      2580
     ctcagagaca gagtaggggg tgggagcaga gcctcggtga gggtcttggc cacagggcag      2640
     tgccttcctg aacgtggcag gctttactac caggaacgca ctcggtggtg gaggccccat      2700
     gttcccagga gccaagattc gtagcatcct tgaggccatc ctgataaaat tcggcgctat      2760
     tgcccccgta gctctggagc tctaaaccgt ctatctgctt ctgtgctgaa cgcctttccc      2820
     atctgctgac gtaggcccag ggctgccctg cccctgctgc cagtgtaccg tgagcggggc      2880
     tccagccagt tcaagctcag agccagagct ggacgggcca gaactgcgct gcacacttcc      2940
     tggactgagg cggggtactt tgggtcccac ccggtttctc ctgattatgg ctgctgtggg      3000
     gtgaggggag ggaggggcag ccccgaggca gtctcttccc tttgagaaga tattttccca      3060
     caaaggggtg ggaagccagg agtgagaagg aattcaggga gagcaaagga gccagtgctg      3120
     agatgctgct gtgttggttg aggaaaacct cgggcctgag ggccaggccg gagcccaggt      3180
     ctctgctgac aatgggggtt caaggaagac gtcgttatct cccctcccca cttactcgag      3240
     gagagaggtg agggggggat gacttgcggg ttctgatcag gcccctgggt ggggaagggg      3300
     cacagtgtcc ctcagcagct tacgcccctg gagtcttggg gggcccagcc tggccctggg      3360
     gccttttcca gctactgtgc ccttgggcag ctgcgtctgg ggctcaaccc cccaatcctg      3420
     ttcccctctc cagctgcggg tctgtaggca gctgtcacat ctgaagggtt tctgcaacct      3480
     ggaccccatc tgggtgtggg tcagaccctg tgacccacat gccaccccca ccctccacag      3540
     agcccccttg ctgggacagc cagctcacct ccaaggacat cccctcctgg cttctccccc      3600
     ttccgagtct gcagcgccgt gggcttctct gccgatgggc ccgggttggg gttaaggtgg      3660
     gcatcctcca ggtacaacga gcctgaagag cccctttcag tgcagacggg gctgcagagt      3720
     gacactggct gggcacctgc cccacgacca atgacaagga tttccagctg aatgctttat      3780
     tcccataggg atctggacct gtgcccaaga tataaatact acactttttt tttttttttt      3840
     aactgacatt gtgaaattct ccctatagct tttgccattc aagcaacatt gtgatctttc      3900
     ttccccgcca cgtgtgtggg aatgattgag tcctgtttgc aagctggaga ggagctctcc      3960
     ctttgctagt actttctcta aagtactagt ctagtaaaat ttattcttgt tagaaggtca      4020
     acaaaatatc tgtttagctt ttatgaagag tcaccgtagc agcccccacg gctggaaaga      4080
     ggcctgtacg ttctggacgc gttttgttgg ctgggcttct ggaggcactg gcaaggtcaa      4140
     actgcatttc tttaagaaca gttgcaggat ctggctcgcc tctgtgggaa gccggcatta      4200
     caggtgcttg gtggatgggc cgtgtcacat tgccatctgg ggtcctttgg ggtttccagg      4260
     ttgtcaccat gctgtcccat ttgggaatcc catacctgcc tgtccccact gcgctggctg      4320
     acccttgctg cctgctgcct cttgggaggg ctttgtccct gcctctgagc tggtgggcag      4380
     gatggctggg tggcccccag agaagcacag acctgagatg gggtctccat gcccggtttg      4440
     ctgttggaat gatctgaaca ggaccccaaa tgcctcttcc ctctggtcat gcctcactat      4500
     ctctaggagc tccatcctgt ggcttccaga gtgtgcactt ccagcccacc cgggcagtgc      4560
     tgagagggag gaggagaaca aggatggccc agcctcccct ccctccccta gaccacgggg      4620
     cgggcagctc gggttcctgg agggctgttt cccccacgct gtccctacat ctgctctgat      4680
     ctaaaatgtc tttcctttta tgctgcgccc agtcttgggg ctcaaagatt tgcccaaacc      4740
     tcattggccc tcgtgactag gctcatctag atggtgctca cgctggtgtt tgaggcattt      4800
     ccactgtgat ctccacgagg ggatgttttc cgggacacat ctctggctct gggaactgcc      4860
     tgactcactg aagaaactac ttttcaggca ctgtagggtc acccatatgc ctccagctca      4920
     gttgacgctt aaaaacaggt gcagaaaagc tcgcgatgga aggtcttaat gagagtgtct      4980
     gtctatgcca atcatgtaaa atgacgtttc ttgaaaaaga ttcagtggtt cagctttgtc      5040
     agcatcatct caacacaagc ctgctggctc tttttagcat ctcatccaac catgtcatcg      5100
     tccagatgag aaatcttagc ccaggtgagg ggagtaactt gcttgaggtc acacagctgg      5160
     ctgttggcaa agctgggatt agaaccctca acccagggtc ccttcctctg cagcgcctac      5220
     atggttggtt gaataagtgg ctgcgtttcc tggggccctg ggttttgggg aagccagtta      5280
     gctgctgctt tggcactggc atggaggtga gcagtcaagg atgctggtga ggctgcagtt      5340
     tctgctcttt ttcatcaggg gggatagtct ctaggatttt tcagtgagga cccttgggct      5400
     ttggatgcag cttgaaccaa gaaaacgagg agggaaaggg attcagtgaa ctattcctca      5460
     gtgggatcgg ttcttcagct cctgatgggg gctgtgtaat gggggcagag gccagggaaa      5520
     aagatgctgt tcacccaccc tcagcttccc ttttcctaaa ttaagaggaa aagtggtcaa      5580
     agaaaaactc ttcatttctc cctgattctt aaacgaaggt ggttaataga aactcaggct      5640
     cccgtgacaa ggcaggacaa gagcctgttt cgctttcctc cctggccctg ccaggtgcca      5700
     actcaaacac tacctttctc attggtttct aagtcagtag agacagatct gttttaagca      5760
     gttgggggtt cgagtagatc tcatgggtac aggaggccag cagggaccag gccagtcagc      5820
     catgctcagg acccctcggc tcctccccca gcctctagct accctgtatc gaggcaaggg      5880
     gaggccagta aagtttgcca agcctgatcc tgcagcctgg tggggctggc tggggtattc      5940
     ttttaccaaa ctctgtttta ccgccagccc cttgtacacc ccaatcccat gtctccctcc      6000
     cttcagctgg accgtgtgcc cctttgggag gaagaagaca agccccacta gggccaaggg      6060
     cagcagagcc ctgccgagtg agaggctgtg gggcagcggc tctgtcctgt gccttaccag      6120
     ccctggggag gggggcattt ggctggaaga ctggaattta attgccatcg tctttgattt      6180
     tgtgacattt ctgcttggaa gtgtgaacta cccccccccc cccccccgct tcctgctcct      6240
     tagcatgcgt gcagctctct cctgttttgg gtgttaccct tggacactcc agctcgggga      6300
     ctgctggcgt gtgagtgtgc agattcccct gtgtggtcga acctaagaac tgtggcttgg      6360
     aagtgatgct ccatgtgacg acgactttgc tttctttcct cttagtgagg aggtgattcg      6420
     tagatcccaa ctgcctatgt aatgtaaata atgtacattt aatttattgc tatggtagca      6480
     cattgtattt gttaatgtac aaaacaaatt ctaaaaggtt gacaaatgta tattttgttg      6540
     cttaaatgtg tctttgcaga aattgacaat aaataacata ttttgtgtcc taaaaaaaaa      6600
     aaaaaaaaaa                                                             6610
//

If you have problems or comments...

PBIL Back to PBIL home page