(data stored in ACNUC7421 zone)

EMBL: CR628336

ID   CR628336; SV 1; linear; genomic DNA; STD; PRO; 3503610 BP.
XX
AC   CR628336;
XX
PR   Project:PRJNA13127;
XX
DT   03-OCT-2004 (Rel. 81, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Legionella pneumophila str. Paris complete genome
XX
KW   complete genome.
XX
OS   Legionella pneumophila str. Paris
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
XX
RN   [1]
RC   (er) Nature Genetics online version available ahead of print (2004)
RX   DOI; 10.1038/ng1447.
RX   PUBMED; 15467720.
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   "Evidence in the Legionella pneumophila genome for exploitation of host
RT   cell functions and high genome plasticity";
RL   Nat Genet 36(11):1165-1173(2004).
XX
RN   [2]
RA   Cazalet C., Rusniok C., Bruggemann H., Zidane N., Magnier A., Ma L.,
RA   Tichit M., Jarraud S., Bouchier C., Vandenesch F., Kunst F., Etienne J.,
RA   Glaser P., Buchrieser C.;
RT   ;
RL   Submitted (05-AUG-2004) to the INSDC.
RL   Buchrieser C., Institut Pasteur, Genomique des Microorganismes Pathogenes,
RL   25 rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   cbuch@pasteur.fr Phone: (33-1)-45-68-83-72, Fax: (33-1)-45-68-87-86
XX
DR   MD5; 081a153d0b4e68c872fa7eb346d9acfc.
DR   BioSample; SAMEA3138252.
DR   EnsemblGenomes-Gn; EBG00000239927.
DR   EnsemblGenomes-Gn; EBG00000239928.
DR   EnsemblGenomes-Gn; EBG00000239929.
DR   EnsemblGenomes-Gn; EBG00000239931.
DR   EnsemblGenomes-Gn; EBG00000239932.
DR   EnsemblGenomes-Gn; EBG00000239933.
DR   EnsemblGenomes-Gn; EBG00000239934.
DR   EnsemblGenomes-Gn; EBG00000239935.
DR   EnsemblGenomes-Gn; EBG00000239936.
DR   EnsemblGenomes-Gn; EBG00000239937.
DR   EnsemblGenomes-Gn; EBG00000239938.
DR   EnsemblGenomes-Gn; EBG00000239939.
DR   EnsemblGenomes-Gn; EBG00000239940.
DR   EnsemblGenomes-Gn; EBG00000239941.
DR   EnsemblGenomes-Gn; EBG00000239942.
DR   EnsemblGenomes-Gn; EBG00000239943.
DR   EnsemblGenomes-Gn; EBG00000239944.
DR   EnsemblGenomes-Gn; EBG00000239945.
DR   EnsemblGenomes-Gn; EBG00000239946.
DR   EnsemblGenomes-Gn; EBG00000239947.
DR   EnsemblGenomes-Gn; EBG00000239948.
DR   EnsemblGenomes-Gn; EBG00000239949.
DR   EnsemblGenomes-Gn; EBG00000239950.
DR   EnsemblGenomes-Gn; EBG00000239951.
DR   EnsemblGenomes-Gn; EBG00000239952.
DR   EnsemblGenomes-Gn; EBG00000239953.
DR   EnsemblGenomes-Gn; EBG00000239954.
DR   EnsemblGenomes-Gn; EBG00000239955.
DR   EnsemblGenomes-Gn; EBG00000239956.
DR   EnsemblGenomes-Gn; EBG00000239957.
DR   EnsemblGenomes-Gn; EBG00000239958.
DR   EnsemblGenomes-Gn; EBG00000239959.
DR   EnsemblGenomes-Gn; EBG00000239960.
DR   EnsemblGenomes-Gn; EBG00000239961.
DR   EnsemblGenomes-Gn; EBG00000239962.
DR   EnsemblGenomes-Gn; EBG00000239963.
DR   EnsemblGenomes-Gn; EBG00000239964.
DR   EnsemblGenomes-Gn; EBG00000239965.
DR   EnsemblGenomes-Gn; EBG00000239966.
DR   EnsemblGenomes-Gn; EBG00000239967.
DR   EnsemblGenomes-Gn; EBG00000239968.
DR   EnsemblGenomes-Gn; EBG00000239969.
DR   EnsemblGenomes-Gn; EBG00000239970.
DR   EnsemblGenomes-Gn; EBG00000239971.
DR   EnsemblGenomes-Gn; EBG00000239972.
DR   EnsemblGenomes-Gn; EBG00000239973.
DR   EnsemblGenomes-Gn; EBG00000239974.
DR   EnsemblGenomes-Gn; EBG00000239975.
DR   EnsemblGenomes-Gn; EBG00000239976.
DR   EnsemblGenomes-Gn; EBG00000239977.
DR   EnsemblGenomes-Gn; EBG00000239978.
DR   EnsemblGenomes-Gn; EBG00000239979.
DR   EnsemblGenomes-Gn; EBG00001175928.
DR   EnsemblGenomes-Gn; EBG00001175929.
DR   EnsemblGenomes-Gn; EBG00001175930.
DR   EnsemblGenomes-Gn; EBG00001175931.
DR   EnsemblGenomes-Gn; EBG00001175932.
DR   EnsemblGenomes-Gn; EBG00001175933.
DR   EnsemblGenomes-Gn; EBG00001175934.
DR   EnsemblGenomes-Gn; EBG00001175935.
DR   EnsemblGenomes-Gn; EBG00001175936.
DR   EnsemblGenomes-Gn; EBG00001175937.
DR   EnsemblGenomes-Gn; EBG00001175938.
DR   EnsemblGenomes-Gn; EBG00001175939.
DR   EnsemblGenomes-Gn; EBG00001175940.
DR   EnsemblGenomes-Gn; EBG00001175941.
DR   EnsemblGenomes-Gn; EBG00001175942.
DR   EnsemblGenomes-Gn; EBG00001175943.
DR   EnsemblGenomes-Gn; EBG00001175944.
DR   EnsemblGenomes-Gn; EBG00001175945.
DR   EnsemblGenomes-Gn; EBG00001175946.
DR   EnsemblGenomes-Gn; EBG00001175947.
DR   EnsemblGenomes-Gn; EBG00001175948.
DR   EnsemblGenomes-Gn; EBG00001175949.
DR   EnsemblGenomes-Gn; EBG00001175950.
DR   EnsemblGenomes-Gn; EBG00001175951.
DR   EnsemblGenomes-Gn; EBG00001175952.
DR   EnsemblGenomes-Gn; EBG00001175953.
DR   EnsemblGenomes-Gn; EBG00001175954.
DR   EnsemblGenomes-Gn; EBG00001175955.
DR   EnsemblGenomes-Gn; EBG00001175956.
DR   EnsemblGenomes-Gn; EBG00001175957.
DR   EnsemblGenomes-Gn; EBG00001175958.
DR   EnsemblGenomes-Gn; EBG00001175959.
DR   EnsemblGenomes-Gn; EBG00001175960.
DR   EnsemblGenomes-Gn; EBG00001175961.
DR   EnsemblGenomes-Gn; EBG00001175962.
DR   EnsemblGenomes-Gn; EBG00001175963.
DR   EnsemblGenomes-Gn; EBG00001175964.
DR   EnsemblGenomes-Gn; EBG00001175965.
DR   EnsemblGenomes-Gn; EBG00001175966.
DR   EnsemblGenomes-Gn; EBG00001175967.
DR   EnsemblGenomes-Gn; EBG00001175968.
DR   EnsemblGenomes-Gn; EBG00001175969.
DR   EnsemblGenomes-Gn; EBG00001175970.
DR   EnsemblGenomes-Gn; EBG00001175971.
DR   EnsemblGenomes-Gn; EBG00001175972.
DR   EnsemblGenomes-Gn; EBG00001175973.
DR   EnsemblGenomes-Gn; EBG00001175974.
DR   EnsemblGenomes-Gn; EBG00001175975.
DR   EnsemblGenomes-Gn; EBG00001175976.
DR   EnsemblGenomes-Gn; EBG00001175977.
DR   EnsemblGenomes-Gn; EBG00001175978.
DR   EnsemblGenomes-Gn; EBG00001175979.
DR   EnsemblGenomes-Gn; EBG00001175980.
DR   EnsemblGenomes-Gn; EBG00001175981.
DR   EnsemblGenomes-Gn; EBG00001175982.
DR   EnsemblGenomes-Gn; EBG00001175983.
DR   EnsemblGenomes-Gn; EBG00001175984.
DR   EnsemblGenomes-Gn; EBG00001175985.
DR   EnsemblGenomes-Gn; EBG00001175986.
DR   EnsemblGenomes-Gn; EBG00001175987.
DR   EnsemblGenomes-Gn; EBG00001175988.
DR   EnsemblGenomes-Gn; EBG00001175989.
DR   EnsemblGenomes-Gn; EBG00001175990.
DR   EnsemblGenomes-Gn; EBG00001175991.
DR   EnsemblGenomes-Gn; EBG00001175992.
DR   EnsemblGenomes-Gn; EBG00001175993.
DR   EnsemblGenomes-Gn; EBG00001175994.
DR   EnsemblGenomes-Gn; EBG00001175995.
DR   EnsemblGenomes-Gn; EBG00001175996.
DR   EnsemblGenomes-Gn; EBG00001175997.
DR   EnsemblGenomes-Gn; EBG00001175998.
DR   EnsemblGenomes-Gn; EBG00001175999.
DR   EnsemblGenomes-Gn; EBG00001176000.
DR   EnsemblGenomes-Gn; EBG00001176001.
DR   EnsemblGenomes-Gn; EBG00001176002.
DR   EnsemblGenomes-Gn; EBG00001176003.
DR   EnsemblGenomes-Gn; EBG00001176004.
DR   EnsemblGenomes-Gn; EBG00001176005.
DR   EnsemblGenomes-Gn; EBG00001176006.
DR   EnsemblGenomes-Gn; EBG00001176007.
DR   EnsemblGenomes-Gn; EBG00001176008.
DR   EnsemblGenomes-Gn; EBG00001176009.
DR   EnsemblGenomes-Gn; EBG00001176010.
DR   EnsemblGenomes-Gn; EBG00001176011.
DR   EnsemblGenomes-Gn; EBG00001176012.
DR   EnsemblGenomes-Gn; EBG00001176013.
DR   EnsemblGenomes-Gn; EBG00001176014.
DR   EnsemblGenomes-Gn; EBG00001176015.
DR   EnsemblGenomes-Gn; EBG00001176016.
DR   EnsemblGenomes-Gn; EBG00001176017.
DR   EnsemblGenomes-Gn; EBG00001176018.
DR   EnsemblGenomes-Gn; EBG00001176019.
DR   EnsemblGenomes-Gn; EBG00001176020.
DR   EnsemblGenomes-Gn; EBG00001176021.
DR   EnsemblGenomes-Gn; EBG00001176022.
DR   EnsemblGenomes-Gn; EBG00001176023.
DR   EnsemblGenomes-Gn; EBG00001176024.
DR   EnsemblGenomes-Gn; EBG00001176025.
DR   EnsemblGenomes-Gn; EBG00001176026.
DR   EnsemblGenomes-Gn; lpp0066.
DR   EnsemblGenomes-Gn; lpp0111.
DR   EnsemblGenomes-Gn; lpp0158.
DR   EnsemblGenomes-Gn; lpp0159.
DR   EnsemblGenomes-Gn; lpp0164.
DR   EnsemblGenomes-Gn; lpp0200.
DR   EnsemblGenomes-Gn; lpp0206.
DR   EnsemblGenomes-Gn; lpp0210.
DR   EnsemblGenomes-Gn; lpp0265a.
DR   EnsemblGenomes-Gn; lpp0265b.
DR   EnsemblGenomes-Gn; lpp0289.
DR   EnsemblGenomes-Gn; lpp0290.
DR   EnsemblGenomes-Gn; lpp0439.
DR   EnsemblGenomes-Gn; lpp0457.
DR   EnsemblGenomes-Gn; lpp0769.
DR   EnsemblGenomes-Gn; lpp0770.
DR   EnsemblGenomes-Gn; lpp0772.
DR   EnsemblGenomes-Gn; lpp0773.
DR   EnsemblGenomes-Gn; lpp0774.
DR   EnsemblGenomes-Gn; lpp0775.
DR   EnsemblGenomes-Gn; lpp0776.
DR   EnsemblGenomes-Gn; lpp0777.
DR   EnsemblGenomes-Gn; lpp0829a.
DR   EnsemblGenomes-Gn; lpp0829b.
DR   EnsemblGenomes-Gn; lpp0829c.
DR   EnsemblGenomes-Gn; lpp0858a.
DR   EnsemblGenomes-Gn; lpp0858b.
DR   EnsemblGenomes-Gn; lpp1052.
DR   EnsemblGenomes-Gn; lpp1097.
DR   EnsemblGenomes-Gn; lpp1098.
DR   EnsemblGenomes-Gn; lpp1099.
DR   EnsemblGenomes-Gn; lpp1559.
DR   EnsemblGenomes-Gn; lpp1560.
DR   EnsemblGenomes-Gn; lpp1562.
DR   EnsemblGenomes-Gn; lpp1579.
DR   EnsemblGenomes-Gn; lpp1580.
DR   EnsemblGenomes-Gn; lpp1612a.
DR   EnsemblGenomes-Gn; lpp1612b.
DR   EnsemblGenomes-Gn; lpp1867.
DR   EnsemblGenomes-Gn; lpp1906.
DR   EnsemblGenomes-Gn; lpp1907.
DR   EnsemblGenomes-Gn; lpp1908.
DR   EnsemblGenomes-Gn; lpp2040.
DR   EnsemblGenomes-Gn; lpp2050.
DR   EnsemblGenomes-Gn; lpp2245a.
DR   EnsemblGenomes-Gn; lpp2245b.
DR   EnsemblGenomes-Gn; lpp2369.
DR   EnsemblGenomes-Gn; lpp2411.
DR   EnsemblGenomes-Gn; lpp2415.
DR   EnsemblGenomes-Gn; lpp2416.
DR   EnsemblGenomes-Gn; lpp2422.
DR   EnsemblGenomes-Gn; lpp2429.
DR   EnsemblGenomes-Gn; lpp2864.
DR   EnsemblGenomes-Gn; lpp2883.
DR   EnsemblGenomes-Gn; lpp2886.
DR   EnsemblGenomes-Tr; EBG00000239927-1.
DR   EnsemblGenomes-Tr; EBG00000239928-1.
DR   EnsemblGenomes-Tr; EBG00000239929-1.
DR   EnsemblGenomes-Tr; EBG00000239931-1.
DR   EnsemblGenomes-Tr; EBG00000239932-1.
DR   EnsemblGenomes-Tr; EBG00000239933-1.
DR   EnsemblGenomes-Tr; EBG00000239934-1.
DR   EnsemblGenomes-Tr; EBG00000239935-1.
DR   EnsemblGenomes-Tr; EBG00000239936-1.
DR   EnsemblGenomes-Tr; EBG00000239937-1.
DR   EnsemblGenomes-Tr; EBG00000239938-1.
DR   EnsemblGenomes-Tr; EBG00000239939-1.
DR   EnsemblGenomes-Tr; EBG00000239940-1.
DR   EnsemblGenomes-Tr; EBG00000239941-1.
DR   EnsemblGenomes-Tr; EBG00000239942-1.
DR   EnsemblGenomes-Tr; EBG00000239943-1.
DR   EnsemblGenomes-Tr; EBG00000239944-1.
DR   EnsemblGenomes-Tr; EBG00000239945-1.
DR   EnsemblGenomes-Tr; EBG00000239946-1.
DR   EnsemblGenomes-Tr; EBG00000239947-1.
DR   EnsemblGenomes-Tr; EBG00000239948-1.
DR   EnsemblGenomes-Tr; EBG00000239949-1.
DR   EnsemblGenomes-Tr; EBG00000239950-1.
DR   EnsemblGenomes-Tr; EBG00000239951-1.
DR   EnsemblGenomes-Tr; EBG00000239952-1.
DR   EnsemblGenomes-Tr; EBG00000239953-1.
DR   EnsemblGenomes-Tr; EBG00000239954-1.
DR   EnsemblGenomes-Tr; EBG00000239955-1.
DR   EnsemblGenomes-Tr; EBG00000239956-1.
DR   EnsemblGenomes-Tr; EBG00000239957-1.
DR   EnsemblGenomes-Tr; EBG00000239958-1.
DR   EnsemblGenomes-Tr; EBG00000239959-1.
DR   EnsemblGenomes-Tr; EBG00000239960-1.
DR   EnsemblGenomes-Tr; EBG00000239961-1.
DR   EnsemblGenomes-Tr; EBG00000239962-1.
DR   EnsemblGenomes-Tr; EBG00000239963-1.
DR   EnsemblGenomes-Tr; EBG00000239964-1.
DR   EnsemblGenomes-Tr; EBG00000239965-1.
DR   EnsemblGenomes-Tr; EBG00000239966-1.
DR   EnsemblGenomes-Tr; EBG00000239967-1.
DR   EnsemblGenomes-Tr; EBG00000239968-1.
DR   EnsemblGenomes-Tr; EBG00000239969-1.
DR   EnsemblGenomes-Tr; EBG00000239970-1.
DR   EnsemblGenomes-Tr; EBG00000239971-1.
DR   EnsemblGenomes-Tr; EBG00000239972-1.
DR   EnsemblGenomes-Tr; EBG00000239973-1.
DR   EnsemblGenomes-Tr; EBG00000239974-1.
DR   EnsemblGenomes-Tr; EBG00000239975-1.
DR   EnsemblGenomes-Tr; EBG00000239976-1.
DR   EnsemblGenomes-Tr; EBG00000239977-1.
DR   EnsemblGenomes-Tr; EBG00000239978-1.
DR   EnsemblGenomes-Tr; EBG00000239979-1.
DR   EnsemblGenomes-Tr; EBT00001753989.
DR   EnsemblGenomes-Tr; EBT00001753991.
DR   EnsemblGenomes-Tr; EBT00001753994.
DR   EnsemblGenomes-Tr; EBT00001753996.
DR   EnsemblGenomes-Tr; EBT00001753997.
DR   EnsemblGenomes-Tr; EBT00001753998.
DR   EnsemblGenomes-Tr; EBT00001753999.
DR   EnsemblGenomes-Tr; EBT00001754000.
DR   EnsemblGenomes-Tr; EBT00001754001.
DR   EnsemblGenomes-Tr; EBT00001754002.
DR   EnsemblGenomes-Tr; EBT00001754003.
DR   EnsemblGenomes-Tr; EBT00001754004.
DR   EnsemblGenomes-Tr; EBT00001754005.
DR   EnsemblGenomes-Tr; EBT00001754006.
DR   EnsemblGenomes-Tr; EBT00001754007.
DR   EnsemblGenomes-Tr; EBT00001754008.
DR   EnsemblGenomes-Tr; EBT00001754009.
DR   EnsemblGenomes-Tr; EBT00001754010.
DR   EnsemblGenomes-Tr; EBT00001754011.
DR   EnsemblGenomes-Tr; EBT00001754012.
DR   EnsemblGenomes-Tr; EBT00001754013.
DR   EnsemblGenomes-Tr; EBT00001754014.
DR   EnsemblGenomes-Tr; EBT00001754015.
DR   EnsemblGenomes-Tr; EBT00001754016.
DR   EnsemblGenomes-Tr; EBT00001754017.
DR   EnsemblGenomes-Tr; EBT00001754018.
DR   EnsemblGenomes-Tr; EBT00001754019.
DR   EnsemblGenomes-Tr; EBT00001754020.
DR   EnsemblGenomes-Tr; EBT00001754021.
DR   EnsemblGenomes-Tr; EBT00001754022.
DR   EnsemblGenomes-Tr; EBT00001754023.
DR   EnsemblGenomes-Tr; EBT00001754024.
DR   EnsemblGenomes-Tr; EBT00001754025.
DR   EnsemblGenomes-Tr; EBT00001754026.
DR   EnsemblGenomes-Tr; EBT00001754027.
DR   EnsemblGenomes-Tr; EBT00001754028.
DR   EnsemblGenomes-Tr; EBT00001754029.
DR   EnsemblGenomes-Tr; EBT00001754030.
DR   EnsemblGenomes-Tr; EBT00001754031.
DR   EnsemblGenomes-Tr; EBT00001754032.
DR   EnsemblGenomes-Tr; EBT00001754033.
DR   EnsemblGenomes-Tr; EBT00001754034.
DR   EnsemblGenomes-Tr; EBT00001754035.
DR   EnsemblGenomes-Tr; EBT00001754036.
DR   EnsemblGenomes-Tr; EBT00001754037.
DR   EnsemblGenomes-Tr; EBT00001754038.
DR   EnsemblGenomes-Tr; EBT00001754039.
DR   EnsemblGenomes-Tr; EBT00001754040.
DR   EnsemblGenomes-Tr; EBT00001754041.
DR   EnsemblGenomes-Tr; EBT00001754042.
DR   EnsemblGenomes-Tr; EBT00001754043.
DR   EnsemblGenomes-Tr; EBT00001754044.
DR   EnsemblGenomes-Tr; EBT00001754045.
DR   EnsemblGenomes-Tr; EBT00001754046.
DR   EnsemblGenomes-Tr; EBT00001754047.
DR   EnsemblGenomes-Tr; EBT00001754048.
DR   EnsemblGenomes-Tr; EBT00001754049.
DR   EnsemblGenomes-Tr; EBT00001754050.
DR   EnsemblGenomes-Tr; EBT00001754051.
DR   EnsemblGenomes-Tr; EBT00001754052.
DR   EnsemblGenomes-Tr; EBT00001754053.
DR   EnsemblGenomes-Tr; EBT00001754054.
DR   EnsemblGenomes-Tr; EBT00001754055.
DR   EnsemblGenomes-Tr; EBT00001754056.
DR   EnsemblGenomes-Tr; EBT00001754057.
DR   EnsemblGenomes-Tr; EBT00001754058.
DR   EnsemblGenomes-Tr; EBT00001754059.
DR   EnsemblGenomes-Tr; EBT00001754060.
DR   EnsemblGenomes-Tr; EBT00001754061.
DR   EnsemblGenomes-Tr; EBT00001754062.
DR   EnsemblGenomes-Tr; EBT00001754063.
DR   EnsemblGenomes-Tr; EBT00001754064.
DR   EnsemblGenomes-Tr; EBT00001754065.
DR   EnsemblGenomes-Tr; EBT00001754066.
DR   EnsemblGenomes-Tr; EBT00001754067.
DR   EnsemblGenomes-Tr; EBT00001754068.
DR   EnsemblGenomes-Tr; EBT00001754069.
DR   EnsemblGenomes-Tr; EBT00001754070.
DR   EnsemblGenomes-Tr; EBT00001754071.
DR   EnsemblGenomes-Tr; EBT00001754072.
DR   EnsemblGenomes-Tr; EBT00001754073.
DR   EnsemblGenomes-Tr; EBT00001754074.
DR   EnsemblGenomes-Tr; EBT00001754075.
DR   EnsemblGenomes-Tr; EBT00001754076.
DR   EnsemblGenomes-Tr; EBT00001754077.
DR   EnsemblGenomes-Tr; EBT00001754078.
DR   EnsemblGenomes-Tr; EBT00001754079.
DR   EnsemblGenomes-Tr; EBT00001754080.
DR   EnsemblGenomes-Tr; EBT00001754081.
DR   EnsemblGenomes-Tr; EBT00001754082.
DR   EnsemblGenomes-Tr; EBT00001754083.
DR   EnsemblGenomes-Tr; EBT00001754084.
DR   EnsemblGenomes-Tr; EBT00001754085.
DR   EnsemblGenomes-Tr; EBT00001754086.
DR   EnsemblGenomes-Tr; EBT00001754087.
DR   EnsemblGenomes-Tr; EBT00001754088.
DR   EnsemblGenomes-Tr; EBT00001754089.
DR   EnsemblGenomes-Tr; EBT00001754090.
DR   EnsemblGenomes-Tr; EBT00001754091.
DR   EnsemblGenomes-Tr; lpp0066.
DR   EnsemblGenomes-Tr; lpp0111.
DR   EnsemblGenomes-Tr; lpp0158.
DR   EnsemblGenomes-Tr; lpp0159.
DR   EnsemblGenomes-Tr; lpp0164.
DR   EnsemblGenomes-Tr; lpp0200.
DR   EnsemblGenomes-Tr; lpp0206.
DR   EnsemblGenomes-Tr; lpp0210.
DR   EnsemblGenomes-Tr; lpp0265a.
DR   EnsemblGenomes-Tr; lpp0265b.
DR   EnsemblGenomes-Tr; lpp0289.
DR   EnsemblGenomes-Tr; lpp0290.
DR   EnsemblGenomes-Tr; lpp0439.
DR   EnsemblGenomes-Tr; lpp0457.
DR   EnsemblGenomes-Tr; lpp0769.
DR   EnsemblGenomes-Tr; lpp0770.
DR   EnsemblGenomes-Tr; lpp0772.
DR   EnsemblGenomes-Tr; lpp0773.
DR   EnsemblGenomes-Tr; lpp0774.
DR   EnsemblGenomes-Tr; lpp0775.
DR   EnsemblGenomes-Tr; lpp0776.
DR   EnsemblGenomes-Tr; lpp0777.
DR   EnsemblGenomes-Tr; lpp0829a.
DR   EnsemblGenomes-Tr; lpp0829b.
DR   EnsemblGenomes-Tr; lpp0829c.
DR   EnsemblGenomes-Tr; lpp0858a.
DR   EnsemblGenomes-Tr; lpp0858b.
DR   EnsemblGenomes-Tr; lpp1052.
DR   EnsemblGenomes-Tr; lpp1097.
DR   EnsemblGenomes-Tr; lpp1098.
DR   EnsemblGenomes-Tr; lpp1099.
DR   EnsemblGenomes-Tr; lpp1559.
DR   EnsemblGenomes-Tr; lpp1560.
DR   EnsemblGenomes-Tr; lpp1562.
DR   EnsemblGenomes-Tr; lpp1579.
DR   EnsemblGenomes-Tr; lpp1580.
DR   EnsemblGenomes-Tr; lpp1612a.
DR   EnsemblGenomes-Tr; lpp1612b.
DR   EnsemblGenomes-Tr; lpp1867.
DR   EnsemblGenomes-Tr; lpp1906.
DR   EnsemblGenomes-Tr; lpp1907.
DR   EnsemblGenomes-Tr; lpp1908.
DR   EnsemblGenomes-Tr; lpp2040.
DR   EnsemblGenomes-Tr; lpp2050.
DR   EnsemblGenomes-Tr; lpp2245a.
DR   EnsemblGenomes-Tr; lpp2245b.
DR   EnsemblGenomes-Tr; lpp2369.
DR   EnsemblGenomes-Tr; lpp2411.
DR   EnsemblGenomes-Tr; lpp2415.
DR   EnsemblGenomes-Tr; lpp2416.
DR   EnsemblGenomes-Tr; lpp2422.
DR   EnsemblGenomes-Tr; lpp2429.
DR   EnsemblGenomes-Tr; lpp2864.
DR   EnsemblGenomes-Tr; lpp2883.
DR   EnsemblGenomes-Tr; lpp2886.
DR   EuropePMC; PMC1449017; 16597941.
DR   EuropePMC; PMC2257941; 18194518.
DR   EuropePMC; PMC2621349; 19165328.
DR   EuropePMC; PMC2876543; 20351136.
DR   EuropePMC; PMC2888818; 19400772.
DR   EuropePMC; PMC2976443; 20833813.
DR   EuropePMC; PMC3584888; 23319553.
DR   EuropePMC; PMC4126679; 25105285.
DR   EuropePMC; PMC4672373; 25141909.
DR   EuropePMC; PMC5026788; 27028760.
DR   EuropePMC; PMC5225317; 28074027.
DR   EuropePMC; PMC5338858; 28212376.
DR   EuropePMC; PMC6540132; 31086119.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01368; CRISPR-DR55.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02057; STnc40.
DR   SILVA-LSU; CR628336.
DR   SILVA-SSU; CR628336.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3503610
FT                   /organism="Legionella pneumophila str. Paris"
FT                   /strain="Paris"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:297246"
FT   regulatory      192..197
FT                   /gene="dnaA"
FT                   /locus_tag="lpp0001"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204..1562
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="lpp0001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11149"
FT                   /db_xref="GOA:Q5X990"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X990"
FT                   /protein_id="CAH11149.1"
FT                   /translation="MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQRLILLAPNR
FT                   FVVDWVRKHFFSRIEELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKS
FT                   APKKAVDYKSSHLNKKFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGK
FT                   THLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQTNSINEFKRFYRSLNALLIDDI
FT                   QFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEP
FT                   PELETRVAILISKAEQSNIELPYEVAFFIAKRIRSNVRELEGALRRVIANAHFTGKPIT
FT                   IEFVHEALRDLLALQDKLVTIENIQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALS
FT                   KELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLMRILSS"
FT   CDS_pept        1576..2679
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="lpp0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11150"
FT                   /protein_id="CAH11150.1"
FT                   /translation="MFELTIKKEDLLTPLLTVSGAVDKKQSLAILSHFLLKLSDGLLYI
FT                   TATDLEIEMSAQVACDSNNTSGSITVPAKKFIDIIRSLDENASPSIVFDKALVTIKQNR
FT                   STFKLATLPAENYPSSEDECNDVELTIPRLVLLQLLQSTHFAMSQQDVRIFLNGLLLEF
FT                   DSNIISAVATDGHRMAISRYSCNNIAQAKLLIPKKGVQELLRLLNCINDEQVLLAAGKS
FT                   HIKLITNQFVFLSKLIEARFPPYTKAIPREQDKYIVIDCTTLKRALSRIVILAHEKSKA
FT                   VLLHLQLGQLTLIANNNEQEEAIETLSAETQGDELKIGLNATYLLDVLSHFSEGQIRLS
FT                   MSNTESSILIESLVNDNYQYIIMPMKI"
FT   CDS_pept        2676..3737
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="lpp0003"
FT                   /product="RecF recombinational DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11151"
FT                   /protein_id="CAH11151.1"
FT                   /translation="MILSEVRIHNFRNIASTSLILNPNFNCITGPNGSGKTSLLEALYM
FT                   LSCAHSFRSREVAPIISYGQNQLNVFAHAYDESTISVQKSITDGTQIKLNNQFCCTTSQ
FT                   LAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLK
FT                   SRATYEHFIPWDQQLSQLANQLDKARNDYFFQWQPKFYQVLSDLTNISCTVEYYKGWDR
FT                   KNAGQNIEELLQKSFDSDRNKLYTQYGPHQADLIISIEQYRVKHTLSRGQQKIILIALK
FT                   LAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDS
FT                   GLFEVNCGAIKIL"
FT   CDS_pept        4034..6451
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="lpp0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11152"
FT                   /protein_id="CAH11152.1"
FT                   /translation="MSVDASYDSNNIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDESLAGYCKEIFVTIHSDESITVKDDGRGIPVDIHKEEGKSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEELHLLVRRHGKVYEQHYRHGVPESPIAETGEAN
FT                   STGTQIWFKPSAETFSNIEFHYDILAKRLRELSYLNSGVCIHLFDERTQKKDTFHYEGG
FT                   IKAFVEHLNKNKTPVHPVVFSMTSEKDGIVIELAMQWNDGYQETIFCFTNNIPQRDGGT
FT                   HMAGFRAALTRTLNNYIENEGYAKKAKVSPTGDDAREGLTAVLSVKVPDPKFSSQTKDK
FT                   LVSSEVKPAVESCVAEKFNDFLLENPTASKSIVAKIIDAARAREAARRAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPSLSELYLVEGDSAGGSAKQARDRKFQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGPEEYDPDKVRYHRIIIMTDADVDGSHIRTLLLTFFYR
FT                   QTRELLERGYIYIAQPPLYKVKRGKQEQYVKDDEALFDYLTQCALDGATFYPAKEAPPI
FT                   SAKSLEELVQHFRRVEKIIKRYKRRYPSDILKRVAYMPMLHQEDFNNLPKIENWCRQLH
FT                   LSLQQVDSKTEQYKVDIQKLTEGNQYTPKITVYQHGLENDIPMQVEFFLSKDYKEMVDL
FT                   GHKLSNLIEEGAYIQRGDKSLPVENFEQVLNWLMDEAKKGQTIQRYKGLGEMNPEQLWE
FT                   TTMDPEVRRMLQVSIEDAVAADEIFTTLMGDNVEPRRDFIETNALDAENIDI"
FT   CDS_pept        complement(6821..7861)
FT                   /transl_table=11
FT                   /locus_tag="lpp0005"
FT                   /product="hypothetical protein"
FT                   /note="similar to peptidylarginine deiminase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11153"
FT                   /db_xref="GOA:Q5X986"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X986"
FT                   /protein_id="CAH11153.1"
FT                   /translation="MNTAPKQYGFYMPAEWYPHERCWMAWPCHHETWSKIGLDKAKMAY
FT                   ARVAKAIAQFEPVTLLVNPGDEDSATNLCKGHNIEIISLPINDSWTRDTGATFLINNEK
FT                   QLAGVDWIHNAWGGNYADCSLDNLIASHLIKCTEAQYFHAPLVMEGGSFHVDGEGTILT
FT                   SKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIGDETDGHIDEIATFIAPGK
FT                   VLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATYLNGERLTLSYIN
FT                   FYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQIDALDVFSGGGGIHCITQQQPK
FT                   SYKLGE"
FT   CDS_pept        complement(7864..9756)
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="lpp0006"
FT                   /product="hypothetical protein"
FT                   /note="similar to biosynthetic arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11154"
FT                   /protein_id="CAH11154.1"
FT                   /translation="MNNNTLSDDNLYNIENWGEGYFRINSKGNIEISKKPGKPGVELQT
FT                   IVDAADRAGLHLPLLIRCSDILHDRVHRIYQAFTQAREDTYYAGNYQLVYPIKVNQEQS
FT                   VVRELLKSPDNQIGLEAGSKPELMAVIGMLGDHQSTIVCNGYKDTSYIRTALIAQQMGH
FT                   KVFIVIEKKSELDIILKESARLQIKPTLGVRIRLVSKSAGKWENTGGVKSKFGLNAKQV
FT                   LELILQLKANDMLDCLQLMHCHLGSQIANIHDIRHCMQEVARYYIELRQLNAPISTIDV
FT                   GGGLSVDYEGTRSNKGCSMNYSLVEYATHIMLALKHLCQEAEIPEPDLISESGRALTAH
FT                   HAVLVSNITDVEIINKAPVLPEISEDDSHVIRDIYDTYQAITDSSPTEIYNYAAHSLNE
FT                   AHSLFKHGVISLQEKAKVEAFYTNICMEIKDKLDEENPSEKALLMRINECMAAKIFCNI
FT                   SFFQSIPDAWAIGQIFPVAPISQLNRTLSMHSILQDLTCDSDGTIKQYPGSSCVTTTLM
FT                   LPSYDINNPYNIGFFLVGAYQEILGNLHNLFGDTNSLDVKLSDDGQFELDDLVSGDTVT
FT                   NVLNLAHFDTKKLIQSYEKQLIKSELPKEKALSYLNELRSIFSQLTYLDGNIAQ"
FT   CDS_pept        complement(9776..10621)
FT                   /transl_table=11
FT                   /locus_tag="lpp0007"
FT                   /product="hypothetical protein"
FT                   /note="Putative carbon-nitrogen hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11155"
FT                   /protein_id="CAH11155.1"
FT                   /translation="MKENKLTVALVQEQWYENPKEHQDKLASGIFSATQQGAKLVCLQE
FT                   LTLSPYFCTRSDVDPTPYMEDIATGPTAQFVSQMAKSNQIHITASLFEKAGYNTAVAFN
FT                   PQGELIAVTRKQHIPSGEKYHENFYFKPGDSNYPVHTIAGHYLGLPTCYDQWFPELSRI
FT                   YGLKGAEILVYPTAIGGEPTAPGFDSQPMWQKVMVAQGIMSNTFIIAVNRIGCEDGLSF
FT                   YGSSFISTPMGEILVQAPRNEPAVLVAELDFSQRELWGRLFPFPQQREPETYHELVKSR
FT                   "
FT   CDS_pept        complement(11162..12421)
FT                   /transl_table=11
FT                   /locus_tag="lpp0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11156"
FT                   /protein_id="CAH11156.1"
FT                   /translation="MTFTCDELKGLEHPYEVLGNGDALAENREELNKLTNDEKLVLASR
FT                   LVLECPVNELKDFAHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNINPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLTNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRTDVVMKIKGFCAEDSELAIKVQSAFALRRDIERNLLGDNPEQFFSSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVALPSTEEIIPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIVSD
FT                   SEEEEEKQNCWTSFCGLFGK"
FT   CDS_pept        12609..12866
FT                   /transl_table=11
FT                   /locus_tag="lpp0009"
FT                   /product="hypothetical protein"
FT                   /note="Similar to host factor-1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11157"
FT                   /db_xref="GOA:Q5X982"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X982"
FT                   /protein_id="CAH11157.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
FT   CDS_pept        12894..14138
FT                   /transl_table=11
FT                   /locus_tag="lpp0010"
FT                   /product="hypothetical protein"
FT                   /note="Similar to GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11158"
FT                   /protein_id="CAH11158.1"
FT                   /translation="MFERPQGGERAVLVQLALPGVDADKALAEFEELALSAKAEVLDCV
FT                   LGARATPDAKYYVGKGKAEEIAHLVNMLDADLVLVNHELSPSQERNLERLFGCRVVDRS
FT                   GLILDIFAQRARTFEGKLQVELAQLQHLSTRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRERIRYINKRLEKVRCSRDQNRQARRKASMPTVSLVGYTNAGKSTLFNVLTGEHT
FT                   YVADQLFATLDPTMRKLELPGSSAAILADTVGFIRDLPHHLVEAFRATLEETQQADLLL
FT                   HVIDISDPNWRETVFEVQKVLDELKVSNIPVIQVFNKIDLQEGWQPKIDYTEDSCKVWL
FT                   SATTGAGLDLLKEAIATQLHGMILIEDIVIKPDQAKLRAQLYQLGAVLKESVDENGDWL
FT                   MKIRITADQKRRLLS"
FT   CDS_pept        complement(14243..14713)
FT                   /transl_table=11
FT                   /locus_tag="lpp0011"
FT                   /product="hypothetical protein"
FT                   /note="Similar to thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11159"
FT                   /protein_id="CAH11159.1"
FT                   /translation="MKRLIPTFIYLLVLAITPFSTQAEALLKDTFGHNIPFSSLKGKWV
FT                   FINYWASWCETCVDEIPEFNRFYKNHKNEAVALYAVNYDALPLPEQKLLIKKFNINYPN
FT                   LLKDPAQDLQLGDITGVPVTFVFNPKGQLIKKLYGGQTAKTLEKVIAENRTS"
FT   regulatory      complement(14719..14724)
FT                   /locus_tag="lpp0011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(14880..16457)
FT                   /transl_table=11
FT                   /locus_tag="lpp0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11160"
FT                   /protein_id="CAH11160.1"
FT                   /translation="MNTTEHTELGNGLLMDKIEGNPYLRIDEFGVLHLRLQRFGENNLP
FT                   EPMELEMSAGEIIAMAGDYFTQANWTMDLDLPKCELFNSPAELGKHLIRKPIDPKEESA
FT                   LITAYNNLAAPDVTRKEIDRIYSINNANYVPFSPTLNFYAQQLMYYFRVKDYGEMLVRN
FT                   QTHFTPWSIRVYILGHAIALRYAHLSYELKQLATDRNYQSDNPDLSALKISLQNKNETL
FT                   SSNTLLDLANRYHAQAYSIELFTFHYYSDHFATGHMSMIGDLRVVLKERFGVWGNILAN
FT                   NLHDEVNRVGVYTVRPYDPTPNATEAPSRARGDGKFDTCLNQFNRLACLNGMTASLKDI
FT                   NQVLSGSVIPEQKDFGGLVHMPDVDFNSRQHQPLLVLSKGKVYYRNNLSQIHIISPSEY
FT                   EALRENPEKHGYKELTSKWAAFKLVTKLRLFPYLYDGSVMPVSDEKLAEIIADEKRRNP
FT                   QRAPIPTPSCLPESEPTVFDWRTKASWRNNKDSLDILDGLKKHSILGAKQTHSAIQEEE
FT                   EVQLNLGV"
FT   CDS_pept        16603..17442
FT                   /transl_table=11
FT                   /locus_tag="lpp0013"
FT                   /product="hypothetical protein"
FT                   /note="Similar to other protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11161"
FT                   /protein_id="CAH11161.1"
FT                   /translation="MKAIEVERLIQGTLIREGGGVKLRRYIGADKTNHFEPILLFDYFD
FT                   SSDPLDYLAGFPPHPHRGFETITYLMEGSITHEDNKGNKGVINAGGVQWMTAGKGIIHS
FT                   EMPSSSTGRLHGLQLWLNLPAAEKWREPRYQEKSSDQLPIEVMESGATIKVIAGRIDQG
FT                   LSSPIVEIATRPLFLDITLPANATIQQTIPDDYQAVLFVIEGAVNTGGQQITAGTLASL
FT                   TNGERIQIEGKDKENRNHCLLIAAAKLHEPIVRYGPFVMNTQEEIMQAIHDFRTGYF"
FT   regulatory      17959..17964
FT                   /locus_tag="lpp0014"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17975..19090
FT                   /transl_table=11
FT                   /locus_tag="lpp0014"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11162"
FT                   /protein_id="CAH11162.1"
FT                   /translation="MAYVLQGGGSLGAYQFGVVKGLLEAGYEPDWIAATSIGAIQAAII
FT                   VGNPPEKRIEKLERFWDEIAPGNFFDFLGESDITLDFYNKLSAACALLFGQPEFFFPKW
FT                   CTGTIPLWGDPTTLSYYDTTPLRKTLLDLIDFELLNSCPIRLSLGAVQISNGHLIYFNN
FT                   INYRIEVEHIMASAALPPGFPAVNIDGELYWDGGVHSNTPLEVILEAIPAENTLCFLID
FT                   CFGGRSFIPKSMSEIEERRKDISYGTHAQRTIYNYLQRQKMRNSMMELSRILTDEQKKE
FT                   SAHLLDIGSPHHCTLVHLAYSSRIVKAASKDYNFGRVVIKKRMEAGYSDAKAVLAEESQ
FT                   WGYLPEDGKSRLYESPNNLSRLFRKRKKEVF"
FT   regulatory      19177..19182
FT                   /locus_tag="lpp0015"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19192..20265
FT                   /transl_table=11
FT                   /locus_tag="lpp0015"
FT                   /product="hypothetical protein"
FT                   /note="Similar to multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11163"
FT                   /protein_id="CAH11163.1"
FT                   /translation="MKEKFATWSKIVTKHIRFFFSYSIPMFFKKAKNYTNLPIIVVGLA
FT                   LIIGLFHLFSYLIPFTDNAFVVTNVTPVAADVSGFITEIYVKNGQKVKKNDPIFSVYRV
FT                   PYELAYQQAMADYKEGLKKIDVFQKQIERTVALIKATDAELEKAQFALGLKKNKNVAEA
FT                   VSVLELKNLGYDVSTLSNKRNALQQEVAVLQAKIEQQRHTVASLKAKMDNAKVNLDLTI
FT                   VRAPGDGVIDNMYVSPNTPIEIHKPVFSFIDTANYYIQANFNETDLRNVRQGDKAYIIL
FT                   RMYYFDKIFHGVVVNSLWAAERQSTAPKSQIQVVTNQNEWLLLPQRFPLQIKILDPDPD
FT                   YPLNPGASAYVYISTKR"
FT   CDS_pept        20240..21172
FT                   /transl_table=11
FT                   /locus_tag="lpp0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11164"
FT                   /protein_id="CAH11164.1"
FT                   /translation="MFISQLKDKLASYDRYKEHRINGLKAVFVLELMIIFYFFSSIDNP
FT                   YFYYFYAPITCFTVEAAGTTLKEKYMLLLYTLLGSILSIFLFGIISVYNVLFIFFVFFY
FT                   TLALYFLVLHHFKKMLVIVPLMLSLASYSLIYGVEADSNFYIAINNALYTLAAMVVIFA
FT                   GLFIFPKKYYFDIWERAFLEVITGLESLSAKICKGEVKTIAIFSGIIVMERYSKMLPRN
FT                   IKCYSILKITILSFELILTMSYLLSFQKQLRKEYVIVLHHYLERLCQSCKARQPLILSD
FT                   QELPAFKETHELEILYQLILSWNYLCADG"
FT   CDS_pept        21157..22062
FT                   /transl_table=11
FT                   /locus_tag="lpp0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11165"
FT                   /protein_id="CAH11165.1"
FT                   /translation="MRRWLGVQAFSYVELRSIQISTVFAFTIFVQEWLRYPRAGWTGFA
FT                   VMMIYAGFDNGTTIFRTYHRFLGVLLGLFTGYLLWFVGHLDYRTLILIMPLMVFFAFFL
FT                   VGRAYSIPTVFTVNVSVLGSGYFSTEDTLPVTYFIIDYTLCTLIAFTIILGFEYFWFRH
FT                   YGLMQRFIKSTQAEVIDDLYKLVRLLNQGKIKKTEWFQACIKLTDSLFEVNKLITNSQF
FT                   LISSEHAVGDEFNQFVELANRIFIGLKALYMAYYTKHYHTFDYYQLFQQVQKDLVHLKD
FT                   FVAGEQTIDLSEGVKHATSG"
FT   regulatory      22031..22036
FT                   /locus_tag="lpp0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        22046..23431
FT                   /transl_table=11
FT                   /locus_tag="lpp0018"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane efflux proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11166"
FT                   /protein_id="CAH11166.1"
FT                   /translation="MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDS
FT                   KNIPYIAWWRDFKDPTLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLM
FT                   TGYSRNPATGFPGVLIVFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQIT
FT                   ASYFTYLAEIERKEFLQTLANDLTQLAKVASKVYQGGLSSEIEQEELYSQVNLIQGELE
FT                   VTERNIVISRNALRYLLNQNPGEIKTVKKLLQLKNHKLIPGSLPLTVLENRPDMQVAEN
FT                   RLRASHEGIGVAESNLLPTIQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVL
FT                   GAVAKAKGVNKVSYYNYIDTLQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLN
FT                   DRLYQTGIQSYIETLNSKISLDKINISLNQDKLQELLSIVRLYQELAGGYRAKLESEIK
FT                   SSV"
FT   CDS_pept        23666..25342
FT                   /transl_table=11
FT                   /locus_tag="lpp0019"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Legionella zinc metalloproteinase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11167"
FT                   /protein_id="CAH11167.1"
FT                   /translation="MLKKIMFFILSISTSSIFAADNVDLYQAPLNSINKYPILQTPKNA
FT                   IILKSSSAVIDNSLQKLNQTKEDNQMIVRYQQLYKGIPVIGAQVMITKGTDSGVQSNDN
FT                   AEVNGHLLDNIELNTKPAISAQQAKEYAKKSYFQFSPQSNIQQETAELQIRPDHNNQLK
FT                   LVYLVSFKSVQQDGKPDWPFFVIDAQTGALIKQWNNIKNYLDTGPGGNEKVQEYWYGKD
FT                   GLPALDVTQNGSQCVMENSKVKLVNLHSQWDWENTINTPFEYVCNNNIEENINGGFSPG
FT                   NDAYYFGHVIVDMYKDWYGLNALQHSNGAPMQLVMRVHFGQNYDNAFWDGQAMSFGDGL
FT                   DFYPLVSLDVAGHEVTHGFTEQHSGLEYHDQSGALNESLSDMAGQASRAYLLEKNPQLY
FT                   NKAYLQPNEVTWGIGETIVRDSYGKALRFMDYPSSDGSSADCLDKGIAQNNGSYCAINY
FT                   DEVVAYANAHIALPQERQSFIVHTASGVFNKAFYLMSKDMGIKNAYHIMVVANTKYWTP
FT                   TTDFKNGACGVIYAARDLNTDINKVKSAFGQVGIDIAGCAI"
FT   regulatory      25551..25556
FT                   /locus_tag="lpp0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        25563..26474
FT                   /transl_table=11
FT                   /locus_tag="lpp0020"
FT                   /product="hypothetical protein"
FT                   /note="Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11168"
FT                   /protein_id="CAH11168.1"
FT                   /translation="MAFFLITLCIIILSFFCLAVMVLKFMQQPSLPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIHMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
FT   CDS_pept        26665..27144
FT                   /transl_table=11
FT                   /locus_tag="lpp0021"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11169"
FT                   /protein_id="CAH11169.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   IDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSITACFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
FT   CDS_pept        27141..29264
FT                   /transl_table=11
FT                   /locus_tag="lpp0022"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11170"
FT                   /db_xref="GOA:Q5X969"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X969"
FT                   /protein_id="CAH11170.1"
FT                   /translation="MNYSLFISCSKGLEYLLEDELKGLGLHVTQVSPQGVYGEASLPVI
FT                   YNLCLWSRLANRIQLILFSGHAAKEQAVHQLCTDFHWQTVFTHDKTIAIEFHGASEQIR
FT                   NTMFGAQIVKDGIVDHFRRLNGSRPSVDKEKPQILIHAHLKNDILTVSFDLVGYSLHQR
FT                   GYRKKAGKAPLKENVAAAMLLRAKWPELAAQGYGLHDPFCGSGTLVIEAAMMAAHIAPG
FT                   LLRQDQSLQYWARHQSSLWEKLRTQALQQVKPLAVKLVGTDADGKIITLARSNAERAGV
FT                   LPLVEFNTLPLNACRPGTKRGLVVCNPPYGERLGEVTQLVPLYQQLGTTLHTCYQGWQA
FT                   AILTSSPVLAKALGLRADKQYTLYNGPLECKLYCLTLSAANKLKNTPDAPLSDNAQMLF
FT                   NRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYAVLQEYAPPASIPVHKA
FT                   EKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGSEQYQKIGKTSQRLIVTEGKAKLIVNL
FT                   YDYLDTGLFLDHRLMRLKFAQLEPGTRFLNCFCYTASASVHAALAGALTTNVDLSKTYL
FT                   LWAEDNFRLNDINLSKHQFLQYDCKEWMKTTRDKFDVIFLDPPSFSNSKRMSDILDIQR
FT                   DHVSLINMAMRLLNPDGVLYFSTNLRQFKLEPMLKEKYAVQDITPQTIDQDFKRNSKIH
FT                   HCFKIVMPHFADN"
FT   CDS_pept        complement(29334..29882)
FT                   /transl_table=11
FT                   /locus_tag="lpp0023"
FT                   /product="hypothetical protein"
FT                   /note="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11171"
FT                   /protein_id="CAH11171.1"
FT                   /translation="MKSFIEQAQFYATYHQNQATRYTHMAGVPLIMLSIMIFLGFVKIV
FT                   IPGVYATDLACLATLAALIYYFLLNWQLALALTPILIFLLWLASWFNYDGPTKFGLWVF
FT                   IITFVVGWGLQFYGHFIEGKKPAFMVNFTQALIAPLYLTAELFFMAGLMNSLREQIYGN
FT                   EEVNTEEISKSKTKTKSKS"
FT   CDS_pept        complement(30029..30454)
FT                   /transl_table=11
FT                   /gene="hbp"
FT                   /locus_tag="lpp0024"
FT                   /product="hemin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11172"
FT                   /protein_id="CAH11172.1"
FT                   /translation="MMLKTQLTAFIGAVILAGSSLANPIKPEVCPSVPSIQSEGMSMSS
FT                   EILEGMYITYNLSHYNTSSSWVFIVGPIAAENDDMALAESNKLLSTMSGSPHPEDDGEG
FT                   NWICQYTTKSKDIIAFAIEADDMLSPLKMMRYLRTIR"
FT   CDS_pept        complement(30594..31166)
FT                   /transl_table=11
FT                   /gene="rcp"
FT                   /locus_tag="lpp0025"
FT                   /product="Rcp protein, confers resistance to cationic
FT                   antimicrobial peptides and promotes intracellular
FT                   infection"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11173"
FT                   /db_xref="GOA:Q5X966"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X966"
FT                   /protein_id="CAH11173.1"
FT                   /translation="MKRLISCLTIICALNASAAAETTSNPCSRWISFLKPVCQRFHQTW
FT                   TEGHDDMYFSGYAWHNRYVYSNEKIKSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDS
FT                   HRHLEPAVGYAYLKTASVNKDLKAGLGYSVLVTSRVDYDNVPIPGALPWAALFYKRITI
FT                   AATYIPGSSREGHENGNVLYMLGKISL"
FT   CDS_pept        31326..32717
FT                   /transl_table=11
FT                   /locus_tag="lpp0026"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11174"
FT                   /protein_id="CAH11174.1"
FT                   /translation="MDLFRKKDIKGSLDNESHLAKCLSVFDLTFLGVGAIIGAGIFVLT
FT                   GIVAATISGPAVIFSYVVAGFACAFAALSYAELAASIGGCGSAYGYAYAGFGELIAWIV
FT                   GWDLLLEYSIAVSAVSIGWSGYANDFLMALKIFIPTHLLHGPADGGDLNILAILIIAVL
FT                   TTLLIVGVKSSSRFNNIMVFVKLLVIFIFIAIAFGEVKVENWSSFMPYGWAGVMKGASI
FT                   IFFAYVGFDAVSTAAEEAINPQRDLPIGIIASLAICTVIYILVSGLLTGIAHYTTLNVS
FT                   SPISHVLLVLGYKTAAGLVGVGAIAGLTTVMLVLFYGLTRVFLAMSRDGLLPRFLSKTN
FT                   EHTKTPIRIILLCGILMASLASVTPIGTLAELVNIGTLFAFIVVCGGVLYLRRTHPDME
FT                   RPFKTPFMPYVPILGIISCFYLILNLPWVTILRFIIWMLVGIAVYFAFSRTNSALSVEG
FT                   DCAAE"
FT   CDS_pept        complement(32727..33722)
FT                   /transl_table=11
FT                   /locus_tag="lpp0027"
FT                   /product="hypothetical protein"
FT                   /note="similar to low-affinity inorganic phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11175"
FT                   /protein_id="CAH11175.1"
FT                   /translation="MDYNTIFILFVIFIAFVFDFINGFHDAANSIATIVTTGVLTPRQA
FT                   VLWAAFFNFIAFLIFNLTVAQTIGYGLIDTDLVDTYFILAALMGAIFWNLVTWYYGLPS
FT                   SSSHALIGGLAGAAIAKGGLSSLKITGFAKVAAGIFISPVLGLLIGLLFTHIFSLFLRH
FT                   KNEEELNTLFKSFQLISSALLSITHGGNDAQKTMGIIAVLLFSASWLDGVFYVPFWVVI
FT                   SCHGVISLGTLAGGWRIVHTMGTKITKLNTLKGCAAETGAAITIFAATEFGVPVSTTHT
FT                   VTGSIAGVGLISGIGGAHWKVLRRIFYSWLLTIPAAALVAAAIMTISPTA"
FT   CDS_pept        complement(33739..34380)
FT                   /transl_table=11
FT                   /locus_tag="lpp0028"
FT                   /product="hypothetical protein"
FT                   /note="similar to ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11176"
FT                   /db_xref="GOA:Q5X963"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X963"
FT                   /protein_id="CAH11176.1"
FT                   /translation="MRTSSFLDRLISEVDSALRTLVLPPKRITTRQSPAENLADTVLSA
FT                   QEKKHISGLMRVNHAGEVCAQALYQGQALTAQLTHIKEQMASAAAEEVDHLAWCEERLY
FT                   ELGSKPSLLNPIWYCGSVLLGALAGLAGDKVSLGFVAETERQVTAHLQRHLHYLPEKDK
FT                   KTIAILKRMQEDEEHHAHTAMEAGAVELPYIIKQLMNAVSKLMTQSSYYI"
FT   CDS_pept        34603..37533
FT                   /transl_table=11
FT                   /locus_tag="lpp0029"
FT                   /product="hypothetical protein"
FT                   /function="regulatory protein (GGDEF and EAL domains)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11177"
FT                   /protein_id="CAH11177.1"
FT                   /translation="MIDKMRKSKKLHPLNHIPSGDNFSHLNLLERSLISQLIELSYDEN
FT                   TLHTLSLSGLKLLGKHPLLKDTITAVWHHDGSHINILASNGLKFDAPKELEKLLAVVSD
FT                   WHFLKIYKTKLKKHSEEKLKQRVDICLDKYQGNLFCISFWFDSIDCNFEILMPFFKDIL
FT                   GILNLSLARLMNKKREKLLTTILEKAGDSVEITNEEAVIQYVNPAFENITLYSAREAMN
FT                   KTVASLLRSPVEDVQLFEEINQTLKSGNTWKGQIRSRKKDGSYWVAQTIIVPVMDDELG
FT                   RITQHIAIKQDITEQVHRFNQLKISEERYRNLMNAVSDGIFIHNLQGAFLEVNEAACLS
FT                   LNYSREELINSYVWDIEVGFSQESLNQLWENVQKGPINTEGMHRRKDGTTFPVDVRLAV
FT                   FNATGEKLVLAIVRDITLQKRSEATIRKLTRALEQSPVLVIITDKTGTIEYVNAKVIEQ
FT                   TGYRKEELLGGNTRILRSGQTPHEIYKTMWEHLANGEEWHGELLNKNKSGEHFWVSAII
FT                   SPIRNENEEITHYLAVMEDVTQKKSYEEMLKYQATFDNLTNLPNRLYAVNKLERAISKS
FT                   HINNQKLAVLFLDLDEFKQINDSLGHAVGDLLLKALSERFLSMIRQTDTIARLGGDEFM
FT                   MILENIMQDKDAESIAKKCREICSQPFVIESQELSVSTSIGIAIYPDHGKDAKTLMRNA
FT                   DTAMYQSKIRGKNNWTVFQNTMIEGANNHIRIKTELHQAFTRNELYICYQPIIDLKKNK
FT                   VVAAEALLRWQNTTLGQINPDQIIPLAEETGMIIPLGYWILDKVCAQAKEWEFITGSKI
FT                   KLAVNISTLQLKQKDFIHKVQLILKRTKLSADSLIFEVTESAFIDDSKFILSQLNKLSD
FT                   MGIHFSLDDFGVGYSFLQYIKSYPFKNLKIDRVFIQGVNTNHNELSLINSIITMARNLK
FT                   LSVIAEGIETAEQLELMRSMNCDMVQGWYFSKPLSGDKFLFFLMNK"
FT   CDS_pept        complement(37645..38535)
FT                   /transl_table=11
FT                   /locus_tag="lpp0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11178"
FT                   /protein_id="CAH11178.1"
FT                   /translation="MKTEALLSWLNVESNESYDSIRIKYQLRLEALEKEERIKKMGGIN
FT                   PFAPKIPLNNTRIITSKEIQEAWAAIDSLSKYQKFKGLVAQEENLSTIPNKKMDSKREE
FT                   TKLIHFVRERAQGPQGRRLPAHLQAKIKRASLDKPHSKLITEGVEQQINAILDKTTLSA
FT                   SDLQSAVYTAVQNYTNYHMKSENKNNPKYNRGQGDGFFSFFRHGSFGITTANNLYTSIS
FT                   AKNATLDETIEKLKDFLGHSSRAYHHHSFTSYLADALAEKGLLTSHPASRYKQEDVVNQ
FT                   LDQWIAQNSTVNLLK"
FT   CDS_pept        complement(38594..39787)
FT                   /transl_table=11
FT                   /locus_tag="lpp0031"
FT                   /product="hypothetical protein"
FT                   /note="Similar to aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11179"
FT                   /protein_id="CAH11179.1"
FT                   /translation="MVFKSRLVGVILLCFSSITGWCLSQSHEEDRIIVSNCLYEQLKDK
FT                   ARLIAQSDHFSFIAIPIDENIANTLQKMRPVCGNYLNAEPYIQQTYNRFLDSQKLLDKL
FT                   TRYHSISTANPYPINHEAQVHGLFEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWF
FT                   KQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMP
FT                   GADDDSSGISVELEMARVLFSSNFELNRPVYFIAYAAEERGLIGSGYVVQDFLQKKILV
FT                   KAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKIPVGYTKCGYACSDH
FT                   VNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN"
FT   CDS_pept        complement(39849..40874)
FT                   /transl_table=11
FT                   /locus_tag="lpp0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11180"
FT                   /protein_id="CAH11180.1"
FT                   /translation="MGWTDRFWNAYRVVTNTVIEGAANSLNAAGSLACLLGGAGVSLSY
FT                   SMSETIKAGYFGSVGVAGTVNLDVTAVEFNYGFNQTIPFRRDLLEKSGGGSYALNDFAN
FT                   PGTVFMISSLAILSGTTLRTFGANLKKWQQNREDKYHFIAKYSTDLEPPSYKEYLYVNA
FT                   ESFFNSLAIASFSSLLAKNVLDFSIKDLSKYHFTYPFNGTNITGSVKTPDYTGPVTSEF
FT                   FPLDFFVSQNTTIHTDYFNLIVNEKVKANAMTNVTYGGGVHLEPSHQSSAPLLAASATI
FT                   GIGTYLAGTFFGKKILRERDERLQRSRSSSYSIVSGTFWDNKHDIEAKGDTKFEHTHSL
FT                   Q"
FT   CDS_pept        41138..41899
FT                   /transl_table=11
FT                   /locus_tag="lpp0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11181"
FT                   /protein_id="CAH11181.1"
FT                   /translation="MKLHSISTNKMRLIISMWLIYLFAVLFLVASLFTMLILMMEYTLV
FT                   CKNKQYHLAKECVLHSKIYNLYHSSTELGDLKAAVVKSSRSSKGNTLYYVDLLTAQGPV
FT                   NLTGSSSSGRDDKEIAANSINNYISNSLETTFKVSYPASWWMYGLSVFFLLVGAVLLTV
FT                   RGAITDFDRILKTIVIKRKGLFKTEETKLSFSDVDKIIVEESLGSRGTKTYRLAIALKD
FT                   KPPIPLVTTYDSSFAKKEKIANQLNQFIHEN"
FT   regulatory      42142..42147
FT                   /locus_tag="lpp0034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42156..42512
FT                   /transl_table=11
FT                   /locus_tag="lpp0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11182"
FT                   /protein_id="CAH11182.1"
FT                   /translation="MSKFFTLLICISIGLLSFPTYAQKTIRLSPNETKTLKNSTLWTLN
FT                   ATCNVQSSTQVNGKIKIIVLKNNGKVNGKSLSTGQGTSITIKNNSSISVSAESGTQINL
FT                   INLGNQELQAVCST"
FT   CDS_pept        complement(42575..43297)
FT                   /transl_table=11
FT                   /locus_tag="lpp0035"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11183"
FT                   /protein_id="CAH11183.1"
FT                   /translation="MNYQYSPNLKKKFLLAFTTLFIVQMFYFAPVRASTGDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRVGENISQLSQLLLRPGLGYELLPTTTIWLGYDRVYTAQ
FT                   PFSNPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRAIHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFQLNNFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSTALLLTE"
FT   CDS_pept        complement(43511..44254)
FT                   /transl_table=11
FT                   /locus_tag="lpp0036"
FT                   /product="hypothetical protein"
FT                   /note="Similar to arginine transport system periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11184"
FT                   /protein_id="CAH11184.1"
FT                   /translation="MVRLRIYLCSLLLAIPFYKPYALSLVIGTLSYNPPFETQVNDSSK
FT                   KNEFYGFEIELMDEICERINAKCQYKPLLFEQILAEINSGAINLGIGSINITPERSERF
FT                   LFSLPYKASYHQFLIPSNSNIKKIDDLKGKTIGIHLGSPTIDYLKVYFNNNIQFKYYET
FT                   FMDLLNGLTDPQVSAIVTNSDQAQYWASITPDCKLLGDSFPFGIGFGVVARLDQAELIE
FT                   KINQALIEIENDGTYLKIYNLFFQP"
FT   regulatory      complement(44263..44268)
FT                   /locus_tag="lpp0036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(44415..45932)
FT                   /transl_table=11
FT                   /locus_tag="lpp0037"
FT                   /product="hypothetical protein"
FT                   /note="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11185"
FT                   /protein_id="CAH11185.1"
FT                   /translation="MAATIPHIETITFNDWFLAIIDTPGIPIDEIETRAAEGFKRKLTE
FT                   RQFQQLTELIHLISFIKHRRFSNPILALRIYVDENTSSLSRTALVEAVRMLPPEDNKTY
FT                   ELVAYLAQKNKLERYTNITKVPPLQIYQQNGVFEQCDEWILLFELFGLTQATPSDFIPA
FT                   IAHLLIIKNFGIPDLRALSKFMSTAHKLGILSQNFMNNMTPHLCNGQIIEKYESLLLKL
FT                   QINDLLNKEILETIYSLIKQLDALDAFFSLYHEELSHDSTLSFLREILPSFCVMSRPSK
FT                   ESYDDQVSTNTPLHLAVIESDKANLERTLAFANRNLLIKSSYENTALLLACKLADKESA
FT                   RLILAKMQELGCDVNQKDHHGMTALHWANFYHFDELIRELEVAGADPKLKAANGKTCEY
FT                   FYQHQFTMNDLKLNGKEIIDGEFKLSECALTDIAFHMDKIALNLKLTTPSEIAELYARD
FT                   EMAQIRSSNRFYLFFKLFRPKLINWLEKQNGLEPQVTYRFSGQSSSA"
FT   CDS_pept        46159..47244
FT                   /transl_table=11
FT                   /locus_tag="lpp0038"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS4 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11186"
FT                   /protein_id="CAH11186.1"
FT                   /translation="MSITELSDILNGYFSWNKSRIECFATMLISLIKVRTVNLTEIACG
FT                   FSSPAKQDSRYTRIKRFFREFKIDFSSVSVWVIHCFGLSGQALYLSMDRTNWRWGKKDI
FT                   NILMLSVVYKGIAIPLFWTLLAKGGNSDTRERIEIVQRFITKFGKSMIAGLLADREFVG
FT                   DNWFAWLLTEKIPFCIRIKNNVITTNSRGLEVSIDALFYDLKSGEQRILQGLRKLWRQK
FT                   IYLSALRLADGELLIVATDHLMYEPIEHYALRWEIETLFSCLKGRGFNFEDTHMTQPDR
FT                   IEKLLVLLTIAFCWAHKTGEWRHVQKAIKIKKHGRKGVSFFRYGLDLLRDAALNGCQFI
FT                   RHSFSDILGFLCISRVICAAE"
FT   CDS_pept        47270..47563
FT                   /transl_table=11
FT                   /locus_tag="lpp0039"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11187"
FT                   /protein_id="CAH11187.1"
FT                   /translation="MQVKQPAIYIMANKRNGTIYTGVTSDLIKRVYEHKYGDVPGFTQE
FT                   HGCKFLVYYELIEDMISAIAREKQLKGGSRKKKLALIEKLNPYWEDLYEKLL"
FT   CDS_pept        47833..48315
FT                   /transl_table=11
FT                   /locus_tag="lpp0040"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11188"
FT                   /protein_id="CAH11188.1"
FT                   /translation="MKFRFRFYLGIILLILAIVCPLLIPLIVQSNFSVLIKGFLSSILV
FT                   FGLPEVLIVLAIALLGKEVYGLLEQKIKNILFKEKVSRARYRLGLVFFAFPLIIGLLEV
FT                   FVKEITLAYGSYYYWVEIIWTTMFALSFFICGKQFWDKFKSLFIYDSYVVFEKNKK"
FT   CDS_pept        complement(48337..49332)
FT                   /transl_table=11
FT                   /locus_tag="lpp0041"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11189"
FT                   /protein_id="CAH11189.1"
FT                   /translation="MDPITHGVLGAACAQAALGKYDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLVVALFLLCFSQYRKFWKVTIGASIVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVIASLFFCI
FT                   LFLIFNTILHNRALDGIHQYATTNNFKIHHPRALPKLASSTYWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRQALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDNPIFSLWGIEILPGQEHINKLSLPKINEYCKSPDSERYKGDGLN"
FT   CDS_pept        49497..49820
FT                   /transl_table=11
FT                   /locus_tag="lpp0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11190"
FT                   /protein_id="CAH11190.1"
FT                   /translation="MVQFFVAPGVSSSRFNIAFSNTAGNVGVRDSLNEWLTGISIKAGS
FT                   ITKLTRNVDLLLTYQFTQYNNIAGVQMEPLSEDTLRGSYKPNVNTALIGFKVHPSDEIT
FT                   KDT"
FT   CDS_pept        complement(50133..50993)
FT                   /transl_table=11
FT                   /locus_tag="lpp0043"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11191"
FT                   /protein_id="CAH11191.1"
FT                   /translation="MISYLFSEVHFTHALKKVLGISVLVGVYSAIIYFWFEQDNLHSSN
FT                   WLSYSQSVFGIILGLLLVFRSNRAYERWWEARTLWGQLVNASRNLAIKIRILLSPNADE
FT                   AKKFSELINTFCEVLAIHLRQKSNRDDFKKFLTRASLPNHVPSYVAQELYRELSEKTKA
FT                   SKRLNLWLLDNEFSKFMDICGGCERIKNTFISLSFRVFVKHVFIIFILFLPCSLIDTLG
FT                   VWAIPATIIITYLIIAIEGIARNLEEPFGLTEDHLNLGSITESIRESVNEVLLGQNSNE
FT                   ESNSI"
FT   CDS_pept        complement(51171..51407)
FT                   /transl_table=11
FT                   /locus_tag="lpp0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11192"
FT                   /protein_id="CAH11192.1"
FT                   /translation="MKRVHHHPATHSHPSNATVQVSNGQHTVVVNPNPSYLPGQPPMYH
FT                   PNSFFTTHHHSPYYASQNQHYHQQPAPNTHQHP"
FT   CDS_pept        51728..52603
FT                   /transl_table=11
FT                   /locus_tag="lpp0045"
FT                   /product="hypothetical protein"
FT                   /note="Similar to sterol desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11193"
FT                   /protein_id="CAH11193.1"
FT                   /translation="MDSLDLDFYAITRAFLFFSLIGFIVFLEYFFSFHRLGKAGFRRRR
FT                   ISNWYLGIVNIIVALPLSTLTTAAYCEYYQIGLFNLLKVPFGLVFILWFIMYDLYVYLF
FT                   HRLSHATFLWHFHKIHHSDKSLNVTTSFRFHPVEYILFNALKIVLIILLGPYFFVILFS
FT                   DFIQAILVFWGHSNIALNAKLEQALSRIIITPRYHVMHHTQDECRRNYAGGLTLWDYLF
FT                   HTQTEPLWNKDEINKLTLGVQTNTNWPEFKNLLLINKLIHFFGKPQFVYFKLPLITIGV
FT                   AVIFGIVEFY"
FT   CDS_pept        complement(52728..52940)
FT                   /transl_table=11
FT                   /locus_tag="lpp0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11194"
FT                   /protein_id="CAH11194.1"
FT                   /translation="MKSTNNMQKKETDKPTSAQAQKKEVRRNNAPDFIPGASPYYNLYC
FT                   FFYKLCHGEDTSTQHQPNTTIKHGR"
FT   CDS_pept        53150..53548
FT                   /transl_table=11
FT                   /locus_tag="lpp0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11195"
FT                   /protein_id="CAH11195.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKTLSVFPAGTSINKTTVKEICFTDI
FT                   FCETHPFVWYYYPEHNLAIWTSRLAGTTQEYPADYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQDHQMIPIRNSESWRYIKSSSFSMS"
FT   CDS_pept        53747..54409
FT                   /transl_table=11
FT                   /locus_tag="lpp0048"
FT                   /product="hypothetical protein"
FT                   /note="Similar to antibiotic acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11196"
FT                   /protein_id="CAH11196.1"
FT                   /translation="MKPTDKKHWSKIEYLHQSVKNPNIHIKGKHSYYSDAWTGSFEETV
FT                   VRYLYGDEYSLKTWQPQWQIDQLYIGDYVCIAAEVIILLGGNHNHRADWFCLYPFADKY
FT                   VEAYQGKGDTIIEDGVWLGMRAVIMPGVTIGEGAIVAASSIVTKDVEPYSIVAGNPAKP
FT                   VKKRFAENVVERILALDIFSWSEAKFNLLKDYICGNNIDKLEQASRNYDQNLSIGSK"
FT   CDS_pept        54406..55284
FT                   /transl_table=11
FT                   /locus_tag="lpp0049"
FT                   /product="hypothetical protein"
FT                   /note="Similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11197"
FT                   /protein_id="CAH11197.1"
FT                   /translation="MISIRQLRLGDESTLETFLKSHADESMFLRSNLYHSGLSYHDKPF
FT                   HGDYFASFDNNKKISGVLAHYWNGNVIVQCPDFNVLTALVGAFQKTATREIAGILGEDQ
FT                   QADVVMKQLQLEHVDYAVNYPDGLYALNLQNLAIPDNQDRYQLKVAKDCDKCLLYEWLR
FT                   AYQIEALGAEESSSILKEQVESEVKNTLEGNDRWVLEENGIPVSLCGFNARLPDIVQIG
FT                   PVWTPVTLRGRGYARTVVALSLSAAQKSGVNRAVLFTNNQAAVRAYQAIGFNKVGNYRL
FT                   AILKKPILLTR"
FT   CDS_pept        55337..56632
FT                   /transl_table=11
FT                   /locus_tag="lpp0050"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid permease family proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11198"
FT                   /protein_id="CAH11198.1"
FT                   /translation="MDMDIKHKPLKRELSLFGATMMGLGSIVGTGVFVSIGIAAGVTGP
FT                   SVILAIALAALVATCNAFSSAQLAANHAVSGGTYEYGYRYLHPAFGFTAGWMFLCAKSA
FT                   SAATAALGFAGYFIHLSGLETVPVIPIALAVSITLILLVLSGLRRTNTVNIIIVMITLI
FT                   TLTVFIISGLPDFMQRGTANLRPFFPVSKQEGLSHFFYATALMFVAYTGYGRIATLAEE
FT                   VKNPGKFIPAAIIITLMVSAVLYILVGLVAIGAVGVEKLAQVTETNATPLESAAQAIGI
FT                   PGLSVLVSIGACTAMLGVLLNLILGLSRVALAMGRKGDLPKIFCYVSETRHVPVSSVIG
FT                   VGVVIIALVLTGSVETTWTFSAFTVLIYYAITNLAALHLPKEEQLYPPLFAIGGLLSCL
FT                   FLAFWVPIGVWITGISLLVLGLLWKVVANRFL"
FT   CDS_pept        56714..57580
FT                   /transl_table=11
FT                   /locus_tag="lpp0051"
FT                   /product="hypothetical protein"
FT                   /note="Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11199"
FT                   /protein_id="CAH11199.1"
FT                   /translation="MLDGIMVLWFILLMLSLAFIAYDVREMPIDWVQKLGWVLVVAYTG
FT                   PLGLFFYFLTCRSPGKGLHALYTKAQWKQAVNSEVHCLAGDATGIIFAAIFLSFIDFSN
FT                   GIELILEYISAFFFGWVIFQAGMMRSMYSSYGEALRKTFFAETISMNFVMMGMIPVMMI
FT                   LMNTLDYGRNPAHLQFWFIMGIATVVGGFLAFPINNWLVKKKLKHGCMTLPEGDEHIEG
FT                   HMTHHHGGHEEHLQAQAERIDSKVIHGHTHEMGSLPLNIQLKYIGISFGILLIIVLIMA
FT                   FFVPLKI"
FT   CDS_pept        complement(57641..57889)
FT                   /transl_table=11
FT                   /locus_tag="lpp0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11200"
FT                   /protein_id="CAH11200.1"
FT                   /translation="MARLKTCVTPLIQNMQRQVKNGHLNHKHKGGVMFNLKRNLIKLGT
FT                   LSISIALLAACHTVKGTVTGAKQDIKATGKAISRTMQ"
FT   CDS_pept        complement(58034..58516)
FT                   /transl_table=11
FT                   /locus_tag="lpp0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11201"
FT                   /protein_id="CAH11201.1"
FT                   /translation="MWLDYLHKINSDPNLLYLFIRTFIIYVFAIFIIRVGNTRYNFETA
FT                   FDYIFVFVIGAVLSRAINGNSTLISAMAGSSLLIFLHWVFAICSFYSHGFGKLVKGKSV
FT                   LLIQDGQLIWSALKRHQVTEEDLRQVFREKLNASDLTTVKEARLERTGRISFIIYK"
FT   CDS_pept        complement(58729..59622)
FT                   /transl_table=11
FT                   /locus_tag="lpp0054"
FT                   /product="hypothetical protein"
FT                   /note="Similar to probable methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11202"
FT                   /protein_id="CAH11202.1"
FT                   /translation="MSNFRYSQGKKLREALMKEKPLQVVGTINAYAALQAKRAGFHAIY
FT                   LSGAGVANASYGLPDLGITTLNDVLEDVRRIMSAVDLPLLVDIDTGWGGAFSIARTIKE
FT                   MIKAGAAAVHIEDQVQAKRCGHRPGKALVEKEEMIDRIKAAVDAKTDPDFVIMARTDAL
FT                   ANDGLNKALERISAYIEAGADMIFFEGVRKLEEYQALTEQCNVPVLANITEFGVTPLFT
FT                   LEELKEVGVSLALYPLSAFRAMSAAAEKVYDTIRKNGSQKDILAEMQTREELYQVLNYH
FT                   FYEDKLNELFMKEKTT"
FT   CDS_pept        complement(59931..60665)
FT                   /transl_table=11
FT                   /locus_tag="lpp0055"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11203"
FT                   /protein_id="CAH11203.1"
FT                   /translation="MLNKLMWLTGKAQEDWIEKILHLRQKIWPDYQRIKNDTLFKLYSH
FT                   YPLYQWLSHYNGEVVAVINSLPVALDKSLDNLPQEGLNWVLSHLESTTPLTQSNYLAAV
FT                   SVTVNPAYQRLSLSKLLLNRLKASAQEAQYKALIVPARPSQKENYPLISLEDYLKWKRV
FT                   DNTIFDPWLRVHAQLGGKIAYPCQQSRVITANIAQWEQWFGHPLLQTGQYLVKGGLNPV
FT                   TINKEKDIGIYIEPNVWVIHDL"
FT   CDS_pept        complement(60658..61359)
FT                   /transl_table=11
FT                   /locus_tag="lpp0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11204"
FT                   /protein_id="CAH11204.1"
FT                   /translation="MIREYMDKRNNQFTTEILNYFSDLKKFSTSYLEWLTMEHYQFSLN
FT                   NTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLDVTNRIPYVATR
FT                   QFFMRLEALIEINASKTLGVMYATETAAIFEHILFKEISAELCQRKRLDFENSRIKQFH
FT                   DLHLDGVEQAHKDELGKFMDHTLAQEHVDPNIFLQEKEIMDGVYAAIDIMEDWWSGLIN
FT                   AKAHLLEQAHA"
FT   CDS_pept        61465..62373
FT                   /transl_table=11
FT                   /locus_tag="lpp0057"
FT                   /product="hypothetical protein"
FT                   /note="Similar to lysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11205"
FT                   /protein_id="CAH11205.1"
FT                   /translation="MINFSQIQVFIAIVESGGFIAAGEKMHRSQPAITNAIKKLESSLG
FT                   FELFDRKVYRPQLTAKGKAFYQKAREVAAQFMQLENSAETLRSGVETQFSIDLDIALPL
FT                   PGYAPLIQSFIRQYPETCFSLSNNTFVRCLERLERRECHLCIAASHIRSPQIEYLRMPS
FT                   IRMIPVASRDYYDQHKERINNPKLGIYCMQIMIAGTQQELYQLKIEPLSNSMPKWFVGD
FT                   MYIRKQLILSGMGIGRLPDHLVEKELAEGSLVQLNTRDYVAVTMDIYAMRLNNQEHGMV
FT                   SNYAWQSLKSYADDTVSPDLK"
FT   CDS_pept        62518..63237
FT                   /transl_table=11
FT                   /locus_tag="lpp0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11206"
FT                   /protein_id="CAH11206.1"
FT                   /translation="MIDFKINSQPDDESCGPTCLHAIYQHYGLDISYEEVASQVESFLS
FT                   GGTIAPMLGKHALQLGFKATLYVNNLQLYDPTWFNSDGSSNTDVLREMLMQQMRYKRNQ
FT                   YLARGTHAALDFLTLGGAIYFRCLTAEILKEYFGRKIPILTGLSSTYLYNCSREIFNKE
FT                   GKSRSDPIRGLPCGHFVVLCGYNQKHRLVVVADPYKKNPVSGDNYYTVSIHRLINAIML
FT                   GVVTRDGNLLIIEPKYT"
FT   CDS_pept        63273..63833
FT                   /transl_table=11
FT                   /locus_tag="lpp0059"
FT                   /product="hypothetical protein"
FT                   /note="Similar to part of sdbB protein (substrates of the
FT                   Legionella pneumophila Dot/Icm system)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11207"
FT                   /protein_id="CAH11207.1"
FT                   /translation="MPGTENHEFHTLTKSIVKNLLEFTGWNIAPGQKYIHSDPHQCYIQ
FT                   HEGDQTLTIATLSSKVAKYKEEIRTGRTTSRSRDPVIDKCPEEYKLYRDFLDENCFVRV
FT                   RDSAKERLAAKFGVDSRGEVNAHFADLCELEMLGGQSVYEGFVNNYLVMSDKYIKAHPQ
FT                   KDYDPDKINFLSSNPMGYTPKSS"
FT   CDS_pept        complement(64139..64543)
FT                   /transl_table=11
FT                   /locus_tag="lpp0060"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11208"
FT                   /protein_id="CAH11208.1"
FT                   /translation="MNNKKIGEFAKLCGVGIETVRYYQRQGLLHVPLLNKELGAEKIRR
FT                   YGDDDISRLRFILLAKKAGFTLKEIKELLEFDAKNDRERVRDMAEKRIEKLNLKINELT
FT                   EARNRLSLLVTKCIETSSSPCPILMTFEKS"
FT   regulatory      complement(64550..64555)
FT                   /locus_tag="lpp0060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        64613..65356
FT                   /transl_table=11
FT                   /locus_tag="lpp0061"
FT                   /product="hypothetical protein"
FT                   /note="Similar to glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11209"
FT                   /protein_id="CAH11209.1"
FT                   /translation="MNHTSIKKAVLYRMVIEHHVCPYGLKARDLLRRQGYEVEDNWLTT
FT                   REQVDVFKDKHNVKTTPQIFINDERIGGYDDLRHYLGKKVRDPKEKSYRPVIVLFAITA
FT                   LMAMAVSYASFANPFTPHVLSWFIAFSMAVLALLKLQNIESFSTMFLNYDLLAKRWVPY
FT                   SYIYPFAEGLAGILMIAGALNWLSIPIALFIGTVGALSVFKAVYIDKRELKCACVGGDS
FT                   NVPLGFISLTENLMMIGMALFMLLM"
FT   CDS_pept        65555..66646
FT                   /transl_table=11
FT                   /locus_tag="lpp0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11210"
FT                   /protein_id="CAH11210.1"
FT                   /translation="MSKEIKKNLQNNNSAFVYLRSTGLATNSLSSILQYMTRIIVLTES
FT                   AGIALGILGVLFSVIGFVSSTIARIFDPTASKLSRVMSAGILIAAAAGAIPLIYLGTLF
FT                   PAMWVYLGIGIMGFGVLNSSYYLYSDVRKENALINQYKDNPEQYVESIKEKRQAKYEKL
FT                   LNTRLDDKQARVLLVFKLYQLDKKLAVAKQEGLARLYDIVCHRKHTRSLERFIDLGTSL
FT                   TSLIVGVSVLFWGIAAWPIGPILLGISLAVFSVSLSKSAMQFYRKVNKNNALLKEVLSN
FT                   DRYVSLIDANLDNPYDIEEMGTVEKTQEKVCTRELSQESVLSKDQEHKEHYTKLFQPAH
FT                   KTALRPNDEETDELSCKSVLLQR"
FT   CDS_pept        66766..66984
FT                   /transl_table=11
FT                   /locus_tag="lpp0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11211"
FT                   /protein_id="CAH11211.1"
FT                   /translation="MANVTKLSGIHFTVHGLRRTLITIAEGLDISAYALKRLRRPMQQI
FT                   TDYFMKVYGYSTFGNPVRNPTATGSKM"
FT   CDS_pept        complement(67037..68341)
FT                   /transl_table=11
FT                   /gene="hipA"
FT                   /locus_tag="lpp0064"
FT                   /product="HipA protein, DNA binding regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11212"
FT                   /protein_id="CAH11212.1"
FT                   /translation="MVMRKLYILMNNELVGVLTQDNAGGLSFSYVADWISKPHSRPVSL
FT                   SLPLINQRFSGEVVYNFFDNLLPDNPQIRARIQARFQAKSSRPFDLLALIGGDCVGAIQ
FT                   IVERIPQTQRLSIESHVVSEAEIARTLRSYQTSPLGMDKEDDEFRISIAGAQEKTAFLY
FT                   YQNEWHKPFGPTPTTHIFKLPIGYLPHQGIDLSESCENEHLCLLLASKFGLEVAKSKIL
FT                   QFEDEKVLVVERFDRKWSRDNRYILRLPQEDLCQALGYSPNLKYQSDGGPGIKEIMQLL
FT                   NGSQQPQKDRDEFFRAQVVYWCLGAIDAHAKNFSISIQPQGGYQLTPLYDIISAYAIVE
FT                   QKQLSFKKLKMAMALYGKNSHYKIDGIQKRHFIETAKYVQYSKIKAAQIFEQVIDRIDS
FT                   AIDEVSTQLPNHFPEKIADPIFKGMRAFKERMIST"
FT   CDS_pept        complement(68335..68574)
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="lpp0065"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulator HipB"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11213"
FT                   /protein_id="CAH11213.1"
FT                   /translation="MIISSAKDLALYLNDKRKQLKMSQSEVADLVGLKQDTISKFENSP
FT                   DNSRIDTLFRILSALNLNMSLVEKDQKTHEDIEW"
FT   regulatory      complement(68581..68586)
FT                   /gene="hipB"
FT                   /locus_tag="lpp0065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68614..68898
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0066"
FT                   /product="hypothetical protein"
FT   regulatory      69319..69324
FT                   /locus_tag="lpp0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69332..69697
FT                   /transl_table=11
FT                   /locus_tag="lpp0067"
FT                   /product="hypothetical protein"
FT                   /note="Similar to plasmidic transfer origin protein TraK"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11215"
FT                   /protein_id="CAH11215.1"
FT                   /translation="MKKSLMENILTCRLGQQRTNPRKYKVEFLALREDISEALEKGWSI
FT                   TIIWETLRDEGRFTATYNTFRLYVLKYLNGQKFRYSQKEANDQQPKGLAKNQDKEKKPT
FT                   AIPSFTFNPIPNLKELL"
FT   CDS_pept        complement(69995..70840)
FT                   /transl_table=11
FT                   /locus_tag="lpp0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11216"
FT                   /protein_id="CAH11216.1"
FT                   /translation="MSQNLDQSLSDMSEEEQISYMEDWFRDNYEDPAQECPYAEGEYIY
FT                   IYGGPYDAYEELEGQFSDEVPERLITQLADKLSLECYNWSGKEVPSKIFDYIEPNPEYY
FT                   EDFRNNLNMIEKIADLQFDEDVRLHTLKLLYINVITALETYLSEAFTTLINSNPIYKRQ
FT                   FLEKNKDFNERKLPISNIYKQYEAIDDYIKQYLSDLLWHRLEKIEKLYLAAFNLHFSEN
FT                   KQPILYAIHMRHDLVHRGGKDKDGNILVITKNDVIDLTKSVRLFGIHLYSQLTSLNQSN
FT                   "
FT   CDS_pept        complement(71169..71336)
FT                   /transl_table=11
FT                   /locus_tag="lpp0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11217"
FT                   /protein_id="CAH11217.1"
FT                   /translation="MASEEYAKKLRNKEEELNKYHGIENEIEEIEFALDDKDIESAKDS
FT                   LETLKSRLNL"
FT   CDS_pept        71961..72902
FT                   /transl_table=11
FT                   /locus_tag="lpp0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11218"
FT                   /protein_id="CAH11218.1"
FT                   /translation="MKWIFKFFKSNIAVLVLLILVLVLLVLCNISCMPLSCLPQIIQGF
FT                   FILLAAVVTAIFAIHKYQSEQRILRLQKIYFEDSLLGQANSIEGIRSQTQKNMLLTENL
FT                   YNLIINILNQQMVELETIKVELIATFDNTLTHIGLDFFTTDFKKETISKLLHDSGIKRN
FT                   VLPTWISQFEIDSYRFSAFLQAQILILKMQASRLTESNKEDFLSATHRILGDYVRQNYL
FT                   LVERHVLLFNLLSEIVLEFSSEDYLSPEKIFEAFKKERMKKMATLLNTSYKDLIQDFKS
FT                   IDIGNINKEDSIKLDERMKCVREKISDALYSI"
FT   CDS_pept        72941..73105
FT                   /transl_table=11
FT                   /locus_tag="lpp0071"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (ISL3 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11219"
FT                   /protein_id="CAH11219.1"
FT                   /translation="MKLIQRRAYGFRNFENYRTRVKAAVLLIGEFPRNWERPKLRHVKF
FT                   KAYLNFAKT"
FT   CDS_pept        73331..74551
FT                   /transl_table=11
FT                   /locus_tag="lpp0072"
FT                   /product="hypothetical protein"
FT                   /note="Similar to phage-related integrase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11220"
FT                   /protein_id="CAH11220.1"
FT                   /translation="MKFTDTYIRNLKPQQKWFEQIEFSGLGIRVMPGGGKSWIFRFTFD
FT                   GKRYKMTLGKYPGIGLKEARELMLDAEHLKEQGINPIEYAKQQQAKSDNTVKKLAFSWY
FT                   TQYVEKHLKRPLTVKKQIDGDIINLLGDRVLDELETKDITEALDKIVKRGASVHANRVL
FT                   SSLKQMFGYAVSRGTMSTNPASNIRARDIGGHEKPRERVLSLDEIKSLWLFLDSKDSQM
FT                   APQTRIAIKIILLTGVRTAELRLAQWSEINFDDSLWTIPAMHSKASIVHKVHLSDLTKQ
FT                   LLQQLKSISRSDYVLTGADYRQPLTENALPRAIKRIQERLGIPEWTAHDLRRTFATQLG
FT                   ETLQVDPVVIEKCLGHKMPRIMATYNCNEMLPQRREALERWAVCIENMMQDNVVYINKL
FT                   LQNERSL"
FT   CDS_pept        74635..74958
FT                   /transl_table=11
FT                   /locus_tag="lpp0073"
FT                   /product="hypothetical protein"
FT                   /note="Similar to phage-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11221"
FT                   /protein_id="CAH11221.1"
FT                   /translation="MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPH
FT                   TEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVLHAFVKKSAKTPKPDLQLALKRKRE
FT                   VEK"
FT   CDS_pept        74955..75239
FT                   /transl_table=11
FT                   /locus_tag="lpp0074"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11222"
FT                   /protein_id="CAH11222.1"
FT                   /translation="MMKLKTLKAKALKNPEVKEAYDALESEFALIDALLTMRQKAGLTQ
FT                   EELAERMGTKKGNISRLEKGNTNPSWNTLEKYAHACGFDISMAVKRIAS"
FT   CDS_pept        75421..76254
FT                   /transl_table=11
FT                   /locus_tag="lpp0075"
FT                   /product="hypothetical protein"
FT                   /note="Similar to L.pneumophila LvrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11223"
FT                   /protein_id="CAH11223.1"
FT                   /translation="MILRMISLSFLFANAHELAALLELPYVQRLVYLMGIRPYMDRQSC
FT                   IVGIKRRISYQSLRETLYVGPIAGVKTGSPSLQQIKRAVKSLERAGLIEIQSTEKHLIV
FT                   KCIYAELDNPAQKKAVPKPNLYPDTNPTQEDALESGESCNFGQKPNIANNTEADPPQKS
FT                   EDYNYIYMCSKFEKFWKSYPHPVDREAAFYQFRELNPDDKLFEKIMTGLHGQIESYNLQ
FT                   VMLSEWVPKWKYPSNWLAKKCWQTDPYVFEQSLPVVHDLENQQIGIQEDSNLDHT"
FT   CDS_pept        76560..76958
FT                   /transl_table=11
FT                   /locus_tag="lpp0076"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11224"
FT                   /protein_id="CAH11224.1"
FT                   /translation="MTKDYFKKIKEYYRKLTLFYSNQGKNERERISVEVFLSLLGINYS
FT                   KVDVISIEEQNNPVDVQYKECRFQIKEIPDDVKRHRDIKQTYEALEKADKDKIDWPISV
FT                   YDKSPYQTAWERVTNKLGSVNEIFSASK"
FT   CDS_pept        77084..80260
FT                   /transl_table=11
FT                   /locus_tag="lpp0077"
FT                   /product="hypothetical protein"
FT                   /note="Similar to cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11225"
FT                   /protein_id="CAH11225.1"
FT                   /translation="MWIVRIALARPYTFIVLALLLLIIGPLSILRTPTDIFPDINIPVI
FT                   SVIWSYSELPPDDMGNRITSVFERVLPTTVNDIEHIESESLIGVSVVKLFFQPGVNIEL
FT                   ALSQVTSIAQTILRSLPEGTLPPLILNYKASTVPILQLVLSSDTIPEQELNDLGNNFIR
FT                   PQLAPVAGASLPYPYGGKVRQVQVDLDLQAMQTYGVSPLEINTAISAQNLIIPAGTQKI
FT                   GDYEYIVKLNSSPLKVNDLNDMPVKTTPGRVLYIRDVAHVRDGFTPQTNIVRVDGKRAV
FT                   MMSVQKTGGASTLGIIKQIKALLPKIKEIMPAGLNLGQFADQSIFVTAAIQGVITEGII
FT                   AASLTALMILIFLGSVRSTLIISISIPLSIIGSLTILSALGETINIMTLGGLALAVGIL
FT                   VDDATVAIENINWNLEQGKEVEEAILDGAHQIAIPALVSTLCITIVFVPMFYLGGVAQY
FT                   LFVPLAEAVIFAMLISYLLSRTLIPTLAKYLLHKHDPEIKEQSQNFFVRLHHQFEKKFE
FT                   IFRERYSNLLNKALHNATYFVGIFLVFVISSVVLLWPWLGSNFFPNVDAGQIKLHIRAP
FT                   TGTRVEVTARYVDTIDKLIRTIIPPQELDTIVDNIGLPVSGINLSYSNSAPVGPEDADI
FT                   LISLKEKHHSVFDYQRELRTVLNQKFPDISFAFLPADIVNQTINFGLPSPIDIQIIGLK
FT                   QDENRVYAKKLMQRLKKVPGLVDIREHQAMNYPELFVDIDRSKAKELGITQRNIAMSLF
FT                   IALSGSFQTSPTFWLSPENNVSYPLVVQAPQYVMNSLQALRNIMIDGISPNIQSPAQHQ
FT                   ILGALGTITRKWTSVVESHYNVMPVIDIFAATQDRDLGSITHDINQIIAEMNSEVPLGS
FT                   TIAIRGQIDTQHQAFQGLYWGIVFSVLLIYLLIVINFQSWVDPFIIITALPAAIAGIAW
FT                   FLFITCTTLSVPALTGAIMCMGVATSNSILIISFARQHLLETNNPLLAAMEAGRTRIRP
FT                   VLMTASAMIIGMMPMALGLGDGGEQNAPLGRAVIGGLSFATIATLFFVPTVFYIIHNHQ
FT                   LKVKQRNNHA"
FT   CDS_pept        80253..81398
FT                   /transl_table=11
FT                   /locus_tag="lpp0078"
FT                   /product="hypothetical protein"
FT                   /note="similar to membrane-fusion protein involved in
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11226"
FT                   /protein_id="CAH11226.1"
FT                   /translation="MLKGIKFQIKEHKRNPLFVFLVLFLLFFLTVIFYRVYSAIILRQQ
FT                   TRADEVNYVRVLTATPLKGTERIILPGNVQAWHDAVIYARTNGYIKNWYVDIGSHVKKG
FT                   DLLAVIETPELDAQLRQAEADLNTAIANNQIAQSTAKRWVNLVKSNSVSKQERDEKVSD
FT                   AASKYALEVAARANVDRLKELVSFERVIAPFDGVITSRTTDIGSLINAGSSDTGLPLFQ
FT                   IAQTNPLRIYVKIPQNYSSRITPDMKVSLTFAEHPGQTFPAQLIKTAQAIDPATRTLLA
FT                   QFKAENNNEELLAGGYTEVTFTFTIPKNTFRLPVNTLLFQAQGLQIAVVDKNNQVVLKP
FT                   ITISRDFGNVVEIDQGINAGEKIILNPSDSIINGELVKVVS"
FT   regulatory      81385..81390
FT                   /locus_tag="lpp0079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81395..82834
FT                   /transl_table=11
FT                   /locus_tag="lpp0079"
FT                   /product="hypothetical protein"
FT                   /note="Similar to outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11227"
FT                   /protein_id="CAH11227.1"
FT                   /translation="MKKLIILGCVIFMVTSCSFAPKYERPLMPVPEHFKETGKWVPAKT
FT                   VIPSSKITPWWEVYNDPVLNKLESLIEVSNQDLKKIFYRYQEALALVQVSRAGFFPSIM
FT                   GTLNANRQQTSTTMADPSTIPLYNNYIIGSQVNYEIDAWGSIRNAVAAQQNTAHATEAE
FT                   LAAISLSLHAELASDYFSLRGCDESQRILDATVAAYKKALYLNKKRYHGGASPIEDVDQ
FT                   AETQLENAKTAAADMRLKRAQFEHAIAILIGQFPADFSLAPAKLSRTLVTVAPDLPSTL
FT                   LERRPDIAAAEFRVQAANAAIGVARAAFFPVLDLTGIIGFQSQSLSNLISKPSLIWSLG
FT                   PISTLALAQPLVAQPIFEGGKLVGQLKYAKASYFETVANYRQTVLTAFQEVEDSLVAVK
FT                   QLDKEIRSQRAATQAAKRALTQANNRYSGGIVTFLDVVVVENTALQTELAAVNVFTRRQ
FT                   IASVQLIKALGGGWVYLNKER"
FT   CDS_pept        complement(83095..83403)
FT                   /transl_table=11
FT                   /locus_tag="lpp0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11228"
FT                   /protein_id="CAH11228.1"
FT                   /translation="MPLSALTKDKITKILDALTEFDPAKRIMPADALIQWEHLLNEFDQ
FT                   IEACHDDHQDSVKPPQLKQSLFTRSPAFFSLASCSEDTSDEAEQSEPAPPIWRRDSI"
FT   CDS_pept        complement(83452..83688)
FT                   /transl_table=11
FT                   /locus_tag="lpp0081"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11229"
FT                   /protein_id="CAH11229.1"
FT                   /translation="MVDPETMNIILIDYAFATPVDQPRTDKSIHGTKEYLAPEIMCDNS
FT                   ITIKSDSFALGLTIAQIWGYLFNLNITPFTSFD"
FT   CDS_pept        complement(83696..83923)
FT                   /transl_table=11
FT                   /locus_tag="lpp0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11230"
FT                   /protein_id="CAH11230.1"
FT                   /translation="MNKLLRCKTPALDDKQGYLVMKNAGTMDLFELLEALDAGIITLNV
FT                   KEKLQLTYTIIKAVIEQSHNLNLIHTDLKP"
FT   CDS_pept        84154..84903
FT                   /transl_table=11
FT                   /locus_tag="lpp0083"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS5 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11231"
FT                   /protein_id="CAH11231.1"
FT                   /translation="MHHNISEELWSKIYSYLRGLKGLHVKNEASLRRFIEGVWYVLRTG
FT                   CQWRLLPYYYGHWRQIHRRYKVWSDRGIWSELMSVVSDVDIQTMMIDGTIVRAHACASG
FT                   YVKDGNETQALGRSKGGFTTKIHALVDGLGNPIKFILTGGHRNDITQAAELLKEQHDTI
FT                   VLADKGYDSQELIDTLHHQRCSPVIPSRKNSKYPRKIDKQLYKERFLIEAFFSKLKHFR
FT                   RIFSRFDKTTSAFSGFLHLAGALIWMR"
FT   CDS_pept        84891..85124
FT                   /transl_table=11
FT                   /locus_tag="lpp0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11232"
FT                   /protein_id="CAH11232.1"
FT                   /translation="MDALKISFTEPSKQEFKRDLVRLRGGKNDFLVSVELDINALRTFQ
FT                   SRDKSWPRDKDPFKPVPEGFKISPGRKKIPPR"
FT   tRNA            complement(85322..85397)
FT                   /gene="tRNA-Asn"
FT                   /product="transfer RNA-Asn"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 89.51"
FT   CDS_pept        complement(85457..86635)
FT                   /transl_table=11
FT                   /locus_tag="lpp0085"
FT                   /product="hypothetical protein"
FT                   /note="Similar to aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11233"
FT                   /protein_id="CAH11233.1"
FT                   /translation="MDIALAKRVQKVKPSPTLAVAAKAAQMKAQGLDIIGLGTGEPDFD
FT                   TPQHIKLAAISAIEAGDTKYTAVDGIVELKEAVKNKFKRDNELDYQLNQILVSVGGKQS
FT                   CYNLCQAYLNPGDEVIIPAPYWVSYPDMVLLADGVPVIIETTPAQRYKINAQQLEQAIT
FT                   PKTRMIFLNSPSNPSGIAYTQNELKELGDVLKKHPQILIATDDMYEHIIWSQAFTNILN
FT                   ACPELYDRTIVLNGVSKAYAMTGWRIGYAAGPAPLINAMKTIQSQSTSNPCSIAQRAAV
FT                   AALNGSNESIEEMVNAFHQRHDYVADRLQSIDGIEVIPADGTFYIFPSVQAIIEKRGYA
FT                   NDIEFSEKLLNEVGVALVPGSAFGTEGCIRISFATGIDTLKDALNRLQRFCS"
FT   regulatory      complement(86641..86646)
FT                   /locus_tag="lpp0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        86682..88673
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="lpp0086"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11234"
FT                   /db_xref="GOA:Q5X906"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X906"
FT                   /protein_id="CAH11234.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKVELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPEALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTMTGSMQRALTETERRREKQKA
FT                   FNLKHGITPKGINKSVEDILEGAYIGKRKTMVAEQAPRYTHWSPQELAKEINALEKQMY
FT                   AHAQNMEFELAAKIRDEYLLLKEQLMKI"
FT   CDS_pept        89028..90641
FT                   /transl_table=11
FT                   /locus_tag="lpp0087"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF and EAL domains)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11235"
FT                   /protein_id="CAH11235.1"
FT                   /translation="MNIKSNLAHSSVILKGHVNRYAFLGLLISVGSILIASCIVSYQLT
FT                   GSVSLGGFIQAQRSNPAIWILDLTPFMFVYWGQAFCYGLVNKAESLLVDKTKELLNISG
FT                   NLELKLKYESNHDSLTNLPNNRLLNEKIRLAIEQLGAQGELAVIVIKINDLNYNFSSFN
FT                   ANNIVKQFAEKLKSILIDPYMLKASLGINMVARLQSDEFAILMPRLKKDLDINELLIHL
FT                   LTLLNNNLMVDGISINVTSTVGAAIYPVHGEEDDVLVNHAIIAVYQARKENKSYAIYSP
FT                   EMEEDLIQNRMVMNELQRSIENKDLKIYYQPIVELANGQIVGAESSARFEHPELGLLSA
FT                   EKFMPLIEGTNLIHNLTTLMLKEVIKQLAAWHDAGHKIFVSVNLSVHHELPELIEKLLN
FT                   DYEIAPQFLKLEFTERACLTEQMVTKEVFDRLSTMGIKLCIDDFCSENSSFIHLTNFPI
FT                   ENIKIEKSFVLKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIADQNALEKLRDLGCLYG
FT                   QGLYFSRAVNVAEFTSLLKK"
FT   CDS_pept        complement(90733..92304)
FT                   /transl_table=11
FT                   /locus_tag="lpp0088"
FT                   /product="hypothetical protein"
FT                   /note="similar to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11236"
FT                   /protein_id="CAH11236.1"
FT                   /translation="MRRQWYIGFGVILLCLFALFAMLQDIVWFFAFLIPIVILWIYDVL
FT                   QTKHTILRNFPVLGHVRYFLEFLRPEIQQYFIATDESELPFNRETRSMIYQRAKNVRDT
FT                   IPFGTERDILSVGYTWALHSLSPKHSSEVEPRIDVGGPDCKKTYNASRLNISAMSFGSL
FT                   SSNAIMALNKGAKLGGFYHNTGEGGLSPYHLQGGDIVFQIGTAYFGCRDDKGDFDENEF
FT                   IKEASRDEVKMIEIKLSQGAKPSHGGILPAAKLTEEIAKVRKVPMGKDVLSPIAHTAFD
FT                   NPVGLLHFVKRLRDLSGGKPIGFKLCLGRRHEFMAICKAMLKTNILPDFITIDGAEGGT
FT                   GAAPVEYTNFIGTPLEAGLVFVHNALVGTGVRDKIRVICSGKVTNGFDLLTNIALGADI
FT                   CNSARAMMMSIGCIQSKQCNANTCPTGVATQKKRLQYGLVVDEKKFLVANFHNNTIKSF
FT                   LEMVGALGLNNPSDLKPSHIMRRIGVDEVKSFDQIYTYVKPGQFLQGDIPDDYRVHWEH
FT                   ADPDKF"
FT   CDS_pept        complement(92382..92696)
FT                   /transl_table=11
FT                   /locus_tag="lpp0089"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11237"
FT                   /protein_id="CAH11237.1"
FT                   /translation="MTNIKLCKIKLLNKIYEIKCPDGEEVSLILAAEKLNEKMQNNKNK
FT                   FKHLDNFHILLLAALDIGHELIVCKNEQEQQRLQVTQFISSLENKINKAVVGSEMDSNQ
FT                   "
FT   CDS_pept        92852..93433
FT                   /transl_table=11
FT                   /locus_tag="lpp0090"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11238"
FT                   /protein_id="CAH11238.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQINNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLIEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
FT   CDS_pept        93537..94847
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="lpp0091"
FT                   /product="hypothetical protein"
FT                   /note="similar to proline aminopeptidase P II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11239"
FT                   /protein_id="CAH11239.1"
FT                   /translation="MISQQEYKARRKKLAAQLPDDSVAVIPAAHEVLRSGDAHYRFRQD
FT                   SDFYYLTGFNEPDALLVIIAGKDSQSILFNRPRNPAEEQWTGKRLGQDGALQELGVQAA
FT                   YPLSSIAEELPKLFSGKSAIYYDLGRNLSLEKKIRHVLSSLKAQVRRGIKAPESLCDLE
FT                   PILSEMRLLKSDAELELMRQAARISVAAHKRAMQVCQKMEYEYQLEAELIYEFSRHGCR
FT                   SVAYDPIVGGGANACILHYTENNKPLRRGDLVLIDAGGEYGSYAADITRTFPVSGTFSP
FT                   EQKIIYELVLKAQKAGIAAIEPGLPWNHIQQTIIRILTEGLCDIGILKGDLEELIKNEA
FT                   YKPFYMHNSGHWLGLDVHDVGRYKINNEWRPLEAGMVLTVEPGLYISAGMEGVDKRWWD
FT                   IGVRIEDDILVTRAGYEVLTGDLPVNVDDIEALMRGE"
FT   CDS_pept        94837..96039
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="lpp0092"
FT                   /product="hypothetical protein"
FT                   /note="similar to 2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11240"
FT                   /protein_id="CAH11240.1"
FT                   /translation="MANKETDILIIGGGLTGASLSLALQGLGFSVTLVESRPYSDKVNP
FT                   DFDARSLALSPASQRILAMLGVWEILKEYTTPIHMIHVSDQHRFGVSRLHGEKNSPLGY
FT                   VVEMQYINRALSILINKEHLLAPAALKSIDFNNSTATVAHGDDMISIQAQLIVAADGTE
FT                   SMTRHLCNLPVKIKDYAQDAIVANVGLIKPHGNRAFERFTPNGPLALLPMMNDKMSLVW
FT                   ASKPEEAKRLVMLNDGDFLRELQTAFGYRLGRFGKVGKRYSYPLKQVLMPQQTKWPVVF
FT                   VGNAAHTLHPVAGQGFNLGLRDIAALAQCISQKGLNPQMLEHYLKLRAHDQQMITWLTD
FT                   GLIHLFTSRLPGMGVARNLGLLALDNIPALKNLLARYARGFGGITPDLVCEIALSTGEF
FT                   Q"
FT   CDS_pept        96036..97199
FT                   /transl_table=11
FT                   /locus_tag="lpp0093"
FT                   /product="hypothetical protein"
FT                   /note="similar to monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11241"
FT                   /protein_id="CAH11241.1"
FT                   /translation="MSQHFDVLVIGGGIVGLTAALAMAQRHYTVAVIDAGTLMVNTDKS
FT                   DLRVYAINKASKMLLSELGVWQHLDDARVAPYNKMHVWDGVSGAYIDFDSRSIAEPNLG
FT                   AIIEESILKQALLRRISSESKINLFPQSVIDEVCHLERSIKISGQNTAWEGQLLMIADG
FT                   ANSPMRHKLKVDVTSWSYEQQALVATVNSEKSHQNTAFQVFHPDGPLAFLPLSNLNQCS
FT                   IVWSTHADNAMRLKLLDDNEFSRELTRAFGGQLGQIKVESDRHQFPLQMRHVKQYAGHR
FT                   WLLLGDAAHTIHPLAGLGLNVGLADVKSWLTCLEMGKGELISKKVLGAYQRERKHSVWQ
FT                   IILLMEGFKRLFGTSASPVTSLRSLGLRACNEFIPIKRLFMRQASGL"
FT   CDS_pept        97375..98142
FT                   /transl_table=11
FT                   /locus_tag="lpp0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11242"
FT                   /protein_id="CAH11242.1"
FT                   /translation="MTRLKFFSKFQKALLQLETNVSNLSNPLVGSKIKELQTKKILVRA
FT                   DGRSLDHLHKLGGLPQRVESEKLEKVRITDVERYQKFNMNPFGWGACASAEDLRKFLEN
FT                   YSELTKQAWVHKFYGSSTSLLTLKSEVGISCGDHDEEKEELVVDSVSFEQIIASTCPKY
FT                   REKYLGGGLVPNAMKDFKSKVPHTMRLGDFSSEKSTLEWLLINDCEEEFAKLCKEIYGD
FT                   TPLKILLMRFEGDKYLADAVTYYVKEAASSPRV"
FT   CDS_pept        complement(98132..99484)
FT                   /transl_table=11
FT                   /locus_tag="lpp0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11243"
FT                   /protein_id="CAH11243.1"
FT                   /translation="MPYSLGRFFMRSKLVSFFSRSSRPIKAIPSKTWFETQLKSSGLDK
FT                   KFSIDELSETQSSVRVFANKKYLPDTQTINEALTKVTAVNVSGDRSGYFQNGLPFPNEA
FT                   GYFEKIPAGHPELLSPIERLASSKKVVSSHSLVTASGGYPLTNPLLPYRKPIKVSIFSL
FT                   AGPSFENNYLHYRLFLLDPIQKIIDSPLFSHLHDGLPIHFDDAKKELGRYDTNNVMARI
FT                   RLGFPYLARFSSGGFYPSFSKSNAIIFLSEAYFRYQLEDVSLLLASVNQTAKETGKAAF
FT                   LKATAVGMGFFAKIDCGYDIQHMIFPYYLRAYKKLLSEHKFPWIAKIEFPIFNEIQQEQ
FT                   FDSIFEDYNGSTKVYQSTRDVLEFREDEIEKYFPAAINPSDAFALTGNEWGYGSVESMI
FT                   GNNSSIRFDQVHHMNPLILDPSHHVEVQINKDHRVELSANAMPRLSSSIKP"
FT   CDS_pept        99743..100201
FT                   /transl_table=11
FT                   /locus_tag="lpp0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11244"
FT                   /protein_id="CAH11244.1"
FT                   /translation="MFGRLWLRLPACLPALDLSKMVLGRMPAETTFESVKHQFEQELHR
FT                   VGLKRFQENIHAEKLILEQLLRQREELTKKIDEECLNPALRRCANGHDVKGLFWSNMQG
FT                   NLAKIQSKKERVEMDEMIDWLCARRRFLKEWNNLSVDKELNCSASPTL"
FT   CDS_pept        complement(100198..101145)
FT                   /transl_table=11
FT                   /locus_tag="lpp0097"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11245"
FT                   /protein_id="CAH11245.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKENGKESTLDKVNFCRKEFAR"
FT   CDS_pept        complement(101142..102665)
FT                   /transl_table=11
FT                   /locus_tag="lpp0098"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11246"
FT                   /protein_id="CAH11246.1"
FT                   /translation="MKNNKRHVYGLILTLLLLGSGIFLYRHIVLDVPLTDTETINSWMV
FT                   ESNLRFTADRNTPIKASFNIPYLPPNFAILDEYFVSRNYGVTTNLNGSNRETVWSIRRG
FT                   HGPQSLYYRAIFRQTDSDESSLPKPSVTKSQPLNDSQKSAVETITNQVRSTSADIQTFA
FT                   QSTIKELNKRDGNAKLLVGNEFNDDNIINATILILNQSKIPAITVQGIYLNQQKKADLK
FT                   SLLAVFNGKNWIYINPKTGSAGLPKEFLIWQYGNGPLFNVVGGNRAQFSLTVSPTPINA
FT                   LSVAKSRGLEDSQLLRFSLLQLPVNVQGIYKILLTVPIGAFIILILRNFIGIKTFGTFM
FT                   PVLIALAFRETHVAWGITLFVIIISFGLLARFYLDQLRLLLVPRLAAILTVVILLMIFI
FT                   SVLCQNLSLDTGMSVALFPMVILTMTIERMCITWDERGASEAIKSGVGSLAAAVISYGA
FT                   MSYEPLQYLIFAFPELLLVLLSLILWFGQYRGYRLVELKRFKSLASAMK"
FT   CDS_pept        complement(102655..103182)
FT                   /transl_table=11
FT                   /locus_tag="lpp0099"
FT                   /product="hypothetical protein"
FT                   /note="Putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11247"
FT                   /protein_id="CAH11247.1"
FT                   /translation="MRSKFVLFMLMSLLTGSLMANSEAQIYGYVEKATLIDQNLTLSAK
FT                   LDTGAKSASLHAVNITEIEKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRTSEANPG
FT                   LLRTTPMKRPVVLLNIKLGDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVDPALTF
FT                   TTKSKSPVNNEK"
FT   CDS_pept        103432..105357
FT                   /transl_table=11
FT                   /locus_tag="lpp0100"
FT                   /product="hypothetical protein"
FT                   /note="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11248"
FT                   /protein_id="CAH11248.1"
FT                   /translation="MPHASDENQASKPTDLVFILAIAGRIDAQSRILAQKLDKSRSIYY
FT                   AYAVMDSLSSSYSMFKYFFDLFASPNDNDAMHEFLNSPAGLITIAVESVFLVTFSVLAC
FT                   QFENEKEDYYKKFIANAWPYFRDVMKGLKNAYKGWRSAVVAFSLIGGVDAKFLILPMGV
FT                   ILGVFAAANRFWIRSMLEDRKTMMSENIALLMEIKKLISLSHEESFSYFKRIRYQTMQT
FT                   RNLAFWAVAAGGLLDGLYLYVGVLSLAVLSPQLLMAMALICAFYTVACVITRIYEEYDF
FT                   QLRLLVTQTKCQLALITKELETNYAKLLLLQDKMDLDKVDQEELKRLKRLVHNLITRFD
FT                   DSRKLLSQQSNRTYLSSALLGMKNGLYAYGALASVLFLVGSILVMAGVSFPPALLTACI
FT                   ILGLVLVLSFTIHSLVSNYWHQKKQETQKQRPYERLIEWNNCLNDEFNKTELLAPEEFH
FT                   KLLNDGLSLDPSPQFFFQEWFEVLRSLFSGFGKGQKFIDFAGNSLQELGEDGHYRDTPV
FT                   MYVLSVFSALLFGVTLALRALAKGLGRTPLAQQAKLTEDSKEASVSPEITKGVMQKTEE
FT                   QRESIQSEKTRTDSPGHTDSLSLFGIFETKTKRNQPDSPSVPHSKSESALNQLIPSQNS
FT                   TILGLA"
FT   CDS_pept        complement(105323..105913)
FT                   /transl_table=11
FT                   /locus_tag="lpp0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11249"
FT                   /protein_id="CAH11249.1"
FT                   /translation="MQENFDPSTITTLHKTSIIRWKANGIEYQHKQFLQLVEENHAFNF
FT                   QLWHAEDKARRDDMGFEFVYQAKREIDAFNQQRNNRMEAMDEWLYKALQPENHNHCPVN
FT                   SESPGMIIDRLSILSLKSYHMDLQTKRQDVGVEHRMACTQKLEIIQQQLNQLALCLDEL
FT                   LNEVRAKTRTFRVYHQFKMYNDPKLNPELYCSD"
FT   CDS_pept        complement(106140..106868)
FT                   /transl_table=11
FT                   /locus_tag="lpp0102"
FT                   /product="hypothetical protein"
FT                   /note="Similar to arginine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11250"
FT                   /protein_id="CAH11250.1"
FT                   /translation="MKRFMFILLIFLNFHAFGKPIIIGVPEFAPPFVSRSGGGEFYFGF
FT                   NIDLMNSICKIIEEECQYKGMNIQQLYTSLNAGKVDIMLAPTPIVSTGDTNYIFSLPYL
FT                   PSNAQVITLKANDNINTLMDLKGKKVGTLKYTLYGGLLQEHFQDFFDLVEFSKLSDMAL
FT                   SLSNQKIEAIVLNAHAAKYAMSNSATELKMVGDQIPIGNGYGILALKNNAPLIMKINKA
FT                   LLQIEKDGTYLEIYNTYFSD"
FT   CDS_pept        complement(106959..107405)
FT                   /transl_table=11
FT                   /locus_tag="lpp0103"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11251"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8Y9"
FT                   /protein_id="CAH11251.1"
FT                   /translation="MTIWVDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAREKTNFANALDRWLAKSK"
FT   CDS_pept        107516..111490
FT                   /transl_table=11
FT                   /locus_tag="lpp0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11252"
FT                   /protein_id="CAH11252.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQIPA
FT                   QKNQFSLNHSVPFGLPASLSVLAIVLTYAPNLLHRELSEQLLTMLDSIRETETSVDNQL
FT                   AERCTEQLNYYRDAKPVLIALKERGAKDLIQILEQADERSLLAFSHLAKDTDLNILIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLIDESINALSIRLLLSLISSEKA
FT                   IEKLKEARACLAQYPFSIDLHAMRAVFDFYQYELKKDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIDYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGKI
FT                   RTKINQLDPYLFDTPQLYQLASDLITKSCNSGKEPLSSSPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLLIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLYQMECLLEENKRGDELNNKGLEVLYHYYALNYPNLRSDLFLK
FT                   VVNHIYSRFFTKGNNETEGRNELLHWLKQNFPLIDKLPKELDRKKEIFLYNSAGKKIGF
FT                   LGESNVAMTFVNEEIVLLARTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENAIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGIIRNKNNALELFHYILNRDSRRSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISQDKKQETICDAVLDRLINSEACAALVLKEFLGDRTHNSIQKANNPEIGKVSQFFDRR
FT                   HIVSLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNPDSPQAWQGKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANSGITSLFYKQKTLNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWSKRD
FT                   KQKKSPIICSYLLSYTGKKSVLSHLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQLLDRKILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLVSAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNTEN
FT                   SSSKIIKFCDDPTPCPTRKKAGDFINAPVAESRTNSLYLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQPKKSINYNTPAITSNFESIM"
FT   CDS_pept        111711..112175
FT                   /transl_table=11
FT                   /locus_tag="lpp0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11253"
FT                   /protein_id="CAH11253.1"
FT                   /translation="MRILLSFYLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNITNLDLWITHPVTDPGASAGWTSRLQAGKWSALVVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPTSNQGTFWVAEDLSLAALNAAVGGRGFVLPEK"
FT   CDS_pept        112571..114751
FT                   /transl_table=11
FT                   /gene="rnr/lidP"
FT                   /locus_tag="lpp0106"
FT                   /product="hypothetical protein"
FT                   /note="Similar to exoribonuclease RNase R"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11254"
FT                   /protein_id="CAH11254.1"
FT                   /translation="MSKKSKDPFYKREREKYAEPIPSREYIMEILDEYGRPMSRSKLFD
FT                   KLDLSSESQQESLGFRLKAMLRDGQIMQDRRGRFCLLQKINLLRGTVQGHPDGFGFFIP
FT                   DDGSEDMVLSAKEMRAVMHGDMVLAYQSGLDRRGRPEAKIHEVLEHANTTVVGRFFTDH
FT                   GVNFVIPDSKRLTQDISIPQEFIGEAKNGQIVLVELIAYPNKRSQAIGRVIHILGEHMA
FT                   PGMEIQVAIHAHGIPFEWPDDVLAEVGKIPQQISEEQLKGRTDLRNLPFVTIDGEDAKD
FT                   FDDAVYCYKKPKGGFQLYVAIADVSHYVAKDSALDQEAARRGNSVYFPGKVVPMLPEAL
FT                   SNGVCSLNPHVDRLCMVAELSITQEGKISRSRFYRAVIHSHARLTYTAVGAWLEQGKTD
FT                   EKHQALWPMLESLYDLYHILLDTRRLRGAMDFETTETRIEFDENKKIKCIVPVIRNDAH
FT                   KLIEECMLAANVATARFLEKAEIPTLYRVHAAPEEDKITALRQFLGELGLSLGGGRKPG
FT                   PKDFQRTMNMIGDRPEKHLIETVMLRSLKQAQYVESNEGHFGLAYSAYTHFTSPIRRFP
FT                   DLLIHRAIGHLLDNHPVYEFEYSHEDMNRLGKHSSMTERRADEATREVITWLKCEYMQD
FT                   KLGQVFKGRISAVTSFGIFVELDEIYVEGLVHVTSLKNDYYTFDSAKHRLIGARGGQVY
FT                   RLGDKMTVLVARVDLNERKIDFEPVEDEVCNE"
FT   CDS_pept        114744..115493
FT                   /transl_table=11
FT                   /locus_tag="lpp0107"
FT                   /product="hypothetical protein"
FT                   /note="similar to RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11255"
FT                   /protein_id="CAH11255.1"
FT                   /translation="MNEQYVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLVKAE
FT                   NAHVPIEKLSSQKMNQQFSEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDG
FT                   ITDPHNLGACLRSADATGVDFVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAM
FT                   DILKQQGVWIFGAAGEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMG
FT                   SVESLNVSVATGVSLYEVIRQRGQFRE"
FT   CDS_pept        115486..116136
FT                   /transl_table=11
FT                   /locus_tag="lpp0108"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to ribose 5-phosphate isomerase RpiA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11256"
FT                   /db_xref="GOA:Q5X8Y4"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8Y4"
FT                   /protein_id="CAH11256.1"
FT                   /translation="MSELKIKAAKAAIAYIEDDMVIGVGTGSTVNFFIKELAAIKHKIE
FT                   ACVASSKATEALLRAEGIPVIDLNSVQDLPIYVDGADEVNERGEMIKGGGGALTREKIV
FT                   ANVATQFICIVDESKVVKRLGEFPVAVEVVPMARSFVARQIVKLGGDPEYREGFVTDNG
FT                   NIILDVFNLNFSTPMALEDSLNVIPGVVENGVFAKRLADKVLVASASGVNNLK"
FT   CDS_pept        116200..117579
FT                   /transl_table=11
FT                   /locus_tag="lpp0109"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11257"
FT                   /protein_id="CAH11257.1"
FT                   /translation="MDTHKVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVK
FT                   ERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSD
FT                   QKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYC
FT                   VDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDY
FT                   ALSPFLDKGEHWQSLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQG
FT                   GNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPI
FT                   EKKIVEAMSIKKELEQKYVDLCTRSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQN
FT                   SFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDID
FT                   I"
FT   CDS_pept        117963..119156
FT                   /transl_table=11
FT                   /locus_tag="lpp0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11258"
FT                   /protein_id="CAH11258.1"
FT                   /translation="MPKVIIFTDFDGTVTGKSGNETVFTEFYQSLLQGYKKDVEQDYKN
FT                   TPMKDPIEAQALFEAKYGKYNENFDHDQQDVDFLMSPDAVALFHEVLKNDDVTVNIVTK
FT                   NRAEYIKAVFKYQGFSDEEIEKLTILESGYKFNDVNSRLNHPTERANRVYILDDSPTDY
FT                   AEMLRAVKGRGYNEEEIRGYCKNPGEFEWSQYLEDVREMFPPKENSPEEVRLPYEQGDE
FT                   VSIGEETPALLQEDNLSQREETATVLSNQPVPSSDFRTLKIMGAFAGIGFGFGFALGVT
FT                   LVATGVFAPSGVGLLGALTLGAISGTGAAALSSAIGFAVAKGTDITPEPVSEEPVPAVK
FT                   QSSHEAMRGLGGSQLLSTNNIHPVGHFPSVLSRRTPTKGKEEQCQEEYVLTNPLNNS"
FT   CDS_pept        119322..119651
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0111"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein, truncated"
FT   regulatory      119753..119758
FT                   /locus_tag="lpp0112"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119766..120218
FT                   /transl_table=11
FT                   /locus_tag="lpp0112"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11260"
FT                   /protein_id="CAH11260.1"
FT                   /translation="MRVLIVEDSAFNAFCLRRLLESVVASISVTIVNNSQAALSFVNNY
FT                   CPDIVVVDGDLGASPDEMNCNGPELAGILLQKYPQLPIVAWSDSDAMREDFIKVFKSHG
FT                   LFLNEYNTWPKVIGLERIHKTWSYYFGEFIGGQNPSFASQTSINYY"
FT   CDS_pept        complement(120248..122938)
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="lpp0113"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11261"
FT                   /protein_id="CAH11261.1"
FT                   /translation="MKPPLILIDGSSYFFRAFHALPPLTNSKGQPTGAIYGVANMVKKI
FT                   IKDYQPEEIAVVFDAKGKTFRDEWYPEYKAHRPPMPQELSSQFQPLIQLLQAMGLPLLI
FT                   IDGVEADDVIGTLAKQATEQGIPVVISTGDKDMAQLVNEHVSLINTMSNYSMDIDGVKA
FT                   KFGVTPEQIIDYLTLIGDSVDNIPGVEKCGPKTAVKWLTEYQTLDNLLAHANEIGGKIG
FT                   EYLRASIPHLPLSKKLVTIKTDLELPLNLNQLMPKPADNEQLIKLTRELEFKSWLKELL
FT                   QEEENQKSPKEMDASNNKSYEIITTHQQLNHWLNKLEQSQQFCIDTETTNLDVMQAELV
FT                   GISLAVEEDNASYIPLAHTDGSTQLVKEEVLTALKPILENPAIGKIGQNIKYDYSVLKN
FT                   YGITLKGIRYDTMLESYVLNSGAGRHDMDSLALKYLGYKTISYEDVAGKGAKQLRFDQI
FT                   PVEKAGIYAAEDADITLRLHHKLYPMLDKPLRNVLHDIEMPLLTVLADMEMHGVLIDPV
FT                   ILEKHGSRLKEQMKSLEQEAVQLAGKAFNLNSPKQLQEILFDEQKLPVVAKTPTGQPST
FT                   AESVLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGR
FT                   LSSSDPNLQNIPIRSEEGRLIRTAFIAPEGSLIMAADYSQIELRIMAHLSQDDNLLRAF
FT                   ANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIYGMSAFGLAKQIGVERQDAQH
FT                   YIDTYFRRYPKVLEYMERTRKQAHQLGYVETLFGRRLYLPEINSRNLMRQKAAERTAIN
FT                   GPMQGTAADIIKKTMLAISSWEHSQKSPSAKMIMQVHDELVFEVRKEAVEECHAIIHNL
FT                   MEQTVKLSVPLVVSIGTGSNWDDAH"
FT   CDS_pept        complement(122941..123996)
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="lpp0114"
FT                   /product="hypothetical protein"
FT                   /function="Lipid A biosynthesis; third step"
FT                   /note="similar to
FT                   UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11262"
FT                   /db_xref="GOA:Q5X8X9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8X9"
FT                   /protein_id="CAH11262.1"
FT                   /translation="MNSSLRDIANLVQGMVIGNDAITVSTLSPIDNILPGSLVFAEGED
FT                   NIKLAENSEAAAILIGQGTIDSPKPLIQVKNPFKAFIALLNHFYPPRRISPGVHPTAVI
FT                   GAEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCR
FT                   IGSNVTIHASTVIGSDGFGYTFVDGQHLKVPHSGYVVIENNVEIGANTAIDKATLGATV
FT                   IGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHIEDEV
FT                   ILGARTGVPPHKHLKKGTVYLGNPAKPKDVAIKHELSVNRIPLIRKNIKSLTEQVAVIN
FT                   KKLDIKAKEVE"
FT   CDS_pept        124260..125042
FT                   /transl_table=11
FT                   /locus_tag="lpp0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11263"
FT                   /protein_id="CAH11263.1"
FT                   /translation="MLKKILLTGLCVLFSMNLSASEPIYDEEIPLLWSSIITVSGGPSW
FT                   ATPGQNQYIYPMSPVYINNFNPNLPPNYYLYFTHDSPTTILANGEIFFGLQRAINPQMI
FT                   GQLGLGVAGVSDAKVTGDVNLNGLLNVYTYDYKVNHARVELKGKLIGSAFTPVQPYLSG
FT                   SFGIAFNNAHDYRTLSINQFLFPAPWFASNTTYAFAYSVGAGVQKMLNRNWQVGVGYEF
FT                   ADLGKSYLGGDGVNITKGPRLTHLYNNQLLFSVSYLYS"
FT   CDS_pept        complement(125039..126268)
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="lpp0116"
FT                   /product="hypothetical protein"
FT                   /note="3-oxoacyl-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11264"
FT                   /protein_id="CAH11264.1"
FT                   /translation="MKKRVVITGMEITSSIGSGIDKFWLAASQGQCGIKRIQSYDPSPY
FT                   STQIAGEITDLSLDHLPEFNKSKRYPRAAQYALFCAHHAIEKAGLEKAELNAAGTFIGT
FT                   SIGGQPELEAGYKLFFTDSWKKIPPLSVIRGMPNSIANHIAIAFGIGGPNSTISNACVS
FT                   SGEAIGMAYQQIAHGNLTTALCGGTESLVWESVMAAWCKLRVMSTNNENPSQASRPFDL
FT                   NRDGMVMADGAGILILEELQQAKARGAQILGEIIGYGASCDAFHVTAPNSQGQARAIVA
FT                   ALNDAKLSINDVHYINAHGTGTQLNDSTETETIKMVFGKRAYDIPITAQKAMTGHAIGA
FT                   AGAMEIIATTLSLQKNTLLPTINLHTPDPACDLDYVPNAAREKTIDIALSNHFAFGGAN
FT                   AALVLRKYIS"
FT   CDS_pept        complement(126393..127253)
FT                   /transl_table=11
FT                   /locus_tag="lpp0117"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11265"
FT                   /protein_id="CAH11265.1"
FT                   /translation="MITQVNQLDELQLKDLKALRAECKKNDGSIPNLYIHILKQHRSLP
FT                   TSFLYYHNGTLIGFLSVYFFYDDAVEVAVLVSPQYRRQGIAKQLIKEALPLIKSQNYFN
FT                   LIFSCPSRLNDNWLTQKGFTYLHSEYFMERDDLNPILDYIRPLSFRMATLEDIPILCGL
FT                   DEVCFPDKNQDSVNRFQQILNEREYEIVIAMLNNHPIGKAHIRWQTKRATLSDIAILPK
FT                   EQGKGFGSALIAHCINMILSEGKSRVDLDVETHNKKALNLYIQLGFHIQNACDYWSINV
FT                   NQLAK"
FT   CDS_pept        complement(127372..127947)
FT                   /transl_table=11
FT                   /locus_tag="lpp0118"
FT                   /product="hypothetical protein"
FT                   /note="similar to peptide methionine sulfoxide reductase
FT                   msrA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11266"
FT                   /protein_id="CAH11266.1"
FT                   /translation="MLRIFLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGDTLKNPTYEQVSAGNTHYAESVMVEFDPNKLSYKKLVEYFFMHIDPTVKNA
FT                   QFCDHGSQYRSAIFYLNDQQKKIAMEYKKELEQKFPTVYTEIVPSTSFYPAEEYHQNYY
FT                   KKNPVRYKYYRYRCGRDARIQEVWGNKK"
FT   CDS_pept        complement(128055..128651)
FT                   /transl_table=11
FT                   /locus_tag="lpp0119"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein, predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11267"
FT                   /protein_id="CAH11267.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   VLLDKPYIAISFLLLSGYLDTLDGSLARFQNRASDFGSAMDIVMDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSSCFNFLAALFCFLVCLTALIRLFEFKKSVQAPG"
FT   CDS_pept        complement(128974..130254)
FT                   /transl_table=11
FT                   /locus_tag="lpp0120"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11268"
FT                   /protein_id="CAH11268.1"
FT                   /translation="MPTLKSYFLKDTSLRTEILAGATTFLTMVYIVFVNPKVLHDAGMD
FT                   QGAVFTATCLITAFACALTGFIANTPIGVAPSVALNIYFSYSVVQGMGVDWQHALAMVF
FT                   ISGLLFLFLTLTKLRRLLIEAIPHNLQIAIVIGISLLIALIALENNQIIIGDQHNLMRL
FT                   GPIIRPETGLFFLGFILILTLDYHKIPGAIIIGILSISILSLMLGLTSWQGLIAMPPSL
FT                   EPTFLQLDFSGLSSIVALKTIFTFFLITVFDATGSLIGLLSPTIFKHEKNYYKRLTRSL
FT                   TADAAASSLAGLMGSASTSPYIESATGIEAGGRTGLTALVIATGFILMLFLFPLAKMIP
FT                   SFAVGPALLYVACCMIKHITNMKLQDISETAPCMVIIMMVPFTASIADGIGLGIILYTL
FT                   LKLFTRQKPNPLIIVLSLVFIVFFLIN"
FT   CDS_pept        complement(130272..131078)
FT                   /transl_table=11
FT                   /locus_tag="lpp0121"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11269"
FT                   /protein_id="CAH11269.1"
FT                   /translation="MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNK
FT                   DHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKPVALLVHDEFHYQIGDKTAIEPHG
FT                   FYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGEMPI
FT                   SRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN
FT                   HRLDTLNEIFDMFNGYLESRHGHHLEIIIIVLIAVEIIIAVMNFHF"
FT   CDS_pept        complement(131177..131446)
FT                   /transl_table=11
FT                   /locus_tag="lpp0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11270"
FT                   /protein_id="CAH11270.1"
FT                   /translation="MNSKVFSQRFNRELATLGFPEDLTEKTKAVSKVFGVTRHLANAMI
FT                   FGHVLPDKEQLDKIAEILEVCPQWLSGATDRKKAYSGRETADSV"
FT   CDS_pept        132053..133855
FT                   /transl_table=11
FT                   /locus_tag="lpp0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11271"
FT                   /protein_id="CAH11271.1"
FT                   /translation="MIQLGDLLKPTWAAEQSLNNAWSVLNDEEKETIKSRMDKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFAQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSIKHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIEFKNCHEMTMTELAQHIQHDMLI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHERVYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWNKTNNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDSFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
FT   CDS_pept        133855..134892
FT                   /transl_table=11
FT                   /locus_tag="lpp0124"
FT                   /product="hypothetical protein"
FT                   /note="Similar to farnesyl-diphosphate farnesyltransferase
FT                   (Squalene synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11272"
FT                   /protein_id="CAH11272.1"
FT                   /translation="MVMRSFSFYYQHLENVSRSFSFCISQLTSPAKEWVALSYLLLRVA
FT                   DSIEDAKWQDLQTQSDSFAAFKSFLVQTPANDQFTKWLSSFPSQLPLGEKQLLCAVPLL
FT                   LEEKDNLPESIKQSVIKTILQVVDGMHYFLNHYHMEGKIVFPSLVTTNQYCFFVAGLVG
FT                   KLLSHIFTDLLSNFKWTATLLNQAFHFGFFLQKINLLKDKVDDETSGRYFISSENSLRE
FT                   SLVIHAHHSLAYVKSIPIIEGRPYRLFCAWSLFIGLASLKWLDKYGHRQKIKPRETYYL
FT                   VNQINQLIDDNRALEKLFNSYLPGQYEEGSRYASESTKKIPTWFKKIYDGEMDSLTLFD
FT                   LDIEV"
FT   CDS_pept        complement(135178..136374)
FT                   /transl_table=11
FT                   /locus_tag="lpp0125"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS4 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11273"
FT                   /protein_id="CAH11273.1"
FT                   /translation="MHKKIFCQNLLDSALKNSIHAKRKQCLVRFLSDLMDYDTTLSVTE
FT                   IGKKLTSKTTVKSKIYAAQTFVNNFKLERDIVCIYKSLTHFFWSHAKEIVVLIDWTGGC
FT                   SEGYHVLEASIAAHGRSIPIYHEVHSESEQENAEIHRQFLLRLKEVIPSSLSVTIITDA
FT                   GFHREWFQQVLELGWDVIGRIYSLYCYQIEGETNWHKVKDILFEGIGKASALGKVKLGK
FT                   TKKAVEGYLYTYKEKLSGKVRKKKNKYPSHDKAHSNYYKNGWVLFSSLNKHARFLVSYY
FT                   KKRMQIEQNFKDIKNEQLGMGFRRNQSSGKTRVNMLFFLAVLLIMIAWWFGLMIESLNK
FT                   HRSYQANTIKNKRVRSFIHLARMAYRHEPELLNWDLFQYIMSDLKQQYHSFIECGALS"
FT   CDS_pept        complement(136692..139913)
FT                   /transl_table=11
FT                   /locus_tag="lpp0126"
FT                   /product="hypothetical protein"
FT                   /note="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11274"
FT                   /protein_id="CAH11274.1"
FT                   /translation="MIIRELFNWIHNDSATLHLSDQTIERDLIEQEESQAKQTHRVLLG
FT                   NVRLLKYSGSSNTEAIKELEQHCLFMDYLQLYKQEFVKDGKNTVFLIALRNLLSHSHEE
FT                   QLRLMPKINELFQILLRDNKESALSFYDKNKELFRYCTEIQERVTFDLLQQKMEADSKL
FT                   VMTQLDYFNEHLTYQENPLGIIALCRNWIGETEKFTALILWLLERKVSVEKILLTNLLQ
FT                   DFLKYHLFTLHSKDNEVSRLYSLLSHFPEAQELVMAAQKISCGELMFQQYSLDGIFRGK
FT                   NLPVVSPEIPPLQFSLSKDNFIALHRTFGPAFLTAGIATATNHSEVAWLDMLRHTLNQP
FT                   ETLKLLPDIINIIAREYSPKVLKTLAELIAESTAHQLLTLNQSCVFHLLQHKPRLLHDI
FT                   TEENVIEYINHLVRLDTHDQEIIYQLMALFRVLLKKNHPATKAVFEAILDNLVNHPQLL
FT                   EDEEFLTQLKRYPDCELLLEERCENILKQLNFCIAEQTSGLLFGKHNYYIIEDVWLRAL
FT                   RKFAVLQQINPQMKFSFGHKYALQARIAEVVFIHQGDLFDLDTFIDALDLPPVTSSGEI
FT                   SPYERTLIEILATIDNDLIRKQIIQKLETTPFNRLDWHEREYGNQTVFIKAAKKGNLGL
FT                   INLLEDKMKPSVLNKALRAAAKNYQWETLDHLCSLPGVELRQDEMDDLVVYLAEHGRIE
FT                   SVKKLLKLYDYKPSTELIGTILKKAIDNDNLQVVMYFCKLPVESPKQSMLDRLFKLAIQ
FT                   LQHWDIVEYLANSKHYSPSQTTLEKAFQQTALAMQHEAVEILGNVEKTPVRAIVIERAL
FT                   LKASKLGHTKVVQSICALPSETLTKQAIEDALEQAAAEGHLDIVSCLCEPGTTTLRQPG
FT                   INSGMKIAVQAGKLSVVNYFCSMTGSNKPTPRLIDQTLVMAAKKGQTAIFIAIHSNHQT
FT                   PPGKHAIEQSFQLAITAGKLPILDYLCRHEGYGLNQSKVDQALISAVKSKQLEIVSYLC
FT                   ESLEITPSRKALRIAVSKAISSDQTGLAEYLRSRSTDKSKHTDTLVDEIDSTSKVGKQL
FT                   EANGLFKKKKRQTDREPQILFNPTI"
FT   CDS_pept        complement(140150..141358)
FT                   /transl_table=11
FT                   /locus_tag="lpp0127"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted signal transduction protein.
FT                   Contains EAL motifs"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11275"
FT                   /protein_id="CAH11275.1"
FT                   /translation="MLARQGIYDKNSAIFAYELLYRNSEAQNSQVDNLNPSSGEAATSS
FT                   VLLQLFANLDVNTIIGNKQAFINFTHNHLVQKIPMLLPKNRIVIEVLETVAIDQALLLN
FT                   LMELKKQGYQIALDDFVFRNELAPLVDMADIIKIDVLNLDQQQIAEQLLPLKSFRGKLL
FT                   AEKIEDKQQFNHCVNLGFDFFQGFFLNKPDSLTGQIITENKIQLLRLLTEINNEEVPIQ
FT                   RIEEIILQIPKLSYRILRLANSASLYMSKKIESLMDAISQLGLMQIRNWLNLLLLASLD
FT                   DVAPDLLERTLIRAKMCESLAKSMDYPNSHQAYTVGILSTLDGILNEPMPSLLAKIRLS
FT                   EALNEALLNYKGDLGKILKLAIDYEQANFNQLERIPVKSETLSQSYLKGIEYANHVIDI
FT                   INK"
FT   CDS_pept        complement(141599..143053)
FT                   /transl_table=11
FT                   /gene="gcsB"
FT                   /locus_tag="lpp0128"
FT                   /product="hypothetical protein"
FT                   /note="glycine dehydrogenase [decarboxylating] subunit 2
FT                   (glycine decarboxylase) (glycine cleavage system
FT                   P-protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11276"
FT                   /db_xref="GOA:Q5X8W5"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8W5"
FT                   /protein_id="CAH11276.1"
FT                   /translation="MLIFELSKTGRQAKAQIPRAVSKNYSIPEEFQRKSPPRLPACSEL
FT                   QVVRHFTCLSQKNFSIDTNFYPLGSCTMKYNPRGVHKAASLPGFINRHPLAMDNESQGF
FT                   LETLYKLQNYISEITGMPGVSLTPMAGSQGEFAGVAMIKAYHQSRGDTARDEILIPDAA
FT                   HGTNPASAVMCGFKVVEIATAPDGDIDLDELKRKVGPRTAGIMLTNPSTLGLFMRQIKE
FT                   IANLVHQAGGLLYYDGANLNAILGKVRPGDMGFDVMHLNLHKTFATPHGGGGPGAGPVA
FT                   VGKRLIPYMPLPVVKKTDSGYHWATRQDYPQSIGRLSCFMGNAGILLRAYFYMLVLGKE
FT                   GLLRVSEFATLNANYLLKELTKVGYTAAYPGRRASHEFILTLNSEKKNYDVTAMDFAKR
FT                   LLDYGVHAPTTYFPLLVPECLLIEPPETESKEELDAFVAVMKTIREEAIKQPDILKAAP
FT                   HTLPVKRLDDVKAARELDLNYFATHE"
FT   CDS_pept        complement(143047..143355)
FT                   /transl_table=11
FT                   /locus_tag="lpp0129"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11277"
FT                   /protein_id="CAH11277.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRDELKELIQKTEGKLC"
FT   CDS_pept        complement(143355..144725)
FT                   /transl_table=11
FT                   /gene="gcsA"
FT                   /locus_tag="lpp0130"
FT                   /product="hypothetical protein"
FT                   /note="glycine dehydrogenase [decarboxylating] subunit 1
FT                   (glycine decarboxylase) (glycine cleavage system
FT                   P-protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11278"
FT                   /db_xref="GOA:Q5X8W3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8W3"
FT                   /protein_id="CAH11278.1"
FT                   /translation="MPYIPHTPNDTKEMLTAVGAQDIQDLFDEIPASLQYAGFQSIPAG
FT                   INEMEMLKEAQNQAQKNRNGICFIGAGCYEHHIPAAVWDIASRGEFLTAYTPYQAEASQ
FT                   GTLQLLYEYQTMICELTGMEVSNASMYDGATALAEAVLMAVRLNKHSKTNRVLITGTVH
FT                   PFYRETIETIVRNQHIEVITLPFDEQQGITDFGSLNQYTGEDITALVIAQPNFFGCLEQ
FT                   VDKMTSWAHHNKTISVACVNPTSLALLKPPCSWGEHGVEIVCGEGQPLGSPMASGGPYF
FT                   GFLSTRMAHVRQMPGRIIGRTVDKDGKTGFSLTLQAREQHIRRAKATSNICTNQGLLVT
FT                   AATIYMSLLGPEGLSQVATQCHQNTHELITALTQIEGVELAFKAPFFHEALIKLNQPVQ
FT                   SVLQQLADAGIAGGYAPEQHYPQLANTLLVCATEVRSAEDIAKYAKTLKTIMSKRGA"
FT   CDS_pept        complement(144728..145105)
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="lpp0131"
FT                   /product="hypothetical protein"
FT                   /note="Similar to glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11279"
FT                   /db_xref="GOA:Q5X8W2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8W2"
FT                   /protein_id="CAH11279.1"
FT                   /translation="MNDLKFTTTHEWLREDEEEVTVGITDHAQELLGDMVFVELPEIGD
FT                   EVSAGQELGVVESVKAASDFYAPISGVVTAVNEAVGKNPALVNHDPYHEGWLVKLKPSH
FT                   PDEIKSLLSDEQYQNEIAEEN"
FT   CDS_pept        complement(145139..146221)
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="lpp0132"
FT                   /product="hypothetical protein"
FT                   /note="Similar to glycine cleavage system protein T"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11280"
FT                   /db_xref="GOA:Q5X8W1"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8W1"
FT                   /protein_id="CAH11280.1"
FT                   /translation="MTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHHAVRNDAG
FT                   MFDVSHMTIVDILGAGGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIIDDLIVYQR
FT                   ASDNYRVVLNSATRQNDVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKTLSILAPA
FT                   HVDAVSTLTSFECVDVDHWFFARTGYTGEDGLEIIVPNEFVTQLWNDLLNAGVTPCGLG
FT                   ARDTLRLEAGMLLYGQDMDETTTPLESGLAWTVKWEPEDRGFIGMGALASQKQQGIKRK
FT                   MVGLTLLDKGIMRHGQKVIIEGCPDGIITSGSYSPTLQQSIALARVPVETGEQVLVDIR
FT                   GKLIPAKVGKPRFIKQGKPV"
FT   regulatory      complement(146229..146234)
FT                   /gene="gcvT"
FT                   /locus_tag="lpp0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146344..146823
FT                   /transl_table=11
FT                   /locus_tag="lpp0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11281"
FT                   /protein_id="CAH11281.1"
FT                   /translation="MGKNMVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLK
FT                   AKGHVTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVA
FT                   IAYRDNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
FT   CDS_pept        complement(146798..147328)
FT                   /transl_table=11
FT                   /locus_tag="lpp0134"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with L. pneumophila IcmL/DotI"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11282"
FT                   /protein_id="CAH11282.1"
FT                   /translation="MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDY
FT                   KNYMQQQKEIAKYFSADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTH
FT                   WQAIMPILVVYKNPQYEQKQNLKVILGFTVASPGQGVRGFSVTSLQSTPISPPCQCKIE
FT                   ETPGNTKQGDAKQ"
FT   CDS_pept        147825..149564
FT                   /transl_table=11
FT                   /locus_tag="lpp0135"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11283"
FT                   /protein_id="CAH11283.1"
FT                   /translation="MGNSRFYFANPDKFSRFINRWDLLLLILTFSVLFFLGWAGSQMAT
FT                   PYQLGDQIPISLEPSNLPFYALRTVLRMFIALIFSILFTFIVGALAAKNRRAEQIVIPA
FT                   IDILQSIPVLSFLSITVTGFIHLFPNSLLGPECASIFAIFSAQVWNMTFGFYQSLKTVP
FT                   HDLIEVSAMFRLSAWQRFWKVEVPFSMSGLLWNMMVSMSASWFFVVLSEAISVAHQNIR
FT                   LPGVGSYIALAIAQRDLHAVGYAILTMVIVIFLYDQILFRPLIAWSEKFKMEQSPDESE
FT                   YQSWLIDLIRSSRLMKRVTEWLAVFTNSFVNARWLRIGEVKAVKEIDFKRQKRLDRLWT
FT                   ALVLIAVITGGWFLLKFILAELKVSDIFHVFLLGAATGARVIILILLSSMLWIPVGVWI
FT                   GLRPRLAQKIQPIIQFVAAFPANLFYPLFVIAIVKFNLSVEIWVTPLMILGTQWYILFN
FT                   VIAGASSIPRDLYLAADNFGLKGWIWWKRLALPGIFPFYITGAITAAGGAWNASIVAEY
FT                   VSWGNITLKATGLGEYIQASTTAGDFPQIALGTAMMCVYVLAFNHLIWRPLYRLAEERF
FT                   NFN"
FT   CDS_pept        149572..150870
FT                   /transl_table=11
FT                   /locus_tag="lpp0136"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11284"
FT                   /protein_id="CAH11284.1"
FT                   /translation="MPETIINIENLSKSFKKAPSQHLLVLEDVNFKLQEGEIVALLGKS
FT                   GSGKSTLLRIIAGLIAPSSGTVTYRGKPVTRPVEGIAMVFQSFALMPWLTVLENVELGL
FT                   EAQGISREERRHRAIEAIDIIGLDGFESAFPKELSGGMRQRVGFARALVINPDVLLMDE
FT                   PFSALDVLTAENLKSDLLELWKEKKTNTNGILLVTHNIEEAATLADRIVIFGNDPGYIR
FT                   AELPVTLPQPRDPESPEYLALVDKIYTLMTTGPKEKAKRAQRERQIGLGYRLPDVEPSE
FT                   LSGLIETMKSFEERIDLPELADELMMNIDDLFPILETLEILGFAKVSAGDIQLSELGKQ
FT                   FSEADLQERKQLFAQRLLEKVPLARYIRRVLDEKAGHRVSEERFLSKLEDYLSEKEADR
FT                   VLKTMIDWGRYAEIFAYDFNTGILSLENPGKGA"
FT   regulatory      complement(150978..150998)
FT                   /gene="dsbA"
FT                   /locus_tag="lpp0137"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(151031..151645)
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="lpp0137"
FT                   /product="thiol:disulfide interchange protein precursor
FT                   DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11285"
FT                   /protein_id="CAH11285.1"
FT                   /translation="MFKKLIALLFLMPMTALATQFIEGKDYQTVASAQLSTNKDKTPLI
FT                   TEFFSYGCPWCYKIDAPLNDWATRMGKSAHLERIPVVFKPNWDLYAKAYYTAKTLAMSD
FT                   KMNAILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPTIDMRVNSGMSLMA
FT                   HYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKSA"
FT   regulatory      complement(151654..151659)
FT                   /gene="dsbA"
FT                   /locus_tag="lpp0137"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(151656..152258)
FT                   /transl_table=11
FT                   /locus_tag="lpp0138"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11286"
FT                   /protein_id="CAH11286.1"
FT                   /translation="MKKLALVLILCSSSVIFAQENPQEAGQNKSTVCTACHGPQGISTN
FT                   PEWPNLAGQHEKYFVKQLKDIKEGKSRSAPTMTAIVANLNEQDIDDLAAYYAKMPVAEG
FT                   STPEKYLKRGEQLYRGGDLNKHIAACIACHGPKGSGNAQAGFPLLSGQHAAYTIMQLQA
FT                   FKDGKRTNDLNQIMQDISSKMSPEDMEAVAYYIQGLY"
FT   CDS_pept        152333..152935
FT                   /transl_table=11
FT                   /locus_tag="lpp0139"
FT                   /product="hypothetical protein"
FT                   /note="Similar to GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11287"
FT                   /db_xref="GOA:Q5X8V4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8V4"
FT                   /protein_id="CAH11287.1"
FT                   /translation="MPINLYSKAVFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNC
FT                   LTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLE
FT                   ARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKVR
FT                   QYYELAEHLVSVQAFSSVKKDGVEELISVLDRWYEWN"
FT   CDS_pept        153049..156360
FT                   /transl_table=11
FT                   /locus_tag="lpp0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11288"
FT                   /protein_id="CAH11288.1"
FT                   /translation="MTPLFPTQGPITIRQGIGGSCYLLSSLDCILNLGADGEQLIKSLF
FT                   TQTEDGKVIVRIKRHEALKDNLQKNKMTGKYTHYVDELNNEDVFEISPERLKEIDNQYG
FT                   GVKSNSLAIKILERLVSYYYAGDWSNTDPLASVVAHDIPDRIAGFTSTAFLGKFFGIQA
FT                   EDIPYSKLDDIIKLKLMNPDEPVYISMSYGKVDSFGKFHGRHALRIDKIIPKGSGNYDF
FT                   VLINPHDNSKTETYKLDDLNKRNCRFCLFNTSIHRASLTKKLLTLSNEDGRYVFSNSGL
FT                   QKRLISLEEMNLLTDNKIISSCISLHKQIPYLEKLFLKLSVEEKKTLTTCIANADGSKK
FT                   EFLKLFLTHIPTMDLLELVLREETSQELLGEVLTELALSSPVEENKLSPKAGINFNSEA
FT                   FLHLILKSAIQQKINQLAYMPEKAKQEIESGIINFYFGGASSSLTRASGLRALFIANVF
FT                   SKKSIETLFPPKALFAKAIANYFTLKTLPDLLIEYLKSKDTSPIDEEFFDVVLASATFK
FT                   DPDEFFENLFRLSRINPEVAKALFVFSSQKINVLFGISLEEYAKKIALKDSGEFKSWFE
FT                   SLSKPQPVIKIPEIDNVLRQQRVDDAKRVISDIVQRINSFPFSFEGFKTVAHVNLNAEE
FT                   FRGQLKKIVHSGELQNALQILDLPDGHPEVQKALERKLRMIDAAANRRSDFLRKYETDI
FT                   DEHVRQIKNFPIDFNDADTIVAIESQRILLNKKLHTLVKTEDLLGEQFIANPKIKMVYY
FT                   AQVEKINLRAELLQKRLLDEAQKVINSVEKRMDNFVIRFDDISSASAVEWQRNNLLQQL
FT                   DNLVKPNQALLSAEKILDCNDLQPSIVRALQAKKQEINETADQLIIKINAEEVVKSYEK
FT                   QISEFPISFNRCQTVEEVIARKQDLIQSVRNLVGNKPDLLKAQEQLQLLSGEYHSDIKM
FT                   ALTDKVREINRQADVMSKRITDQIAATKETLNILAEIKFSDHLKTIESMVKTLETKAVG
FT                   DENYKRAAPIARTFYNNLLRAEERFKNSQLPKNVKCKDFHQDCVRAINAVIPVLEVHRG
FT                   WKQVFADLASALATLCTLGGANLYAGRWRLFPVPTESEKIVKDFSLSMQPLSVRA"
FT   CDS_pept        complement(156457..158415)
FT                   /transl_table=11
FT                   /gene="acsB"
FT                   /locus_tag="lpp0141"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11289"
FT                   /protein_id="CAH11289.1"
FT                   /translation="MSIRDLVISIFQPLLNTLAKHKRCSMLPVHLRHPHLTPTEESLSE
FT                   FWSEIAAQTIDWIQPWSITLQGGLHKGDVKWFQGGLLNVSANCLDRHLPHKANQTAIIW
FT                   EGDDENQNKTLTFAQLYSEVCKMSNVLKSLNVRKGDTVGIYLPMIPEAAIAMLACARIG
FT                   AIHTVVFAGFSAHALQQRLIASSCKCLITADAFQRGGKTIPLKKQADEASVDLNITKLV
FT                   VKNLNTPTALNKNKEHWWHELKQTVSDQCMPEPMNAEDPLFILYTSGSTGQPKGVVHTT
FT                   GGYLVQAAYTHQLIFACQDNEVFWCTADVGWITGHSYVVYGPLCNGITTLMFEGIPTWP
FT                   DAARNWRIIDKHQVNVFYTAPTAIRSLMRTGDQWLNSSSRSSLRLLGSVGEPINPEAWN
FT                   WYHQKVGQGKCPIVDTWWQTETGAIMISPRASDEVTKPGSARKPIPGIVPLLLNEQGHE
FT                   INGAGEGLLAIKYPWPSMARTIAGDHQRYCNTYLSNGYYITGDGAKRDEDGDYWITGRI
FT                   DDVLNVSGHRLGTAEIESALVSHPKVAEAGVVGIPHDLKGQGIFAYVILKQGNKPDAKL
FT                   QTELMERVKDEISAIAKPDVIQFVNDLPKTRSGKIMRRILRKIACKEVSHIDELGDLTT
FT                   LANPQIVEELMKNILKR"
FT   CDS_pept        complement(158342..159238)
FT                   /transl_table=11
FT                   /locus_tag="lpp0142"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11290"
FT                   /protein_id="CAH11290.1"
FT                   /translation="MANIGFVGLGHMGFPMAINLLKAGHSVMGYDLQQSALEHFAEQGG
FT                   AIAHNLQELAKDKDVIVTMLQTGQQVLHVCLGVDGIFSQLNAGSLYIDCSTIDVKSSRE
FT                   THQIAKENHLLVVDAPVSGGVAGAAAATLTFMVGGEAEAYNAAHPILSAMGKKIIHTGG
FT                   AGSGQAAKICNNMILGTTMIAISEAFILAKELGLSDGKLFEVVNNSSGQCWAMSKYVPV
FT                   PGILENVPANNDYKPGFAANMMLKDLLLSQNTAKSVHIETPLGSKTTEIYQQFVDQGLG
FT                   DIDFSAIIKHIGKTQEV"
FT   CDS_pept        complement(159262..160761)
FT                   /transl_table=11
FT                   /locus_tag="lpp0143"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C. burnetii methylmalonate-semialdehyde
FT                   dehydrogenase MmsA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11291"
FT                   /protein_id="CAH11291.1"
FT                   /translation="MGYNVPHYIGGQLINETDTEAQAIYNPALGEIIGQVHFASKATCD
FT                   RAVAIAKAAGNEWSQTPAIKRARVLFRFRELLEKYQMDLARIVTREHGKTLDDAKGSVA
FT                   RGIEVVELHCGLVNELKGDFSAEVASHIDCHTFRQPLGVCAGVSPFNFPVMVPIWMMIP
FT                   AIACGNTFILKPSEQDPSAPVRLLELLSDAGLPPGVANCIQGNKTTVEHLLAHPDVAAF
FT                   TAVASTPVAEYIYTTAAAYGKRAHTFGGAKNHCVVMPDADLDQAANAIVGAAYGSAGER
FT                   CMALSVVVTVGQHTADALINKISPLIRAIRVDAGDVEGTDMGPLVSQAHRQRVLAAIEK
FT                   GVNEGARLIIDGRTFQHPQYPQGFYLGPCLFDEVTEEMSVYQNEIFGPVLVIVRVNHFE
FT                   EALALVNKHQYGNGTAIFTRDGFTAREYSQRVQAGLVGINIPIPVPIANHPFGGWKRSV
FT                   FGDTNMHGEESIHFYTRRKTVTSKWPITELKDSSFAMPTHD"
FT   regulatory      complement(160768..160773)
FT                   /locus_tag="lpp0143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(160872..161048)
FT                   /transl_table=11
FT                   /locus_tag="lpp0144"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11292"
FT                   /protein_id="CAH11292.1"
FT                   /translation="MKSIEDFTGFSESGIDDAIQNALKKAGNPTHFEVVETLGSQDRQS
FT                   DRRYQVTLKTLSD"
FT   CDS_pept        161226..163694
FT                   /transl_table=11
FT                   /locus_tag="lpp0145"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with eukaryotic proteins, putative
FT                   coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11293"
FT                   /protein_id="CAH11293.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLTELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTLFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEKQQYFLEYALKNAEKVEDVVS
FT                   YLSSRHRTLPAPANYGAHSLYLIDGEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLDLYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKTAQKYASSKPGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSEATLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYM"
FT   CDS_pept        complement(163798..164529)
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="lpp0146"
FT                   /product="hypothetical protein"
FT                   /note="similar to dihydrodipicolinate reductase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11294"
FT                   /db_xref="GOA:Q5X8U7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8U7"
FT                   /protein_id="CAH11294.1"
FT                   /translation="MRTRVIVNGANGKMGILACETLENHEQFEVVAKLSRQDNLGQSIL
FT                   DTKAQIVVDLTRADCVYENSLTIINHGARPVIGTSGLVETQINELTKLCEIKQIGGIIA
FT                   PNFSLGAILMMMLATKASEYFSEVEIIEGHHQQKLDAPSGTALKTAEMIAAARKKPKNK
FT                   LPLKELTPGARGGSHHDINIHSLRLPGLLARQEVLFGNIGETLSITHNSIDRRCFMPGI
FT                   VLACQKVLNLTNLVYGLEHLL"
FT   CDS_pept        complement(164709..164894)
FT                   /transl_table=11
FT                   /locus_tag="lpp0147"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical, similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11295"
FT                   /protein_id="CAH11295.1"
FT                   /translation="MRIILSILAIFMPWLVLLIKDNPGGAVVALIMQATLIGWPFASIW
FT                   AWRAVNPLTPASQSKQ"
FT   CDS_pept        165251..165943
FT                   /transl_table=11
FT                   /locus_tag="lpp0148"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of ProQ, activator of
FT                   ProP osmoprotectant transporter (truncated?)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11296"
FT                   /protein_id="CAH11296.1"
FT                   /translation="MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLR
FT                   IRPLKIGIMSDILQHAEKAEQVGVSKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNP
FT                   VAEVTEEEAENASMKIKKRVEKSVKNARKQVNAKAANHSYVNNQPSTVSSVKPMNSFDS
FT                   HPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKA
FT                   EDKKETTE"
FT   CDS_pept        165944..167014
FT                   /transl_table=11
FT                   /locus_tag="lpp0149"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11297"
FT                   /protein_id="CAH11297.1"
FT                   /translation="MRIATLFSAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLSQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASTKPSSAKPYPLYALPEDEQNL
FT                   TLDEANTKPGLIRFRYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKKIFNVHRSNNIAYDRTKTPYKQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRTMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDALYRATR
FT                   DLPDYVDAYFMILKQP"
FT   CDS_pept        complement(167114..172741)
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="lpp0150"
FT                   /product="SdhB protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11298"
FT                   /protein_id="CAH11298.1"
FT                   /translation="MLLLSIEVIKMPDKKSSETLLSQQINEVRGLLLQALKTQLDDLVA
FT                   EKLIPQPSGVPFVDFEKDPPQIATLKKVINCLYHAEEAFKSWESIDASTLLGKAKAAPK
FT                   LIRALTQIYKSLGLLDEASPEIRGVIADNYHLLEPLFTQAYAIVQESGWLSEFMEMDVT
FT                   DKASKVIFQGMDLLGPDIDKWHDTHPLVDAFSKISKLVETISKLQEKDMPGKEKEQAVE
FT                   LVHALLDDLDNNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWAN
FT                   HYLPTLIAFTDQLERQNYLKPGSLSANLCSQIEQLGKQVNDILSEPGFGITERVVTIDS
FT                   LQRQREQKIHNAQVKSVQVIMATEKQQAATADFYRILEAYKGMNLSQITEPDRRVLRQL
FT                   YPQIQTALAHASLDLENQLTSVLNTTGPEKTPTKPKSWWELAKGGLGYVASYVVNYNVD
FT                   KTLGTRVSVDRFLSSQIASEQFKILVAEKAREKLRTGSDKIKETALQYQAEARVNAIKS
FT                   TLRKQPAQMEAPPSQFVAVKPSKLLNLRGTLTAIQEMQLSTTVNGTRTSVDTLIHRHLP
FT                   EKYQVCFSTLPYQVNKNDPELVKQIKTVENNLFQLEKALKDFEKIDLSYGIMIRLHYFI
FT                   AIASAASKLKSSVKELSPEGQKALAPLLQQIMTLGSSFSDTNYTANDLSALQQLKMEGQ
FT                   LRPKSPSVASPDTIGTLPEETVKRTAKKPKEKTTELLDYADKISHARALLLDKFKTTLS
FT                   PALADDLNPQKKGVPFVHLDQDPPQIAAIKKIINSMYHAECALKTWHGIDTSTTLGKVA
FT                   AAHQGVAALSQVYKSFTLFTEDFSDIHNLIRENHDLIAPVIIEANKLVNQYGWARQFSE
FT                   LDIAQQLGSILGQGINTVQPKTDEVTQTASLVKLFSEIPRLLNNISSSLDQKSEKSIDE
FT                   LRISNKKIEAIGAVFELFFEEHAYLMSMFKGFSAISGLIELNKKIQREGTNLQEATIRQ
FT                   YQAWLKEGYPNLMMTLDEIETRHYLTPGLLSAPIALELDQINDKLNEIIETKPDFKLQK
FT                   IPLSFYMGDKRIERLMTKKTEHCLALLQIEEQKKAVNTFFGILKHYSGQPLSNIKPNEL
FT                   AQLRLAFVEIQSAMANSNLELSNDFVAALNQLETSPPEKTKKIKVTVSQLLKVQPAVEN
FT                   YLNEHKKSCELKIAVIDKAIEHVKDKSFELKSGASKEINISQLRRTFLETESKKPVVGP
FT                   GELKRTSVSSLNTVRGNLAYIQELKMSSTVGMMREQFSALTRDNFSTRVQKYLIKPQDK
FT                   PLHMINDNDPLMVRQIKEVENGLYHLETALKQFEQMKKSDSLVSQTKALLEIANHALQL
FT                   KMAVERFSPELKEHYGPLVRTVFSFSNKIQSINYNKEDWADLQFILNRAHKELLKRKTP
FT                   RDHRIEKAFFEAGIREVQIDRNESVGKKTAKLGVKYAHLASPQLEKGRAYLSSRYKSAF
FT                   GQQPKVIRSFTREQLANEEFMDAEISRLKRTLEEQYGFNIATIKVFLALLEQIQRAGAQ
FT                   AAEVAGMVNTLVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLS
FT                   AALELDMPFSKKLSILDDTTYVNILIRQTESDLQTLKKKLSEDPSNHEIAFEIEIKNDK
FT                   LAFLRQQMVLLEDKNPNQTRNVLLDMQFEVSLRNHLVYTTLKAPIAQEYEQIAREYYKK
FT                   NKNRFLYADDCSKELLQGLKEFEKKHLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIE
FT                   NINRELQNKDIPIEQRALKVKSLPNDSVFIEKLSSADKGTHFLRKFMQFITIITASITE
FT                   AIKTGGSLIYIYRQKQMEQSIKNIEKSISFKEELHTIRDPDSPSPRKGEGKEGEIEFTK
FT                   L"
FT   CDS_pept        complement(172833..174257)
FT                   /transl_table=11
FT                   /locus_tag="lpp0151"
FT                   /product="hypothetical protein"
FT                   /note="Similar to pyruvate kinase II PykA, glucose
FT                   stimulated"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11299"
FT                   /protein_id="CAH11299.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLASELSIGDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAKITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDPETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
FT   CDS_pept        complement(174241..175431)
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="lpp0152"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11300"
FT                   /db_xref="GOA:Q5X8U1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8U1"
FT                   /protein_id="CAH11300.1"
FT                   /translation="MNLIKMSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIK
FT                   SALDNGAAVIVLSHLGRPEEGKYEKKFSLEPVADYLRKNLEYPVRFVKDYLSGVDVKPG
FT                   ELVVCENVRFNPGEKANDEALAKKLANLCDVFVMDAFGTAHRAQASTYGVAQYAPVAVA
FT                   GPLLIRELEALNQVLKAPKKPIVAIVGGAKVSSKLSLLKQLVGMVDVLIPGGGIANTFL
FT                   KAQGFEIGISLYEPDLLDEARHILILAKEKGCQIPLPTDVVVGKTFSETCPAFNKSLSN
FT                   VAEDDMILDIGPETIRDYVDLIHEANTIIWNGPVGVFEFPQFAYGTRAIAIAIAESDAF
FT                   SIAGGGDTLAAVDLYDLNQQISYISTGGGAFLECLEGKTLPAVAILQERAKHVKTN"
FT   CDS_pept        complement(175442..176434)
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="lpp0153"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11301"
FT                   /protein_id="CAH11301.1"
FT                   /translation="MTIRVAINGYGRIGRCILRSIFEYNRQNEFEVVAINDLSGIDVTA
FT                   HLTRYDSTHGPFRSDVSIEGNMLIVDGHGIQVIAERDPAKLPWKQLDIDIVFECTGFFT
FT                   SRDAAMGHINAGAKKVLISAPAKGVDTTVVYGVNHSVIKASDVIVSNASCTTNCLAPVV
FT                   KVLNDAIGIESGLVNTVHAYTKDQMLLDGSHKDLRRARSATQSIIPTKTGAAAAVGLVL
FT                   PELAGKLDGFAMRVPVLNVSVVDLTFQAKRATSVEEVNDIMRKAKSRILQINEDPLVSC
FT                   DFNHNPASAIFDTTETKVIGSLVKVVAWYDNEWGFSNRMIDTAHQMMNC"
FT   regulatory      complement(176441..176446)
FT                   /gene="gap"
FT                   /locus_tag="lpp0153"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(176515..178521)
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="lpp0154"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11302"
FT                   /protein_id="CAH11302.1"
FT                   /translation="MNSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFL
FT                   KFNPKNPHWFNRDRFVLSNGHGSMLLYSLLHLTGYNLDINELKNFRQLHSKTPGHPEHG
FT                   HTPGVETTTGPLGQGLANSVGMALAERVLASHFNHDHYNLVDHYTYTFAGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIVFYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDAD
FT                   QIEQAISAARENTTQPSLIICKTVIGLGSSVAGSEKAHGSPLSAQDINNVREFFNWKHA
FT                   PFEIPDSIYKQWDHREQGDKEEQQWLQLLHEYRLQYPSEHDEFLRRANGDLPDDWQEIS
FT                   AGFLKQCLNNEKAIATRKASQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHN
FT                   FSGNYLYYGVREFAMAAIMNGLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYV
FT                   LTHDSIGLGEDGPTHQPIEHIAMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALL
FT                   LSRQNLPALAHGTDAADLIKKGGYIIADCEGKPDAILIATGSEVQLAITAAEKAKARGL
FT                   QVRVVSMPCAERFLAQSDAYKNQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCF
FT                   GVSAPATDAFNYLGITVEKIINTLDTLTKQTMV"
FT   CDS_pept        178779..180113
FT                   /transl_table=11
FT                   /locus_tag="lpp0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11303"
FT                   /protein_id="CAH11303.1"
FT                   /translation="MTPIISHLLKIFPELNTQVKTDSLNWTFSTHLKQLGPDFYSKIAR
FT                   LHPILNMEYSVLCQRLRYNLSAPDYSSPEQIKEQLIDALKLAELLEYTYQHYLVVPREV
FT                   VRLRRHKAIYRELLTELSGYSFALDNPEPESLKTSLSLTQAIREKTAQSNWYRIFISRS
FT                   KRVINLLDNLDTGSKAFRDFVVLLDKYTNPFLAYLGWCFFAPRLFTNLFLILKHTIPGE
FT                   WMGEKEKSLDWSDRFYAHLQRRWFELANDSVWFTVGILNCFVLVGALAPLSVYLSLFAF
FT                   VFDVANTSLRAYIEIGRLQQLQKEYAELFDQEENEDQKKIIKEYQDSISYRIKFEILRS
FT                   FLSVGGAVAVVIAMALSVPALGIINPVIPLIGAVLLLALWGVSLYLNNKLDEYRPVDNI
FT                   EKPAPSVINKLSFFAPKNEKKESLHLSSKPEKDLEAEELIPTFTF"
FT   CDS_pept        180177..182228
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="lpp0156"
FT                   /product="Oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11304"
FT                   /protein_id="CAH11304.1"
FT                   /translation="MLSKNYMMERYNMSTTVGLPQFSHIKIEHFKSHLDALLKNHLEEI
FT                   DRLLKENHHYTWDNLIYPLDSLADELERFWSPFAHMHAVMDSEAIRESYETCLPLLSAY
FT                   DAAIGHNQDLYEAIKSIDQHSLNPAQKKIIEDSMQDFELSGVALSKANKKRFEAIQSRL
FT                   AELSSKFENNVLDATHAYTIHITEAERVAGLPEHALNTAKELAHEKGLDGFVLTLEYPC
FT                   FQAVITHAEDRALREEMYRAYITRASDQGPNAGTFDNTPLIDEILSLRHEKAELLGFNN
FT                   FAELSLATKMAASTNQVTEFIYDLISRTRDKGKAEFRQLEVFAQDKWNLSPVNPWDVAY
FT                   LSEKRRQDLYSLSQEELRPYFPQPKVMQGLFAIVKKLFGMSIEEIEGVDVWHKDVQCYC
FT                   IVDESNQTRGYIYTDLFARPHKRNGAWMDSMQSRRKLEDGTVQLPIATLTCNFAKPSAN
FT                   RPAMLSHDEVVTLFHEFGHCLHHVLTQVDYLGGSGINGVEWDAVELPSQFFENWCWDEH
FT                   ALSLLTSHVDTGETLPSALYERLIAAKNFQSAMAMLRQMEFALFDFRIHQEYQIGKASY
FT                   VANILADVRSKTSVVPIVPYNRFQHSFSHIFGGGYAAGYYSYMWAEVLSSDAFARFEEE
FT                   GIFNPKTGHDFLKSILEAGGSRKAADAFAEFRGRPATIDALLRHNGIL"
FT   misc_RNA        182378..182782
FT                   /locus_tag="tmRNA"
FT                   /product="tmRNA"
FT   CDS_pept        183008..183355
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0158"
FT                   /product="hypothetical protein"
FT   CDS_pept        183169..183672
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0159"
FT                   /product="hypothetical protein"
FT   CDS_pept        183831..187949
FT                   /transl_table=11
FT                   /locus_tag="lpp0160"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Wolinella succinogenes hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11307"
FT                   /protein_id="CAH11307.1"
FT                   /translation="MESSQILSPIGIDLGGKFTGVCLSHLEAFAELPNHANTKYSVILI
FT                   DHNNFQLSQAQRRATRHRVRNKKRNQFVKRVALQLFQHILSRDLNAKEETALCHYLNNR
FT                   GYTYVDTDLDEYIKDETTINLLKELLPSESEHNFIDWFLQKMQSSEFRKILVSKVEEKK
FT                   DDKELKNAVKNIKNFITGFEKNSVEGHRHRKVYFENIKSDITKDNQLDSIKKKIPSVCL
FT                   SNLLGHLSNLQWKNLHRYLAKNPKQFDEQTFGNEFLRMLKNFRHLKGSQESLAVRNLIQ
FT                   QLEQSQDYISILEKTPPEITIPPYEARTNTGMEKDQSLLLNPEKLNNLYPNWRNLIPGI
FT                   IDAHPFLEKDLEHTKLRDRKRIISPSKQDEKRDSYILQRYLDLNKKIDKFKIKKQLSFL
FT                   GQGKQLPANLIETQKEMETHFNSSLVSVLIQIASAYNKEREDAAQGIWFDNAFSLCELS
FT                   NINPPRKQKILPLLVGAILSEDFINNKDKWAKFKIFWNTHKIGRTSLKSKCKEIEEARK
FT                   NSGNAFKIDYEEALNHPEHSNNKALIKIIQTIPDIIQAIQSHLGHNDSQALIYHNPFSL
FT                   SQLYTILETKRDGFHKNCVAVTCENYWRSQKTEIDPEISYASRLPADSVRPFDGVLARM
FT                   MQRLAYEIAMAKWEQIKHIPDNSSLLIPIYLEQNRFEFEESFKKIKGSSSDKTLEQAIE
FT                   KQNIQWEEKFQRIINASMNICPYKGASIGGQGEIDHIYPRSLSKKHFGVIFNSEVNLIY
FT                   CSSQGNREKKEEHYLLEHLSPLYLKHQFGTDNVSDIKNFISQNVANIKKYISFHLLTPE
FT                   QQKAARHALFLDYDDEAFKTITKFLMSQQKARVNGTQKFLGKQIMEFLSTLADSKQLQL
FT                   EFSIKQITAEEVHDHRELLSKQEPKLVKSRQQSFPSHAIDATLTMSIGLKEFPQFSQEL
FT                   DNSWFINHLMPDEVHLNPVRSKEKYNKPNISSTPLFKDSLYAERFIPVWVKGETFAIGF
FT                   SEKDLFEIKPSNKEKLFTLLKTYSTKNPGESLQELQAKSKAKWLYFPINKTLALEFLHH
FT                   YFHKEIVTPDDTTVCHFINSLRYYTKKESITVKILKEPMPVLSVKFESSKKNVLGSFKH
FT                   TIALPATKDWERLFNHPNFLALKANPAPNPKEFNEFIRKYFLSDNNPNSDIPNNGHNIK
FT                   PQKHKAVRKVFSLPVIPGNAGTMMRIRRKDNKGQPLYQLQTIDDTPSMGIQINEDRLVK
FT                   QEVLMDAYKTRNLSTIDGINNSEGQAYATFDNWLTLPVSTFKPEIIKLEMKPHSKTRRY
FT                   IRITQSLADFIKTIDEALMIKPSDSIDDPLNMPNEIVCKNKLFGNELKPRDGKMKIVST
FT                   GKIVTYEFESDSTPQWIQTLYVTQLKKQP"
FT   CDS_pept        187946..188938
FT                   /transl_table=11
FT                   /locus_tag="lpp0161"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Wolinella succinogenes hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11308"
FT                   /protein_id="CAH11308.1"
FT                   /translation="MKHLTLSEQGSFCKLQGERILVFNKDQMVFEGTLNRLKTISIVKQ
FT                   GVTLTSNLLVACAMRGIQIFILDYSGKAVCSLQGGLHRTAKVRESQFKYIYTKEASNMA
FT                   ARFILAKIKKQSAVLKYFAKAKNRPENEKIILHAASQKMAGIVANITETNWIKLQDWRF
FT                   TLLGFEGSAARIYWETVKEVNLVCSDFEGRRPRVNKDITNSMLNYAYSILSSWVWQAIT
FT                   NAGLELYAGILHTSKPGKPSLVLDLMEEFRPWCADRIIFKLHARAQKQNELTPALKKTL
FT                   IGEMANLYAKPLPYHKRRISLESIIQRQVYHLSAVFSGEGKYKGYLFKW"
FT   CDS_pept        188945..189244
FT                   /transl_table=11
FT                   /locus_tag="lpp0162"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Wolinella succinogenes hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11309"
FT                   /protein_id="CAH11309.1"
FT                   /translation="MQIRLYKEYIVSYDIRDNSIRRTIYERLKDIGLTPVQKSVFWGYL
FT                   NEPEKRYLTNFLKKELAKQDTAFITPCKLAQEYEVNLINLELDELRKPDGHIIV"
FT   CDS_pept        189225..189818
FT                   /transl_table=11
FT                   /locus_tag="lpp0163"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Wolinella succinogenes hypothetical
FT                   protein -RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11310"
FT                   /protein_id="CAH11310.1"
FT                   /translation="MDTSSYKLPVNMIRQYCFCPRIVYYHMVVGLKVAYPGWVQYGEEY
FT                   QHKQQVLDKRRTLSKFKPISEQAVLRQNTMLEHPSYPFYGICDGIIEDELEIIPIELKS
FT                   FASKISLGQKMQLTAYGMLSELIFEKPCTRGYIITGEKAKAKLIKIDEKSKFKVIEICA
FT                   KIKKIFGTETLPYSTANGLQCIQCEFLNHCNDRF"
FT   CDS_pept        192785..193228
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0164"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT   CDS_pept        complement(193218..193901)
FT                   /transl_table=11
FT                   /gene="prpA"
FT                   /locus_tag="lpp0165"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11312"
FT                   /protein_id="CAH11312.1"
FT                   /translation="MTELNIKKEIGKRILEARKAKGLTLKALGELAGGLKQTRLTNWEQ
FT                   GVRTPGPEEIKSLARALDVSPAYLMCLSDELQFKEAKNPSQLIPLLDYRQACEASLHTG
FT                   AESSGDKVFISVSTSLQPELSTDAFALKITDDSMMPEIRINDVLVIEPSVLPEPGDFVA
FT                   VKINGKPETIICQYKKLSYTSSEFELLTLNDNWPNIKVSDDINVKIIGVLVQNLRCYKS
FT                   PKVKS"
FT   regulatory      complement(193906..193911)
FT                   /gene="prpA"
FT                   /locus_tag="lpp0165"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      194038..194043
FT                   /gene="lvrA"
FT                   /locus_tag="lpp0166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194054..194923
FT                   /transl_table=11
FT                   /gene="lvrA"
FT                   /locus_tag="lpp0166"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11313"
FT                   /protein_id="CAH11313.1"
FT                   /translation="MMDFVINGDELEAMSGLPHFQQLTYLRGIRPYMDVKTGIVGIKRR
FT                   ISHQSISEQLYVEPHQGIKSQNFSRDQVRRSVSGLVRAGLIEVQSEGMHLILKCLLASS
FT                   HYSAQNKAAINPPQKATIKPRGESLENTGLTEFEALKADTVESQKAAIPHKDNYYIYLL
FT                   SQFEKFWSLYPEKKSKNNAQAVFEELKPNAELCHTIINALTAQINYRDTMKLQGTWVPP
FT                   WKYPANWLAQRCWEDELPTDALQEKNHAEHTKNTRKRHATEDLFCPPCDVKDREHNNVI
FT                   QLQRYLQS"
FT   CDS_pept        194865..195251
FT                   /transl_table=11
FT                   /gene="lvrB"
FT                   /locus_tag="lpp0167"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11314"
FT                   /protein_id="CAH11314.1"
FT                   /translation="MSKTESTTMSSSSKDTFKAERRIDLLFSKFAAFYGHVWRSQFKDE
FT                   VFLKFAKKEWQEALADFTDMVLTRAILNCREFYELPPTLPQLLYCCRQIRKQESFYVVK
FT                   DVYQPANKAVVSSCLQKCKELLAK"
FT   regulatory      195253..195258
FT                   /gene="lvrC"
FT                   /locus_tag="lpp0168"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195264..195467
FT                   /transl_table=11
FT                   /gene="lvrC"
FT                   /locus_tag="lpp0168"
FT                   /product="Legionella vir region protein"
FT                   /note="similar to carbon storage regulator gene csrA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11315"
FT                   /protein_id="CAH11315.1"
FT                   /translation="MLVLTRKAGQQILIGKGLIQMKVLKVENDIISIGIKAPSHIDIDR
FT                   EEIYFRKLRQEQEAANDAEMAI"
FT   regulatory      195451..195456
FT                   /gene="lvhB2"
FT                   /locus_tag="lpp0169"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195464..195766
FT                   /transl_table=11
FT                   /gene="lvhB2"
FT                   /locus_tag="lpp0169"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11316"
FT                   /protein_id="CAH11316.1"
FT                   /translation="MKTDKQLSKRAFQKIRTLYWGTVCLCAPSVSSAQNIESIINRTIN
FT                   YLQGGLARTVGVFCIIIAGYLCLARQKFPKEYFVMILVGMGIIFGGSSLYSTLIG"
FT   regulatory      195765..195770
FT                   /gene="lvhB3"
FT                   /locus_tag="lpp0170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        195776..196057
FT                   /transl_table=11
FT                   /gene="lvhB3"
FT                   /locus_tag="lpp0170"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11317"
FT                   /protein_id="CAH11317.1"
FT                   /translation="MSDLEISPIFNALTRPAMTAGVTFEYHMLNLIVSMCAFIGFSPLY
FT                   GIIFIPLHVFGWLVCRYDTHFFTICAKRFLLPQAPNTSLWRVRAYEPF"
FT   regulatory      196028..196033
FT                   /gene="lvhB4"
FT                   /locus_tag="lpp0171"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        196044..198524
FT                   /transl_table=11
FT                   /gene="lvhB4"
FT                   /locus_tag="lpp0171"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11318"
FT                   /protein_id="CAH11318.1"
FT                   /translation="MNLSKTLKHVYQEAKVSNLFPVTHLNSPCIFESQSGLVGSVIKVN
FT                   GAAFEIEEAETLNHQRFLLHQALVSLDSRFIIYVTTHRQKISCPLIGEFKPGFAKDLDE
FT                   RYQQRFKDKNLYKNTLYITVVLKGDDTSKTGSWLQWAKSLSMKGNSELAEHHREQNIQI
FT                   LNRAVEQLHTNLNSFGASILGMQDEELGFSELLQFLGLVVNAGQTASFKHPVYSPPIAN
FT                   SIPQTFKQEAKYPEGHLGQYLSSCQLLFGECIQFQGNTQQDCLFGAMLSLKKYPTNTAS
FT                   ILLDSMLSLDCEFIATHTFAPIGRDSALDTISKKRSKLLNAEDKALSQTTALTDLEDGI
FT                   ASETLLLGAHHHTVMLLAPNKSLLDAAILEATKRYGATGVVVVKETLGQEPAFWSQLPC
FT                   NQHFITRASLITSQNFVDFCPLHNTQTSFSNENFLGGAVTLLETPSKTPVYFNYHARGS
FT                   KTNPSKGHAAIFGGNNAGKTTLVNFLDAQMGRFGGRSFFIDRDESSKIYILASGNSSYI
FT                   KIEPSNPIAMNPLQLPDTSENRSFLKSWFATLVQEDSERAIPSPIAEIINDCIDYSFEQ
FT                   LAPEFRTLSHLSQFLPVDFPRWPHLKRWLKRNDSRIDGEFHWLFDNQHDALNLDFDKVG
FT                   FDVTYLMDQVQSIIATPVYLYLLHRMRQCLDGRLTSFIIAEAWQLFASPFWEKALREWL
FT                   PTIRKKNGHFIFDTQSPKTITDSPIKHIVLDNLATLIAFPNPLADKETYMEHLKLTEAQ
FT                   FEAIKENTPESRIFLYKQDHEAFLCKLDLSGLSQYIRVLSANTQSVKLLDDIMQEVGHD
FT                   PELWLPVFFERSKK"
FT   regulatory      198510..198515
FT                   /gene="lvhB5"
FT                   /locus_tag="lpp0172"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        198521..199231
FT                   /transl_table=11
FT                   /gene="lvhB5"
FT                   /locus_tag="lpp0172"
FT                   /product="Legionella vir homologue protein B5"
FT                   /note="putative traC protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11319"
FT                   /protein_id="CAH11319.1"
FT                   /translation="MKRTACFLIAVLGISGASHADILGVEDAQLIVLAMKQLGELQEQY
FT                   RVLTDTYQTTRSQLDNLNQLKSMNSGHYGFGDFNNGLDTLQSWQSPVSTWQDALENLSG
FT                   GNQQRYQALMDAYEKNHPSLDESSYARFTTPANVARFKEDKAVNRAVLVQTTESYNEIN
FT                   KHMEALHKLSQQIEKTPNTKGAIDLNSRLITEIGFIQLMSLRLQALISQQAAQENLSAL
FT                   QDRAEMAKFNRLPK"
FT   regulatory      199234..199239
FT                   /gene="lvhB7"
FT                   /locus_tag="lpp0173"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199246..199392
FT                   /transl_table=11
FT                   /gene="lvhB7"
FT                   /locus_tag="lpp0173"
FT                   /product="Legionella vir homologue protein"
FT                   /note="putative component of the type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11320"
FT                   /protein_id="CAH11320.1"
FT                   /translation="MKWLLSVLMIALLSGCSKPPDLDSPCHHFGQYCPQYPINDEPIME
FT                   LTK"
FT   CDS_pept        199389..199784
FT                   /transl_table=11
FT                   /gene="lvrD"
FT                   /locus_tag="lpp0174"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11321"
FT                   /protein_id="CAH11321.1"
FT                   /translation="MNTLIKGLMVILIAATISACHHENPLKTQPAKASVRFLINASANA
FT                   EKQLHFAIHKDAYGFAYLECMEGKQSPDIQCNALYQGMIAFAKEGHYAGFQMITQADLT
FT                   DKKVFESLADEYAETAATSFPHFVSGS"
FT   regulatory      199775..199780
FT                   /gene="lvhB6"
FT                   /locus_tag="lpp0175"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        199788..200828
FT                   /transl_table=11
FT                   /gene="lvhB6"
FT                   /locus_tag="lpp0175"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11322"
FT                   /protein_id="CAH11322.1"
FT                   /translation="MNTLQFDNFIIQLAGEVDKLTNHFVFDGYTALATLLKAPLGAMIV
FT                   LYIILKGYGIALGVIERPQHELFRFSMRAGLIYMMAMNWDLFSSYMRDLFVSGSESIAT
FT                   RLMQAVHKYPSGGSINQGLQNVLNEILNLGSDLFDAGSLRKLTPYFAGMMVFLSGSVTI
FT                   GLAFIEIVIAKLMLAVTLCTAPLFILFTLFDQTKSFFDRWLGVLAGFAFVLIFVSSVVG
FT                   LCIHLLHWVTYAFLGNTDELTAAIWVPIFIVACLCVMGITQAVAIGKSIGGSVCTSAGS
FT                   AMVGGFIGGSIGAWGFSKSSVQKPVNTLRQGLGNASRLMEKGKQLGEASHNVFKQLHKN
FT                   LRRGAS"
FT   CDS_pept        200825..201541
FT                   /transl_table=11
FT                   /gene="lvhB8"
FT                   /locus_tag="lpp0176"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11323"
FT                   /protein_id="CAH11323.1"
FT                   /translation="MSKTNLNEYFKRARSWADDQFGRIEQSRNRYQAAFFSAMGLNVAA
FT                   IMVIGMLAHYQTVVPMLVHHYDNGVTTVEPIDNKETPINRAQIESDIARYIQYRESYDV
FT                   SSYRAQFELVHLLSNSTVAKEYLQEQDAANTASPIHALGNHIKREVRIYSINFLDSVLA
FT                   NEKDLHKDHHALAEVVFSLIDTDKTSGKTTSTHYNAMISWRYTNPPDSPETRWKNWDGF
FT                   EVTRYTRQTRLMEAQA"
FT   regulatory      201525..201530
FT                   /gene="lvhB9"
FT                   /locus_tag="lpp0177"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        201538..202290
FT                   /transl_table=11
FT                   /gene="lvhB9"
FT                   /locus_tag="lpp0177"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11324"
FT                   /protein_id="CAH11324.1"
FT                   /translation="MKKILLSAAVLLLSLGTYAQNNPTSLSTDTRIKKVVYRENDVIPV
FT                   HGIPFTTTQIQFAKQERVLDIEGGDTTAWMVTYHPQLENMIFVKPTMFDSKTNMTVITN
FT                   QRAYYFSLTSTKKLEQEPGKKTYALKFEYPQAQPIHTKNTTPNKTIHPKVVNTAYRFSG
FT                   SPQLVPRHVFDDGKFTYFELSSQGSVPAIFAVDDQSGKESTVNTRREGKYIVVQRLAPQ
FT                   FTLRQGGLTASVFNAPEINRIKANRRPK"
FT   regulatory      202276..202281
FT                   /gene="lvhB10"
FT                   /locus_tag="lpp0178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        202287..203378
FT                   /transl_table=11
FT                   /gene="lvhB10"
FT                   /locus_tag="lpp0178"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative type IV secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11325"
FT                   /protein_id="CAH11325.1"
FT                   /translation="MSMDDKKREDSLGNRTQVAKNPKHNAMKDKLLLAGVVIICIVIGI
FT                   GGLLPKRKANSVNEPDEKQSLSMALNQNLELIAALKEKNATAQTGYKGSDPRHPPVLKT
FT                   IQSQTVSKETLARMNAPSTFFNSGGNEVISTATGGEVQASKTLTGRDGNSEFLNQQNDI
FT                   TSVSAKRLPHPAMTVPAGEMIPATLETAINSELAGMVRAITTRDIFALEGSKLLIPKGS
FT                   TLVGQFNTAITQGQSRIFVVWNRLQMTNGVIVTLNSPSSDPIGRSGQAADYIDRHFFER
FT                   FGTGALLSVLGAYTATGGVNGQDEYNSRSQYRMNIASSFQQAANQTLQQDMQTRSTLQI
FT                   NQGAAINVFVAHDLDFYRVAGRA"
FT   regulatory      203367..203372
FT                   /gene="lvhB11"
FT                   /locus_tag="lpp0179"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203380..204384
FT                   /transl_table=11
FT                   /gene="lvhB11"
FT                   /locus_tag="lpp0179"
FT                   /product="Legionella vir homologue protein"
FT                   /function="putative component of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11326"
FT                   /protein_id="CAH11326.1"
FT                   /translation="MEAIKACFSPGATGLLSPLQDFLEDEHVSEILLNKPQEVFIEQHG
FT                   QLTRFDIPVLTSQYLRRLFLLIANENKQTLSESTPVLSGNLADGSRVQLVMPPASLHET
FT                   LSIRKFTLKQVSFEDYKAKGFFSSARGVGVKEYSECIGKTDGLLELYDAKSWQEFIRQA
FT                   ILQKKNIIISGGTSSGKTTFLNSCVGQIPLHERLITLEDTYEMDVPHSNIVRLKALKQI
FT                   GDHAQKITMQDLVQATLRLRPDRIIMGEIRGRELFDFVSACSTGHSGALATIHANNPKV
FT                   AFMRMAQLYKLNQVAGMDETDIYKVLHEVIDVIVQLQKTTDGRRLVEVYYKHA"
FT   regulatory      204359..204364
FT                   /gene="lvhD4"
FT                   /locus_tag="lpp0180"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        204377..206278
FT                   /transl_table=11
FT                   /gene="lvhD4"
FT                   /locus_tag="lpp0180"
FT                   /product="Legionella vir homologue protein"
FT                   /note="putative component of type IV secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11327"
FT                   /protein_id="CAH11327.1"
FT                   /translation="MRNPWVVAITLIGGLAINGQMAVLLTGIAQWASPLVLVDLLTHGF
FT                   YWETAIAGCITALLMGCAVGFLKQGFYRYLSFLISSILLGGMVVFLLGFELYSWIFLSS
FT                   VQSLSGLMELAFLRYQEPELWHLFLTVEGIVFILTFLAIALYLFHWLKPNNKALGNAHF
FT                   SNGFETKKAGFFERQDQSIVIGKKYGAPLYSNGFEHVLVFAPTGSGKTRSIGIPNLFNY
FT                   PYSVVCNDVKLTLFRTTSGYRERVLGHRCFCWAPADENRITHCYNPLSLISEDKIQRLT
FT                   DIQRIAHILMPDNKKSDPIWQQASRKLFKVAVLYLLDTPERPTTLGEINRLVKQAGFDD
FT                   WLASVLEETNHLDPEFYRNGYSYLNNHEKTRSSILETFSGYFELFDDPTIDAATARSDF
FT                   DLRQLRREKITIYIGFTDDDMERLSPLLTLFWQQLISVMIKNIPDPVDEPYPLLCLIDE
FT                   FSSLGRIERLRRSLKLLREYRVRCVLIMQYIAQTYEQYTHDEAKAFTNIKTKIAFATED
FT                   IFDAEYVSKLLGTRTVKVSAGSTSTQTQGYSESKSYNYQAIPLLRPDEVMRLPEDQTLI
FT                   MRTGHAPVKAAQMVWYLDTTMKHLACGSTEVPRQNVTHHPFVHQASDKSLMPEALEL"
FT   CDS_pept        206376..207173
FT                   /transl_table=11
FT                   /gene="lvrE"
FT                   /locus_tag="lpp0181"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11328"
FT                   /protein_id="CAH11328.1"
FT                   /translation="MNHLKIIGTAGLFMMSCAAQANDKELWAHIEALYSKIGTLQTQIN
FT                   SIPQGAPGPMGPAGPKGERGPAGTYTAGEGISISNGEIKTTLTHHIGEEYNGGIIFWVD
FT                   KTGQHGLIASKTDLNNNEGIQWRNGESGNKVTNARADGIYAGESNTKLIIAQQTIDNQS
FT                   GTFAALLAANYRVLGDGITPCPIPTPESATCYGGWYLPSAYELTLLHNNLQRQGISTFA
FT                   PDYYWSSTESSVGEAWLQNFSTGELMASGKASTLGHVRAVSRF"
FT   regulatory      207407..207412
FT                   /locus_tag="lpp0182"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207419..208168
FT                   /transl_table=11
FT                   /locus_tag="lpp0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11329"
FT                   /protein_id="CAH11329.1"
FT                   /translation="MITPVSPIYLKQEAKKLKKIQGLSMGKALDEVSKKLGFSNYRHYL
FT                   NVYESNLKEPAPSKEALLKMISSERDMLKKMKIATSFIQQFKTPFRDVLNIINQFQHSR
FT                   KAVQSICGKLNLMKKEIQSFLLNDFLSEEGQDEINFRAPYFIAKKIFISHLDYEINANA
FT                   LNVNGQYVLQTEFELELDHNDPLSKDARFNDREFEGSFRVEINKDKTITLIHSDMSLDS
FT                   RLEPMHGFTEEEVEDYYNRFPNERGLI"
FT   CDS_pept        complement(208292..210931)
FT                   /transl_table=11
FT                   /locus_tag="lpp0183"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to L.pneumophila TraA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11330"
FT                   /protein_id="CAH11330.1"
FT                   /translation="MAIAFAQASIHSRAKGHSAIAASSYRSGAKLYDARTGITHDYSNR
FT                   HDVIYSDILLPEGSPEAFSEREFLWNKAELAEKRCDAQVCKDIVLALPKELDLVQQIEL
FT                   ARRFAQTHFVDKGIPADITIHDHHDGNPHAHILITTRRLEKTGFSKYKARDLNPAFAKG
FT                   FIIEKDYWGEQWRDMQNEYFIEKNLDLTVDLNHIISERHHGKLKDTDNHYLLTEKTILQ
FT                   QARQEVLLNDIDNVINHISAQNSVFTRRDVERLVFKTFRPSNTPQNYLHWVEQIMGHED
FT                   LIELGTNERGQLCYTTRHQYIQEAKLRDDIEAMIKNKDGIGGKGIDNIIKNYPLSDEQL
FT                   EAVRYITGGSQISVVIGRPGTGKSYLLKPIKEHCEQNNYLVIGAALSGKVAKSLQTDTG
FT                   IPSSTIASLTYKLANQQLKLNSNDVLIIDEAGMVDFASMALLIREAKKAGSKLILVGDP
FT                   DQLKPIHKGEIFRGIAALTGYIELEHIKRQNDLGDRLASMNMAKGMIVEAVDHYHEKGA
FT                   IVFSETTEAAAQNLIHDWQADITNTNLQDSVVLAFTRASVGYLNEKARLALKEKQILGQ
FT                   EEIAFQGFKKPLKIAVGERLLFRQNDKILGVRNGDLGTVQSIKKDQFQIKLDSGELLTI
FT                   PNSYNKIDYGYALTVHKSQGMTVRHSKVLIDSKYWDRHLSFVAMTRHKDSLKIYADSIN
FT                   HPTIKELKQTLSRSTTKDNVIDWPLDFATRAGFNPDQLIGRVLNHIAGVGHKIKSAFNY
FT                   VVHYEAYLVDRQFRGLQEDKTELRAKAKLIADRQDQSTQEITISNSKETVYKELQKNHP
FT                   TLAKYQKLLDKRKNLTGYFAERIDKQINAYARELAKDRQLMNHLQSHLPRVAEKINRVS
FT                   RHAKSHNL"
FT   regulatory      211167..211172
FT                   /locus_tag="lpp0184"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211180..211386
FT                   /transl_table=11
FT                   /locus_tag="lpp0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11331"
FT                   /protein_id="CAH11331.1"
FT                   /translation="MSKMTVSQMEAVLLDRIEKAKIKLDKLQQKHKLEIGTLAYKHGLH
FT                   QFDIQRLDAAFLKLARELRNDND"
FT   regulatory      211360..211365
FT                   /locus_tag="lpp0185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        211373..211642
FT                   /transl_table=11
FT                   /locus_tag="lpp0185"
FT                   /product="hypothetical protein"
FT                   /note="some similarity with TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11332"
FT                   /protein_id="CAH11332.1"
FT                   /translation="MTTIKQIEKERQLLARCEKSLMLEKLKKRKADTRHKIELGGLIIK
FT                   AGLHRFEKAIILGALDFSLELIKHDKHYENLFLDRGIDLFSSIR"
FT   CDS_pept        211736..212383
FT                   /transl_table=11
FT                   /locus_tag="lpp0186"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11333"
FT                   /protein_id="CAH11333.1"
FT                   /translation="MLRRSLKTKNLKFLIPVLVTNMLMIGILISSNIKLDVSLLQNLYL
FT                   FPIKAEIASAPIIIFLCILINALIPSNLKALIIFWRIDALPGHRAFSHFVFSDPRINLD
FT                   SLRSKLGEFPDNPRSQNLLWYSLLKKHESNITVKEAHQYFLLFRDATSMTLIIFLLFFA
FT                   STFFYEIHMAKFVFLMLLGEYLLLMIASRNMANGLVKNVLSLESNSPAIKGD"
FT   regulatory      212373..212378
FT                   /locus_tag="lpp0187"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212387..213196
FT                   /transl_table=11
FT                   /locus_tag="lpp0187"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11334"
FT                   /protein_id="CAH11334.1"
FT                   /translation="MKLQIFDVEHGACALLTCINGTRLMIDCGHNANSGWKPGSYLRSQ
FT                   GVTHLDMLAITNYDEDHVSGLPDLLEQVHVNWLWRNPSVSATDIKNMKAKNGMGYGIES
FT                   LVNILPTYKYTGWQPPEFSFVERRGFYAPYPTFVDTNNLSMAIHLNIAGINFLFSGDLE
FT                   SGGWNTLLKDQSFRNVIANTDIFIAPHHGRESGIYPQIFEEYQCFPHYIIMSDKSHMYD
FT                   TQKTLDYYSSKARGGFFRGKHRRVLTTRKDGSITFNFNFLKGECLVA"
FT   CDS_pept        complement(213223..213684)
FT                   /transl_table=11
FT                   /locus_tag="lpp0188"
FT                   /product="hypothetical protein"
FT                   /note="Similar to cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11335"
FT                   /protein_id="CAH11335.1"
FT                   /translation="MDKYIYDFMAATIEVAATNPMAPYGAIIVYDDKEILLKSVNNAHN
FT                   NPLMHGELSVIHRLFENGFDGDVSRLSLYTTAEPCPMCAAAIYWAMIPKVVYGSSISFL
FT                   HELFGRQIQVDAKEILSKTPNFYECQLLGGVMEKNCNQLFIEAKKLREL"
FT   CDS_pept        complement(213677..215104)
FT                   /transl_table=11
FT                   /locus_tag="lpp0189"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11336"
FT                   /protein_id="CAH11336.1"
FT                   /translation="MNNSIGKSKTPLQYKVFHTLLGFAVFFSLITVPAEAQVIQIHGIL
FT                   TSSELLWWPVVFFVLRLIHGVYGFAYLRHAVYAVLLFHAIYVLFLKFAIWLPASSFWKM
FT                   QEPYTQVLGRDFVYLIKSSLFLWVCALLPIRFASSANHKYYGYIFWVSLVAFCFLDMGW
FT                   LNMHKNTPDTQIVVPLLIFGLLNIFYNWLSVVIARIEHIESPIQSDRHLLKFQLPQVLK
FT                   NDGNTFKYHHMLFCSSIVFFIASKTMAAKFISIGFLTINVGGIVFSLAYLAADMMTDVY
FT                   GIERTKQMVLFVIFCNLLFVFDVWVTNMLAIGENEPYRAILHNQARMFIASATAFFLGM
FT                   TINSTVISLIKSRQRKRGISLKKEFITTVWTRIATSSAFGIIIDVSLFSLVAFYGIVPT
FT                   EKLASVIVFEDAYKISYEVFLAPVSILMIYFLKVKEKVDIYDELSNLNPFRIDTNYKVS
FT                   ANKFAENYMKPAERNDG"
FT   CDS_pept        complement(215097..215456)
FT                   /transl_table=11
FT                   /locus_tag="lpp0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11337"
FT                   /protein_id="CAH11337.1"
FT                   /translation="MEKWNQGNRFLRFLYQHLYLRFNGQIREPYLIRIDNIYTDPDSNE
FT                   LTVSFHIANKRVNQDMSVAEFVKTDMIYLVDPRIVFDMGQQFGSHSEKLIVAQKTEPSL
FT                   KKRCVSTLKRVFIDE"
FT   regulatory      complement(215114..215119)
FT                   /locus_tag="lpp0189"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(215465..215470)
FT                   /locus_tag="lpp0190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(215473..216120)
FT                   /transl_table=11
FT                   /locus_tag="lpp0191"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional repressors (RecA-mediated
FT                   autopeptidases) and prophage repressors"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11338"
FT                   /protein_id="CAH11338.1"
FT                   /translation="MTTNILSESNNLQLAQTLTDLIERENKLTPAALARKLGIPTNKIT
FT                   RILNGDVTDPKASTLLQIANYFGITIEQLLGLESIVREGTSITEPLAQSLPIYEFSHPT
FT                   RMTNEWYRWSTNEIDGDYFALAIDTDLYEPTFPQNSLLIVNPDMMPDDRSYIVVKRNDS
FT                   PQHCSIKKYVLEGTQGYLYPINPKLPVELFDRNLYTVAGVILEVHQKLRSKK"
FT   regulatory      216275..216280
FT                   /locus_tag="lpp0192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216289..216528
FT                   /transl_table=11
FT                   /locus_tag="lpp0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11339"
FT                   /protein_id="CAH11339.1"
FT                   /translation="MDQQVKLNIYKGMIQYIINSTHYTLKNIADLSDTHIDNIRSIYCH
FT                   NAVPNSFKSEVQLMKLYQIVLEISTNPKNLALAG"
FT   regulatory      216545..216550
FT                   /locus_tag="lpp0193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216559..216765
FT                   /transl_table=11
FT                   /locus_tag="lpp0193"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative phage excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11340"
FT                   /protein_id="CAH11340.1"
FT                   /translation="MKWVKLKKYCQDSGDTSDAVHAKRKRGIWLDGVQCKLGPDGNIWI
FT                   NLIEVEKWVENGNKATNCSLRAV"
FT   regulatory      216701..216706
FT                   /locus_tag="lpp0194"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216714..217922
FT                   /transl_table=11
FT                   /locus_tag="lpp0194"
FT                   /product="hypothetical protein"
FT                   /note="Similar to phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11341"
FT                   /protein_id="CAH11341.1"
FT                   /translation="MGGKRQQGNELQPPRGVSIRQWETGSAIRIIFSYRGVQCRETLKL
FT                   EPTKANLKYAERLRGEIINAIALGTFNYADYFPDSKRAKLFGHAIIKATTAELLQDYMA
FT                   IAERTLEASTYNGYRKVCETHLYPAFGKIPIRELSPVIIRNWITGLNVTVKTVRNILTP
FT                   LRNMLDQAMNDGIIERNPLDRLVLSKLLNKKTSKSDWEVDPFDQDEIKAILDAATGQAR
FT                   NLFQFAFFSGLRTSELIALEWNDIDWLKGTVRVSKAVVLKQEKGTKTKSGVRDVLLLPP
FT                   AFDALKNQKAFTYLEGSRVFYNPRTNTPWETDGQIRKTCWTHLLKKAGVRYRNPYQTRH
FT                   TYASMLLSAGENPLWLATQMGHRDTEMIIKHYGRWIPDKSTVAGYQPVNDWNFSISTTI
FT                   SKS"
FT   CDS_pept        218149..218973
FT                   /transl_table=11
FT                   /locus_tag="lpp0195"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11342"
FT                   /protein_id="CAH11342.1"
FT                   /translation="MSTLISFFEQHPVFTQDEYRQFLLSQGTTNPNTQRELLAYHLKKQ
FT                   HIIRIRRSLFASIPAAFRDVAEEFPVDSYLLAGRITQDAVIAYHSAFDLHGVSYSLHHQ
FT                   CLYLSDQLIRPFKFKEADFIRLPFPNSLLEQDATQMDVLSIDRQGLDVKVTSLERTLVD
FT                   VLDRPNYGGGWEEIWKTADHISILNLDKVINYAQLLNNATTTAKLGFFLEHFKQQFGVD
FT                   ESSLKLLEAQKPSGVHYLERGKRESGKLLKRWNLVVPTYILDHSWDEPNEDV"
FT   regulatory      218948..218953
FT                   /locus_tag="lpp0196"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        218960..219922
FT                   /transl_table=11
FT                   /locus_tag="lpp0196"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11343"
FT                   /protein_id="CAH11343.1"
FT                   /translation="MKMSREKLQQESASTGFKMEHLEKVFILMELLEDFTSFPQFKDKF
FT                   ALKGGTALNLFFFNLPRLSVDIDLNYIGSTDRETMMSERPALEKTVVAICERKGFTLDR
FT                   NPGRHAGGKMVWRYPSALGQMGNLEIDLNFMYRIPLWPIEYKSSCAVGSKQIHNIPVLD
FT                   SHELSAGKLSALIDRKTGRDLFDAHYLLTKTNLDMAKLRLALVVYSAISRKVDLRQLTP
FT                   QAISVDITDLKNRLIPLIRKTEIEAMNGISNWAEQMVQECQQAFDQFLPLSSSEHLFLE
FT                   NLLDKGVVEPELITTDTLLIENIKNHPAIRWSAQQHHTN"
FT   CDS_pept        220253..222193
FT                   /transl_table=11
FT                   /locus_tag="lpp0197"
FT                   /product="hypothetical protein"
FT                   /note="Similar to adenine specific DNA methylase
FT                   (Mod-related)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11344"
FT                   /protein_id="CAH11344.1"
FT                   /translation="MSSSDEKIDKPKLCWPGKHLNERVSLPFQTIETINNSEIDHHKSN
FT                   WDNRLIWGENFLVMSSLLKEFAGKIQLIYIDPPFATGQDFSYTVNIGEHTEAMKIPSAL
FT                   EVKAYRDTWGKGTESYLQMMYDRLSIMKDLLAENGCLYVHCDWRVNYLLRFILNEIFGE
FT                   ENFINEIIWRRKQAQSWSANQFGVTNDSILLYTKGKDYIFNPSFSKDDENTKKYILERF
FT                   KFDDGDGRKYMKSPLVNPLNRPNLRYEFHGVKPPKTGWLYSMERMEEMFANNELVMPED
FT                   KNARIYRKIYEDTYQGQMIQNIWLDIPIVNPMAKERVNYPTQKPIALLERIITTSSNTG
FT                   DLIADFFCGSGTAGLAAEKLGRRWIMVDLGRFAIHTSRKRLLDINSTPFIVQNLGKYER
FT                   QHWVKMNGQYTGYLKFILELYGAGVTEELVRQFRQAFKTLHGKKGDVYIHIGNVDAPVT
FT                   LLEIREALQECKENNISKLVVLGWEWQLGLHELIYEEAHPYGVKLRILQIPREVMELSS
FT                   NDRKKHDIQFFELACLETETKIVNKNVIVTLTDFIIPHPDLLPIEVREKISNWSDYIDY
FT                   WSIDWMSNQRSYKNKTIFHSMDQQYRTRENSNLNLSMSHKYDNSGNYQILVKVIDIFGN
FT                   DTTKMVEVKVS"
FT   CDS_pept        222190..224688
FT                   /transl_table=11
FT                   /locus_tag="lpp0198"
FT                   /product="hypothetical protein"
FT                   /note="similar to Type III restriction-modification enzyme,
FT                   helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11345"
FT                   /protein_id="CAH11345.1"
FT                   /translation="MSLNNTVSGLPIPNALHESVKIWRNDGYKNVSNTTKRLLEWWFLE
FT                   EHELDNGTPFSFWEGQREAIEHLIYCYEVLQARSLYELVRQLDVKIFIDPSEDKWTKYA
FT                   FKMATGSGKTIVMAMVIVWSYFNAQKEDKNKFSQNFVLIASNLIVLDRLLGDSVNPTFF
FT                   EGGIFRQYPFIPSEWISDFHINVVSEDELPVHSKPGLIYLINWQKFIERDLKLEDNPVQ
FT                   VVLGPKPPSDLQRKKKLKDILANLKNILVINDEAHHVWDEELIWYKAIDSLHSHSPLMC
FT                   QLDFSATPKDQNGNLFSHIIMDYNLGRAIEENIVKRPKIAELRNVPEIASQKASERYKV
FT                   QIDAGVDQWRKIWEVMIKAGKKPVLFIMAEDNKAADDVANYLENFSDLTHHILTIHSAR
FT                   AKGQIADKDLDMARKAAREIDSFANPYRAIVSVLMLREGWDVRNVCIVVPLRSYSSKAK
FT                   ILPEQTLGRGLRRMWPEQTDLEEQLIVIEHPQFHNLIEEAFKEQGVKAKFYSLDDVFVS
FT                   PELIQIDNEKLQYDIEIPILIGGLTHSITGLERLDFNCFDKKVFEYDSLIPNEIILQKV
FT                   DMLTKKLESEEILEFPFANNPQVYIASITHAIVKATKIPGQFHKIAPIVKNYIVNDLFD
FT                   RTIELDNIEALKKLNLPVVRKVIISNFIEEINKLVVVEETPILSIFLKKASDIKPFQCS
FT                   VNTINLRKTILNKVPYSNELEKNFLIFLDHVNDVEAFIKNETRTMNLKIPYVDHAGFLR
FT                   NYIPDFVVKTPDLMLIVETKGRIDIDVAAKDAQTRRWAQMVSAKTNKNWEFLRVNQSDF
FT                   DGGGYNSIRDFLILASKQKH"
FT   CDS_pept        224863..225129
FT                   /transl_table=11
FT                   /locus_tag="lpp0199"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11346"
FT                   /protein_id="CAH11346.1"
FT                   /translation="MKKSRYTETQIVKILKEVEAGRLVKEICREYGISDATYYNWKAKY
FT                   GGMEASDVKRLKDLEEENRRLKQMYAELSLDHKILKDIVEKKL"
FT   CDS_pept        225090..225545
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0200"
FT                   /product="hypothetical protein"
FT                   /note="similar to transposase"
FT   regulatory      225529..225534
FT                   /locus_tag="lpp0201"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        225539..226405
FT                   /transl_table=11
FT                   /locus_tag="lpp0201"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11348"
FT                   /protein_id="CAH11348.1"
FT                   /translation="MVRPLRIEYAGGLYHITSRGNRKEAIYLSDEDRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLFIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGRYKS
FT                   ILVEKDSYLLELSRYIVLNPVRARMVEKADEWHWSSYLATSGRAPVPSWLTVDWLLSSF
FT                   GSIKSEALINYEQFVDAGLIKKNPLLDLKHQIYLGSDEFISRAVSYVKPTIDFTDISRA
FT                   HVPDLVKGFAIEEYERMSGNRDEAIYSSYKSGLYSMKEIGKHFGLHYSRISRIIKQHYI
FT                   QEAKDKI"
FT   CDS_pept        226596..229781
FT                   /transl_table=11
FT                   /locus_tag="lpp0202"
FT                   /product="hypothetical protein"
FT                   /note="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11349"
FT                   /protein_id="CAH11349.1"
FT                   /translation="MKDTPERLIAEAAAHSQSTHNVVTSNAAASLVIRLATEYLFKGGA
FT                   ATSSLAASSASMTSSMSVSVAGNVDAEKRMQRRIKRYENRKGMLEESSKLWLRKTRDSY
FT                   TPNTLLDRVTLVGKDSTSTEWYLPLPEVYAIVLSALMDKSLERWPVPVGSSPEKERLLR
FT                   LREFDQVNNALAKARPAICSTGIRHAWLMALDGYEGKRLPLNAEDVLAQGMFDFMVQEV
FT                   LAKRMGITLAHERDPVGDERVRFNQHFQSLFLPWVLGEAPESVCNVIADAKTSESALSF
FT                   VLSRFEAIGFMPDDIMMQRVRGSCSEAGLEAIPCNFTPLLATLHAGMARHASALFLRPN
FT                   GVPATSSQKVAQQTIQWLRGPDFSPEALNAQLERGTPFQNVYLVLRFLDALQQYKERKH
FT                   LLHVCDMPVEDKAAWVESLAFFGACLQDPEPSLERLLADTPRLEERIRAFERGFSVWRS
FT                   NSYQDFITNYFAQWFGNEEISARGQLFTRLCELYARETAQSENPAIRVSDAMLKEWTGQ
FT                   IGEDGLLPVEPYQINRILLHALCYPQHTWTPLFRENLSILLRFIRSGFNEENTVRSQAL
FT                   SRASYPEALLADIEAIATGTLAHTPAVLTPSRITDDASSLYATRLLASTPDAPESAIRA
FT                   VVENPGFNPDAKDNNRLTPFYLAAAYGHIPLASVLLERGANYLVKCLNQYSSLYIAVEN
FT                   NHLPFLRWFLGALSVEQRIELLVVQDQHRNTALHKALSRPELLKLLLEGLSLESRVQLL
FT                   EMKSQYGNTVLHLAASRPESLKFLLEGLSIEQRVELLTTLQRKDGASVLHFATSNPESL
FT                   KLLLEGLSIEQRVKVLKMKNQYGESVLHIVASYPEPLKLLLEGLSIEQRVELLAVQGQV
FT                   GNSVLHEALSQPQSLKLLLDGLSEEGRVQLLEMKNQYGNTVLHLAASHSEPLKLLLEGL
FT                   SEEKRFELLRAKNQHGYSVLYRALSCYPESLGVILEMLCETTQRQVLEDLGCLRGNVFL
FT                   GKPEILDEINFALKFSVSVSNTSVSCLDTSSQAATSSGNQNTFFDSGSKRRIDAQRNTS
FT                   PEETEERACSLKK"
FT   CDS_pept        230009..230875
FT                   /transl_table=11
FT                   /locus_tag="lpp0203"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11350"
FT                   /protein_id="CAH11350.1"
FT                   /translation="MVRPLRIEYAGGLYHITSRGNRKEAIYLSDEDRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLLIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGRYKS
FT                   ILVEKDSYLLELSRYIVLNPVRARMVEKADEWHWSSYLATSGRAPVPSWLTVDWLLSSF
FT                   GSIKSEALINYEQFVDAGLIKKSPLLDLKHQIYLGSDEFISRAVSYVKPTIDFIDISRA
FT                   HVPDLVKGFAIEEYERMSGNRDEAIYSSYKSGLYSMKEIGKHFGLHYSRISRIIKQHYI
FT                   QEAKDKI"
FT   CDS_pept        complement(230880..231446)
FT                   /transl_table=11
FT                   /locus_tag="lpp0204"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11351"
FT                   /protein_id="CAH11351.1"
FT                   /translation="MMLKPQDIVILLKMLANKNPQQFIQKDLATYLCMSASEVHEGMKR
FT                   LTLSHLLVPVSQESDTNSKRKKILTPIKAACEECLIYGVKYFCPVRLGEYTRGIPTSYA
FT                   APLFAKYIVLGSDPIPIWPYAEGDHRGLALEPLYRSVPQSITKHPDQIFYELLVFIDAI
FT                   RTGRARERALAIKLLRERISLNEST"
FT   CDS_pept        complement(231770..232150)
FT                   /transl_table=11
FT                   /locus_tag="lpp0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11352"
FT                   /protein_id="CAH11352.1"
FT                   /translation="MSMLYTNNYEEISARLLDLSPILITATIPPKASVKHTTIHKQLIE
FT                   LNDIHNTLLLLIAEELPHWHLTIKIPSPTALPSIYTFTEFVTERDRLFAAITEYNDLYL
FT                   HLVHVRKSHEEDWSIKFNVKLH"
FT   CDS_pept        complement(232229..232765)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0206"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C-terminal part of phage integrase"
FT   CDS_pept        233168..234034
FT                   /transl_table=11
FT                   /locus_tag="lpp0207"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11354"
FT                   /protein_id="CAH11354.1"
FT                   /translation="MVRPLRIEYAGGLYHITSRGNRKEAIYLSDEDRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLLIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGRYKS
FT                   ILVEKDSYLLELSRYIVLNPVRARMVEKADEWHWSSYLATSGRAPVLSWLTVDWLLSSF
FT                   GSIKSEALINYEQFVDAGLIKKSPLLDLKHQIYLGSDEFISRAVSYVKTTIDFTDISRA
FT                   HVPDLVKGFAIEEYERMSGNRDEAIYSSYKSGLYSMKEIGKHFGLHYSRISRIIKQHYI
FT                   QEAKDKI"
FT   CDS_pept        234326..235429
FT                   /transl_table=11
FT                   /locus_tag="lpp0208"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11355"
FT                   /protein_id="CAH11355.1"
FT                   /translation="MKILKFLCSIVFSLILIATTLNAADIDYIIDTDIGGDIDDVLALF
FT                   VALDNPVKPLAITTTHIEPREKAQIAKLVVTYAGFSEIPVYAGIGTTRNDPRELFLQQN
FT                   PLWPPFFGYPDSLPGDSPWFPQQAVPYRQMNHSIFDEMNIEEESAPEYLARIAKNYSPQ
FT                   HKLVIVSLGPLHNISAALKINPSISSNLKIYSMGGIYPKGYNWLVSPEVTAPVLGTTEV
FT                   ISIVSQFVDAHDFYITPEEFLEIEKSAQSEFGLAVIQDWKNWYNIDKRNLNKTHLSDPV
FT                   TLYLALHPEEITHMSSKLLTFPCLDLNGVLAPEFAGSWYNMPGLENKLMKVEDSEESHI
FT                   KFVSQVESSSAIRRKIINSIKQILGNS"
FT   CDS_pept        235729..237378
FT                   /transl_table=11
FT                   /locus_tag="lpp0209"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of sidC"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11356"
FT                   /protein_id="CAH11356.1"
FT                   /translation="MKLPFKEPVAPRYIYINPQTNVVHLLMPVMSGTEIGLDNTCKSVY
FT                   SLLEFFCLLGANQQSAASMILKNYQEGLAFDIKYHPNSEQKALKEQRLVQINMYLRLLQ
FT                   QVQQEEQITNPLKLIFPTYPAALESLMQASEANLYSVILRPEEQDVQLRTTAISPVFSA
FT                   HHDTMVNGQRIEKKSSLYEILSNSYEGLVFIPKSKEQLIERVLSKCADSPVDFEHIRAM
FT                   LTQETKAYLGIEESFNQTQGNRYAPSAPVNQAYIDGELMISAEYPATPQDYLNALLEYC
FT                   TPNLFDNIEESPFYTINNKERLSILTQFFLAELNIICREEGIAETNFGQILEANPELIN
FT                   NLAKCVKQALTSYQSVEDALINYVNQHRDDFQFTSPIPQYSFPKLKERFNSHYKQIKDS
FT                   PHFDEFMLLSTKKGLFFAHQGCIAVHFACFMNALFFNDILDENTKTFLQSVQQDFETID
FT                   KFENTIPHQNTHINAGMKEAVLDLSSMDNEALQDLYEDINSYQDSNLKEALLAQLKQER
FT                   PDFKLQMNAKIFLQHVAYGEQDEAEELLNKDP"
FT   CDS_pept        237675..238718
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0210"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (ISL3 family)"
FT   CDS_pept        238709..239518
FT                   /transl_table=11
FT                   /locus_tag="lpp0211"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins, possibly interrupted by
FT                   an IS element"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11358"
FT                   /protein_id="CAH11358.1"
FT                   /translation="MFLISAPGNGEEPYEYAYWAKDSHMQRMLEKYIRQDDETRQFMLE
FT                   RVKAIEELVNPPEAERFFAHPKPRGLHYTTQNKEGKTIDHWEAHVDLTPLKKALQHFLD
FT                   EFKKLYNNPKPNNYREVLNNIWVKEVGMAQRCVPAHIAQEYCRVGWDLFLRLKDNKALF
FT                   DASNPNNLKRQLKIFDWNTYTYDLWFTPGSHAVDCGLGFSCALIRGGNNCPRPTNMYDR
FT                   WTTPNEVVEQDLEMISIIDEVRTCDLKQSLENLSQPLIAQAAQYLSI"
FT   CDS_pept        239615..239896
FT                   /transl_table=11
FT                   /locus_tag="lpp0212"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11359"
FT                   /protein_id="CAH11359.1"
FT                   /translation="MESALYNYFPMRWFISKEASIPSQIQDGPARLNGSQEADEGIKMH
FT                   GGSTILSPKNKSSRVRFYSSPVLDAEKPAMRFFSSLSTEPVSSNNSPI"
FT   CDS_pept        240007..240228
FT                   /transl_table=11
FT                   /locus_tag="lpp0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11360"
FT                   /protein_id="CAH11360.1"
FT                   /translation="MISRSDLIKYSCRVESAFLISSTITNTGGFYQAHNTLTLNRWFFL
FT                   YCLKIELCYRGINWLVYCPFYHKNGKTN"
FT   CDS_pept        240269..240784
FT                   /transl_table=11
FT                   /locus_tag="lpp0214"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11361"
FT                   /protein_id="CAH11361.1"
FT                   /translation="MFNVSIRKATSLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIPE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDGIEDNSKGEISAIYIHPNFWHQGF
FT                   GKKLSLAALKTLKELGYTEALLWVLSDNHQARSFYEGMGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
FT   CDS_pept        complement(241233..241457)
FT                   /transl_table=11
FT                   /locus_tag="lpp0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11362"
FT                   /protein_id="CAH11362.1"
FT                   /translation="MKPIKNSKEQEHIAPEAQDPRLSYTEDDRRPLTSTTSAKHPSRMF
FT                   GKSEERSARESYDQYGNNVTTYWTQGPWN"
FT   CDS_pept        complement(241674..241988)
FT                   /transl_table=11
FT                   /locus_tag="lpp0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11363"
FT                   /protein_id="CAH11363.1"
FT                   /translation="MKPTLFLVLLWICTESFGTTIMVKGLPSALEYRNDLYYWPPNVAI
FT                   SPDTTNLFITMDGIDKVCFLNTGLQGGLEQISEISIIINGAKKDWNCFPYTTTILEARP
FT                   "
FT   CDS_pept        242283..243719
FT                   /transl_table=11
FT                   /locus_tag="lpp0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11364"
FT                   /protein_id="CAH11364.1"
FT                   /translation="MTPLFPQKGHPIAIKQGRSGSCFLLACLDCLLNGEAEGIDVVRKK
FT                   FKQTTSGVTLRIKRTDNTMKVQWEKMAGKYTYSYDPRTDEDVIFIDNEKLKEIDNSKKG
FT                   SSSNSLAVKILEHISAYYYQIAWDGESLLAHKLHPKFRNNPIAKQSDTAFLAKLLGVHV
FT                   TSFYDPRKLVKLKTIDPMIPVYVGMNFGKLDRLGRHRRHALRIGNIKPLDDGEYEVTLI
FT                   NPWNNQKQTTCLLSALRKRKCHFAVFDSSPQKKLLTEIFLEYKTEIGCELFRNKELAFL
FT                   LCEMKQCGLLDSELAKYPLSSCMVLYKKLPNLVANYRRLPYNERYNMLICVANSNGHVR
FT                   LFNKLMQGLSVVDKPSMSRSPQRVYPSAKSFFADLFASLEASLERVHYNDLLKTLRVNY
FT                   GHLRSVNTALNQVENRQGIYSKMELRNMNQRLERLGFFMKCHTDPRGYRHPDLGQQPNF
FT                   CNRSTEKVNAKSHQDKGVSL"
FT   CDS_pept        243980..244726
FT                   /transl_table=11
FT                   /locus_tag="lpp0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11365"
FT                   /protein_id="CAH11365.1"
FT                   /translation="MKRYIWFHPSYVSESAEATLLGQQTNAKDHGYILLNDQDLGKVTC
FT                   EDHLTIMGHSTLAPTPAEDTGLYMQGDTADDLIGRLTTNGLKEAPKILSLESCRAGISG
FT                   GLAQQLSRSPFFKYTLIEANLNSVGRKPMEMQWNFPTDSLGRAVLKLDNSPWMFYLGGF
FT                   LVGRLTHDTYTTEDLFSLLSPPTFHKHFFAHYQPGFFGGRSGRHCLFNKTTITLEKASN
FT                   FAHEDQDSASAKALEVVLKKLYFQPA"
FT   CDS_pept        complement(245074..245952)
FT                   /transl_table=11
FT                   /locus_tag="lpp0219"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11366"
FT                   /protein_id="CAH11366.1"
FT                   /translation="MLTNIERAKLQLIDETSDMVIITKAEPLDAPNGPEVVWVNKAFEN
FT                   ISKYKANEIIGQTPRILQGKETNQNTLKMIKEAIKAQTNINVDLLNYTKDGTPYWIKFS
FT                   IVYLRDGQGNLCYLGAIEKDISAIKNLNIQLSEKAKTDPLTNVYNQENFFITGNEAVKN
FT                   FHQNQETVGLLFFDVDDFKGINDTQGHIYGDKILKKVAQESLKLIRKTDNVFRYGGDEF
FT                   AIIFSGINVKILEKKAQQLQKKLAKSHISVSIGGTISKQSDKSINTLLARADEALYYVK
FT                   ANKKGLFFIRE"
FT   CDS_pept        complement(245982..247064)
FT                   /transl_table=11
FT                   /locus_tag="lpp0220"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11367"
FT                   /protein_id="CAH11367.1"
FT                   /translation="MPCEKCDSAATYHLSGTYQLLILPPRGHCYSKLLKYLTENNFDIN
FT                   KRDSGIIELLFTAERAQDIGHALERCYSQAELEDSKAVLLPIDIADRNVERVLNHTHSL
FT                   KKIVGLCLSQWLVGLIENQGLSTFCQPILHNTTLKPYGFECLLRGKQDNNILPSSDLFG
FT                   AAKSSDMLFLLDKKARICHIENMSKIDIADKKIFINFNPTAIYDPLFCLTTTNQSLKKT
FT                   SIKPAQIVFEVTESDEVKDKKHLLKIIDYYRNQGYCVALDDLGSGYSSLNLLTELQPDY
FT                   VKLDQELISQIHTNEFKQIILEKICEMATKLKIKIICEGIETEDELQIIKNYAIDFYQG
FT                   FLFEKPMPYEKIPDYIKAST"
FT   CDS_pept        complement(247179..247940)
FT                   /transl_table=11
FT                   /locus_tag="lpp0221"
FT                   /product="hypothetical protein"
FT                   /note="Similar to type I methionine aminopeptidase
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11368"
FT                   /protein_id="CAH11368.1"
FT                   /translation="MLVKTPEEIKKMRVAGHLAASVLEMIEPYVIAGASTKELEQVCRQ
FT                   YIIEDLKAIPSTLNHYGFPACICTSINHVVCHGIPSEKKLKNGDIINIDVTVQKDGYIG
FT                   DTSKMFLVGNIKPFAKKLVEVTQECLYKAISIVRPGTHLGDIGNIIQTHAEQHGYSVVR
FT                   EFGGHGIGKSMWEDPHIMHFGKPNTGLRLQAGMTFTIEPMLNLGRKEVKTLGDGWTVVT
FT                   KDHKLSAQWEHTILVTDNGHEILTLRADEHL"
FT   CDS_pept        complement(247921..248133)
FT                   /transl_table=11
FT                   /locus_tag="lpp0222"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11369"
FT                   /protein_id="CAH11369.1"
FT                   /translation="MGIVKISDELHEATKLMARAMSRSINSQAEYWIRIGKLAEENPSI
FT                   TYTDILKILVHQASLGEIYDVSEDA"
FT   regulatory      complement(247949..247954)
FT                   /locus_tag="lpp0221"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248310..248789)
FT                   /transl_table=11
FT                   /locus_tag="lpp0223"
FT                   /product="hypothetical protein"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11370"
FT                   /protein_id="CAH11370.1"
FT                   /translation="MKEKTAKQLKLFIIYLLSYWLLSIISCLIAFGYDNSLRMLLASPK
FT                   SDLSGALLFFSSFIATALLFVFRYKTFSDQPYPYFIFGFYVGNVSLLMLFILDAFIREL
FT                   IVWKFPEFLLVFISPFVELVLSYLFFGFAFLAIIPAVTSAFILYAVQRKLLLPPI"
FT   CDS_pept        249025..250002
FT                   /transl_table=11
FT                   /locus_tag="lpp0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11371"
FT                   /protein_id="CAH11371.1"
FT                   /translation="MNLKKEVFLNQNCAEMMIKKAAQLILRSDLDFEYTRGIQDIQVDL
FT                   GPAFMFSPDEEKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAK
FT                   SGWVSYSSQSNHFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAQNIIHAA
FT                   NFVYILRAQDENAAIEYCALNHEFHPEIKRTARVKAEPETRTNGEIHNPPKDLSCQNLK
FT                   TIYSKHVALLHVINRLEAGSKSYNPYWMGSQAKLNTILEALGACYQKGLDVDNELSNSN
FT                   SELSKAINIRRLPSIFSFWGGKNESPVESRKIINEKRTYRRNNP"
FT   CDS_pept        complement(250131..250550)
FT                   /transl_table=11
FT                   /locus_tag="lpp0225"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11372"
FT                   /protein_id="CAH11372.1"
FT                   /translation="MKTYRKELWFNIPERMGFINITDKVIECLKESSIQEGLILVNAMH
FT                   ITASVFINDDESGLHQDYKKWLEQIAPHEPIRQYRHNDTGEDNADAHIKRQIMGREVVV
FT                   AITEGRLDFGPWEQIFYGEFDGRRDKRVLVKIIGQ"
FT   CDS_pept        250975..251748
FT                   /transl_table=11
FT                   /locus_tag="lpp0226"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11373"
FT                   /protein_id="CAH11373.1"
FT                   /translation="MYKTVHFYSNNLKLEGKLEEPTGKCLGYVLFAHCFTCGKDIAAAS
FT                   RIASALVSNGFAVLRFDSTGLGSSEGSFSETNFSSNVEDLVAAADYLRAHYRAPVLLIG
FT                   HSLGGAAVLLAAKNISEVKAIATIGAPASAHHVKHHFSADLSKIESDGEAQVTLGPRSF
FT                   TIKKQFLQDIDRYQDTINSDAGKALLILHSPIDKVVSIKEAEKIYKAAKHPKSFISLDK
FT                   ADHLLSDKRDSQYAAEVIAAWASRYLTPSSEDQSG"
FT   CDS_pept        complement(251830..252285)
FT                   /transl_table=11
FT                   /locus_tag="lpp0227"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11374"
FT                   /protein_id="CAH11374.1"
FT                   /translation="MPDIKHYLKPIILFSGLLAAPFAMAEATKAEETSTVKLSTILQQL
FT                   SDQGYKNIHDAEIDDGVLTVEGSNEQGVKFEIHLDPATGKILKKQEHPQPKYSIIDITK
FT                   KIETEGKFKIIEIEFDEGIYKIKGETDSHEKKELHIDPNTGETKTDH"
FT   CDS_pept        complement(252453..253337)
FT                   /transl_table=11
FT                   /locus_tag="lpp0228"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11375"
FT                   /protein_id="CAH11375.1"
FT                   /translation="MAGTSLLTLIDDIATALDDIAVMTKVATKKTAGVLGDDLALNAEQ
FT                   IIGIHANRELPVIGAVAKGSAVNKLILIPLAILINFFAPALVGILLILGGLYLCFEGFE
FT                   KIVEKIFHKKNEPAKKKIDTQTIDMRQFEKEKISGAVRTDFVLSAEIIVITLGTVAATS
FT                   LINQIAVLTLISLIMTIGVYGLVACIVKLDDLGFILREKKYPLKQIGILLIGAAPILMK
FT                   ILSVAGTIAMFLVGGGIITHQIAAIHHFTENLSAMMSIGVDFFIGIISGAITAALYFTF
FT                   KKMKSKFKLMNTK"
FT   CDS_pept        complement(253604..254014)
FT                   /transl_table=11
FT                   /locus_tag="lpp0229"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11376"
FT                   /protein_id="CAH11376.1"
FT                   /translation="MIGKDKWEILTEKMTNLHIYETDLSEKFILGSGKGGQKLHKTAST
FT                   VYLKHLPTGMEVKCQESRSREDNRYFARQRLCEKLQAVFSDEKTKTQQRIEKIKRQKRR
FT                   RSRRAKQKMLDEKSRQSQLKTLRKSPRSHDIE"
FT   CDS_pept        complement(254115..254840)
FT                   /transl_table=11
FT                   /locus_tag="lpp0230"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11377"
FT                   /protein_id="CAH11377.1"
FT                   /translation="MKNNRHFLKFYFIKDLSWLSSVRTSFIYSPFESIASSPFSSYIEL
FT                   RKKPVKFLLILLIALTLCDCGRSKETQFYLLTPISPQKNSRNSYNHLQIGVDEVSIPDY
FT                   MKKPQLMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWNNKFHP
FT                   DYHLQVMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNT
FT                   NLTHLTEEIARFFIKNTTR"
FT   CDS_pept        complement(254837..255523)
FT                   /transl_table=11
FT                   /locus_tag="lpp0231"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C-terminal part of paraquat-inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11378"
FT                   /protein_id="CAH11378.1"
FT                   /translation="MILGGTFFYIEYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIG
FT                   EVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVA
FT                   EIELIKPTPAVKYKQTYYRSYPVFPTHNSAEKYTSMEEAFEAAKKAFEDVSELVRSKEI
FT                   QDTLEAIQKVSENLGQLASSLNQDVPSVVAYLNQSLKQITSAAYSTQNLTDYLSRYPES
FT                   LLRGKR"
FT   CDS_pept        complement(255591..256346)
FT                   /transl_table=11
FT                   /locus_tag="lpp0232"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11379"
FT                   /protein_id="CAH11379.1"
FT                   /translation="MYVFRRFSKHIITFLHSLELAFRFLGHLVDSTIKVIFGKLSIVWP
FT                   NTLEMIYYSGARLVILLSFIGILLGATVSQTVYALLKPFQLHQRVLPIVQNILTHEILP
FT                   VLIGFILCIQAALHMVNTRLEHYQENPEAIILAQVLPIIVGMNIASLLLYVYLVSAIFF
FT                   SFYLTFHFMLGFTNNEFLSYVVSSTTLFDLIYSVVKTLILCIIVGLTSGYYYYEASIRH
FT                   IYLRKAVSRILTRGSFWLIIASMYITLTF"
FT   CDS_pept        complement(256612..257178)
FT                   /transl_table=11
FT                   /locus_tag="lpp0233"
FT                   /product="hypothetical protein"
FT                   /note="Protein with a F-box domain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11380"
FT                   /protein_id="CAH11380.1"
FT                   /translation="MKAKYDPTEPGLQKLPSEIKVMILEFLDAKSKLALSQTNYGWRDL
FT                   ILDWPEYTKEITNTLFRLDKKRHRQAIAQMMSGRVTASSMAKLFEELLCSSIPSSYVFL
FT                   IFFASQNSVAFIEVLTVILVFAAITSLAHDLVDYFIESDTKAEKQHAQRRAFQFFAQPS
FT                   QNAVQQNSEEENLSADPKARPCEPL"
FT   CDS_pept        257395..258093
FT                   /transl_table=11
FT                   /locus_tag="lpp0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11381"
FT                   /protein_id="CAH11381.1"
FT                   /translation="MTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRYGMQMTADMP
FT                   GLWSPLSNYDIENDLRMARIQRNGRVREIGYLTVNLVFQFDSLDVTEYETKYGISAKDV
FT                   LEKAGFTCSKDAAGYSESVSTSTRSLGQESKPEKPTQTSVVNTSFFSLKSVDTDKRFTK
FT                   STKPGILYEARSYGKIEDDTLKSYGFTEGQWERQKEGIENIVIIKKLTQSISPSPAILG
FT                   EAVDNIPTLS"
FT   CDS_pept        complement(258223..259083)
FT                   /transl_table=11
FT                   /locus_tag="lpp0235"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11382"
FT                   /protein_id="CAH11382.1"
FT                   /translation="MSLLLDDIRYFIAASDTLNMTRASEIIGISQPALSYSIKRLENKL
FT                   GGLLFIRLKNGIQLTKLGEEFKRRSHRLLYEWEQVQNIANPESGFVQGNYTIALHPSVA
FT                   LYTLQYFMPKLQVNYPGLGINFIHGHSREMTEKVISWEADFGIVVNPIQHPDLVIIKLS
FT                   TDEVTVFYANDAQNKLIYDRKLAQSQYILKKISKKITFNGVINSTSLEVVAKLTALGLG
FT                   YGILPTRVTYPYKHLKKILNAPVFRDEICLIYRPEKHNNPVSKKIIQIIRSSISNDNDK
FT                   ENYFD"
FT   regulatory      complement(259093..259098)
FT                   /locus_tag="lpp0235"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      259180..259185
FT                   /locus_tag="lpp0236"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        259194..260243
FT                   /transl_table=11
FT                   /locus_tag="lpp0236"
FT                   /product="hypothetical protein"
FT                   /note="Similar to pyoverdine biosynthesis protein PvcA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11383"
FT                   /protein_id="CAH11383.1"
FT                   /translation="MKNTAFLITENHYPKDYRLKKSPDSDSAMGVAKRILAEVMIFRRV
FT                   PETISLCSTGCQKCASPHLPKIISAVNENEPVTFILPAFPGKSPNPEKVLGHLPDHAER
FT                   LSLNFLGALCQRIKNFYTPGIKIILCSDGRVFSDVVGMNESDVTAYQLELDRLIKEMSL
FT                   ADLSTFNLDYFYKNLHFVQMREELMKSYGQSLDFLKQKIRNGAKPSASPDEQEANRMYS
FT                   GITRFLFEDAMHAGQAKSRTAIQKESRVKAYEVIRRSNAWSALIAEHFPKAVRLSIHPQ
FT                   TCGSKKLGIRLIGNESWMTPWHGVAVESNKGYVLLRRSEAEALGAKLICSSDGRRSHYQ
FT                   LMAEVSYEL"
FT   CDS_pept        260233..261069
FT                   /transl_table=11
FT                   /locus_tag="lpp0237"
FT                   /product="hypothetical protein"
FT                   /note="Similar to pyoverdine biosynthesis protein PvcB"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11384"
FT                   /protein_id="CAH11384.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVSGTYQRKMEFYNSKT
FT                   VSPIITKHPQKDFSVIRYNEPPSADKGHFVNPPDIEFTGIDQEELDFFHRSLNKALYSA
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
FT   CDS_pept        261066..262508
FT                   /transl_table=11
FT                   /locus_tag="lpp0238"
FT                   /product="hypothetical protein"
FT                   /note="similar to FAD monooxygenase, PheA/TfdB family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11385"
FT                   /protein_id="CAH11385.1"
FT                   /translation="MSAQVADVVIVGAGPVGLMCAYLGQRCGIHTVIVDKSDGPLEVGR
FT                   ADALNARTLQLLELIDLFDELYPLGKTCNTSSVWADGQFISRQSSWWEELEGCLHKHFL
FT                   MLGQSYVEKLLDEKLKETAATVKRSTAIVNIEINEAGCLTTLANGERIQSRYVIGADGA
FT                   RSFVRNHFAIPFEIIRPQIIWAVIDGMIDTDFPKVPEIIVFQAETSDVAWIPREGEIDR
FT                   FYVRMDTKDFTLQEAMDKINHAVRPHSLNFKDIVWFSQFSVKESVAERFFIQDRIFLAG
FT                   DACHIHSVNGGQGLNTGLADAFNLMWKLHMVMHFGASQELLHSYEAERKPVAHGVIETS
FT                   GELVRSTKYSLNGTHAQDYVRIVQKRAGYITGMGIRYGETGLCGSRLFDFEIFNGIAKT
FT                   RLYSLLDYMKFTLFIFGDCEVELQPPEFVKVIPIYPTQCQENFWTDNTHYANQAILVRP
FT                   DSYIQCAVPLDKMESLFELAQL"
FT   CDS_pept        262505..263653
FT                   /transl_table=11
FT                   /locus_tag="lpp0239"
FT                   /product="hypothetical protein"
FT                   /note="some similarity with transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11386"
FT                   /protein_id="CAH11386.1"
FT                   /translation="MKKSLIFLAIGMFTVGCNTFLIAGLLPQIGETLGQPVAVTGQGVS
FT                   LFSLTYLLSAPLFSLIFVNQPVKRMVQLALTVFMFGNLITLLSENIVLFLIGRSLAGAG
FT                   TGIFTPLCISIAVHFASPSAKGRILSFIWSANSAGVVFGVPAGLYLSSLFHWQLSIASL
FT                   IILSLLALIGFSMQNIDIKLPKPSPFGGRLRLLVEPKTLSVIGITCFTALASLGLYSYV
FT                   TLIQSGSPNSLSMTLLSWGLGGFIGSSLIGVFIDRTGKPRVIMALILVGLMFALIAIPF
FT                   TRNLPYLGLIPFFMWGACGWAIVTPQQHILYELHENQGIILAAINSSALGLGSALGTLL
FT                   GGLLISSGFRGIYLPFSAATLLFFVLIIQLIVINTSHKVNNI"
FT   CDS_pept        263650..264882
FT                   /transl_table=11
FT                   /locus_tag="lpp0240"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11387"
FT                   /protein_id="CAH11387.1"
FT                   /translation="MNRPVVIVDPLSSGIELAPAFKARGIPAIAVTLKPLDWIGFGANM
FT                   QTSDFIEIIPDQPNLVEILAKYDPIAIIPGTEEGVPLAEALAINLTPQFANDPEKSQNR
FT                   LHKALMQKALQEAGVPALKTLNTASENEVEAWIRTNGLIDSPLIIKPPVSAGSDKVFHI
FT                   PARGEWKKAFNQVLSEPSKITGKNNETVVVQEQAIGTEFAVGTVSANGKHYLAHLIQYN
FT                   KTSFNDRKTVYDYVEFVPYSEEIYGELFDYTKKALDALGIRWGAAHNEIMLTKDGPRLI
FT                   ETGARMCGGPVVGFAREATGSSQADKLVEIYVDGGVSTEEYVFKKTVVPVFLKSPAKGK
FT                   ISNVEAFADLSKLPTFLNEHIWFKNGDLVPQTVDYLTSIGIIGLAGDRDSILLDYEKIR
FT                   SMESKLVIQTF"
FT   CDS_pept        complement(265040..266182)
FT                   /transl_table=11
FT                   /locus_tag="lpp0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11388"
FT                   /protein_id="CAH11388.1"
FT                   /translation="MLSKYDKLIYINLAQDQVTANIDTLIIHENPTILVKIPDGSDLKT
FT                   LVDPDFFPGPITNRTKIYFSAHGHEELDDMVLDRQKENPKIYKLDDVAAYFGKLLTNPD
FT                   FKNPDITPRLTLVMSVCEGLGFAKNLQKKLFDDYGLLVDVIANKNVIHEQFVKPHHETT
FT                   AYLTHRETSIKGVGREHKRPHSKVLLTIDKEGTQQEIDVYELKWIEKVLNTIHQQVATF
FT                   GKWADFEKPENIKIQEGLNAFCHDIDALISLLINQDINLTANNLLALLLSCQKTTADPL
FT                   YKQAMNYEMFQIMTKNLINEGLRYINPKVEIQEYSHALEELQSQKDKMIRDEVAPNIFR
FT                   AKKAIFSALLAEASEYGIDSVLDELEKAKQELSQGKMNPS"
FT   CDS_pept        266605..267696
FT                   /transl_table=11
FT                   /locus_tag="lpp0242"
FT                   /product="hypothetical protein"
FT                   /note="some similarity with methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11389"
FT                   /protein_id="CAH11389.1"
FT                   /translation="MRYCSIDILIIEFYLKFGSLIQCQLLAVYTYIINFKNSKMNKFPQ
FT                   SFSEANERIGNAIHHVCLNASDAKFIKSNIQESYQSWANVLYDRVFLNWGLCDKKIYRE
FT                   LSALNFDFSKVGFFPHVYGQSLLFYLIRPLIKIHFFNKRLLDVGCGNGVGLKISSELLK
FT                   TRYALGLDLVNKLVTNSNNSFYIEDKINYMQADAENMAIANESFDIVTNLESSHLYPQI
FT                   EHFFSEVERVLAPNGFFCYADVNFDVKRQAERFETFVKTRKNLRIIEKHNITKMIQASI
FT                   YQRLIVNEKGFYQLAQYLLGPDKIHYTSELANVASSMGLMFLPWWRIRFKSPALQALGK
FT                   FARRCKHWNKKYYFYYLIQKIDS"
FT   CDS_pept        267801..268619
FT                   /transl_table=11
FT                   /locus_tag="lpp0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11390"
FT                   /protein_id="CAH11390.1"
FT                   /translation="MFIKSPCIDLTRHSKIWINPDGEIPKKIVERLKWQKETRPRDAIT
FT                   LFVNKACEDKSNSAVESLRACGVKIKIIELCLEKNEKQDDPFIIACFNKALALAKKEKN
FT                   LVDRVRASVRATNVLRLMKLVQHEGLYSDNDVLFLKFEATRLLSPYLFGQYEGEVNDVH
FT                   LFGVAINDPLTTDYFYTRLVEKMKKPWEEEITPDEFEPPCGLYLIPDEIISKIQFGHLK
FT                   FAEIRDCIITGSDQSHHDITRAKKLLNLEEDSLLDEAKSIVASQEKQYRM"
FT   CDS_pept        complement(268794..269636)
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="lpp0244"
FT                   /product="hypothetical protein"
FT                   /note="Similar to protease heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11391"
FT                   /db_xref="GOA:Q5X8K6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8K6"
FT                   /protein_id="CAH11391.1"
FT                   /translation="MINNLKTFILLASLTALLVVIGGLLGGSTGMLVALLFAGIMNFSA
FT                   YWYSDTLVLKMYNAEPLSNNHFVYHIVSELAHRAGTSVPKVYLINNSTPNAFATGRNPE
FT                   NASIAVTTGLLDRLTQEEITGVLAHELAHVIHRDTLINVVSATIAGTISGIANMFMWLS
FT                   MFGHSSNNEEGVHPVVGMIMMIVAPLAAGLIQMAISRSREFEADAGGARISGNPQWLAS
FT                   ALLKLDQANHEQYFDEAETHPATAHLFIINPLNGEKLANLFSTHPSTAERVARLRAMY"
FT   CDS_pept        269845..270756
FT                   /transl_table=11
FT                   /locus_tag="lpp0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11392"
FT                   /protein_id="CAH11392.1"
FT                   /translation="MYSKYPVFFPNKNIESFSGVRFSNVVGIPSAIESLYRGDNNLAGI
FT                   IFLLPTLITGVFCQSFPEVVDMEQVRLHKLTNLSNDFHMVSMSEDPQIALDWGKGCFIT
FT                   IDPVLFSDYIVDVHATFRKNQLNFPDRMEQEREHIALAVPFCSIKKITIDNKELANPFY
FT                   LSIPQDNHEARMEFNTLYSELISLLRKKYTQEVDGEEEKVALRAYAIRYLDFYSKFGSC
FT                   NNPFNKSLAQLVELYPEFMSNFLQSSHLSSKTGLMKDIVLNSSDNLFKEHPYTQSIDAS
FT                   YIHRVKESTTCYEDDWAKPVYD"
FT   CDS_pept        complement(270803..271255)
FT                   /transl_table=11
FT                   /locus_tag="lpp0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11393"
FT                   /protein_id="CAH11393.1"
FT                   /translation="MFNGHFFVKKSSFFDSSFFTTSDTKEEFPLFPEEGMDCLFEKLGS
FT                   RITSKKTGNTYFITPADPSIVIQKGNDGVHEYYHLILNKKVIAVSSFVNHKTTIYLANI
FT                   IKQLEPERIGTPVDFDFLGDTDETDSVFSDTLDNTEGNIDQMPSPR"
FT   CDS_pept        271666..273144
FT                   /transl_table=11
FT                   /locus_tag="lpp0247"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11394"
FT                   /protein_id="CAH11394.1"
FT                   /translation="MNIAIIGGGTGLTTAWALENQRKFHVTVFEENDRLGGHIHSIKIN
FT                   NVILEGGAEFIGPPALYPNVHRLFQSLGMALDQFELNMDFDNLKQRDHIVLPPLYHTSS
FT                   GKSEDVSSILYTLSCGLFGKRRKQNETRVSVDTMFTEMYNLLEMNHLIMDARNKLLHPD
FT                   NLMTLEQFINEFKEKCVHVLSPVDKFAEEFVYPLIASGWGVSIETIKKFGAHYAMNYLA
FT                   AGMNWFDAPEGLSSYIDKMVAQCTNTQFKVNTAIKKLIPITIDGKIKYQLLKRDDTFVC
FT                   DSTGSPMIYDDVVISTPAYVTNELLSDIESNTIKVLREKLANVTYYDTTVVFHQDPEYL
FT                   SPYRTVVHSRFDGTQSANTMCKPWKFNKDEIPIMKTWVLPGQEMPKNVLREVHYKHPVM
FT                   DKNYYEAQQALHAAQGEAGLWHGGILAGFNDSHESGVTAALQIAAHLNQREHCLDKNER
FT                   LALFPHILDSVLSPKLSTDMGVEVAGVVAYPSMP"
FT   CDS_pept        273404..274813
FT                   /transl_table=11
FT                   /locus_tag="lpp0248"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Zn metalloprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11395"
FT                   /protein_id="CAH11395.1"
FT                   /translation="MIRKKITQISFFMILALIVGAVEAKTTRPADEQQLARSIYKQFIE
FT                   VQSGFTTGSTTPLVEVAVKYLKKAGFSNEDIFVGGASPQKANLVVRYRGTGEKKPLLLL
FT                   AHTDVVEAKASDWSMNPFQLTEKDGYFYGRGTLDDKAQAAIWIANLIQYKQEGFKPKRD
FT                   IIVALTADEEGSSPYNGISWLIKNHKDLIEADFALNEGGWGDLANGKKISQNIQVSEKY
FT                   IVNYNLEVRNKGGHSSLPTKDNAIYRLAGALERLSKFNFPLKTNDVTAAYFKQMAAIET
FT                   GPLKTEMVEASKGSKQAMQRLADSSPQWNAILRTTCTPTLLEGGHAMNALPQLAAVTIN
FT                   CRVLPEDSPEMVEQSLKTAINDPEITLKRIGKLSRGPSSPLSPEILKTITHLTQTYWPE
FT                   VPAIPIMVTGATDGRYLRSVGIPTYGVMGLFLDRDDFRAHGRDERISVESFYEAQAFLY
FT                   DLVKQLSSNVT"
FT   CDS_pept        274940..275992
FT                   /transl_table=11
FT                   /locus_tag="lpp0249"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted acyl-CoA transferases"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11396"
FT                   /protein_id="CAH11396.1"
FT                   /translation="MLKGLKVIDLSTVLAGPSVGTFFAELGASVVKIEHPVHKDVTRTW
FT                   KLPGEDPHSEISAYFASVNFGKDYLFLDLMKEEDYLFFLNLIAEADILIMNFKKGDDIK
FT                   LRIQADHLLSINPRLIIGKINGYGEESERVAYDLVLQGESGFMSINGTPDSGPVKMPVA
FT                   LIDVLAAHHLKEAILLALYNREKSGKGKVVSVSLYDAAVSSLVNQASNYLMTGQVPQRI
FT                   GSLHPNIAPYGELFRTADAALIILAIGSDRHFAKLCTVLGLNDLPDNDEFKHNQNRVRN
FT                   REKLALLIAGQTAKWQSNKLLEMLHRENVPAGKIMDLKDVFDNERAKSLIRKELIGDVP
FT                   TARVTSVVFK"
FT   CDS_pept        complement(276189..277055)
FT                   /transl_table=11
FT                   /locus_tag="lpp0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11397"
FT                   /protein_id="CAH11397.1"
FT                   /translation="MKPGYLLGALLLSPLLAFANSDNNADGLIFSPLPQNKNTVVRHYS
FT                   NEQDMSNLNQMTQRTIDFPTQIVRVSGNLTGLELSCDDVENEIDQIFSKKISPNLFTYN
FT                   TYVSCGFDEHDPEQYATNFSIQSYFDPLTDNAVDYLKNYLKEYNGYNLFNTTTLQIENA
FT                   KGIIVSMNLNAGLKNNPDKTPFMLYRQDRNNFYFKSNFDMRKELITDIYQRFYSNDPDM
FT                   ILPFFDKWIFSYAGSVYYSILKASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKR
FT                   NSNKHCL"
FT   CDS_pept        277434..278387
FT                   /transl_table=11
FT                   /locus_tag="lpp0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11398"
FT                   /protein_id="CAH11398.1"
FT                   /translation="MISQKEALVLLNKYEKHLNELQNIITTSYQNLLRCDAQIIPNALA
FT                   ALKAIANNTQFVPVVATSGMSSIKALSSNPQIALKELLVNDFFKDHFQKMCIHYAKDKP
FT                   ELLTNLQNFHACVSQEKIIIYKAKNGELALKFPTQEWRDRFIQKMGGVSHFASSDKFNA
FT                   NKECPQTYPENLTTLYLSTYTAKNGELAVVFPNKEIRQNFLTLLRHASSATWSIYEGQD
FT                   AVYFNDKNLHTPGYNFGINAPACVSQSSNAAHADVRYAARVLGQALRNPNNTCFFNRLP
FT                   EELINKIITLSTDNEVLAAEDAISSVQPNLGKPQLK"
FT   CDS_pept        complement(278622..280871)
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="lpp0252"
FT                   /product="catalase-peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11399"
FT                   /db_xref="GOA:Q5X8J8"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8J8"
FT                   /protein_id="CAH11399.1"
FT                   /translation="MFKRTIPLFAAFTLAISPSVFPNYAYAQEDKPKTNQYWWPKMLDL
FT                   SPLRQPNATSNPMGEQFNYAEEFNSLDLNAVIEDLKKLMTTSQDWWPADYGNYGPLFIR
FT                   MSWHAAGTYRIYDGRGGANGGFQRFAPQNSWPDNANLDKARRLLWPIKQKYGRKISWAD
FT                   LLVLAGNVAMESMGFKTIGFAGGREDAWEAININWGPEGKWLESKRQDKDGKLEKPLAA
FT                   TVMGLIYVNPEGPNGVPDPLAAAEKIRETFGRMAMNDEETVALIAGGHAFGKTHGAASG
FT                   KYLGPAPEAAGIEEQGFGWKNSYGSGKGKDTITSGLEGAWTVTPTHWSHNYLQNLFNFN
FT                   WVKTKSPGGAIQWVPENSNASSMVPDAFDPSKRHAPVMLTTDLALKFDPVYSKIAKRFL
FT                   DNPKEFDDAFARAWFKLIHRDMGPRSRYLGSLVPKEIMIWQDPVPPVDYKLVDANDIAN
FT                   LKGKILNSGLSTSELVKTAWASASTFRGTDMRGGANGARIRLSPQKDWPANDPQELAKV
FT                   LKTLESIQNNFNNAQADGKKISLADLIVLGGNAAIEQAAKQAGYDIIVPFMPGRTDATQ
FT                   GMTDVKSFEVLEPKADGFRNYFDKSNNMSPPEMLVEKASLLKLSVPQMTVLVGGMRVLN
FT                   ANTGQNQYGVFTDKPGTLNNDFFVNLLSMSTEWKKSSETEGIYEGYDRKTGKLKWKATS
FT                   VDLIFGANSELRAVAEAYATDDAKEKFIQDFVNAWVKVMTADRFDIKAANTNINS"
FT   regulatory      complement(280879..280884)
FT                   /gene="katG"
FT                   /locus_tag="lpp0252"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(280991..281995)
FT                   /transl_table=11
FT                   /locus_tag="lpp0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11400"
FT                   /protein_id="CAH11400.1"
FT                   /translation="MEHCMPKTKYALPPVVLYESHADRATSDFLIKQLPDLKKTGYTTI
FT                   CVDGMEPGASLEENISMMKILIKIQIKKLSELPLEHPEYEQGIEKLRSVVAKLELFEAM
FT                   KEQGFKLGGIDLPVSEQLKEKSLNSIRREQTLTDNTLGHVKENDGGVVVVLGFGHCIFQ
FT                   QMIKEQDENADQYLWYHVHNPDNETQAYKELVKSYTKKGLSTYFPLGVNIFKSSDKELD
FT                   TDFWNKVSANCYNYDPKALETSTASILKSLLGPEVSAHLRTDGHHHVDALISLETVEKT
FT                   HQVKSSDFLRSLSKTLGDIHFEVAKIKTKDQVIIRGINEPEVAEQISKLSKKM"
FT   CDS_pept        complement(282282..283535)
FT                   /transl_table=11
FT                   /locus_tag="lpp0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11401"
FT                   /protein_id="CAH11401.1"
FT                   /translation="MSLEIYTWKNGSKGLGFTKPVKSMLFGGNVGHAAVELTFPADAKG
FT                   DELAKKYQDVPGLSISKRTEIVPEKQEDGSYKPKEQVVYFVYFSWWPGHTNGHHINSHR
FT                   EDLESEWRHEPAPKIKPEIQKHLYGENTPAANKTNVTGILISEKTISKVKEFSHQNIKE
FT                   TITIENDPAYQQLKAKEAALQTELQQLIYKGKIYEQELAKSALEQRQPNKDLGLTDAEI
FT                   VRLAEINKELKRVVEQIKLCQMDFEERYLSVGEPPSSVIRIPTTHDYNAPTFALDTAGI
FT                   LEKMASLAQSTTAYSFYKFNCSTSATQVVKAGISDELKNIMKTDGFNVDKASQTTIATP
FT                   TSFSHFSQQVQTELILLNTNQALVEQQRAKTANTSGPLTTTTQSFKQKFQEAVKGKSEE
FT                   IVREQDESEENRMDLTMS"
FT   CDS_pept        283927..284244
FT                   /transl_table=11
FT                   /locus_tag="lpp0255"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11402"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8J5"
FT                   /protein_id="CAH11402.1"
FT                   /translation="MTMMITTGNSFDGKVIKQCLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSQMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
FT   CDS_pept        284496..287144
FT                   /transl_table=11
FT                   /locus_tag="lpp0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11403"
FT                   /protein_id="CAH11403.1"
FT                   /translation="MPIDINKYYSLIVKMPCPSEGGPTLNLAFGKDTAKRWGVVFLQRI
FT                   KTPNGLGTVIGEYKDRLWIWLDDNRGVSRWEVKDNLFSMKGFEPVKKPSMKSYPDEVEK
FT                   YIENLFQCSINELVTFTQNPFLLIFGEESKQAIEAIEKNWGLWLEYTTTNLNTWSNYFT
FT                   KYLQEHSQNPLEKMQQYGELTSRVTGIPKITIKEFNLSYVKEIKEVEEQIFELQQQKSS
FT                   LLEQTTAKEDQEQIKGMFKNLEQVLHDKLEQLNKLEEQNRRQKMLTSQLNKVLTNQQFA
FT                   EFNQHAKRIELTVNSLLAIKPQLQDKHFMKTYQAMLTLMAQYLYEQDLIEKQSEATDKT
FT                   GKEEAEANLSPDLFTGLVFAMVAGDSTIKKAYYLRLINRLDNNNNAAKEMPVTFDLEIW
FT                   AVSNPQQMINLCRFLFNNSKFKQFEEGLSYKEYPLFIFEIVKLKMSFILALNEVQKNNS
FT                   KFSIPQEIKFHAQKTIDLLVDLILDGNEEIAIWAEKQIKGNKNPFIKNYRVYAALAEFY
FT                   ATPPHVNEEKGLFFYNEGKTSTKDPEENKQAKLVSILYEAIHGSTGEIRRAAVELLNQK
FT                   REYHYLKLVGHKNPDAALLCLDYCLANNQLDEAKQYITLARKADRAKAAYFEALLVDKQ
FT                   KGDFMPFFLEAIEFGFAHAGYALRKMLSVLLEKKQIEEINERYLNLLNKPFVLNILTVP
FT                   VIKDTIMAVYNSTGDTQQQEEFREKWMFNLLVVVKNTEIVQKTDLVVTIITECRELLSD
FT                   EGLLVALSILSKQRYFDEPGDPFLLDAIAQIITEQDKKGPKHFFNLGIYDFLKNNTKLV
FT                   VLLMNNSSSKERLAQCERFTSFIKKEQIRIEESDKVKNQPSLANLGLFGDNNNLPEEKG
FT                   PSPSPMGTKKG"
FT   CDS_pept        287559..288695
FT                   /transl_table=11
FT                   /locus_tag="lpp0257"
FT                   /product="hypothetical protein"
FT                   /note="Similar to chitin-binding protein CbpD"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11404"
FT                   /protein_id="CAH11404.1"
FT                   /translation="MKKILGSIGLAVVSISLFAHGSMEVPISRTYQCYKEGPESPKSAA
FT                   CKAAVQVGGTQPLYNWHEVNQAAANDRHRELIADGQLCAGGRDFFKGFNLARTDWTTTV
FT                   VHPDSNGRFQFVYVATAPHKTKYFKFYVTKDGYDFNTPLKWSDLETSPFCTITSVTLAN
FT                   GRYQMDCPLPANRTGKRIFYVIWQREDSPEAFYSCSDVFIDSTAQAPTWFELQNFYGSG
FT                   DIAANTKITLRVFKHEVEVESTSITVTESNRTAEQWPLALGAAVNNRSSLVRIGQLDPQ
FT                   SGQVVLAANQANKIYLSDSDTSSYHVLVDFAEPSGNSDLIYPDGISTYKAGTIVLGRLD
FT                   RKYYQCKPWPYSGWCSQAPAYYEPGVGLAWREAWILLG"
FT   regulatory      288707..288725
FT                   /locus_tag="lpp0257"
FT                   /regulatory_class="terminator"
FT   CDS_pept        289073..290107
FT                   /transl_table=11
FT                   /locus_tag="lpp0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11405"
FT                   /protein_id="CAH11405.1"
FT                   /translation="MTIMRVFLSFLLLFFNSLSFAQSELPQLFLFLGGDRASTFQETLQ
FT                   NPCIRGVQIIYSWRQLEPQKGVYDFSKIEEDLNDLSRIDKKLFIQIQDRSFSPDVFPVP
FT                   DYIRMEKAYHGGVVQQYDFPGEGKPITAGWVARTWDPAVRKRFQLLLKKLASKFDGKIY
FT                   GINLPETAIDLDPNHLPEDFTSDKYFYSVLDNMGYLKKVFQKTKVIQYVNFFPDEWNND
FT                   HHYMSRLFSFARSHHIGLGGPDVVPYKESQMKNSYPFFHKFKGEIEAAIAIQEPDYTYT
FT                   NPKTGDFYRFDDFYSFSKEYLGAFILFWNTEEPFFSEQLLPKLNDSYFQCDKVNDKANT
FT                   ADAN"
FT   CDS_pept        290220..291590
FT                   /transl_table=11
FT                   /gene="qxtA"
FT                   /locus_tag="lpp0259"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytochrome d ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11406"
FT                   /protein_id="CAH11406.1"
FT                   /translation="MLVELLSRIQFGFSIGFHILFPTLNLGLAVFLVIMEALWLKTKNP
FT                   VYLEICKFWTKIFALTFGMGVVSGIVLAYQIGTNFGPFITQFGNVLGALFAYETLTAFF
FT                   LEAGFLGVMLFGWKRVPPALHFIATLLVTIGTTVSAFWIMSANSWMQAPSGYQLIEGKY
FT                   VVDSWWAVVFNPTFIPRFIHMLLASYVTTCFVIMAVSGFYFLRKQSTAIAKKSLSFSLW
FT                   ASLILVPLQIGVGDVVGINVHHYQPLKTAAMEGIWETQKGAPLLLFAIPSQTQQKNFYE
FT                   VGIPKLASLINTHEWNGEMIGLSSVGNEEQPRMAPVFFSFRIMVGIGLIMLFTAIAGFI
FT                   LRLRGTLFENSWFHRWCIVMAPLGFIASIAGWLTAELGRQPWVVHGLLKTRDSVSAIGV
FT                   EEVIISFVLLIVAYGVVFGFYLYYLLRLISHGPGILEEDEVEHHAFQYMTDFPKEKK"
FT   CDS_pept        291590..292579
FT                   /transl_table=11
FT                   /gene="qxtB"
FT                   /locus_tag="lpp0260"
FT                   /product="hypothetical protein"
FT                   /note="similar to cytochrome d ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11407"
FT                   /protein_id="CAH11407.1"
FT                   /translation="MLPFIFATLLGFIVLMYVILDGFDLGIGILFPFTSSESERDKMMN
FT                   SIAPVWDGNETWLVFGGAMLYGAFPQVYGLLLPILYMPIMLMLIALIFRGVSFEFRFKA
FT                   KRSKTLWNWSFSISSVAATFLQGVILGAFVQGFSINESSMTINDPDWLTPFSLCTGIAL
FT                   VCGYALLGATWMIIKSTGRLQRKMVHYARGLLVLVSFFLLFVSIWTPLHSEEVFHRWYS
FT                   FPNMLLLSPLPLIALIAIYLVWQNLSSGSEYKPFIYSIIIFLCSYIGIAISVYPYLIPH
FT                   QVTFWEAAAPDSTLVFILIGVAIMLPILLAYTLYAYYLFRGKSSENYH"
FT   CDS_pept        complement(292580..293365)
FT                   /transl_table=11
FT                   /locus_tag="lpp0261"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11408"
FT                   /protein_id="CAH11408.1"
FT                   /translation="MNKMIILLVIAIIFLHMCLIWLWYRYTNNPSVVDVGWASGLTLAG
FT                   LIYLNNQEFSLRSLLLVLALLTWGIRLGGYLWWTRIRLKKIDKRYLALSNDWKLAKPLG
FT                   FFLNFQLQGVLICLVSIPWYFSSSETQTTLNLLDGLALIIFLTALILETVADNQLQDFK
FT                   KNYPGKVCNQKLWRYCRHPNYFYEWLVWCSFTLFALSSPYGWIAIISPLTLYLIMTKIT
FT                   APMTEQGSIESRGNLYIEYQKVTPMFFPKWLKNNSTPRK"
FT   CDS_pept        complement(293362..293898)
FT                   /transl_table=11
FT                   /locus_tag="lpp0262"
FT                   /product="hypothetical protein"
FT                   /note="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11409"
FT                   /protein_id="CAH11409.1"
FT                   /translation="MIINPVHIVHYLSYYLCWIFCIYLASYGYPLLGLIFTVLIMGLQI
FT                   IVQILNQLPWRDALYFSIGLALLGAITDAIWLYSGMIYFKANFFGSHFPPLWMVALWLS
FT                   FGFNLVVLYGSWLTYYFLWGLVMFPSIIFAYWLGVQFGAATLIGSEVVFYLTLGLTWSL
FT                   FLPLSLYLFNYLHRK"
FT   CDS_pept        complement(293888..295675)
FT                   /transl_table=11
FT                   /locus_tag="lpp0263"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11410"
FT                   /protein_id="CAH11410.1"
FT                   /translation="MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDN
FT                   LSSTGMAIIEFSSAKTKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIATVVTNPVQGTMITLIQKWATVCEIKQPDSLLAQAMLELLPLLS
FT                   VEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TRLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNLIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYEAFLTATKKYTNITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPLVSIDSAGQGIMVGKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNQALHLAEMTTQAFNKPPTYIEPVSLAIGL
FT                   HAGQGCIAIAGRLRERNDY"
FT   CDS_pept        295758..296456
FT                   /transl_table=11
FT                   /locus_tag="lpp0264"
FT                   /product="hypothetical protein"
FT                   /note="similar to oxydoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11411"
FT                   /protein_id="CAH11411.1"
FT                   /translation="MARYLVIAASSAIGQSVTTLLKNRGDTVFTTARNNHKISPDFQLE
FT                   ATHFDAVLDVFHQTGPLDGVVNCAGSLLLKNAHNTSFDEFQAAINASLTTSFATIRAAG
FT                   LTMNQGGSVVLISSAAALVGLANHEAIAAAKAGIIGLAQSAAATYASNNLRVNVVAPGM
FT                   VNSPLTSSLLSNQLVLNASKAMHALGRIGVPEDIAHAIVFLLNPDNSWITGQVIAVDGG
FT                   LSRVRPKMKI"
FT   CDS_pept        296473..297642
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0265a"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein (N-terminal part)"
FT                   /db_xref="PSEUDO:CAH11412.1"
FT   CDS_pept        297623..298012
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0265b"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein (C-terminal part)"
FT                   /db_xref="PSEUDO:CAH11413.1"
FT   CDS_pept        complement(298017..298430)
FT                   /transl_table=11
FT                   /locus_tag="lpp0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11414"
FT                   /protein_id="CAH11414.1"
FT                   /translation="MNGWTLKVFAIAFFIFIVTDMIWLGFIARNLYFDQYQQWLRLSEG
FT                   QLKPIWWSALLVYLLFALSIIVFVIPLAKTSLPYAALYGALLGAIIYGIYDFTCLAIFK
FT                   DFPVGMAFLDWLWGIVLCSWSSIATIYVASYIK"
FT   regulatory      298782..298787
FT                   /locus_tag="lpp0267"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        298794..301679
FT                   /transl_table=11
FT                   /locus_tag="lpp0267"
FT                   /product="hypothetical protein"
FT                   /note="similar to serine/threonine-protein kinase
FT                   (conserved domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11415"
FT                   /protein_id="CAH11415.1"
FT                   /translation="MKLLRFHELKSLPGMDEKALELLIKVLGNKGIRKLIKSANGKPIS
FT                   REIMIHEFGIDCQILFITTGASLKPIIVPTENKISGGGKSYCEQFKVYALDDGKTYFLK
FT                   SVKIDAESVTEFTNEKDTLSKLGRLVGTFFNEQTQVHYILTTFIKGIDLSRYKNALPLS
FT                   VNLKHFWEVLGIMISVCHQVKQFHELGLIHRDLKPGNIMLDADMQCHLVDFGSSSSDKE
FT                   PKPVSWGTASYLAPELNAQEDFIAFSQASDLFALAYSLDELFNPFRQVKFAKVDIGIKN
FT                   KHLVLLHAEIEACITGLMSNETSARTLYFSRILQLQRVPESFKSRPEAFTYMIMLLTQW
FT                   KSCYEIPELKKELDEIIAEIKVAYENHEQDVLKITSMLEQLSKADGLLNSHKSLLSVLI
FT                   KSLANVQQQELGQDDILPRRFESDVVSRLIKTPTAKMMAAIKQVSDAIVKILEQYEHSP
FT                   TESFEYAVLQDFLEQMVQSDILFGAPKEKIEISDIIKILKANRPEDFVQIQHISFKFAQ
FT                   VALRDLALHDLPKHEPEGAFLEILQKYQAKYAPEETSLFELYHHMAGVRDHNPSKVKKG
FT                   EGYRFRAFICDELFYGDEIFSTGDNRGREGKPNQRLQTNQVGLMKFEHSVHTKGLLTLS
FT                   GQSWYADCKTQLPNYDSIHYLSALKTDCPYITGPSGMTSLFMNMMFLLLNPKDQDVILS
FT                   YSLGVMTYVVGAGYHSIKEILIPMVKCVGIVPDYPQHKGTEYLTASPLYNHYFKAIEEF
FT                   DKEFAEVHEKIWQEYLTYFRMTYMPVCMRDHCLPHQVPSMEDISSEVKEMLEIVSKSVK
FT                   NCLEEHQVKRTGDMGLFLSTPCGQTKALEVLSHVCQQQVGLTAIFRQIQAYFKGTFETE
FT                   EGIIINKEMQLKFIAHFFDVLKESPTLLSQFNLTLRIENTIGVHQCEIGSFRRKELFLE
FT                   LKKTFIAANEEQMVANHEPRKETRNVIILPY"
FT   CDS_pept        301698..303668
FT                   /transl_table=11
FT                   /locus_tag="lpp0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11416"
FT                   /protein_id="CAH11416.1"
FT                   /translation="MLSKEKINPSLKNTKRQGSDNLAAMADPTSLKNTGDYRCFNSKPE
FT                   AYIYFIFLLNQWQTNYMDDKREAIAKAIDSIKMAYENHEQDTLVIHKTLHGLSHLLEQE
FT                   HADELNALCLVPIKDNQSNANNVLPRRFESELACRLIESPTKSMMQAIDLVSQAIINLI
FT                   EEYSKLDSKSSERAALNFFLQELEGSDIEFGAFKKRPSLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARSVIGPFPLRNLPPFKPTGLFAQVLDKYLQDHPDLKEEEEGFSYQLMAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKIHLKTKQLGLMKLDHSAHSRGLAVIPEQ
FT                   TWCADAQAQEANQNSIYHKTALRNDCPYVTGPSGMTSIYMNMMMLLLNPQNIELIQAYS
FT                   LGIIAYIVGAGFHSVNEILIPLVKCINLLPDYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDKVWAYYLNYFKSCYMPLCMRDFCGAEQLANCPDPAPEVKILCDIVLKSIEDC
FT                   INFHNLNRHLDSRFLGTTTADIDVLNQLKEACASQSSISGIMRLLQKYFSGENIARPTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLIISTKTEIFSDDFRIECFNLHR
FT                   ILKREHQVSENCNSTSQFLKL"
FT   CDS_pept        303748..304335
FT                   /transl_table=11
FT                   /locus_tag="lpp0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11417"
FT                   /protein_id="CAH11417.1"
FT                   /translation="MKNAAIIKNRIFLNLDKPVKRFLASDKADTPMTAEFYAEKDYEQL
FT                   FLDFLSQATGSYDEQISMLIAELDSGADRVAQKLMSALYSPWQKNLFPKAIKTIANKSE
FT                   EYPLMSDLLIKFCQQHVGSVDAVDDFGETALAKILKKDQQRKSPLLFLVKHGAKHCQLT
FT                   SALQDSLIVNNSDIYNVAEDNTMDWISNCPQP"
FT   CDS_pept        complement(304477..304923)
FT                   /transl_table=11
FT                   /locus_tag="lpp0270"
FT                   /product="hypothetical protein"
FT                   /note="Similar to sensory protein (eukaryotic)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11418"
FT                   /protein_id="CAH11418.1"
FT                   /translation="MPGSLPLKQLVFFLGMLTQANIPSWYEELNKSGLTPPGPVFSIVW
FT                   SILYALLAIVAWVLWCSRNESEMRSVFYLYSVQMLMNWAWTPLFFVLHWTGLGFLWILV
FT                   MAGLTGLLILSLKNKKESIAILLLPYLVWLLFAAYLNGMIWLLN"
FT   regulatory      complement(304931..304936)
FT                   /locus_tag="lpp0270"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(304984..306399)
FT                   /transl_table=11
FT                   /locus_tag="lpp0271"
FT                   /product="hypothetical protein"
FT                   /note="similar to deoxyribodipyrimidine photolyase phrB"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11419"
FT                   /protein_id="CAH11419.1"
FT                   /translation="MTIALVWFRQDLRLTDNPAFIEACSHHEIVIPLYIYDDKCSVLGQ
FT                   AQAWWLHHSLIALGKSLNQQGLSLVLRKGDPQEIILELVAQYGVESVYWNRCYEPQVIA
FT                   RDKKIKLALGEREIKVQSFNGNLLHEPWTIKNKNGDFFKVFTPYWKQCRQILNIPSPFM
FT                   LTKRPRGIEITSDDLGKWKLLPAINWAARFSEYWTPGEEGAQKKLDEFIVHHLSGYKRE
FT                   RDFPAKNATSRLSPHLHFGEISPWVILRALELAKLEQTCDLASVEHFLSELGWREFSVY
FT                   LLYHFPKLDCENFRKEFDAFPWQNDEQLLTCWQKGMTGYPIIDAGMRELWATGYMHNRV
FT                   RMIVASFLTKDLLIDWRSGAQWFLDTLVDADLANNSASWQWVAGCGADAAPYFRIFNPV
FT                   LQSQKFDPDGIYIRQWIPELAQLNSQSIHQPWTDADANSIFLGKKYPKPIIDHQEARTK
FT                   ALSYYQQIKKGMD"
FT   CDS_pept        complement(306494..307201)
FT                   /transl_table=11
FT                   /locus_tag="lpp0272"
FT                   /product="hypothetical protein"
FT                   /note="similar to membrane protein LrgB"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11420"
FT                   /protein_id="CAH11420.1"
FT                   /translation="MPSSILSESMIQAFFWSLITIGMYFITQKLYRRWPFWWLMPLALT
FT                   PILVASLVLLLHVNYQDYFRGTKWLVLLIGPATVAFAIPIYEKRALIRQHWPVLLIGVI
FT                   VGSFTAIVSSWGLAILLGLDDNLRLSLLPRSISTPFAIEISKGIGAAPDLTAIFVIVTG
FT                   ILGAILGEFILSRLPFNSALARGALLGVGAHAAGTAQAHKIGNTEGAIASLAMILVGLF
FT                   NILLLPLISHLLK"
FT   CDS_pept        complement(307179..307568)
FT                   /transl_table=11
FT                   /locus_tag="lpp0273"
FT                   /product="hypothetical protein"
FT                   /note="Predicted membrane protein, similar to conserved
FT                   hypothetical protein LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11421"
FT                   /protein_id="CAH11421.1"
FT                   /translation="MANKIQQNSFFQIVLVGLFWLASELLLKLVKLPLSGGILGLGIVL
FT                   LLLATNCLKLNRIRRGAELLLANMLLFFIPGVLAILEHQEFIGLLGLKILFIILLSTIT
FT                   VMLVTALVVDYCYRWRTHYAKQHSL"
FT   CDS_pept        307674..308558
FT                   /transl_table=11
FT                   /locus_tag="lpp0274"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcriptional regulator, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11422"
FT                   /protein_id="CAH11422.1"
FT                   /translation="MEFKLLRSFIEVVRQGSFSKAAENLFATQSTVSKAIKQLEEELGI
FT                   TLIERFKKRNVPTTAGEIVYQRGTKLLADRDDLLKELDEIRGLKQGRLRLGISPVGSST
FT                   LFAPLFVLYRQHYPGIEVELVEHGSDKLAECLRAGEIDFAGTLLPISEEFDCQLVRSEP
FT                   LVALLASGHPLATKHCISLPELKEIPFILFGSGFALHRIILDACRHAGFEPKVVAQSSQ
FT                   IDFMLELVAAGLGVTFLPRMIATQRHKTQIRSLLLNGSEFQWNMAMTWRRNSYLSEAAK
FT                   AWLALVREVHVDN"
FT   CDS_pept        308681..308893
FT                   /transl_table=11
FT                   /locus_tag="lpp0275"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11423"
FT                   /db_xref="GOA:Q5X8H6"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8H6"
FT                   /protein_id="CAH11423.1"
FT                   /translation="MNNQQKIKCPICGKQNTWSPDNQFRPFCSERCKLIDLGEWASESR
FT                   KIPGSSIDPESIVTSNNKQDNEDEQ"
FT   CDS_pept        complement(308979..310058)
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="lpp0276"
FT                   /product="Phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11424"
FT                   /protein_id="CAH11424.1"
FT                   /translation="MKLGILGGGQLARMLALAAYPLGINTVCLDPSPDACAGQLTRLIV
FT                   SDFNDELALKQFLSEVDCVTIETENIPFSCAELAAQIKPFYPSTQALKITQDRLHEKNF
FT                   FRTLNIPVPEFLPVESEDELIQAISVIGIPAVLKTRRFGYDGKGQYVLRTQADISKSWG
FT                   LLGGQPLILEKLISFESEFSLIAVRNKSGETSFYPLIKNHHRKGILHFSEAPVHHDALQ
FT                   QEAQTHAFKILEALNYVGVLTIEFFYQGNQLIANEIAPRVHNSGHWTIEGAHTSQFENH
FT                   LRALFDLPLGSTEVSGSCFLLNCIGNLLPLEPCLSIPGVHYHAYGKAPRPDRKVGHVTL
FT                   IDTHLERYAKNKNLLLDIS"
FT   CDS_pept        complement(310055..310555)
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="lpp0277"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11425"
FT                   /protein_id="CAH11425.1"
FT                   /translation="MKPILIGLIMGSQSDWQTLIHAAQTLDALNIGYEAEIVSAHRTPD
FT                   KLFQYAEQAEKRGLEVIIAGAGGAAHLPGMVAAKTSLPVLGVPVMSQTLNGVDSLLSIV
FT                   QMPAGIPVGTLSIGKAGAINSALFAAAILANKYPDIRAALKRYREQQTQKVLDNPNPKE
FT                   EKS"
FT   CDS_pept        complement(310615..311454)
FT                   /transl_table=11
FT                   /locus_tag="lpp0278"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11426"
FT                   /protein_id="CAH11426.1"
FT                   /translation="MHYQNQRVLLASKHQKEKAIQPPFEEKLGCRIHVPADYDTDQFGT
FT                   FTGEIPRKASAYETLILKAKAAAKQFGYRYVISSEGSFGPHPQLYFCPADTELMAFIDL
FT                   DNDLIIAEHEVSTETNYSHIDISATDDYEAFLNKAKFPSHGIIVRALNSEENYIQKGIC
FT                   EREQLKTAIQKAFTYSTTIRLETDMRAMMNPLRMNVINKLAVKLVHRIQQYCPQCHTPG
FT                   FGKISAEGHLACISCGTPTELYLRKVLNCLKCEFKTYQARDDGLEFADQRYCPYCNP"
FT   regulatory      complement(311463..311468)
FT                   /locus_tag="lpp0278"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(311479..311832)
FT                   /transl_table=11
FT                   /locus_tag="lpp0279"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11427"
FT                   /protein_id="CAH11427.1"
FT                   /translation="MNIIKVSEKKEMNISLHPMKKIEVIVSGDNENMVATMMEKANISG
FT                   FTLLRNVSGKGHHGFHEGKILFNDKASFVMFIAVAPEEAIANIALGMKTLFQKNSGVLF
FT                   VSDVSVARVDYFS"
FT   CDS_pept        complement(311846..314134)
FT                   /transl_table=11
FT                   /locus_tag="lpp0280"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11428"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8H1"
FT                   /protein_id="CAH11428.1"
FT                   /translation="MSSHITLIKTNTNNENKMTQFNYKVDNDVMIIRAMVNNVAKQMTP
FT                   VWPLEKFIACNALHGFESMSFEEAVIQNQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTLEMPHRDKGLYFGFLKLAPFDSALHQNSKSIKSWLSNLPEMPEQAIRLCLDKLGVL
FT                   NQKQEDFLQSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLVDFIAVRLVITCILWPEA
FT                   SQEEKKKKKDSADTKQLIQNIKNKEDDYRQLLLKKLLPELSKAHIKENRANAQMVFCID
FT                   VRSEPFRRCIEKLGHYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCLEHHEKGKEFKNILNRVYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RLTKDLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKIIVRRALAENGINIPQDTLF
FT                   YGAQHDTTTDEVEIYHSNVSQFIHQDILDQLRTDLNMAKHNNNLERINYLNSIDCAEKD
FT                   IARRSTDWSETRPEWGLARNAAFIVAPRQLTKNINLEGRCFLHSYDWSQDKDGALLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SHDDKSFHEPQRLLTIVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYKLE
FT                   KTNNWSVIQ"
FT   CDS_pept        complement(314149..315669)
FT                   /transl_table=11
FT                   /locus_tag="lpp0281"
FT                   /product="hypothetical protein"
FT                   /note="Similar to NADH-ubiquinone oxidoreductase chain 5"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11429"
FT                   /protein_id="CAH11429.1"
FT                   /translation="MDKLLNGLSISLMLSPLIAMLFYSLLGKTRNIQATYYGTTVIGFG
FT                   FGLSLLALIVSANTVNPNSYFLFHASTLSLLLSTLILFISFIIHRFSLRYMHGDKCYRR
FT                   YFFKLSAITLTTVVMALADNLLLFWLAWSASNLLLINLMIHKSQWKAAYNSGILTLKTL
FT                   LPGSLLLITAFWILFTLNNTLSIETITSEVSNKSSPAIAVALGFIILTAMTQSAIWPFH
FT                   RWLMSSLNSPTPVSALMHAGLVNGGGFLIVKFAPLFVAKANLLTVLFIFGALTALLGTL
FT                   WKLLQWNIKSMLASSTMAQMGFMMMQCGLGLFPAAIAHLCWHGLFKSYLFLNSGSAVQQ
FT                   KKYQNKSRPEKLTNLLTAFLGGLGGMYGFALITGKSILSLQASTFLLGFAFITGAQLTL
FT                   GLIAYEKHFKKVILVLALVFSIGIFYGGSIHLIESLLPNLTGFPQYQLSSLQVLTLIIF
FT                   FSLWLVFSMGLFKKIRETRLWDWFYMYMFNASTPHPKTITANRHTYYY"
FT   CDS_pept        315771..316622
FT                   /transl_table=11
FT                   /locus_tag="lpp0282"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcriptional regulator, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11430"
FT                   /protein_id="CAH11430.1"
FT                   /translation="MSIDTITLQCFLAVAETQSFTKAAQRVGRTQSAISQQIAKLENLI
FT                   EKPLINRGRELSLTTDGEIFLGYAKRIYELHRESLDRFKAPELQGEIRFGLPEDFASII
FT                   LSDVLVEFSRLHPRVLLNVECDLTLNLIERFNEGKFDLILIKTTQQQIGTECIEVCIEP
FT                   VEWIGKKELLPLLDKPGPIPLVLSPTPCVYRGNVIDALDKAHINWRLVYSSASYAGKMA
FT                   AVRAGLGITAIQRSMIPNYLERLDYDFLPILNDVHVSLLKNSESNKAIESLEFFILQKL
FT                   KY"
FT   CDS_pept        316664..318253
FT                   /transl_table=11
FT                   /locus_tag="lpp0283"
FT                   /product="hypothetical protein"
FT                   /note="Similar to toxin secretion ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11431"
FT                   /protein_id="CAH11431.1"
FT                   /translation="MNAKPINSIIDVLDRQTISSIAMISVIISLLSLSIPIAAQTLVNL
FT                   IAFGKLLQPVITLSLMVLILMMALGALHIWQIVIIEVIQQKLMVKVSLSLTRHFTHMSL
FT                   DNFSTHHGPELVNRFFEIVTIKKSLASLLLYGINLGLQLFFGLLLILIYHPLFLLFDIF
FT                   IILGILLIIFIPYKKALDSAKKECSEKHVVGAWLEEILINRYLFRFSLYHRYVTQQTDK
FT                   KLVAFLKARNTHFKQLIKHQIGFYTLSALASSLLLGLGGYLVINNQLSLGQLVAAEIVL
FT                   GALIYSFKRFGALLENYYDLVASENKIDAVLNLSLEQVKEDEHGELLTPINSIQLEIDS
FT                   KSKALITVDKPLLVFSEKSDLCQLFVEQLFGFQDPASLHVLINEIPCARKNLISLRRFS
FT                   LLIAEPQWFTGSIYDNLVLNHRNVPNKIIIEQLKNVGLADKIIQLPEGLRTILYEWQDV
FT                   FTSVELTKLMLVRAILLQPELIVIDCAFDILNHQEVNEMMELVLSLKNTLLVIVSQRSD
FT                   FNYLNNRLVISS"
FT   CDS_pept        318250..319236
FT                   /transl_table=11
FT                   /locus_tag="lpp0284"
FT                   /product="hypothetical protein"
FT                   /note="Similar to RND efflux membrane fusion proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11432"
FT                   /protein_id="CAH11432.1"
FT                   /translation="MKLHAYSMISKLPKPQKIAKIIFIVFVAIILFLSFTPWQQFALGN
FT                   GKVIAFSPTERQHTVNSPISGRIKKWYVDEGMRVKPGDPIVDITDNDPELLSRLEVEKK
FT                   AILLRIEAAEQAIAAGKANVDRQKKLYEQGINSRRQYELAQIEYAKYQNELAQANIDKV
FT                   NVDVRIARQKTQIIKAHVAGIIFRRLTGQESVVVNAGDVLAQILPETESRAVELWVDGN
FT                   DIPFVRLNQKARLQFEGWPAIQFRGWPEIAVGTFGGTVSFIDPTDNGFGLFRVVIVPNE
FT                   PWPSVRFLRQGVRVHGWVQLGQVPLWYELWRQYNGFPPESDRENKAS"
FT   CDS_pept        319233..320630
FT                   /transl_table=11
FT                   /locus_tag="lpp0285"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane component of multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11433"
FT                   /protein_id="CAH11433.1"
FT                   /translation="MICFPSGKNRLIVLCLLLILSFKCFPIPGKPLLLDAVLKSVDRSY
FT                   PQIVIARLEIRKAEGDYVNALGKFDPSFDVNPRFQPVGGYINNYADNLFNVPTLYNGLK
FT                   LFGGYRIGRGDWPIYYQNYLTNSGGEYRAGLSLPLLRDRRIDKERTELFTREETIRMKQ
FT                   QDAAATKIKIYQETIKAYWQWVEAGFQLKTFRHLLNLAKERQNAIIQQAQQGDLPRLAI
FT                   AENLQLIVQREQLVNQGEMLLAQAGINLSLYYRDANGKPQKPDESQLPATFPAQPIRVS
FT                   NSISQLQRHPVLRKLENYSKIVKLKQNLARNELLPNLDATAYTFKQYGTGGYPLLIPQA
FT                   AMIGVNFKFPIFQREARGKLISTTSELQQVKTEMKFTYEQLNNELSNLLVAIRIYQQQV
FT                   VLLNKELNLARQVEKGETKRFYEGDSTLFLVNQREQTTAQVKLNWINAEVNLQEATALA
FT                   RFFSSTQ"
FT   CDS_pept        320813..321919
FT                   /transl_table=11
FT                   /locus_tag="lpp0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11434"
FT                   /protein_id="CAH11434.1"
FT                   /translation="MSYSIDNPGGGDCGFYALAIGLISIIQNEYKLHGKSKTYDRWKQV
FT                   EGIYGVRQQDILNVDLTKLHDSPYTYKSELLFLLQMSLRNIAVIVNKEDLIKRIIEEGR
FT                   SKDQTKIEGSNAYCKFMELVQLYLYRRDSLARISQFNELALSPEIVQTARDIAKILRPI
FT                   LRNQPFHQVQKIENAFVKEVLLNDVLSGNTINSNSIILKNLEKIKEQGRWATHDDLKEI
FT                   ADLLKINLNVVGQPNGKPILEYPTVTLKNLSNTHWITQVESLQGPRQYSTPRKRAFGYE
FT                   TVSDRAVPLKEEQTLDRAFRTKTQSERTKRYHQHFETLFDTLSPYGFFTYEQNKRNTQV
FT                   SGKVQTRLESDESLAAQLQEAELRRILY"
FT   CDS_pept        complement(322090..323655)
FT                   /transl_table=11
FT                   /locus_tag="lpp0287"
FT                   /product="hypothetical protein"
FT                   /note="Similar to amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11435"
FT                   /protein_id="CAH11435.1"
FT                   /translation="MLKRDISTLNILVASAGGMIGSGWLFSPFISAQMAGSNSLISWVI
FT                   AAIFMLFIALPLCELGTMFPVSGGMSNYPTYTHGREVGFLFAWTSWLSYVVMTPIEIQA
FT                   ILQYSSHFFPILIDNHSESLTLSNYGYLAAIGIMFFVVILNSYGIKFLAECNKYASIIK
FT                   FVLPSIAIISLLKQSPSLANVNINLSSKEHWVEIFTALSAGGVAFAFTGFQNGLILAGE
FT                   VKNPQRNIPIAILGAVLVGFILYFMLQFSFIAAVPQKYLAQGWHALSYPGDEGPLVGLT
FT                   LLLGLGIVATLLLFDAAFSPFGTTLVYTAATSRILYGMALNQHLPKFFLKVNRHNIPYV
FT                   TLYANLLVGSFAFLPFPGWQKLVAFLSSASILSYGIGPICLLAMRKMHPHMDRPFKLAN
FT                   SIFLSHIAFYICNLMLYWCGFSIIWKLNLALLMGLGIYFFYHRHISMRNGSPLVWFIMY
FT                   MGSFSIISYLGSFGGIGLLKFPFDLICFLPYSILILYMSQVLATPRHDNDMVGNVTELP
FT                   VYNS"
FT   CDS_pept        complement(323803..324636)
FT                   /transl_table=11
FT                   /locus_tag="lpp0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11436"
FT                   /protein_id="CAH11436.1"
FT                   /translation="MFSKALISATYKNGKPGQLTEEHEKAEHHRFKTEYLFKNTEIPKD
FT                   LYASRLIQHFLIIKAIETKLQNLPKTEQSEISAFFALSYLEHLWRTPAIENDLRQLNIN
FT                   PDEIHKDVITKTTENYLENIEKFTPKILLAHFLLHIAGFMHGGNIIRSKYIEPSNRLTT
FT                   YQITADQYDFSAAISFLSSGKHSPLALYQDMMKQIDNIVLTGDEYQELLEQCKGIYETM
FT                   SNIYDDLCDMHTHHLKLPTYSLAAISVSLVALGLILKLLMDFLNPMTNPIANAPR"
FT   CDS_pept        324863..324988
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0289"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="PSEUDO:CAH11437.1"
FT   CDS_pept        324918..325130
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0290"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT   CDS_pept        325750..326448
FT                   /transl_table=11
FT                   /locus_tag="lpp0291"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 3-oxacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11439"
FT                   /protein_id="CAH11439.1"
FT                   /translation="MANYLVIAASSAIGQAVVNSLISQGDTVFTTARDNSKIQPNVLLD
FT                   ATDFEAVNEVFKQFGPIDGVVNCAGSLLLKSAHTTAKEQYQAVIDSSLTTAFATIRAAG
FT                   MHMKGGGSVVLISSAAALVGLANHEAIAAAKSGIIGLAQSAASTYADLNLRFNVVAPGM
FT                   TDTPLTAQLISNTLAFKASKAMHALDRIGTPEDIARTIIFLLDPKNNWITGQVLTVDGG
FT                   LSRVRPKMKI"
FT   CDS_pept        326541..327836
FT                   /transl_table=11
FT                   /locus_tag="lpp0292"
FT                   /product="hypothetical protein"
FT                   /note="Similar to proline/betaine transporter ProP"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11440"
FT                   /protein_id="CAH11440.1"
FT                   /translation="MIKKEILISSLGNTIEWFDFGLFIFMAPIIGAKFFPQASAGNATI
FT                   EAFIVFAAGFLCRPLGGIFFGYFGDTRGRAKTLRISILIITFSTFLLGVIPSYEEIGLT
FT                   APIIFILLRLIQGVSIGGEYSGIIIYLAESAPLNKRGFTTSFAALGANLGFLLATVTLL
FT                   FLHLFFSEETITNWAWRLPFLFIGLPGSLIIYYRFKLSETPVYSLLQKKHRLVSIPFIV
FT                   AIKFAPRQLLKILGLTCMGSTFYYVFFAYIPNYLEHYIGFSLANALTIESFMLIIMLFT
FT                   VPLAGLCGDFFTRKKMLIITAIAILFLVLPCFYLLQFKSIILALLSLGTATILSSLEQG
FT                   NTLAAIVENCPENIRYSGIAFSYNLGNALFGGSTPLIVTLLTENKGLITPAYYLIFMAA
FT                   ITLITATTLLSNNQSLGPLRNPMRSRTQMNLQ"
FT   CDS_pept        complement(327811..328203)
FT                   /transl_table=11
FT                   /locus_tag="lpp0293"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11441"
FT                   /protein_id="CAH11441.1"
FT                   /translation="MTYIIFARWFGLVSVILSLGILFNLEDARDMAKHMVKSDSGYIMG
FT                   GVLPTVFGSLSLMFANSFELGWTLIITLIGASMLLIGIFRVIFVKQWKALLSQYIQEIP
FT                   FLFSLFGLMFGVILLYVGFIANSFAF"
FT   CDS_pept        328441..329259
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="lpp0294"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11442"
FT                   /protein_id="CAH11442.1"
FT                   /translation="MLNPKGLIAFEQRKLFFDTLALMLIVVLPVIIMSITFVYHYQVSH
FT                   RTRDYKPNWGHNFYLEALWWGIPCVIILVLGIVTWKKTHELDPYRPIAGQAQKPLLVQV
FT                   IALPWKWLFIYPEQNIATVNYLEIPLGQQVEYWITTDNVPMSAFFIPQLGSQIYAMAGM
FT                   RTRLHLLASEPGVYDGLNTQYNGDGFSDMHFEVHVVEPKTLQQWFTEVKKSPNGLTDAS
FT                   YNQLLYPSIADKPKLFSSVQNDLFNKVIMIYMESIGRTHPRENIVKFHKE"
FT   CDS_pept        329262..331256
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="lpp0295"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11443"
FT                   /protein_id="CAH11443.1"
FT                   /translation="MLQNLLFGKLTLDAIPFHNFFAMGAGIFMVLALGGVLALLTIFKK
FT                   WSYIWNEWVTSVDHKKIGIMYLILAFVMLLRGFSDALLMRSQQAVAAGNAIGFLPPDHY
FT                   DQIFTAHGVIMIFFVAMPLVFALLNMIVPLQIGARDVAYPYLNSLSFWLTFVGAMLCNI
FT                   SLVVGQFASTGWLAYPPLSELYYSPDVGVDYYIWSLQISGVGTLLAGINFIATILKMRC
FT                   NGMTLMKMPVFVWSALCAMILVALAFPVLTVTLALLSLDRMLDMHFFSDFAGGNSMMYI
FT                   NLIWVWGHPEVYILILPVFGIFSEVVATFSQKKLFGYTTMVWAIAMITLLSFLVWLHHF
FT                   FTMGAGADVNSFFGIATMIIAIPTGVKVFNWLFTMYKGRIIMATPMLWVTAFFTTFAIG
FT                   GMTGVMMAVPPVDFQTHNSLFLVAHFHNVIIGGVLFGAFAGITYWFPKAFGFRLDETWG
FT                   KRAFYFWVTGFYCAFMPLYVLGLDGFVRRTNHYANTMYQPYLVFAAMGALLILVGIVFQ
FT                   VIQLIVSIKNRHALHDRTGDPWNGRTLEWSVASPAPIYNFAKLPTVQALDQFWVDKEHH
FT                   RAEGHIHPKDIHYDPIHMPKNTSTGFIIAIFSGIAGFALIWHMLIPGIIGLLGVVSTAI
FT                   ARTFSNDVDYYIDAETVKKTELAHFRELV"
FT   CDS_pept        331256..331852
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="lpp0296"
FT                   /product="Cytochrome o ubiquinol oxidase subunit III cyoC"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11444"
FT                   /protein_id="CAH11444.1"
FT                   /translation="MHNETILNHIHHHDSDSTDVFGFWMYILTDCILFGCLFATFLVLN
FT                   NPGYPGPALKNYVNLHDVLIETFLLLISNFTFCLAILNLYQDKRHKVQLWLGITFLLGA
FT                   GFISMEVTEFIHMANEGFRWDVSGAISSFFTLVGTHGLHVGFGLLWILIIIIQLPLIKL
FT                   NHVKRRRMTYLGLFWNFLDIVWIFVFTIVYLMGAI"
FT   CDS_pept        331854..332192
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="lpp0297"
FT                   /product="Cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11445"
FT                   /protein_id="CAH11445.1"
FT                   /translation="MEHHGIKEPDYGTGQKKLGLYLVGFISCTFLTLFSFWVVMSHIFS
FT                   KTEVLTLIFSSACIQFLVQVICFLRLSTQTQQGRTNVMTFLFTGVILTSIILGSLWIMW
FT                   NLNYYMVH"
FT   CDS_pept        complement(332287..332469)
FT                   /transl_table=11
FT                   /locus_tag="lpp0298"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11446"
FT                   /protein_id="CAH11446.1"
FT                   /translation="MNEAGYRKKISAVSKEYLQAPGLRLAKNTMFIQDVDWNHGIVIRA
FT                   CFKKRRIISDSVTLV"
FT   CDS_pept        complement(332712..334541)
FT                   /transl_table=11
FT                   /locus_tag="lpp0299"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11447"
FT                   /protein_id="CAH11447.1"
FT                   /translation="MKSTLQLNLYKLEQLTRDNPEQNKRTHRFIDLVKQRLNLLNQLVQ
FT                   LKGSGKLDTQEGYDLLNQSQDMSHQVKSLGQEIKSVELVLLSERNTGAVRWADTSSFIL
FT                   ISGGITSILFLTIAFILANIELSTRRKTELQNQNTQIRLKKIIESASDMIAAFDKDQRF
FT                   ITFNEAYQREFKRLFDKSISINMSLEEAFDDVPENKKKLVQTWKESLQRDEETKNIEVN
FT                   TEQEKIIYEMTSKLIQNGDNEIKGVVHSVRNITKRVQEHTELQESYEKLANGMKELQKK
FT                   NEQITLLVEMSDIMLACGSQEELSYVMAKYSQRLLQFSSGYLFIMHPSKNYLEKAASWG
FT                   NPQPHDLTFTPEQCWAIRLGRIHYAGSSRIELMCSHTMFAEQPELSLLCVPLMAQNDIY
FT                   GLLYLEVGLEFDENQQLLITAFAELTALALANVRLRENLRYQSIRDPLTGLYNRRYLED
FT                   FLFKQLHQAERTKASFAILMLDLDHFKKINDTFGHDAGDLVLKELGQILNSDIRLGDIA
FT                   ARYGGEEFVLLLYDIDAQAAKMKAENLRSAISNLQVKYGAQPVGQITASIGISVYPDDA
FT                   KSPAEVIEAADKALYQAKNKGRNKVILFSEISS"
FT   CDS_pept        complement(334546..334842)
FT                   /transl_table=11
FT                   /locus_tag="lpp0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11448"
FT                   /protein_id="CAH11448.1"
FT                   /translation="MNNTWHQTATGNRPILSKLRLSRTLLNVIFIIALSLLLIINIISY
FT                   NQVKNLIFASNWVSHTHEVIQTIDTCLYDVVEIESRQRFYLIRGSSPQLMTGY"
FT   CDS_pept        complement(334988..337546)
FT                   /transl_table=11
FT                   /locus_tag="lpp0301"
FT                   /product="hypothetical protein"
FT                   /note="similar to cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11449"
FT                   /protein_id="CAH11449.1"
FT                   /translation="MLYSNYRFYLAKNAQLLNPEESREAIEKILAKTKELELIRVAVDL
FT                   TSSNKSISLLSASKESHVIKTKVTQILKEQGLSVIDMMEVEVLQDIEKIEHHHPTHKSK
FT                   NTPLHPIKKHQKKAKHDHSHGHGHHHGHHHENHWIKAALGLIWGIGLLVLSIGTFNIPL
FT                   VAYYVITGLTSLMTLYLGHTVYQSAWQALKEKKWDTTTLYSISTLTILAVSIASVFVPG
FT                   LPMMFEAAPLVLGFWHLGEGIEHTLVGKINKKLDVRDCVPPLVLLKGNPDKEISVKTLI
FT                   PNDMIIVKKGQVIPVDGVLTQQALLYTTRIDGSPNLKEFHPGDVVKAGMQLADHIPSLA
FT                   MQVTKTYQNSYLSLIAENINKANDEKAPIEMFADKVLKYFIPGLIAVALLSGVVIGSLF
FT                   NPALAIQCVVSVLVSACPCALSLITPMAVKIGMKKASENGIHFNNGKALQAAADIDTVV
FT                   FDLNGTLTQGKMVVKSLHITDKKYLRPIALLESQSDHPVAKIIKSYIEQQDTASTEPLE
FT                   ITSIDKSHHSGMKGIVNGEAFMIGNKDMLAANGITSIDKPYDNPEKGSVYIVRGTTVIG
FT                   QIALIDPLREDAIATVKQLKRLGKSVHICTGADQATAEKYATLLGIPKDNICANTVGAV
FT                   TQKGEVSKTSYIQQLKQKGFKVAMVGDAANDATAIAYSDIGIAVKSSIGDSITEQHAGI
FT                   VVQQGLLFPIATAFDVAQKTKQNIFQNLFVSLSYNSIITLVAAGLFVALGFALNPVLGV
FT                   ALMVLESTIVLTNLYLFKQQDILSSTSSNANNAVEVEPTANTTSKVLHALGHRSQPQEN
FT                   LAIVTESKPVNPKVINLFAPKEHSSYRSDVTQQKLGCGIC"
FT   regulatory      complement(337553..337558)
FT                   /locus_tag="lpp0301"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337878..338324
FT                   /transl_table=11
FT                   /locus_tag="lpp0302"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11450"
FT                   /protein_id="CAH11450.1"
FT                   /translation="MKHNLLDKAYKHCVNHGYRFTEPRERVLKILVDERKPLGAYDILQ
FT                   RLSMEVDNPKPPTVYRAIQFWHQEGFIHCIDSLKSYVACLHGHHVGQAQFLICNQCDFV
FT                   KELECVVDFTSVTEAANSIQFSIINCTVEIKGLCSDCNLTNLKN"
FT   CDS_pept        338633..340444
FT                   /transl_table=11
FT                   /locus_tag="lpp0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11451"
FT                   /protein_id="CAH11451.1"
FT                   /translation="MQSKSVRKERFQAYPVGTGLYDTTTMLTAEDLGEIFNYYEKKHGI
FT                   RLIRNGDYHQHVLHNNIEKYVSQIESLYDERVPYYKLLSMCDIYGTSYSNSIFSISLHE
FT                   KKLCEELNKKLKPFMKDNSLRTDLDENQITQVEAICRNLSPDIKKQLDEKRDSILKHLE
FT                   NKKVNCCLTKSQAIEEILDIQRSLGGDEAVGYVFTNDRRSKEGAHFEAVIITKESIIKP
FT                   VEWNQPMSTALYYFDRGLSGMKFYSPRGDFLADGPEQPTQQVDHTHCGVLCVSYLKKLL
FT                   QDKGKALFEESLMIPLYDEENNINYVYIPPPYIMQYSQTSKFIEFYQMLMGKEISASED
FT                   QPKPHNLKQLLEESKRRALGKNDKATAEINQKILDNFDEFRLRWLKGCEEACAKRDEMF
FT                   NNNDRSSYNLYLAYAAKRMQDEARSPKPSVQLNTKMESIDAQLKVSEQEDMLSHERRVL
FT                   ENELEQLPSIQNLTTEDTSVPHNENEELNTLKKDLQEYVFKRMTEAGSKDFAAHHRTKM
FT                   IGLKLGYSAEQKITAANKLIYALDMRDKLEQRPDEMKLNETDIGALTTSRLYKNVIKSH
FT                   LELFNNVLANLPEISEMNVKGASGKEI"
FT   CDS_pept        complement(340555..345045)
FT                   /transl_table=11
FT                   /gene="sidE"
FT                   /locus_tag="lpp0304"
FT                   /product="SidE protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11452"
FT                   /protein_id="CAH11452.1"
FT                   /translation="MPKYVEGIELTQEGMHAIFERMGHPNITSGTIYNGEPTIDKGALD
FT                   RQGFMPVLTGVSPRQDSGHWIMLIKGQGNQYFLFDPLGESSGKYYQNILAKKLPGATLS
FT                   VIPNDAGLNMGLCGYWVASVGLRAHAALTQPIPPSLRNLGQTITQEMRDELTQDGSEKI
FT                   TQWLRAVGNEFPEGDIQPDATALRRATEKNLRIDELQPVFAGTTPKEISINPTAPQETS
FT                   VPTWNGFSLYTDEIVRNAARYAYDNYLGKPYTGTVEATPVNFGGQMVYRQHHGLAHTLR
FT                   TMAYAEIIVEEARKAKLRGESLKTFADGRTLADVTPEELRKIMIAQAFFVTGRDDEESS
FT                   KNYEKYHEQSRDAFLKYVEDNKSALIPDVFKDEKDVKFYADVIEDKDHKWADSPAHVLV
FT                   NQGHMVDLVRVKQPPESYLEYYFSELQPWIGSKAAEAVFAAQRQFFHATYEAVAGFNSE
FT                   NTEPHLVVDGLGRYVIEPDGNPIREETDDEDEEESGELKFFSQKKKLEKNQRYMRVDEY
FT                   LKLDEVQKRFPGAGKKLDGGLPGLSEYQYLQRLNSINRARCENDVDFCLGQLQTAHHQT
FT                   KITPIKRAFQSSSEKERRQPNMDEIAAARIVQQIMANPDCIHDDHVFLNGQKLEENFFR
FT                   DLLAKCDMAIVGSLLNDTDIRNIDTLMQHERNTEFHSTDAKAKTVKLGETWEKTIRSGG
FT                   GVTQIKHDLIFLMQNDAWYHTRVNAIAQNRDKDSTFKEVLITALMTPLTNKSLIDTSRS
FT                   PAPKTLFRGLDLSEEFKNKLINQAETIIANTTEHLFTDLSTEAFKQIKLNDFSQVSART
FT                   CASTSTNIEVPRTIFGSNTIFEILDPDGLLHPKQVGTHVSGSESEYSIYLPEDVALVPI
FT                   KVSSDGKTVKGKDRHIFTLVAVKSPDFTPRHEIGYAVGPLLRMQTPKLAETQRTVEQAR
FT                   EEPDLERVFNLQSRVARQAKLFSTESGYKTFLNEKVAPVLEQSLNGLLDNNVTILGKVL
FT                   SAFPSDGQWSAFNSVEARQMKIQIDAIKQMVEKKAVLEGRILPALAQCQDALEKQNIDG
FT                   ALQALKNIPSEKEMQTMLSISSGLRGQIQRTKQNLTENLEPLQRAMTAKLVSDQEKVKV
FT                   RYEKLIAGIPQQITDLEKAALSDLAGVKKVVSHFNHLQEELKLLRNEKVRMHTGSEKVD
FT                   FSDIAQLEAQLQKIHTKLYDAYLVELTKEISVLAKEKPKNLADVKRMVSNFYAMSADIE
FT                   QLRKEKIKKHGESKDPIDMSDIDKLKEELQKINQFLVKAMGTNIRVSMNQMEVKTFDAQ
FT                   EKEAQQNLKQLDALINKLESSDAVQKQKEELEKLNQLLAEKRKAYPAMVQLQFRSEALI
FT                   IHLRELCEAHQDHLAKTRKTRAQEVTNGRWKVQWLTDWVGLTTDERVTLANKEKELAKF
FT                   KEDLNNDEYDLQELISNLAEKNPSELEEAIGISKESAQKLHKLLSHLNHSTTFMSKIEQ
FT                   RLQSIDELLNEFGKQSPRTEIIKTVEEKQGTLLRL"
FT   CDS_pept        complement(345463..345945)
FT                   /transl_table=11
FT                   /locus_tag="lpp0305"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11453"
FT                   /protein_id="CAH11453.1"
FT                   /translation="MATYYGQCACGKIQFMCTGEPVFTQYCHCNKCLEIASLSQKKQDK
FT                   SGYSLTAAYLTRDFRIVSEENDFEEIIKEKAKLFLCSYCHSLVYGIALDPAQQDSIGIN
FT                   VNNFSFDTSIPDSFKPVRHIWYASRIMDCDDQLPKFKDAPKEQFGSGELFELPNAN"
FT   CDS_pept        complement(346040..348019)
FT                   /transl_table=11
FT                   /locus_tag="lpp0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11454"
FT                   /protein_id="CAH11454.1"
FT                   /translation="MRYVNFELLKRIPQHLKGVMEYYPDVLLFQLNQIQYTHLWHELSS
FT                   AKYLYTNGFVIKPTHWLMYAFQTVKGWLGFDNHCQPEKISYVLDKLSYYGYTKQFLQPD
FT                   FSSITNFSISPEISALVVKSRDDLTTAQLQNKLVNNYFKVEPHLGIDYSYQKLNPNHRF
FT                   GESWTHAHEWGLIPQLDPQDDSLIAEVISTLDKTGISAKDVFFLQHSKYAKAAAQYYCD
FT                   KAKNTIVPSFFFRLLWTDPRPRYLALALAYDPEIAKRDAQKFIEYHLAQKEYDNAFNLL
FT                   GILNDSYLVLKFLLAIPETERHALIQKDTAIAAIMAKYYTEKKQYLLAIQFYSNIEEIS
FT                   PNAAFAIEIQEQNYEKAYDIFKKYNSPDLFSMPERKSLAKIFYSEAETAYVAGKTYRGN
FT                   KSWEKAKQFYLQSLEQKRAAHHLDPSDEYLEDLYAHKRLYALLLIDADIDLNKAEDSDI
FT                   ASIQKAITLLRECRSNNKEEQEHHKRDLAAGLMRRVDTLREKIAFNYYSSDFESIRKHK
FT                   IEHQQDIAILIKTLGELIALLEGTQDKALRLQLGKAHYLLADVQCFFDINAPDINQHYK
FT                   MAMKAVPGNPFYVLRVAELFEEEKSKLQKIGITQLKNMGYQVFDFLHWSEERWCKRDDI
FT                   IHNIKDIHMPPSEPINSSSWNFTF"
FT   CDS_pept        348301..349095
FT                   /transl_table=11
FT                   /locus_tag="lpp0307"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11455"
FT                   /protein_id="CAH11455.1"
FT                   /translation="MATLKIHGVDIYYELYGQGKPLVLIAGYCCDHTFWNAMLHELAEE
FT                   FQVLIFDNRGIGQTRDNGDSFTLEAQADDIMAFLEQLGFRNPSILGQSMGGAIAQLLAR
FT                   KHGKKISKLVILNSVAKFNTRANQAMESLLNLRKENILFDLLIEAGIPWFFSSEYLAEP
FT                   KNIATFKENLKNNPYPQSLKDQARQFRTIPPFDSRGWLHEIKVPTLVIAAEDDILTLPA
FT                   ESQQLAQGLPNAQFITIPGGHSSPLEHPAIVNDAILKFLTSS"
FT   CDS_pept        349112..350578
FT                   /transl_table=11
FT                   /locus_tag="lpp0308"
FT                   /product="hypothetical protein"
FT                   /note="similar to betaine aldehyde dehydrogenase BetB"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11456"
FT                   /protein_id="CAH11456.1"
FT                   /translation="MEIYEMYIDGKFTLAKSGTTRDIFDPANGELIARVPESAKEDAIL
FT                   AIKAARKAFDEGEWRKSLALDRGKLLFKLADLIRANAKMLAELETRNCGKPLPEAEFDV
FT                   TDAANCFEFYGGLATKIHGETMSVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAP
FT                   ALAAGNTAVLKPSELTPITALELFKLIDQCGFPAGVVNLITGTGIGVGEELANNAMVDK
FT                   VAFTGGSATGRKIMQAATGNLKKISLELGGKNPNIVFADCDLEMAIDGALFGAFANQGE
FT                   VCSAGSRLLVERSIHKKIVEGMLKKIPNIKLGHGLDAGVKMGPLVSSAHREKVESYVKL
FT                   GMEEGAKLLCGGKRPTGSEFAKGNFFEPTIFDEVKSTMRIAREEIFGPVLVVIPFDTEE
FT                   EAIRIANDTDYGLSGAVWTKSVTRAHRVTSQIRAGILWVNHYHPTYNEMPWGGYKQSGA
FT                   GRELGLYGIESYLEVKQVNINLDETPIGWY"
FT   CDS_pept        350553..351905
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="lpp0309"
FT                   /product="hypothetical protein"
FT                   /note="similar to 4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11457"
FT                   /protein_id="CAH11457.1"
FT                   /translation="MKHQLVGTKLMKKIHIKTPIPGPKSQQLMELRRQHVARGPFHATP
FT                   IFVKQAKGSFVEDVDGNVFLDFSSGFGVVNTGHCPDSVVNAIKLQAEKFIHTGFNIIPY
FT                   ESYIKVCAKLNDHTPGHFEKKSLLLNSGAEAVENAIKIARAYTGKQAVICFDHAFHGRT
FT                   YMAMTLTSKNKPYKHGFGPFPSEIYRAPFPYEYRWKGTNCVEECFNEFTDLANFRVGVE
FT                   NIAAVIIEPVLGEGGFIQSPALFLQKLREFCTTNDIVFIADEIQSGFGRTGNLFAMNTL
FT                   GVPPDLTISAKGLGGGVVLAGVTGKAEIMDAAMEGGLGGTFGGNPLSCAAALEVFYIFE
FT                   EGSLLQNVTHLAKALQSRLSGFKEKYKVVGDVRGLGVMQAIELVKDKNTKEPNKEAAVQ
FT                   LAQFCLEHGLIILTCGTYGNVIRLHMPLSTGVKDLETGLSIIEEGLKRLSI"
FT   CDS_pept        351994..352752
FT                   /transl_table=11
FT                   /locus_tag="lpp0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11458"
FT                   /protein_id="CAH11458.1"
FT                   /translation="MWYQNIMRNLLEKLPEASRKDGEVFLSKLFLAVKKVDNKPEMEFF
FT                   LGLIEKSFLKFENEKPGSVTLVKFSRYILGLSLLYAKSGNDLAIWNSDFIPYLTEIKKF
FT                   LDTDKEGKLFNKFLNKLEVATFVSLNHQLDIDFKHLISILKANCTLETIESFTEACKGL
FT                   DNDCSKGFSQMMKDIEAQMINLQFTVDFDSDSSPKITDENLENTPLQKNVHVNSTPKGV
FT                   SILHRLGIFKLFALSGVELSDQTNVLVNKK"
FT   CDS_pept        353016..353948
FT                   /transl_table=11
FT                   /locus_tag="lpp0311"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11459"
FT                   /db_xref="GOA:Q5X8E2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X8E2"
FT                   /protein_id="CAH11459.1"
FT                   /translation="MSSKLLTIQLLEELVHAAELNQEGKTADYIPELANVNQELTAIAV
FT                   QPLGEKTLAYSNNPLHPVTLQSTGKMIPLIGLLEEFGADQLFEWVKVEPSGDDFASITR
FT                   LEQFGPKPSNPMLNAGAIALCSRIPGVGEQQFRWLEHWVQKLFNQRLSINPLVFASEKR
FT                   TGNRNRALAYLLKSRSNLGADVHETLDLYFALCSYEAMLDQMLYLPAVLANKGQDPDTG
FT                   EQILSIETCKITLAIMATCGLYDETGTHMVKTGMPAKSGVSGYTIAVVPGKAGIVVLSP
FT                   RVNAKGNSIRGEIMLEGLSKAMNWHFALP"
FT   CDS_pept        354072..354959
FT                   /transl_table=11
FT                   /locus_tag="lpp0312"
FT                   /product="hypothetical protein"
FT                   /note="Similar to D-3 phosphoglycerate dehydrogenase SerA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11460"
FT                   /protein_id="CAH11460.1"
FT                   /translation="MKIAVVEPIGIAMQEIRSELPGHTIIECDSRQWSDEQLIDFVKDA
FT                   DIIVLTNRRLSAAVINSALRLQLIAVAFAGIDHIDRDAVSKRNIPVKNAAGYANTAVSE
FT                   LVFGLMISLARHIPDNNQRIREQGITNTGIELKNKVLGIVGYGAIGAEVVRLAKAFQMT
FT                   TIIYDRKSQVTLDDLFSQSDFVTLHVPLTNETKGMVNLRLLSQMKKSAYLINCARGPIV
FT                   VSSDLKKALEKDMIAGAALDVFDVEPPLPANYSLWEVSNLIATPHIGFNTREALVAKGQ
FT                   LTIRNIKEFLLSRL"
FT   CDS_pept        complement(355096..355695)
FT                   /transl_table=11
FT                   /locus_tag="lpp0313"
FT                   /product="hypothetical protein"
FT                   /note="Similar to dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11461"
FT                   /protein_id="CAH11461.1"
FT                   /translation="MKIVVIGATGIIGKAIVAELNPRHEIISASYKNSDIQVDITSKQS
FT                   IDAMYKKLNTIDAVVLATGKVHFAALKDMGEDDYKIGLTNKLMGQVNVVLAGLEYINDN
FT                   GSFTLTSGILNRDPILYGSSAAMVNGALDGFIKSAALEMPRGIRINGVSPTVITEAMEN
FT                   YGPYFRGYEPVSAARAALAYSKSIEGAQTGQVYCVG"
FT   regulatory      complement(356004..356039)
FT                   /locus_tag="lpp0314"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(356025..357419)
FT                   /transl_table=11
FT                   /locus_tag="lpp0314"
FT                   /product="hypothetical protein"
FT                   /note="similar to oxydoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11462"
FT                   /protein_id="CAH11462.1"
FT                   /translation="MILEFDTIILGGGKGGKTLAMDLAKSGQKIAMVENNQIGGTCINV
FT                   ACIPTKTLVQAAKVAHYCRKAKGYGLNTTLNPIDFKAIRARKDAVVNGMREANLKQFLD
FT                   SGMDLMLGHGHFIGPKMIEVTLSSPRDNQKTLHITADKIIINTGALPYNPPIAGLDKVN
FT                   YFTNDSLMNTDSVPQHLLIIGGGYIGLEFAQMFRRFGAEVTVIEASSEFLGREDKDIAE
FT                   QVFQTLSNEGIQFAVDTKINAIRQEQTEVIIEANRQGQSEIIRGTAVLVAVGRIANTAG
FT                   LHLDKTGVELDERGFIKVNEFLETTAAGIWALGDVKGGAQFTHLSLDDYRLVKHNLQNP
FT                   QKKLSSQNRLIPYTVFLDPELARIGLTEAQARSQGRPIKIATIPAAAIPRAKTQGETTG
FT                   VLKAVIDAETDLILGVSIFCAEAGEILGVIQLAMELRVPYQKLRDMMFAHPTLVEGINL
FT                   WFAQII"
FT   CDS_pept        complement(357471..360830)
FT                   /transl_table=11
FT                   /locus_tag="lpp0315"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminal part of conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11463"
FT                   /protein_id="CAH11463.1"
FT                   /translation="MTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYCEQHTPEE
FT                   AIQDILQIEKLSKDNPLVIDFYEKTHLQYPLHIKLYRYETPIPLSDILPMLENMGLRTY
FT                   TERPYKIKTRDGRLFWISDFNVTYSQTDSFNITQVNNIFAEALININLGICENDGFNKL
FT                   VLSAGLSWQEITILRAYAKYLHQIGIRYSQSYIEKTIEMHAAIARDLIHFFYLKFGLKR
FT                   KSTTHKDISALEQKIQINIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHAGLSKDYL
FT                   SFKLKSSEIPDLPPGQPLYEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDFRTEILGL
FT                   MKAQKVKNAVIVPSGAKGGFVLKKPLHAASREQIQQEVISCYKSFINGLLDLTDNLIND
FT                   KTIPPQNVICYDDPDPYLVVAADKGTATFSDIANSIAKEHGFWLGDAFASGGSAGYDHK
FT                   KMGITARGAWESVKRHFRELEVNIQQQDFTVVGIGDMSGDVFGNGMLYSKHIRLLAAFD
FT                   HRHIFLDPNPDPLKSYEERLRLFNLPTSSWEDYNLQLISKGGGVYKRSSKSIPISPQVK
FT                   KALAIEANALTPNELIRALLKAPVDLLFNGGIGTYVKATTESHADVGDKTNEFCRINGA
FT                   ELHCKVVGEGGNLGFTQLGRVEFALKGGLINTDAIDNSAGVNCSDHEVNIKILLDKEIR
FT                   EKKLTEKKRNQLLSRMTDEVADLVLQDNYNQALILSISAAHSSHYSGLYQDYMKELEKW
FT                   VNLDRSVEFLPDDKKLLERKTTGAGLTRPELAVLMAHTKIHIANELLKSHLPDDSYFTT
FT                   FLETGFPISLRKPYAKALPKHPLSREIIATQLSNKLVNNMGITFMYRMLMETGMSIADI
FT                   ACAYTISACIFQTDVLQNLIDSFQDKISLSTQYELLHHIRQLLNLATRWFLHNNRLTGG
FT                   IEKNIKNYGKSVKKLEQLIPKLMGGVTKEYLEKLISQFVSIGIEKDMAQKIAITRALYT
FT                   SLNIIEVTTQNEFDLSLTAETYFKVGSQFNLVWFRDQIANDSREGHWNTMARLSLRDEL
FT                   DNLQRRLTIAILTTNTKERTSEKLINYWLEQNHPIQKRWEKLLEMLLGSENIDYTIFFI
FT                   ALRELSSLIQVL"
FT   CDS_pept        361030..361755
FT                   /transl_table=11
FT                   /locus_tag="lpp0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11464"
FT                   /protein_id="CAH11464.1"
FT                   /translation="MYKNILFFSNFSRMRWNKYDGDRYQSLWEHNKRDIKHTFFGTIAN
FT                   GKDLREVLFQPVTASFSMLVAGAFAQLLVPYSIFMLCMGEAGFAGRTLINYFEITTVAL
FT                   AMPFIALLSTVGRCIATVKCLVEDQYNLAEMVEDKEVKPNKIYLDCAEVNYTVRDENNN
FT                   QFIRKYYKFQYKMRGLNDELCQGIFTFRDLERAPDNDDFNGDLSSLTLYKYDILDLIKR
FT                   VHKDKFEEMEDENLIRISI"
FT   CDS_pept        361996..362949
FT                   /transl_table=11
FT                   /locus_tag="lpp0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11465"
FT                   /protein_id="CAH11465.1"
FT                   /translation="MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGA
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKR
FT                   VLNVKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
FT   CDS_pept        363109..363450
FT                   /transl_table=11
FT                   /locus_tag="lpp0318"
FT                   /product="hypothetical protein"
FT                   /note="similar to arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11466"
FT                   /protein_id="CAH11466.1"
FT                   /translation="MEKITIYHNPRCSKSRQALEILQNKGFEPIIIEYLKAPLDLEQLK
FT                   RLRTHLALEDLVRTNENVFKELGLSLANEAQVLEAMVKEPILMQRPIVTFKGKAAIGRP
FT                   PEKILELFD"
FT   CDS_pept        complement(363537..364691)
FT                   /transl_table=11
FT                   /locus_tag="lpp0319"
FT                   /product="hypothetical protein"
FT                   /note="similar to fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11467"
FT                   /protein_id="CAH11467.1"
FT                   /translation="MMFGFLNMTVWGYLLTGFVLTHITTTAVTIYLHRYQTHRALTLHP
FT                   LVSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFNIRKVFWQVPELYRE
FT                   ASKDKDMIKKYSYGTPNDWIERKLYSPHANKGIFLMLALNLFLFGIPGLTLWAIQMMWI
FT                   PLVAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWE
FT                   FDLGWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVI
FT                   FPTLRDMQYRIKNRDLKNARHLLKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQ
FT                   QIWLKTSLSNKDLLNLIQKWCSQAEESGLLVLRQFASQLKSYSL"
FT   CDS_pept        complement(364810..366054)
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="lpp0320"
FT                   /product="hypothetical protein"
FT                   /note="similar to ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11468"
FT                   /protein_id="CAH11468.1"
FT                   /translation="MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSA
FT                   QTGTGKTASFVLPILQKASQQTQTSRNRAKVLILTPTRELAIQAHESIIQYGKYLTLRS
FT                   AVIYGGVKSHNQIKQLDSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMG
FT                   FIHDIKKIIKLLPLKRQNLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTV
FT                   YSVDGNHKLALLSHLLHKNNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQ
FT                   RTKALADFKSGKVQTLIATDIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGAS
FT                   GLAVSLVSTEEIKLLLSIEKLINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYK
FT                   GNISRKSRTAFNKSA"
FT   regulatory      366375..366380
FT                   /locus_tag="lpp0321"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        366385..366660
FT                   /transl_table=11
FT                   /locus_tag="lpp0321"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of eukaryotic RNA-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11469"
FT                   /protein_id="CAH11469.1"
FT                   /translation="MKQKKIYVGNLPFGTTEEALSIQFSQYGKIEEMFLIKDRLTGQMK
FT                   GFGFITFSAQQEAESALEMNGQPFDGRSLKVCMAQKKINSVSRSRW"
FT   CDS_pept        366836..367513
FT                   /transl_table=11
FT                   /locus_tag="lpp0322"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11470"
FT                   /protein_id="CAH11470.1"
FT                   /translation="MKAKGFFDEQSSLKKGKIGLNSVWMFSLGHIFLITLSNVLVQYPF
FT                   AMMGFHTTWGAFTYPAIFILTDLTTRIATANKARKIIMLSMTPGLILSYLVASYIEAGN
FT                   NLNENVLSVLHLMPLRIALACFIAYVVGQLLDVAVFQRYRNRPAWWLAPTLSAVAGNFI
FT                   DTALFFTIAFYHCSNPFLSQNWPEIAMVDVFFKIMISLIAFVPVYGLVLSILGIKTTNK
FT                   LMA"
FT   regulatory      367538..367543
FT                   /locus_tag="lpp0323"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        367551..368189
FT                   /transl_table=11
FT                   /locus_tag="lpp0323"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11471"
FT                   /protein_id="CAH11471.1"
FT                   /translation="MLTGLRLLAKDLKILNGKYIQLEPITSQHREELRKAANHEQIWQY
FT                   MPQKATGKLFNSWFDDCLEKMSIRDQITYAVRCKKEGDLKGATSFYDIQPENKRLALGY
FT                   SWYIPKVWGTTANPESKLLMLHQAFEAWGINRVELGTDSRNIHSYRAIKKLGATEEGVL
FT                   RQHMILHNQVITDTIMFSILFSEWPAVKERLIQRLNYAATDKDLLAVSI"
FT   CDS_pept        368323..368850
FT                   /transl_table=11
FT                   /locus_tag="lpp0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11472"
FT                   /protein_id="CAH11472.1"
FT                   /translation="MYNKMFKPLDTDPILYFKMYSNYTEGRVDDCCAFILMPSGLQREW
FT                   VCLQSIQFAFNKRGDVLGINIIFSGNESNIHKKVRETMEGMLKLKLQYGRGEELFVFDE
FT                   EKKTFHMGIVPGKDTQAYLEGIIAFIKDSYRLQPDFAQDIKSQLLSKEYLAQEYSRLRW
FT                   KPPEKETVCVLM"
FT   CDS_pept        369005..370351
FT                   /transl_table=11
FT                   /locus_tag="lpp0325"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11473"
FT                   /protein_id="CAH11473.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLQQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLVAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSHIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVETKTLFENIDSNQLVPGNLPASVLRVRPDIHEA
FT                   EALLKAAHADVGAITANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALNDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVTLYQDLGGGYRGY"
FT   regulatory      370327..370332
FT                   /locus_tag="lpp0326"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        370341..371378
FT                   /transl_table=11
FT                   /locus_tag="lpp0326"
FT                   /product="hypothetical protein"
FT                   /note="N-terminal part similar to N-terminal part of
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11474"
FT                   /protein_id="CAH11474.1"
FT                   /translation="MGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWFVMY
FT                   EYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFMGGD
FT                   KTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVLEIQ
FT                   LNFITQLANLLESYLNPTQSLAAVQTKYLDYERKMLDGFTLYNRYIGEAKIETKKAPFF
FT                   IPHSIAAMQHFRRLFRLFSVFVYYLSTEEIRSDPWVCDQLSKLLCNLQSLQRKLLKQDA
FT                   GPIGGDVVAAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDTEIKEIILIYDVYDI
FT                   RLNEM"
FT   CDS_pept        371435..372427
FT                   /transl_table=11
FT                   /locus_tag="lpp0327"
FT                   /product="hypothetical protein"
FT                   /note="similar to multidrug resistance proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11475"
FT                   /protein_id="CAH11475.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYIKNEQEVKKGQPLFTVFKAPYELAYRKAVSDVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNHSALRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASVYVYIHTH"
FT   CDS_pept        372604..374547
FT                   /transl_table=11
FT                   /locus_tag="lpp0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11476"
FT                   /protein_id="CAH11476.1"
FT                   /translation="MKIPFEGKWRATITKREAGFSQRVVVGGATSGNGSYNGVVGNSFV
FT                   FEDGWVELQWNNNAGSGWQESAVISSVGMTSPLVVVKFVSADDNFPNQRDGDYDDLQVR
FT                   FEHLDAPFEVTQRPYALDRGSLVMFPDGIFDASQGIQYMGVQIKNTWFFDWQSNFPATG
FT                   MKIGIAPVSRSALSAAGIVVIDSWTPQEQEGLGQIMDGGFVRVPDLKINEETTIYFKLD
FT                   VSNANPSKPEIGFVAQRDAYDPHYDEPTRIVDKKIFISRSSYNPATRELVTAIPEGTLY
FT                   LKLNKIAIDRKGATKAAQELKKCLKQHGGGIKGMSKWLHKLSRGFWQNSKDKERWCKEQ
FT                   GNDALRKLLKQLLDGKDIDICHLKAILDQCCERPGGDCECCPCGDGDGRPGGWDDGTGV
FT                   DGWCRVKPVFWLPLDFEYKVVPNPAYIGQFGPLAFEDPWWKVVLIILAIILAIASVIYD
FT                   YVYASEDDQYIIGQVVRNGDAPINLVDAAVSNLNGSRGVDLGQLDAQGNDINNGSPITA
FT                   LDSIIQLNRTAAGSYFGTLDAVLGNVVWKSGATSATTRGFISTLGTFVSIPYDEHDTLS
FT                   GTVTYTNEVVISELAAIPQTLSDPGDSGSVWVDLATARPVALNYGSPTDSSDNRAFANP
FT                   IRSVIDVLNLRF"
FT   CDS_pept        374566..376350
FT                   /transl_table=11
FT                   /locus_tag="lpp0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11477"
FT                   /protein_id="CAH11477.1"
FT                   /translation="MKREFFQKLDKILDIASEHKQMLLQYPDVVMVGVGPERRKGKITG
FT                   EPAIIVTVRKKRSSSELKKRGEKPLPQTIKGIPVDVIELGKAVEAPEIIAVQEKAKKTI
FT                   SKIGAKWLQTPNITAIGYGYKEKGGEIDFNTIAIQFFVKKKFPMAELQKQQISPIPEKI
FT                   NGVSTDVIQLSPIRPAAASGSRGDRHDPLKGGVAIGVGSKPFHYGTYGATVFDRTTGEQ
FT                   LFLSNQHVLDASPGTDTIQPSPVLLDDSVEVGFQLDVCLPIHFIRLDTPNTTVGTVLAG
FT                   AAVAAAVAAALSDEIDPTRRGQEATMPATGSKTLFETQKVKMDYPELPIPGTPFKVKTA
FT                   WDYERHTDAGIKMFSVSEEKKNPHVLRDKLLITDKKLYHPGDTIRIFGLILPEECAPAS
FT                   QSRNDRQPINSRELEDITHYPNVASSINLDLVASMDSDIASSPARRTNTRAAVINPKRC
FT                   RCDRYHPVAILTPTTEDRAFPVVLREPVFAQKNQIFQDLLTVVKQRDDEKLLERVFVLV
FT                   RYGCIYTGTLRVNNIPAGPWKHFFYVQTVNIATSDMKPLLAAQIIGGLPVSQNAKADLD
FT                   IACGPLTWEDGEFDIELI"
FT   CDS_pept        376713..377027
FT                   /transl_table=11
FT                   /locus_tag="lpp0330"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS4 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11478"
FT                   /protein_id="CAH11478.1"
FT                   /translation="MLNKIQGTQESNDFEDTRMTQPDRIEKLLVLLTIAFCWAHKTGEW
FT                   RHVQKTIKIKKHGRKGVSFFRYGLDLLHDAALNGCQFIHHSFSDILGFLCISRVICAAE
FT                   "
FT   CDS_pept        377053..377346
FT                   /transl_table=11
FT                   /locus_tag="lpp0331"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11479"
FT                   /protein_id="CAH11479.1"
FT                   /translation="MQVKQPAIYIMANKRNGTIYTGVTSDLIKRVYEHKYGDVPGFTQE
FT                   HGCKFLVYYELIEDMITAIAREKQLKGGSRKKKLALIEKLNPYWEDLYEKLL"
FT   CDS_pept        377546..377944
FT                   /transl_table=11
FT                   /locus_tag="lpp0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11480"
FT                   /protein_id="CAH11480.1"
FT                   /translation="MFGFFSDYKQYITLRNFAVVYNGLTGLAVLYSLWSNPEADPSEYV
FT                   IDISIHALTAITLMCKQAPESVKAVAMALNTYRGFDALFKAITSLPSTIPGIANAVDVL
FT                   NHRFNFKELEKLGNEETAETRSAVQHTM"
FT   CDS_pept        complement(378030..378632)
FT                   /transl_table=11
FT                   /locus_tag="lpp0333"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C-terminal part of DNA polymerase,
FT                   bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11481"
FT                   /protein_id="CAH11481.1"
FT                   /translation="MGIEVWVMRESTPSCEKHLATLADEVASCVRCSLHKTRTQTVFSR
FT                   GNPKAKLMIIGEAPGFYEDQKGQPFVGKAGFLLNKMIRSIEMTENDVYIANVLKCRPPN
FT                   NRDPALEEISQCSSFLTRQIKLIKPHLILALGRFAGQFLLDKPLPLKQLRNHIHYYNNT
FT                   PFIVSYHPAYLLRNPSDKKKAYIDWLAVKSFLVDYGQ"
FT   CDS_pept        378927..380201
FT                   /transl_table=11
FT                   /locus_tag="lpp0334"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transporter, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11482"
FT                   /protein_id="CAH11482.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTYLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVGTVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFVFVKGELGGLWFGTENFANIRAVTVFVALWISLFSLPLFLMVQQKTGEHLTV
FT                   GTAIRKGLQELRLTIKSLPKQRDLFLFLIARIFYIDGLNSILALGGIYAAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNALFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
FT   CDS_pept        380322..380978
FT                   /transl_table=11
FT                   /locus_tag="lpp0335"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to amidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11483"
FT                   /protein_id="CAH11483.1"
FT                   /translation="MKIIISILFAFISASGHAFSCYDPQTIIQKPIQFDKKRIALTREY
FT                   QLTHYGIDSESIEIEPKMIVLHWTCIPSLDTTFRIFDPPALPTSSPRRNELPGDLNVSS
FT                   HFLVDRDGTIYQLMPETWMARHVIGLNHYAIGIENIGGVDSKDDLTEEQAKANAFLVCY
FT                   LKNKYPQIKYLIGHNEYLQFKGTALWLEKDPNYQTDKTDPGPTFVKKVKQLIAAS"
FT   CDS_pept        complement(381115..382095)
FT                   /transl_table=11
FT                   /locus_tag="lpp0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11484"
FT                   /protein_id="CAH11484.1"
FT                   /translation="MKPCIFLSFLLFFASTCFSKTESIETQGALKNTQEIEQLLRHYLK
FT                   PKAVLNSSYDEFKFASYQGALFNLYSGHTNFNGIGAENLRLGNFYWGLNLYNITTNTDS
FT                   NSRITNALNQNHGSIEDNGIYFHVLKQITSLVFLDVFANFGRDRFRLINTVTIDGNTPL
FT                   TGYAKYYGNDNTVGVRTFLGQTYKLFYLQGDLTFLYSNFNQPDYILTFPDQPVGVPALT
FT                   TKIGTLVEHARLYYQVNEHFSPFLNGGLIQLTSRSFSRPVLGPDFVTIAPLPQLLLAKN
FT                   GYSYGIGFDYLYKLIRITPIYAHTVRGNSFSDDYVGVKLELKGTS"
FT   CDS_pept        complement(382142..382390)
FT                   /transl_table=11
FT                   /locus_tag="lpp0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11485"
FT                   /protein_id="CAH11485.1"
FT                   /translation="MRLLMSGWTCWFILFLSLGLSSCASEPTTVQQAVQNAVSRLTPEQ
FT                   LATYNATSDQFNQWNASSQFNISTGELSFLIVGCGNT"
FT   regulatory      complement(382400..382405)
FT                   /locus_tag="lpp0337"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        382554..383003
FT                   /transl_table=11
FT                   /locus_tag="lpp0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11486"
FT                   /protein_id="CAH11486.1"
FT                   /translation="MRKNLLKTMIVLSIGLLTYETTFSLPQIILNKADDFSIEIGTVSK
FT                   STFSSCGNSIANCLVTLKLMIHNEGFVIIHNNSSRTLTNVRAYFPEELQNQVDQNASAC
FT                   ISLAPGLSCRLTFRPTTMSQFLERTAIPIHGDKTSTAFFDLQITE"
FT   CDS_pept        complement(383108..384655)
FT                   /transl_table=11
FT                   /locus_tag="lpp0339"
FT                   /product="hypothetical protein"
FT                   /note="Similar to multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11487"
FT                   /protein_id="CAH11487.1"
FT                   /translation="MANTIDFYPITPLAKAHWKRISINKIKARTLGKIFVFIMAITIML
FT                   TLFNFSYATDSKLKPTVITVSEEEFQVDGKGKKTKEFKLTFTHPDGTKDNKGYFANKRD
FT                   MFHVLVENKSASPITLHWHGLIVPSDQDGVPGVSQILIPPGQNKLFNYRLLQAGTYWMH
FT                   SHQKFQEQKQLSAPLIIYDKDDPHKDLQEVILFLEDFTYKDPQLIFDQLRTAKMDMKKM
FT                   DSGNDLNDVTYDAFLANKKTLAAPDVISVQPSKKVRLRIINASSSTNFKIDTGKLSATL
FT                   IAVDGENIEPIVDSSFPIGVGNRMDLLVEIPSAGGAFPVKAMAEGTNKQTGLVLTTDNT
FT                   PTPILSPNTTNKTGRVNYYELEKKLKGKNALTNKKINARLHYVLDGQMNGYIWTMNKQS
FT                   WPDVTPKVIHFGDRVEMIYENKSSMSHPMHFHGHVFQVTEIDGQPLDGAMRDTLLVQPH
FT                   STVKVQFDALNPGIWANHCHNLYHLNAGMFTTFEYQHYPKPDFYLKTIGQIKKSKAN"
FT   CDS_pept        384883..385317
FT                   /transl_table=11
FT                   /locus_tag="lpp0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11488"
FT                   /protein_id="CAH11488.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHIGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECTWRVIKGIGENFSVG"
FT   CDS_pept        complement(385332..386324)
FT                   /transl_table=11
FT                   /locus_tag="lpp0341"
FT                   /product="hypothetical protein"
FT                   /note="Similar to magnesium and cobalt transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11489"
FT                   /protein_id="CAH11489.1"
FT                   /translation="MSIEMHSFDSIAVEFDLKNHSMQKIAIEDLNIDYQDKDKIYWIHS
FT                   NLNQKNIFKKLREKLRLPEQVIQLCGEKDNRSTTIEIDEALTLQIQGLCSMKLNDNYDA
FT                   DFSNLIVHLTPNYCFTASKKLSSVLFDMLKSCPKSLPYAKTSCFLLFLLLEGVINDYAK
FT                   IHLAYEELADQLDAQIRTPNKNTYSQVLELKHGVMKVKRYTIAIREILMRITSRNILVI
FT                   SEQCRTSLYNLSNHCHLIVNEIDSLRDMLNGLLGQIDNQLMQNMNETMKVLTAFAAIFL
FT                   PLSLITGIYGMNFYWMPELGWKYGYFWALGLIVLCALLLFLIFRKKKWF"
FT   CDS_pept        386589..387176
FT                   /transl_table=11
FT                   /locus_tag="lpp0342"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11490"
FT                   /protein_id="CAH11490.1"
FT                   /translation="MSQDIEKMYQLIMEINKLKLVFRNTITNPQRNESTAEHSWSASMI
FT                   TLILMNELKREFKSVDELKIIKLVLIHDVVEIYAGDVLAFDLKARKDKEKVELEALEKL
FT                   SAVYPSFGIELDSLWHEFEERKSLEAKIAKAADAICPVFQRLQAKQSYIPFDISMAQLE
FT                   KTKYPYFQFSKTFSNLFEKLKADLLKEQLIFL"
FT   CDS_pept        387311..388810
FT                   /transl_table=11
FT                   /locus_tag="lpp0343"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11491"
FT                   /protein_id="CAH11491.1"
FT                   /translation="MYDDLWKPYASTELPSLKLGGIVLNGQLLSETPIHLVLKAFNRHG
FT                   LIAGATGTGKTKTMQVFAEQLSLNGVPSLVMDIKGDISGLAMPGDASTKLLDRGQQLHI
FT                   DFTPRGFPVELLTLTPQDPGVPLRARIDDFGPLLFSLMLDLNDTQAGVVTVLFEYAKAN
FT                   QLNLVNLDDFKSLLQFAQTDRGNQLIAAQYGGVASTSIGTIVRKIIELESQGGKQFFGE
FT                   PSFVIQDLLRTDANGYGVISILRLLNMQDKPKLFSSFMLKLLSDVYRQMPELGDPDKPR
FT                   LVLFIDEAHLIFNYSSKALLNLIETIVKLIRSKGIGLIFCTQTPNDIPEIVLSQLGLKI
FT                   QHSLRAFTAKDRKALKLVSQNFPVSSYYNTEQLLTTLSIGEALVSALDAKGQPTPLVHA
FT                   MIRAPESRMGPLSNEELKVLLDQSFLFGKYSQMIDAPSAKEKLAELISEQQVAKQQTSQ
FT                   KQNNSSVLNSLSKNTLFRQVVRQVFREFTRAILSLFKSKRN"
FT   CDS_pept        388891..390294
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="lpp0344"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11492"
FT                   /protein_id="CAH11492.1"
FT                   /translation="MINITGTYTDQYQLAMAQVCFLKGQHERIATFDYFFRALPFKGGY
FT                   AIFAGLEDLLDVLEQLRFEQQDIEFLQHQNMHPDFIRYLQQFKFNGTVYTSLEGDVVFP
FT                   TRPVVIIEANLIEAQIIETLLLNIINFQTLIATKARRIRQVAGERILIDFGLRRAQGAG
FT                   GYFASRAAIVGGFDSTSNVRAGRDYSIPVSGTMAHSFIQSYDSEIQAFSDYAEAWPENC
FT                   ILLVDTYNTLQSGVPNAIKIAKEMEKRGHRLKGIRLDSGDLAWLAKRARHMLDEVGLNY
FT                   VAITASNQLDEYVIKNLLEQDAPIDAFGVGTNLAIGAPDAALDGVYKLAFINGQPRIKL
FT                   SDTPAKITIPYQKQVYRVFERDGTYRGADVVCLKTEKKIDMMHHPFEILKSLSIKHYKK
FT                   EALLHKVMENGKRLLPKKSLGEIARFSQQCFDRLPLEYKRFINPHIYKVGLSTELKMKR
FT                   DQLIAEHSR"
FT   CDS_pept        390299..390919
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="lpp0345"
FT                   /product="nicotinamidase/ pyrazinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11493"
FT                   /protein_id="CAH11493.1"
FT                   /translation="MKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCFDLIVASQ
FT                   DWHPSNHISFASNHPGKKSFEKIKLGNLEQTLWPDHCVQGSIGAQFHAQLNTNPIEAIF
FT                   RKGTDPNIDSYSGFYDNLHKKTTGLAGYLHEKGARELYFCGLCADICVYFTIKDALSQG
FT                   FDCYLIEDATQALVKDDFIKIKKELIKQGTHIINSSNLLNNLQ"
FT   CDS_pept        complement(391002..391385)
FT                   /transl_table=11
FT                   /locus_tag="lpp0346"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11494"
FT                   /protein_id="CAH11494.1"
FT                   /translation="MSIQLNHTIVWVKDRDKSAHFLTEILGLPEAIPYGPFMVVEMSNY
FT                   VSLDFCKTDKEITPQHYAFLVTETEFDDIFKRICERKMDYWADPGQTRLGQMNYNDEGR
FT                   GLYFNDPNGHLLEIITKPYGSGS"
FT   CDS_pept        complement(391385..392599)
FT                   /transl_table=11
FT                   /locus_tag="lpp0347"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transporter of the major facilitator
FT                   superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11495"
FT                   /protein_id="CAH11495.1"
FT                   /translation="MYPKTKLSFMTLLLLISFASVNAVLFTPALPSITAFFKITEHAAQ
FT                   QTITSFLVGYALGQLVYGPTANRYGRKKTLYIGIGLQIISSLLCVLAGMISMYPLLVLG
FT                   RFLLALGSGVGLKMTFTLVNECYEPQLAAQKTSYLMLAFAIAPGLSVALGGILNSHYGW
FT                   ESCFYAGTVYGAILLAMVRQLPETQKSLQLEAFQMKHLLQGYVSQFKNKPLISGGALMG
FT                   GASCFVYIFAATAPFIAINLLGMSTTEYGAANILPSLGLTLGSIWSAQFAKKYSQRAGI
FT                   QLGILISAFAALAMMMAALTHHSALIKLFFPMIFIYLGLSFIFANASTFAMSYTSDKAH
FT                   GSAVMNFINMGLVTVVILGLSLLPMSQYLLPAIYIILCILMMWLFFSFIKSNEIISSID
FT                   MNKES"
FT   CDS_pept        392717..393586
FT                   /transl_table=11
FT                   /locus_tag="lpp0348"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11496"
FT                   /protein_id="CAH11496.1"
FT                   /translation="MSKFDQITYFIAVVEEHGFAAAARKFGVSTAAVSRQITRLEAELK
FT                   AELLVRTTRKLSLTEIGARYYQQCKKTLLELNEAEIAIASSRNEAVGILNVTSSRYFAM
FT                   RFLLPYLPEFMELNPKLQIKIELAERFPDLAQENVDVLFGVSMEGPPELVRKRVSTTRY
FT                   VLCASPDYLAENGIPKTPSELGKHRYITHSMRNPDNLVTFKNNEQIYVKPVLWLNDSRA
FT                   LCECALLGMGIIKLHEYIVAEALQDGRLIEVLPEFQESSLSVYLYYQASRYLQPKIRRF
FT                   IDFFTKQQ"
FT   CDS_pept        393998..397348
FT                   /transl_table=11
FT                   /gene="sdbA"
FT                   /locus_tag="lpp0349"
FT                   /product="SdbA protein, putative substrate of the Dot/Icm
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11497"
FT                   /protein_id="CAH11497.1"
FT                   /translation="MHKKYNYYSLEKEKKTFWQHILDILKAPFRLPGWVVSFFLARNIT
FT                   HVALNPNNIPQQRLIHLTKTSNRPEDDIVVINFKKRPPHKWFNDTLIKIANTIAALPFV
FT                   TPRLRTRLHYDNENDINHVNKLLAEIDALVQGKSKQKYCKGRTFDWSKIHLKGLEFLDP
FT                   KMRGYVYEQLHEKYGYVSYTTKRKPNIEFFTLKTPDGSELDSVQVTGEDEEQKPMGERK
FT                   FIITCIARDQNFINWIKDLNYTAKNLGATAISFNYRGVDYSRGLVWTENNLVDDILAQV
FT                   QRLISLGAEPKNICLDGMCIGGAVATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIV
FT                   PELQTANWWSPLTYGRFLLAGVVYALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRD
FT                   KDNGLYDGVIHDHFCSIASLVDSQINSILYKLSTDQPLTEEEKQILCDDQFSHHFKPSQ
FT                   SVLKNPKYKGPHFISRQDLVAELGHQEEYTNHDYFLDRLREKFQLDRTIRPVALAEDGE
FT                   KDIDGIPSQLSNHKERPLIIASSGGTGHISATHGIINDLQSKTDNVVITQHHAELYKNK
FT                   PFSITSVLIRIGVWFTSLPILEDILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKEN
FT                   GIETGRTRPYVDMLLDIYPEGYEYTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVY
FT                   QNILQRLMHAAKQNTPYTRLISTQALSLGAICDAVKYYNTVFLPVYNAERGTSYQPITI
FT                   DQYMTDLPSLGCIHFMNNLEELTSEQKQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNID
FT                   PRNNPMIRNAFKDPSLTKYLDKTQSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIA
FT                   SIMIGSLAANASADYVQYLLNQGYDHIFLFGGLNDSIAARIDQIINSYPDSRHDEIRKK
FT                   IILLGNQSDVEMAPIMTRSNCVVIRGGGLSVMEQMAMPIMDEKIVLLHHEDNEEGPLTS
FT                   GLSWEDGNADKLIEYLSEKGAYAKKTSPGLCSGHLNEAEKDFEKKYITQLKSKGTKEKV
FT                   DLTIPQQKKPPLKKEWGRKTGYTELGHVLSHQHRFFETIPEVREPFCSKEDLHHHELSS
FT                   QSLVSVTVG"
FT   regulatory      397412..397417
FT                   /locus_tag="lpp0350"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        397428..398981
FT                   /transl_table=11
FT                   /locus_tag="lpp0350"
FT                   /product="hypothetical protein"
FT                   /note="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11498"
FT                   /protein_id="CAH11498.1"
FT                   /translation="MIGMRAEQCNLKSFFVHSLKNKSNLLPLIACFNNREINMPKILDS
FT                   NAYREMENELNNLFEQIYKHGKNDRTAITLQVQQFLDNLSESIRDHSRLLLTNIAREEL
FT                   IYFKEKKPGDSREKFQNIDKMSDYFNNLSALINFSVMQQEDPTLRVFYYDMYIQLMNFC
FT                   YLKGDLFGAGAIYTGLIANNLPNSIDRKQLSSESRLIFKDCEEKFKRLFNLSTTYNEHT
FT                   NLKRQFKTALIPALPSLLTVQIYTKDAYDNSVSDFERIQEKLRQLDIEHNRFLNQLQND
FT                   HSTWSKAYYDYMSNVYLPQSIFEYTTLLREYEELITTHGGPIAKQFHEDKNSEHLVSFV
FT                   ESTLLENQSDLKLSPFQNERIVEMLSEIDVVKSECSSPDVFDDISWKLREMNCTLVKAK
FT                   SIGDYTSKIFANLDTPYMEENTDEDPKPVLVEELQTDDVYQLHHSGMKLIRELEQAIED
FT                   HKPKVIYHCSGEANYGFFKEARRRGRHLSPEPMDIEVMDVDVMDYDENDLRNQTVMITV
FT                   "
FT   CDS_pept        complement(399047..399712)
FT                   /transl_table=11
FT                   /locus_tag="lpp0351"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11499"
FT                   /protein_id="CAH11499.1"
FT                   /translation="MEALIRWNHPQKGIILPLDFIPTAESSGLIVPIGEWVLRETCKQI
FT                   GAWRTMGLPDIRVACNVASKQLRQRDFPAMVEDLLKEYSVEPHCLELEITENVIIDKEI
FT                   QRTIKKLKSLGVLIILDDFGTGNSSLNLLKQVAVDSLKIDQSFIQNISKSPGDEAIIDA
FT                   IIAIAQSMNFNIIAEGVETQNQLKFLKKRRCNDIQGFLMSKPIPPEEIEKLLQGNRTK"
FT   CDS_pept        complement(399749..401272)
FT                   /transl_table=11
FT                   /locus_tag="lpp0352"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11500"
FT                   /protein_id="CAH11500.1"
FT                   /translation="MSTESFRILVIDDNPAIHQDFMKILNVSKNSVLLNKFDVELFDDE
FT                   TEQLGISLPEFEIDVATQGIEGIEKVKRSLEEGRPYPLAFVDIRMPPGIDGIETIKRIW
FT                   AIDPQIQIVICSAYSDYSWESTVNTLGLSDNLLVLKKPFDVIAVRQLASALTQKWVLAR
FT                   ETQKHTKFLNQLVEERTESLQQSFSLLRATIESSSDGILVVDLQGKIVDYNSQFVKLWN
FT                   IPESIIKKETSEPQLIQYMSTQLLNSEQHAQHVKEFSIHIDDSSMQIYHFRNGKVVECC
FT                   SKPHRVGLQTVGRVWSFRDITEQTRLKEKLEYQATHDALTNLPNRLLLIDRIEHAISGY
FT                   ARHKMKFAILFFDLDRFKMINDSLSHEAGDQLLCDVAERLRSLVRKEDTLARLGGDEFV
FT                   MLFQSFNSEEQIAGVAQKILKSFQKPFHIAERDINIHVSIGISVYPTDGKTVNTLLSNA
FT                   DMAMYQAKFRGGNQFSFYTEKLNKKTNQQFQLELDLQKAIVHHEFFLLY"
FT   CDS_pept        complement(401275..402690)
FT                   /transl_table=11
FT                   /locus_tag="lpp0353"
FT                   /product="hypothetical protein"
FT                   /note="Similar to two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11501"
FT                   /protein_id="CAH11501.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINSKLEYAQDIAQMGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVALNYSSFLDLVHPNDKAGLKNVVEKALKEKEDYDYELRVRNGDNDYKWYRTIARANP
FT                   HKNEISGVLMDISKRKITEEQIHELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLNNPKGKLILPYLDALSKTLHEEYE
FT                   ENMKEANSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPEIDEFITDKSKLFQILTNILANAKDSVLLHEANDSRTIVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGKGAQFV
FT                   LDLPINPKTLSTR"
FT   CDS_pept        complement(402713..403876)
FT                   /transl_table=11
FT                   /locus_tag="lpp0354"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11502"
FT                   /protein_id="CAH11502.1"
FT                   /translation="MKIESFQYIQNQGWSIPTFPALDSENTLILVFASPIFRANSKPIE
FT                   ELAQAYKKSKIIGCSTAGEIFGPNIFDNSISVAVVQFESTKLQLAKTEVKSTEESYEAG
FT                   VHLSKSLHQKQNPQSIFVLSDGLNVNGSELIKGLNQHAGKGVTITGGLAGDGADFKNTW
FT                   IIYDGKIVDHCIGAVGFYGDQIHVGHGSRGGWDIFGPERVITQSKANILYELDNQPALK
FT                   LYKTYLGDRASELPASGLLYPLAIRNPSAPDSQHIVRTILGVNEEEQSLIFAGDLPKGY
FT                   YAQLMRANFDRLIVSANEAGENANDRLFKNGSLNTQPVLAIDISCVGRRLVLGELTEEE
FT                   TETTLQSLPPKSMQIGFYSYGELSPLATGTCELHNQTMTITTLLESP"
FT   CDS_pept        complement(404049..404930)
FT                   /transl_table=11
FT                   /locus_tag="lpp0355"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcriptional regulator lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11503"
FT                   /protein_id="CAH11503.1"
FT                   /translation="MDIRDIKSFLAVVEYHSLTLAAKKLHVTQSAMSKRIRKIEDELNI
FT                   RLIISEGSRLIFTEAAKQLIPYARQMLSAHQNMVHTLKNSQQFTQSIIIGASVYVSHYV
FT                   LPGFFKYLKETHPTIQAHLKTISEKEVEHILNHGTVDLVICPAREASEKLLSNSLLWEE
FT                   KLNLVVAVNHELAHRTSALSLSELSEYPALLTEKGAALRDKLDTLFEKNQLIINLGFEM
FT                   STIDAIKSLVEYGLGWSYLPDSLLSEKLKILKIKDLELTIPFHAFYLKKRISDRLINDL
FT                   LCYFKKWQNRDN"
FT   regulatory      405118..405123
FT                   /locus_tag="lpp0356"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        405129..407048
FT                   /transl_table=11
FT                   /locus_tag="lpp0356"
FT                   /product="hypothetical protein"
FT                   /note="protein with ankyrin motif"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11504"
FT                   /protein_id="CAH11504.1"
FT                   /translation="MDNDQLSVIHYLWVGLPTKMNSSASIAGHDVAGPIKMAKALQSQA
FT                   QGKPINPIKFWCLEQHQDFYQKLFNDAGVTIEVCGIEEIIRQESQGELRDQALFVQKFL
FT                   NDNLPSGQNSDIKQRVMFKDLFSLFLLVCQPGYFLDTNVFPATDREINLPGRDTVATAK
FT                   SGFQKSNDFYLMYSPQRNDSQMSEIFDIWARNPSFGNLLCFSGSHVPYIEIEDLGVQKI
FT                   SYKSYWGAKLPGLFFWLERNNRQLFEENLPYGDINQQLACSFSRKSLAPCSVCYAEEAE
FT                   PEKLLAMPFTTNEAYIATKANQIFYVNKTTKECVCVSDQFSSLFNCLPDRFHKEKIRLA
FT                   SESEINQLIRSLDNFSHPSYIVNIADGTLLHHAVLSNNIKQVIMLLELGAKFDLKASYQ
FT                   IKPEGTVLKFTPLELANYLKHEAIATLLQSHRISSTHVLSEISSESRIMPEATIQSSDE
FT                   VIQPSSKDERGFTPEQIMVIKVAMQEALSSMGTSHFVSGRDDKKESLVQCKSAFENAPN
FT                   GTERHEALRNFVTAASTPRQGLLNFLPAAYGETRSAIAFFEHIKKQDSSLFDALKPMRE
FT                   DKGPEVARQSNSSVETEATKPVARAREIMLHYKLAMQAERRGELKTDNDSVDSQNLCGT
FT                   RLKN"
FT   CDS_pept        complement(407059..408243)
FT                   /transl_table=11
FT                   /locus_tag="lpp0357"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11505"
FT                   /protein_id="CAH11505.1"
FT                   /translation="MHLKRTLSLTLLAFYGLGTILGAGIYALVGEVAKEAAQFTPLSFL
FT                   IASIIALFTAISYAELSSRLPHSAGSALYVRRAFHQKWLSGLIGWIVVLTGIISAATLS
FT                   HGFVKYFQLFFPLPPSLIITILTVILAGVAIWGIRESATLILFMTLMEVGGLLMIIYYG
FT                   RYSLASIDIKSFSFPHSFDGVLIGAFIAFYAFIGFEDMVNTAEETINPEKTLPKAIFLA
FT                   LISATILYIAVAWVIVLTIPSNTLVKTDMPLIEIIKLQGQSPLLFSIIALISITNGILV
FT                   QIIMASRLIYGMANQQNAPQIFSSVYSKTQTPVHSTLLVFLMILLFAYALPITTLAKLT
FT                   SSIILCIFIIIHASLIKIKLTEKKPTNAISFPIVFPMISILLTLAFLIIQFFLK"
FT   CDS_pept        complement(408311..409087)
FT                   /transl_table=11
FT                   /locus_tag="lpp0358"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with eukaryotic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11506"
FT                   /protein_id="CAH11506.1"
FT                   /translation="MSEREWPANDYAIGSYIQSTVAEEYLAYLKANPTDKILDIGCGNG
FT                   AFTKNILLQVPQGSVLGIDASENMLHLAQDMSKKFPNFSVQKADVLTMTFNSQFDYVVS
FT                   FWCLQWACANIQKAFLNIINALKTGGKFLTLFPAGDDPFIMSYYALRKSGQFASLHNFI
FT                   PPVDYSHLNNLEKKLESLTCRDLNVKLCRQSITLPSLDVFRKFVNGIAFYQGQLPNEEI
FT                   QQINEAMVRYYDSECQTKYHGEYQFNFTIYLVTGEK"
FT   CDS_pept        409295..410506
FT                   /transl_table=11
FT                   /locus_tag="lpp0359"
FT                   /product="hypothetical protein"
FT                   /note="Similar to NAD+-dependent formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11507"
FT                   /protein_id="CAH11507.1"
FT                   /translation="MFNQSQQKIVCVLYDDPKGGFPPNYARESIPELKQYPDGQSLPAP
FT                   DSIDFIPGEMLGSVSGELGLRQFLESNGHQLVVTSDKDGSDSVFARELKEATVVISQPF
FT                   WPAYLTRDRIESAPKLKLAITAGIGSDHVDLQAAMEHNITVCEVTYCNSISVAEHTVMM
FT                   ILALVRDFIPQYNTVIDGGWNIADCVSRSYDLEGMQVGCVAAGRIGLAVLRRLKPFAVK
FT                   LHYTDRHRLPLHLEQELNLTYHPSVESMVKVCDVVSIHCPLHPETEYLFDDRLIKQMKR
FT                   GSYLINTARGKICDQRAVADALESGHLAGYAGDVWFPQPPAKNHPWRSMPNHAMTPHTS
FT                   GTTLSAQARYAAGVREILECWLGNKPIREEYLIVSQGRLAGVGSHSYSAGNTTTGTEQA
FT                   VELV"
FT   CDS_pept        complement(410611..411735)
FT                   /transl_table=11
FT                   /locus_tag="lpp0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11508"
FT                   /protein_id="CAH11508.1"
FT                   /translation="MLTKSCAKATDQNRQELFMDSLLGDFQKMKEKALNQQQERRSKKR
FT                   ELHCKSSEKTKKPNQYAALTHSQVQGVKAKARTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFAFALLLHQAQKPESLIHSLRLATFNNHFILIVNERFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFEGFGRLVNYFSINQEGQCFTHVVREGDTTERDLSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTKTKRRKYETQEQEVPQPRQETSNQPTETVYTDSNHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGFKPDLPKNLFKF"
FT   CDS_pept        411972..412655
FT                   /transl_table=11
FT                   /locus_tag="lpp0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11509"
FT                   /protein_id="CAH11509.1"
FT                   /translation="MVIIGTLMSKERIKKAALEIVEYIHGNIKACNIPNQKKENKFFAP
FT                   LVYLCQTECDKILSNTKISLLERLLKCAKIIDDLQSGNCMQQTFLAFQRLLTRLIEDKL
FT                   SNFSTCIPISVMTIANHAFLIIDNDIVCDPWLNFVGDLKDYCFANMKRKEYFGIRSDWT
FT                   CFTNTEVYDEDSTEFTIQFVNALGVGISGFSEVKLANQLMQSSSMASDLGEDSVIPAPK
FT                   GFHRI"
FT   CDS_pept        412760..413533
FT                   /transl_table=11
FT                   /locus_tag="lpp0362"
FT                   /product="hypothetical protein"
FT                   /note="similar to oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11510"
FT                   /protein_id="CAH11510.1"
FT                   /translation="MNFLNNKIVMITGASSGIGQACARLFAAQGARLILAARRVERLHE
FT                   LSSELKHHNNQEHYILPLDVCKKDLVRQQIESLPSQWNSIDVLINNAGLALDTLPLHQG
FT                   ILEHWDTMIDTNIKGLLYISRLILPGMLERNSGHVINIGSIAGHECYPNGNVYSATKHA
FT                   VHAISKSMRLDMLGSAVRVTEIAPGAVETEFSEVRWKDKQRAIDFYKDFQPLMAEDVAD
FT                   AALYCATRPLHVDIEQMIIMPTVQASANHLSRRGR"
FT   CDS_pept        413777..414136
FT                   /transl_table=11
FT                   /locus_tag="lpp0363"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11511"
FT                   /protein_id="CAH11511.1"
FT                   /translation="MPTQVIRYFVLRWYIEVTFEEIWLILVLKRNANGRTRLLPEQHHL
FT                   LMGLFSFVILFAFNMYQTKALVSMEMASCYDKKGELTCSDILVIVRRSIWANIYFSKSD
FT                   NQLDSTKYSEKTSIH"
FT   CDS_pept        414759..414989
FT                   /transl_table=11
FT                   /locus_tag="lpp0364"
FT                   /product="hypothetical protein"
FT                   /note="signal peptide predicted"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11512"
FT                   /protein_id="CAH11512.1"
FT                   /translation="MNKLIVAVTAGASLLLLTGCAVDGVAVDDVSYDSGYSNDYVYSVG
FT                   YYSNRPYWGNNYYSSPSFVGPYGYWGGDYDF"
FT   CDS_pept        complement(415044..415613)
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="lpp0365"
FT                   /product="hypothetical protein"
FT                   /note="Similar to elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11513"
FT                   /db_xref="GOA:Q5X888"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X888"
FT                   /protein_id="CAH11513.1"
FT                   /translation="MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRN
FT                   LKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAA
FT                   QWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVR
FT                   VPLFVQTGELIKVDTRKGEYVSRAKE"
FT   CDS_pept        415685..416665
FT                   /transl_table=11
FT                   /locus_tag="lpp0366"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11514"
FT                   /protein_id="CAH11514.1"
FT                   /translation="MRDTSLSWQKILAQGFTSTTDLLDFLELPRSEGNLFAEKQFPSRI
FT                   PLGFAKRMQKGNPKDPLLLQVLAKEDELTEADDYVIDPLSESNTLIKGLLHKYHGRVLL
FT                   TLTGVCAVNCRYCFRRHFPYQANNPGRRGWKEVCAYIANDPSITEVILSGGDPLLAANL
FT                   VLEELLQSLEEISHIHTLRIHTRIPIVLPERIDKGLLDLLTNTRFKKVIVVHCNHPQEL
FT                   DESVLRACSDLKKAACYLLNQSVLLAGINDDAGILSKLSHTLFDYGIMPYYLHLLDKVK
FT                   GSAHFDMPLPRAQSIYHQLQSLVPGYLLPRLAREEPGRSSKTLLI"
FT   CDS_pept        complement(416734..418806)
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="lpp0367"
FT                   /product="Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11515"
FT                   /protein_id="CAH11515.1"
FT                   /translation="MDTTLDNPDYYINREFSAVAFNQRVLMLANDERVPLLERMRFLSI
FT                   CSSNLDEFFEIRVAGLKEKIAMSSGKLTIDGLRADEAFSQISHKAHALIDQLYNIFNKQ
FT                   LLPALRKENIHFLETDQWTDDIHLWAKHYFKHEILPVISPIALDLAHPLPRLINKSLNF
FT                   IISLSGKDAFDRNINYAVVHAPRSIPRMIHLPSELCGDAHYFVYLSSIIKTHINSLFPG
FT                   MEISGCYSFRLTRNSDLFLREEEIDDLAKAVQREIFSRHYGHVVRLEIENKCPEKIVDF
FT                   LLQKYHLRHEDTYYCDGPVNLQRYMSAINSIDRPDLNYPAFTPQYPKFSKSQRNLFNVL
FT                   DEQDILLHHPYQAFDLVIDFVRQAASDPNVLAINQTLYRTHSESVMVDALVNAAHSGKE
FT                   VTAVIELRARFDEESNLKLANKLHAAGILVLYGVVGYKTHAKMTLVVRRTHGKLKRYVH
FT                   LSTGNYHEQTAKRYTDLGLLTSEPTITSDAQLIFQQLTGLGKVVKLKALSHSPFTLQKT
FT                   LLQFIEQCSTAATGGIDTEIILKVNGLTDKVMIQALYKASQAGVKINLLVRGVCCLKPG
FT                   LPGVSENIRVLSFIGRFLEHHRVFYFRISEEEHYFCSSADLMERNLYNRIEIMFPIYDE
FT                   GCKKRIKNEIIKNYLKDNNNVWEMQSDGTYKHLMQNGGCAQEKLIALYEEEDKSI"
FT   CDS_pept        complement(418847..420052)
FT                   /transl_table=11
FT                   /locus_tag="lpp0368"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11516"
FT                   /protein_id="CAH11516.1"
FT                   /translation="MKRIFFVVFLLCLETACNTAKNNPLPAQLSDKALVPGFKEVRTEF
FT                   TRSDDPIIKKQSLERVKQLAKAYPDTMFHQKGSFSLLIISGGGDYGAFGAGLLNGWTKS
FT                   GSRPTFTTVTGISTGALIAPLAFAGPKYDATLKKVYTTITTKDVLSNKPVLWTLLTGGS
FT                   ALKGTKPLQDLIARHVDEKLLDDIAKGYYQGRRLYVGTSNLYSRKLVVWDMTRIAASKN
FT                   PERVQLFRKILLASASIPVVMPPVYFDVIANGKPYTEMHVDGSTTFAVFLSRLGSDIKT
FT                   AKKHFKLKQKPNVKIYVIRNNQNQFHYKVIKPKLLVIGKRAIESVTASQGAADVIFIYL
FT                   CALIEGVDFNLANVPNEFDSNSEELFDTQRMNQLYQIGYSKAVKGYPWQKIPPDVRALH
FT                   GD"
FT   CDS_pept        complement(420128..420661)
FT                   /transl_table=11
FT                   /locus_tag="lpp0369"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11517"
FT                   /protein_id="CAH11517.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   SPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAVCFFVVR"
FT   CDS_pept        complement(420658..421278)
FT                   /transl_table=11
FT                   /locus_tag="lpp0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11518"
FT                   /protein_id="CAH11518.1"
FT                   /translation="MQRLVWNFEFSSEQTTPLTTLGHDAQDNLKWEKRYFWPADQIIRL
FT                   NTIDSSLLDLANYQKKHKEDYYYLLPDSDHNIKQRRNELLYKPVIKQSGSVLGFGPKVH
FT                   LENTQTLSCHGDAGQLNRQELLKKIKEKGMVVFVKKEAFVFKFPTTPTVKLELARLEVK
FT                   DKVYFSACVEGRSLNLVETISVLLFGPQPSFEYVTFLKKTLKI"
FT   CDS_pept        421454..423892
FT                   /transl_table=11
FT                   /locus_tag="lpp0371"
FT                   /product="hypothetical protein"
FT                   /note="similar to acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11519"
FT                   /protein_id="CAH11519.1"
FT                   /translation="MAIVFFLIYLAFTLVVLSRRINPLVWEIGSIIYLIPATFYFGFPW
FT                   IIGLFIWFFIIAAVLVVRVEPLRLFIGDYLYKTAGKSVPKLSKTEEEALNAGDTWLEQD
FT                   IFTGKPDWQRLSAVSTDLTAEEQAFLDNETHTLCSMLDEWEISQEYDLSPKVWNYIKEK
FT                   GFLGLVIPKEFGGKGFSARAHSDIVMKIATRSRVAAVTVMVPNSLGPGELINYYGTDEQ
FT                   KAYYLPRLAKGVEIPCFALTEPGAGSDATSIQSEAIVVKKKIDGKSVLGLNITLDKRWI
FT                   TLAPVATLIGLAVNLKDPDGLLKGEGEEGITCLLIPRDTENLEIGNRHLPADQPFMNGT
FT                   LRGKDIFVPIDTIIGGQKKAGSGWQMLVECLSIGRSISLPALGAGSSSISYLTTGAFAR
FT                   IRRQFNVEIAQFEGVEEKLAEIAGLNYLINSTRLLTVAAVNEHKKPSVASAITKYFNTE
FT                   LARITVNASMDVHAGRAIVVGPRNYLNSLYQSVPISITVEGANIMSRNLLIFGQGSMAC
FT                   HPFIRDEFYAISSENKEAFREIIWKHIHYFMQNFAKTICSAWTSGLFIAVPENSMKREY
FT                   KKLARLSYAYSWLADLSLIYLGGDLKRKERLSARLADGMSYLYMAMAALRNVQLNQDHP
FT                   DEQLHARWAVSYCFYHAQKSMIALCHNFPSKFLGFIARVVAFPFGQTMRYPSDKLDHQL
FT                   ARLMTGNNHYRDRLKKSVFLSGDSKQPVDRMEHALQLIIEADGLSKKVSDLKRYKWSKL
FT                   KEKLKEKVESGQLSQQEMEELLAVEDARWDAILVDEFTFDSMKKKTLHSVIEKMKSPLA
FT                   "
FT   CDS_pept        424006..424698
FT                   /transl_table=11
FT                   /locus_tag="lpp0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11520"
FT                   /protein_id="CAH11520.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTKAKLLPE
FT                   CNDMLEKIKEYAQFVKFKLLSSAQVWSGQERPTSDYQNTQENKAEFLASHLEGLPSGLK
FT                   LEVAIGDDAKILRGFSSNGKMVEGDQLKTMDGLLEGWLAKNGLAISGGAVVKIDNTGNQ
FT                   IKVDPQEIRQLINDSEKGVAKYFADKGVSMEVAQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
FT   CDS_pept        complement(424735..425397)
FT                   /transl_table=11
FT                   /locus_tag="lpp0373"
FT                   /product="hypothetical protein"
FT                   /note="similar to nucleotidyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11521"
FT                   /protein_id="CAH11521.1"
FT                   /translation="MKTAMILAAGRGERLRPLTDKIPKALCTVRNKPLIEHHIINLANA
FT                   GFERLIINHAYLGGQIRQYIGNGKQWGLNVIYSPEPPGGLETGGGIVNALPLLGEEPFL
FT                   TVNADIYTDFDFAKLRLKNIDTFHLLLIPKNPSLLHHGDFGLINGSHLTNTNQAYTFSG
FT                   IACYNPKVFANCRQGRYSVTPLLRKYVEQNSATGSVHSGIWYDIGSFDRLQAANQLT"
FT   CDS_pept        complement(425394..426371)
FT                   /transl_table=11
FT                   /locus_tag="lpp0374"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11522"
FT                   /protein_id="CAH11522.1"
FT                   /translation="MHERENALKEWLAQTIQEKDFVLLPLAGDASFRRYFRIQYNGLTQ
FT                   VVMDAPPEKENIEPFLHIANVLDKVKIPVPDILAINKREGFLLLSDLGDQLLLNKLNHE
FT                   TVDNYYSQAMNLLLQIQKCPTGDPELPLFDKGFMLKEMNLCLEWFLKAYLSLDLKQDEL
FT                   QLFQHTIEWIASEVATQPRVFIHRDYHSRNLMLVKNKDSCLATIDFQDAMLGPVTYDLV
FT                   SLLKDCYISWPREKVLEWITYFHEKCPHANIYSLTDFIRAFDLCGLQRHLKVLGVFCRL
FT                   YLRDNKAGYLRDLPLTLKYALECAETYEELHPFFNFLQKRVYLP"
FT   CDS_pept        426614..429133
FT                   /transl_table=11
FT                   /locus_tag="lpp0375"
FT                   /product="hypothetical protein"
FT                   /note="Similar to organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11523"
FT                   /db_xref="GOA:Q5X878"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X878"
FT                   /protein_id="CAH11523.1"
FT                   /translation="MAIGITACVLSLINYQGLAYSAALINEPIQACVIAREVDLTDDIR
FT                   TKFAQCLGWQADQSSPVCLGFYKPITVTPLASPDEVRILADTASFYRTQRSTLSGHVEM
FT                   QQGQRVVNAQTAYVYRDPKTNEVTKIEFLNHVRYLEPDRMMIARKAVVYPQDKSGEVED
FT                   VLYRFNTNRSNALLPAWGRASLIKRFANQDYFLKEATYTTCAPQDKAWAIEAESISIDN
FT                   EKGKGIARNAKLRIHEWPVLYTPYLSFPTNRDRKSGFLMPIVGYSNVGGADLGIPYYWN
FT                   MAPNYDMTLVPHLYTKRGLMLGGQFRYLTSKSTGTFNGNFLPKDKAFGRFLQDNEVEFP
FT                   QIRGLSTNRWEVNFVDSTQFLSDLQLNVNFQQVSDDYYLQDFSTNLASVTQRQLLRQAD
FT                   LTYTTENWTFRGMGQSYQTLHPINEIPVSPVYERLPQLMARGYYDDLPFNANFNILGQY
FT                   DQFHWPNDSWNIALNNMPQGPRFHLNPILSVPMMKPWGYVTPSVQFVENYYDISRNYTW
FT                   GTSRANYNLTIPRYSLDGGLYFERDLHLKGTYYIQTLEPRLFYLRVPYYNQTLIPVYDS
FT                   GFMIFNVDQLFRTNRFSGFDRIGDANQLSYALTTRWLEDESGAEKANFSIGQIKYFSER
FT                   RVQLCQSPTGFCTDNPDTFGNLSSTFGTSPVASRAVYKFNPAWGITGDYIWDPATRATN
FT                   NADLNLHYQPARNAIINGGYSYLVNGDVTQVRNNDTENNALHQAILSAAWPLSEKWSGI
FT                   GAYSYNISKNYSMMSFLGVQYDSCCWAMRILGGRTFRSLNEEFEPRYNNNIYLQILLKG
FT                   LGSVASSDPSGILNTYIPGYYDPFRRR"
FT   CDS_pept        429309..430598
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="lpp0376"
FT                   /product="hypothetical protein"
FT                   /note="Similar to peptidyl-prolyl cis-trans isomerase SurA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11524"
FT                   /db_xref="GOA:Q5X877"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X877"
FT                   /protein_id="CAH11524.1"
FT                   /translation="MFKRIALVCALFSGICFAEGKQLLDKVVAIVNDNVITSSELNAQV
FT                   ELSKKQIIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAA
FT                   SNHLNLSQMRDEITKQGISWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVEQYLKNA
FT                   GRIENSNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNKIKKGEDFSRLAIEESSGE
FT                   FALEGGDLGERHLAELPEVFAKEVVHMKVGQVAGPIRAGNGFHLIKLVAVGGENQRHVI
FT                   TQTHVRHILLKPDASMVPSEAIKQVNNIYRQIQSGKDFALMAKQYSLDAASAVKGGDLG
FT                   WVNPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFL
FT                   QQRKFVEAVQNWQQHLRSQAYINIVDKDLA"
FT   CDS_pept        430595..431569
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="lpp0377"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase
FT                   PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11525"
FT                   /protein_id="CAH11525.1"
FT                   /translation="MNPLLISSGEPAGIGPDLCLALAETNLPVVILGDLSLLEARASEL
FT                   NLSIKFLEYGPHQSFEKKAGYLTVWPVPCAAPVISGELNPQNAAYVIELLTLGASLCSK
FT                   GEFSALVTAPVHKANINAAGITFTGHTEFFADFFEVETVVMMLACSHMKVALVTTHLPL
FT                   RMVPDAINSLLIIKVIQQLHHSLKHDFGIQSPKINVAGLNPHAGESGYLGREEIEIITP
FT                   ALNTLKNQGIDVLGPLPADTMFITNNINHCDAYVAMYHDQGLPVLKYAGFNEAVNITLG
FT                   LPIIRTSVDHGTALELAGKNKANPGSMLAAVKMAKDMALTRIK"
FT   CDS_pept        431571..432062
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="lpp0378"
FT                   /product="dihydrofolate reductase FolA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11526"
FT                   /protein_id="CAH11526.1"
FT                   /translation="MSLISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMG
FT                   RKTYESIGKPLPGRLNIVISQSIQSIPGVVVVDSLGQAIKETADASEVMIIGGAKIYSQ
FT                   AISIANRLYITRIHHQFMADVFFPKINELVWSCRSKEYRQHDNKNQYDMTFCIYERISI
FT                   "
FT   CDS_pept        complement(432069..432614)
FT                   /transl_table=11
FT                   /locus_tag="lpp0379"
FT                   /product="hypothetical protein"
FT                   /note="similar to eukaryotic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11527"
FT                   /protein_id="CAH11527.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCKAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
FT   rRNA            432907..434415
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            434519..434594
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 88.89"
FT   rRNA            434761..437543
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            437764..437889
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            437987..438062
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 94.56"
FT   tRNA            438135..438219
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 73.58"
FT   tRNA            438240..438313
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 82.65"
FT   tRNA            438366..438441
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 90.41"
FT   regulatory      438463..438468
FT                   /gene="tufA"
FT                   /locus_tag="lpp0380"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        438476..439666
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="lpp0380"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11528"
FT                   /db_xref="GOA:Q5X873"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X873"
FT                   /protein_id="CAH11528.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   tRNA            439728..439803
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 82.4"
FT   CDS_pept        439817..440188
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="lpp0381"
FT                   /product="Preprotein translocase secE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11529"
FT                   /protein_id="CAH11529.1"
FT                   /translation="MKSSNENQGKMKDIMSWLAIILATAGAFVCTYYYTFTGPIQSIIW
FT                   LAWLILILFLGYLTTTGKRVFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFI
FT                   LWGVDSIMMWAIAKLTHLG"
FT   CDS_pept        440191..440739
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="lpp0382"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11530"
FT                   /protein_id="CAH11530.1"
FT                   /translation="MVEENKAKQWYVVHAYSGYENFVMREITSRAKHHNLEDKIGEVVV
FT                   PSEEVVEMRSGQKRKSTRKFFPGYVLVHMVMDDQTWHMVRGIPRVLGFIGGTSQTPTPI
FT                   SDKEAQAIMQRVEDGVTKPRPKILFEPGEVIRVKEGPFVDFNGVVEEVNYEKNRLRVAV
FT                   LIFGRSTPVELEFSQVEKT"
FT   CDS_pept        440849..441283
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="lpp0383"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11531"
FT                   /db_xref="GOA:Q5X870"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X870"
FT                   /protein_id="CAH11531.1"
FT                   /translation="MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAA
FT                   TQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVS
FT                   QLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE"
FT   CDS_pept        441293..441988
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="lpp0384"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11532"
FT                   /db_xref="GOA:Q5X869"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X869"
FT                   /protein_id="CAH11532.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
FT   regulatory      442147..442152
FT                   /gene="rplJ"
FT                   /locus_tag="lpp0385"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        442161..442694
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="lpp0385"
FT                   /product="50S ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11533"
FT                   /db_xref="GOA:Q5X868"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X868"
FT                   /protein_id="CAH11533.1"
FT                   /translation="MTLNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEA
FT                   RKSGVYLRVVRNTLTRRAFKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFE
FT                   KLEIRALSVGGKVYNANQIDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLAR
FT                   TLAAVKDKKAGNPA"
FT   CDS_pept        442725..443105
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="lpp0386"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11534"
FT                   /db_xref="GOA:Q5X867"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X867"
FT                   /protein_id="CAH11534.1"
FT                   /translation="MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAP
FT                   AAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGV
FT                   SKDEAASIKKELEEAGATVEVK"
FT   regulatory      443130..443153
FT                   /gene="rplL"
FT                   /locus_tag="lpp0386"
FT                   /regulatory_class="terminator"
FT   regulatory      443184..443189
FT                   /gene="rpoB"
FT                   /locus_tag="lpp0387"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        443197..447303
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="lpp0387"
FT                   /product="RNA polymerase B-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11535"
FT                   /db_xref="GOA:Q5X866"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X866"
FT                   /protein_id="CAH11535.1"
FT                   /translation="MAVAEAKPQYSHAEKKRFRKSFGKQTDIMPIPNLLEIQLKSYRDF
FT                   LQTDTKLSEQLNTGLHAAFSSVFPIESFSGNARLEYVGYKLGEPAFDVRECKLRGLTYS
FT                   APLRVKIRLVVLDKDASDDPKPIKDIREQDVFMGEIPLMTDVGTFVVNGTERVVVSQLH
FT                   RSPGVIFEHDKGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVYVRIDRRRKLPVSIL
FT                   LRALGYEAEDILSEFFETTRCHLKNGEYHIDLIPQRLRGEIASFDIHVPETGELIVEQG
FT                   RRITARHIKQMEKSQMQDLVVPRDYLIGKTLAKNIIDTSTGEFLAQANDEITEELLDAM
FT                   ANHGILQIDMIYTNDLDHGSYISDTLKIDPTGSQLEALVEIYRMMRPGEPPTKEAAEAL
FT                   FKNLFFVEERYDLSAVGRMKFNRRVGIKSDEGPGTLTKEDILSVIKTLIDIRNGIGMVD
FT                   DIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVESENLMPQDLINAKPVSAAI
FT                   KEFFGSSQLSQFMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPI
FT                   ETPEGPNIGLINSLSVYARTNEYGFIETPCRKVVNGRVTDEVEYLSAIEEVDQYIAQSN
FT                   VELDAQGNILADLVPCRHQNEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPTLRSEKPLVGTGMERIVASDSGVSVVAKRGGVIDLVDASRIVVRVND
FT                   DETTAGETGVDIYNLTKYFRSNQDTCINQRPIVSTGDRIQRGDVLADGPCTDMGELALG
FT                   QNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIARDTKLGTEEITADIPN
FT                   VGESALSNLDESGVVYIGAEVKAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKD
FT                   SSLRVPSGMNGTVIDVQVFTRDGLEKDARAKSIEEEHLARVRKDLIDERRIREEDIYHR
FT                   VSHLLLDKVATGGPGSLKPGSKITQDYLDKVEREKWFDIRIEDDAVSQQLEQLSKQLEL
FT                   LTKEMEKRFNDSRKKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIV
FT                   VPVEDMPHMEDGTAVDIVLNPLGVPSRMNIGQVLETHLGLAAKGLGRKIAQMLDERQTP
FT                   EAIKAYLEKIYNHDGVQRVNLKCLNDDELMTLADNLRAGVPMATPVFDGATEQEIKSML
FT                   QLADLPADGKTVLIDGRTGNKFDNTVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVGGRTKIYKNIVDGDHRMDP
FT                   GMPESFNVLLKEIRALGIDIELEHD"
FT   CDS_pept        447392..451597
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="lpp0388"
FT                   /product="RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11536"
FT                   /db_xref="GOA:Q5X865"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X865"
FT                   /protein_id="CAH11536.1"
FT                   /translation="MSDLLGILKQQGQSEEFDAIKIALASPELIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKTFGPVKDYECLCGKYKRLKHRGVICEKCGVELALAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFEAFVVVDPGMTELERGQLLNDE
FT                   AYLDAMEQYGDEFDARMGAEAIRDLLRQIDLEDEIRNLREELPTTNSETKIKKITKRLK
FT                   LLEAFYESGNKPEWMIMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLNAPDIIVRNEKRMLQESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKKMALELFKPFIFSKLEFRGLATTIKAAKK
FT                   MVEREESVVWDILDDVIREHPILLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARSLMMSTNNILSPASGEPIIVPSQDVVLGLYYLTREK
FT                   VNALGEGKIYSSAQEAQNFYEAGHLDIHAKIKIRMPKEDGETGYHLVETTVGRAILAEI
FT                   LPKGMPFDYINRTMTKKVISKVIDSCYRKFGLKETVIFADQLMYTGFKYATRSGASIGI
FT                   EDMEIPDDKSSIIEHADNEVREIESQFRSGLVTNGERYNKVIDIWSRTNELVAKSMMSK
FT                   IATEEVTDAKGNKVRQESFNPIFMMADSGARGSAAQIRQLAGMRGLMAAPDGSIIETPI
FT                   TANFREGLNVFQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVITEDDCGTDT
FT                   GILMQPLIEGGDIVEPLHERVLGRVVASDVYIPTQTEPVVKAGTLLDEEWVEKLEKHGV
FT                   DQVMVRSPITCQTRFGLCAKCYGRDLARGHLVNTGEAVGIIAAQSIGEPGTQLTMRTFH
FT                   IGGAASRATAANNIQIKTKGVIRLHNIKTVTHENKNLVAVSRSGEVTIVDEFGRERERY
FT                   KVPYGAVISAQDNSPVEAGQVIATWDPHTHPVISEVSGRLKFVDLIDGITMNRQTDELT
FT                   GLSNIVIIDAKQRSAAGRDLRPMVKLVTDEGDDIYLAGTNVPAQYYLPVDAIVNFEDGS
FT                   LVGIGDVIARIPQERSKTRDITGGLPRVADLFEARKPKDSAVMAEVSGLVNFGKETKGK
FT                   RRLIINVSEDQCHEELIPKWRHISVFEGEHVERGEIIAEGALNPHDILRLLGVGALANY
FT                   IVNEVQDVYRLQGVKINDKHIEVIVRQMLRKRVITFAGDSKFLVGEQVEESAMLQENDK
FT                   LLAEGKQIARGTPILLGITKASLATESFISAASFQETTRVLTEAAVSGKVDELRGLKEN
FT                   VMVGRLIPAGTGYTYHQSRKAKRARAAAGGDSSATHTVTASDVEHALSEALNADNHEH"
FT   regulatory      451696..451701
FT                   /gene="rpsL"
FT                   /locus_tag="lpp0389"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        451711..452091
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="lpp0389"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11537"
FT                   /db_xref="GOA:Q5X864"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X864"
FT                   /protein_id="CAH11537.1"
FT                   /translation="MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKP
FT                   NSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVNDRKQGRSKYGTKKPKDKK"
FT   regulatory      452100..452105
FT                   /gene="rpsG"
FT                   /locus_tag="lpp0390"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        452112..452639
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="lpp0390"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11538"
FT                   /db_xref="GOA:Q5X863"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X863"
FT                   /protein_id="CAH11538.1"
FT                   /translation="MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYG
FT                   ALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQ
FT                   VPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMA
FT                   KANQAFAHFRWN"
FT   CDS_pept        452654..454738
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="lpp0391"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11539"
FT                   /db_xref="GOA:Q5X862"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X862"
FT                   /protein_id="CAH11539.1"
FT                   /translation="MATPLKLYRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGA
FT                   ATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVL
FT                   DGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGST
FT                   PVVLQLPIGAEEEFKGVIDLIKMKAIHWDEENKGMTFKYVDIPADLKATCEEYRAHIIE
FT                   AAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVI
FT                   EYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILK
FT                   SGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKV
FT                   VILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMG
FT                   ELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKI
FT                   EPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFH
FT                   EVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQ
FT                   GMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAIIKKQ
FT                   "
FT   regulatory      454745..454750
FT                   /gene="tufA"
FT                   /locus_tag="lpp0392"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        454759..455949
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="lpp0392"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11540"
FT                   /db_xref="GOA:Q5X873"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X873"
FT                   /protein_id="CAH11540.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   CDS_pept        455955..456272
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="lpp0393"
FT                   /product="30S ribosomal subunit protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11541"
FT                   /db_xref="GOA:Q5X860"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X860"
FT                   /protein_id="CAH11541.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
FT   regulatory      456294..456299
FT                   /gene="rplC"
FT                   /locus_tag="lpp0394"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        456307..456957
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="lpp0394"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11542"
FT                   /db_xref="GOA:Q5X859"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X859"
FT                   /protein_id="CAH11542.1"
FT                   /translation="MMIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDG
FT                   YSAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFT
FT                   AGQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKM
FT                   AGHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
FT   CDS_pept        456957..457562
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="lpp0395"
FT                   /product="50S ribosomal subunit protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11543"
FT                   /db_xref="GOA:Q5X858"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X858"
FT                   /protein_id="CAH11543.1"
FT                   /translation="MEITTIDTKSKLKLNKEIFAYTYNEGLVHQAVVTFMNNARSGNSA
FT                   QKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTFASKKRDYSQKLNKKMYKRA
FT                   LRSIISELCRTGNLMVVSDFQCDNHKTKDFLKKMNQMEISNALIIMSEVGENEYLGSRN
FT                   LIDYDICDVTTIDPVSLLRFEKVVVTEAAIKKIEEQLQ"
FT   regulatory      457546..457551
FT                   /gene="rplW"
FT                   /locus_tag="lpp0396"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        457559..457855
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="lpp0396"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11544"
FT                   /db_xref="GOA:Q5X857"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X857"
FT                   /protein_id="CAH11544.1"
FT                   /translation="MNAERLMMVLREPHTSEKATVMADKFKQFTFKVLKNATKTEIKLA
FT                   VEHIFNVKVKSVSVVNVKGKSKRFKQTSGKRSDWKKAFVSLHADQDIDFTVTE"
FT   regulatory      457855..457860
FT                   /gene="rplB"
FT                   /locus_tag="lpp0397"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        457867..458694
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="lpp0397"
FT                   /product="50S ribosomal subunit protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11545"
FT                   /db_xref="GOA:Q5X856"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X856"
FT                   /protein_id="CAH11545.1"
FT                   /translation="MALLKSKPTSPGKRGEIRVVHHDIYKGKPHAALVEKLKKTGGRNN
FT                   QGRITVRHIGGGQRQKYRIIDFKRNKDGILGRVERLEYDPNRTALIALISYKDGEKRYI
FT                   IAPSNLEVGATIQSGADSPISVGNCLPLKNIPVGTTIHCVEMKPGKGAQMLRSAGCSGQ
FT                   LVAKEGVYATLRLRSGEMRKIHVLCRAVIGEVSNSEHNLRALGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGLPTKGYKTRSNKRTDTFIVRGRKKK"
FT   regulatory      458700..458705
FT                   /gene="rpsS"
FT                   /locus_tag="lpp0398"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        458713..458991
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="lpp0398"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11546"
FT                   /db_xref="GOA:Q5X855"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X855"
FT                   /protein_id="CAH11546.1"
FT                   /translation="MARSIRKGPFIDHHLISKVEAAIESKSKKPIKTWSRRSTIVPEMI
FT                   DLTIAVHNGKDHVPVFITDNMVGHKLGEFAMTRTFKGHSGDRKAKGK"
FT   regulatory      458990..458995
FT                   /gene="rplV"
FT                   /locus_tag="lpp0399"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        459001..459336
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="lpp0399"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11547"
FT                   /db_xref="GOA:Q5X854"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X854"
FT                   /protein_id="CAH11547.1"
FT                   /translation="MEVTAKLKGAPLSAQKGRLVADMIRNMNVSGALDVLKFTPKKGAK
FT                   LMLKLLESAIANAENNNGADIDDLKVGMVCVDEATTLKRISPRAKGRANRICKRTCHIT
FT                   IKVSDEE"
FT   CDS_pept        459339..459995
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="lpp0400"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11548"
FT                   /db_xref="GOA:Q5X853"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X853"
FT                   /protein_id="CAH11548.1"
FT                   /translation="MGQKVNPIGIRLGIIKDWNSKWFAGKRYAEFLIQDIKLRNDLKKK
FT                   LMAAAVSKILIERPANNAVVTILTARPGVIIGKKGGGIETLRKEISDNLGVPVHLNIEE
FT                   VKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKAGAKGIKICVSGRLGGAEIAR
FT                   SEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIFKGEILPQKKRSTESAQ"
FT   CDS_pept        460012..460425
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="lpp0401"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11549"
FT                   /db_xref="GOA:Q5X852"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X852"
FT                   /protein_id="CAH11549.1"
FT                   /translation="MLQPKRTKYRKQMKGRNRGLALRGSKISFGEFGLKAVERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLF
FT                   EMEGVSKELAMEAFDLAKAKLPFKVMFEERTVM"
FT   regulatory      460411..460416
FT                   /gene="rpmC"
FT                   /locus_tag="lpp0402"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        460425..460619
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="lpp0402"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11550"
FT                   /db_xref="GOA:Q5X851"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X851"
FT                   /protein_id="CAH11550.1"
FT                   /translation="MKKIDELRNMSVEELQNELLSLRKDQFNLRMKKASGSLDKTHLIT
FT                   MVRKSVAKVKTILTEKAGK"
FT   regulatory      460607..460612
FT                   /gene="rpsQ"
FT                   /locus_tag="lpp0403"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        460621..460875
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="lpp0403"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11551"
FT                   /db_xref="GOA:Q5X850"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X850"
FT                   /protein_id="CAH11551.1"
FT                   /translation="MSTNSESNARTMIGKVVSDKMDKTIVVMIERTVKHPKYGKIMKRR
FT                   TKLHAHDENQVCRVGNTVKIRESRPLSKTKSWVLVEVIS"
FT   CDS_pept        460964..461329
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="lpp0404"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11552"
FT                   /db_xref="GOA:Q5X849"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X849"
FT                   /protein_id="CAH11552.1"
FT                   /translation="MIQMQTVLEVADNSGARKVMCIKVLGGSHRRYARVGDVIKVSVKD
FT                   AIPRSKVKKGAVMRAVVVRTAQGVRRDDGSLIRFDDNAAVLLNNQNEPIGTRIFGPVTR
FT                   ELRERFMKIISLAAEVL"
FT   CDS_pept        461342..461671
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="lpp0405"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11553"
FT                   /db_xref="GOA:Q5X848"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X848"
FT                   /protein_id="CAH11553.1"
FT                   /translation="MKRIKSGDEVIVIAGKSKGHIGKVLRVVDDAVVVEGGNLIKKHIK
FT                   PNPQKPENKGGIIAREAPLHVSNVAHYNPVTKKADKVGFKYLESNGVSKKVRYYKSNNE
FT                   IIDRI"
FT   CDS_pept        461687..462238
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="lpp0406"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11554"
FT                   /db_xref="GOA:Q5X847"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X847"
FT                   /protein_id="CAH11554.1"
FT                   /translation="MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVG
FT                   DKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLI
FT                   SITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTN
FT                   EEAKALLEAFNLPLKDKDRK"
FT   regulatory      462240..462245
FT                   /gene="rpsN"
FT                   /locus_tag="lpp0407"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462251..462553
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="lpp0407"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11555"
FT                   /db_xref="GOA:Q5X846"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X846"
FT                   /protein_id="CAH11555.1"
FT                   /translation="MAKKSMLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQA
FT                   KLAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW"
FT   regulatory      462564..462569
FT                   /gene="rpsH"
FT                   /locus_tag="lpp0408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462576..462971
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="lpp0408"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11556"
FT                   /db_xref="GOA:Q5X845"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X845"
FT                   /protein_id="CAH11556.1"
FT                   /translation="MSMHDPIADMLTRIRNGQQAKHQQVTLVSSKLKEEIARVLKEEGY
FT                   IQDFFTETLPNGLKSITLKLKYYHGRPVIEFIKRISRPGLRVYKSYKDLHSIPGFGVAI
FT                   LSTSKGIMTHVSAKVKGVGGEVICEVA"
FT   regulatory      462977..462982
FT                   /gene="rplF"
FT                   /locus_tag="lpp0409"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462989..463528
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="lpp0409"
FT                   /product="50S ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11557"
FT                   /db_xref="GOA:Q5X844"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X844"
FT                   /protein_id="CAH11557.1"
FT                   /translation="MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQH
FT                   SKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKS
FT                   ISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKG
FT                   VKYAGEQIVRKEAKKK"
FT   regulatory      463528..463533
FT                   /gene="rplR"
FT                   /locus_tag="lpp0410"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        463539..463898
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="lpp0410"
FT                   /product="50S ribosomal subunit protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11558"
FT                   /db_xref="GOA:Q5X843"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X843"
FT                   /protein_id="CAH11558.1"
FT                   /translation="MNKQNARHRRGLKAKALIRKTGRSRLVVYRSGVHIYSQIVKSDQL
FT                   GDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKAAGITQVAFDRAGYKYHGR
FT                   VKALAEGAREAGLDF"
FT   regulatory      463898..463903
FT                   /gene="rpsE"
FT                   /locus_tag="lpp0411"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        463908..464414
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="lpp0411"
FT                   /product="30S ribosomal subunit protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11559"
FT                   /db_xref="GOA:Q5X842"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X842"
FT                   /protein_id="CAH11559.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
FT   regulatory      464405..464410
FT                   /gene="rpmD"
FT                   /locus_tag="lpp0412"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        464417..464602
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="lpp0412"
FT                   /product="50S ribosomal subunit protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11560"
FT                   /db_xref="GOA:Q5X841"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X841"
FT                   /protein_id="CAH11560.1"
FT                   /translation="MGKKIKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIR
FT                   GLVNEINYLLLVEESA"
FT   regulatory      464589..464594
FT                   /gene="rplO"
FT                   /locus_tag="lpp0413"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        464602..465036
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="lpp0413"
FT                   /product="50S ribosomal subunit protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11561"
FT                   /db_xref="GOA:Q5X840"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X840"
FT                   /protein_id="CAH11561.1"
FT                   /translation="MNLNTLSPDPGSRPSRRRVGRGIGSGLGKTCGKGHKGQKSRAGGY
FT                   HKINFEGGQMPIQRRLPKMGFKSRVGRTIDEVSLGELAKLNDEVIDLVALRKAGLINNS
FT                   IKDVKVILSGELTAAIKLKGLRVTKGARSAIESLGGSIEE"
FT   regulatory      465015..465020
FT                   /gene="secY"
FT                   /locus_tag="lpp0414"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        465033..466367
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="lpp0414"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11562"
FT                   /protein_id="CAH11562.1"
FT                   /translation="MTMKNQKHNGSKPRGGLAELKSRLLFVVLGILVYRLGAHIPVPGL
FT                   DPAKLANFFSEQQNTIFGLFNMFSGGALSRVTVFAIGIMPYISASIIIQLFSVVSPKLE
FT                   QLKKEGESGRRKINQYTRYLTLLLSIFQSMGMARWLASQQIAMQPDFSFYFTAVVTLVT
FT                   GTMFLMWLGEQITEKGVGNGISLIIFSGIVSSMPNAIGSVLQQVKEGQMQALTLVIIAA
FT                   VVIVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAAQTSHLPLKINMSGVIPPIFASSII
FT                   LLPATLAQFFSQTKGLGWLSDVGMALSPGQPLYLIVYAAAILFFAFFYAALVFNPKDTA
FT                   DNLKKSGAYIPGIRPGEQTTKYIDSVMTRLTLVGAIYLVLVCLLPQILMYTWHVPFYFG
FT                   GTSLLIIVVVIMDFVAQVQAHLMTQQYDSLLKKANFRGTKLPGLL"
FT   CDS_pept        466384..466497
FT                   /transl_table=11
FT                   /locus_tag="lpp0415"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 50S ribosomal protein l36"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11563"
FT                   /db_xref="GOA:Q5X838"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X838"
FT                   /protein_id="CAH11563.1"
FT                   /translation="MKVRASVKRICRNCKIIKRSGTIRVICKDARHKQKQG"
FT   CDS_pept        466575..466931
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="lpp0416"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11564"
FT                   /db_xref="GOA:Q5X837"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X837"
FT                   /protein_id="CAH11564.1"
FT                   /translation="MARIAGVNIPDHKHVVIALTAIYGIGKTTSLKLCKTVDIDPSVKV
FT                   SQLSDAQLESLRTEIAKITVEGDLRRVVTMNIKRLMDLGCYRGLRHRRGLPLRGQRTKT
FT                   NARTRKGRRKGTSS"
FT   CDS_pept        466955..467353
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="lpp0417"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11565"
FT                   /db_xref="GOA:Q5X836"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X836"
FT                   /protein_id="CAH11565.1"
FT                   /translation="MAITKSKQQKTRKKVKRVVSDGIVHIHASFNNTIVTFTDRQGNAL
FT                   CWATSGGSGFRGSRKSTPYAAQVATERAAAVAKEYGMKSVAVFVHGPGPGRESTIRELI
FT                   TQDFKIVEITDVTGIPHNGCKPPKKRRV"
FT   regulatory      467359..467364
FT                   /gene="rpsD"
FT                   /locus_tag="lpp0418"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        467370..467990
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="lpp0418"
FT                   /product="30S ribosomal subunit protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11566"
FT                   /db_xref="GOA:Q5X835"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X835"
FT                   /protein_id="CAH11566.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTISVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
FT   regulatory      467994..467999
FT                   /gene="rpoA"
FT                   /locus_tag="lpp0419"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        468009..469001
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="lpp0419"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11567"
FT                   /db_xref="GOA:Q5X834"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X834"
FT                   /protein_id="CAH11567.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHDD
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
FT   CDS_pept        469020..469403
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="lpp0420"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11568"
FT                   /db_xref="GOA:Q5X833"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X833"
FT                   /protein_id="CAH11568.1"
FT                   /translation="MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEHELIRTTLPKAKDLR
FT                   RYIEPLITVSKSDSVASRRRAFNILRSKSAVGKLFTDLGPRFAKRPGGYIRIIKCGYRD
FT                   GDNAPMAIVELMDRPVSSDDTEE"
FT   regulatory      469437..469454
FT                   /gene="rplQ"
FT                   /locus_tag="lpp0420"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(469470..469949)
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="lpp0421"
FT                   /product="Single-strand binding protein (SSB)
FT                   (Helix-destabilizing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11569"
FT                   /protein_id="CAH11569.1"
FT                   /translation="MARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKDKTT
FT                   GEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEIVAS
FT                   DIQMLDSKGSSATNYDDMPSFQGSSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
FT   regulatory      complement(469958..469963)
FT                   /gene="ssb"
FT                   /locus_tag="lpp0421"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(470033..471400)
FT                   /transl_table=11
FT                   /locus_tag="lpp0422"
FT                   /product="hypothetical protein"
FT                   /note="putative transport protein, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11570"
FT                   /protein_id="CAH11570.1"
FT                   /translation="MKYSWNKTVFPIAAIFSFRLLGLFLLIPVFTLYATNLKGATPTLI
FT                   GLALGSYGLAQGLLQIPFGMLSDKLGRKPMIAIGLLLFAGGSLLGAVTHSIAGMITARI
FT                   LQGAGAIGSVLIALLADLTLDEQRTKAMAIVGITIGTSFSLAMIISPALTHYYGLSGVF
FT                   YLTAALAVLGIMILYLIIPNPSKEQFHADSEPSLSLIKPVVTDQQLQRLNFGIFCQHFI
FT                   LTATFFAIPMLLKYQIENGHLHQQWHFYLPLMLFSFILMVPFIIISERKKRLKTVFVIS
FT                   VLLTTFTQGLLVLTSQNWYWFCILMFVYFVSFNVLEATLPSLVSKLASPGSKGTAMGIY
FT                   STSQFLGIFFGGSLAGILYQWYDNQAIFLINMILSCLWLIISLSMKSNVYFSTLILPFT
FT                   ANNEESKLVVNQLLKVAGIKEVILSKDENTLYVRVDNEEYSTGSAEKILHQSTIYQ"
FT   CDS_pept        471562..472320
FT                   /transl_table=11
FT                   /locus_tag="lpp0423"
FT                   /product="hypothetical protein"
FT                   /note="similar to 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11571"
FT                   /protein_id="CAH11571.1"
FT                   /translation="MSSLVFSGKVGLITGGARGIGKATALKLAQSGCDIAIVYYNSSDE
FT                   AQSLVNEITGMGRKAVALQADVADCQSVKEMFSQFREHFKHLNFLVSNAASGVLKPALK
FT                   MSTKHWRWCLETNALALNHLVTEGLDLMPKNSRVIALSSLGASRAIPNYAFIGASKAAL
FT                   EALVRSLSLELASYGITVNTVSAGVVDTDALKHFPNREQLLDEYQAHALADRALTPEDV
FT                   ANAIYLLCLPEAAMINAHTLYVDAGYSQVG"
FT   regulatory      472378..472383
FT                   /locus_tag="lpp0424"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472391..472804
FT                   /transl_table=11
FT                   /locus_tag="lpp0424"
FT                   /product="hypothetical protein"
FT                   /note="similar to acyl carrier proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11572"
FT                   /protein_id="CAH11572.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
FT   CDS_pept        472804..473700
FT                   /transl_table=11
FT                   /locus_tag="lpp0425"
FT                   /product="hypothetical protein"
FT                   /note="similar to hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11573"
FT                   /protein_id="CAH11573.1"
FT                   /translation="MRFLFVDRIVQLSPGEWIKGIKHVTRDDAYLTTDDHGRLCFMPSL
FT                   IGETLGQLAAWNVMQHNHFTSRPVAGVVSSARLYRPAYVGETILLESYIDSLDEKAVQY
FT                   HSIAKAGNDIIFTIDGALGPMLPMTEFISTEVIRQQFAEIYRPGEWSSVLALSSPVLIE
FT                   ENCSDCGMINSSMQFDRILASEPGISLIAEKRITRSASYFPDHFPNRPVLPMTVLLECK
FT                   LNLAKEFIARAKYDRAYRISELRKIKMNEFVHPGDVVVCQVKVKQQMDDELILSYRCEV
FT                   DGKRVCVVDIVLIPKGK"
FT   regulatory      473688..473693
FT                   /locus_tag="lpp0426"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        473705..474997
FT                   /transl_table=11
FT                   /locus_tag="lpp0426"
FT                   /product="hypothetical protein"
FT                   /note="similar to 3-oxoacyl-[acyl-carrier-protein]synthase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11574"
FT                   /protein_id="CAH11574.1"
FT                   /translation="MKRRVAITGLGVVSPLGNDVSTTWNNLIAGHSGIDSIKQFDASAF
FT                   PTTIAAEVKNFSPDTSISGKHTRFIMSFTHFALEAARQAFEDASIFPTKQTSDRWGIVT
FT                   GSGMMTAEFEYLTRFQQTCAAGGEIDWGKLQSNSRDFYNLVDFGKTTSNSGLSLLIQQY
FT                   GITGYASSVHTACASGGQALGLAMQVIRRGEADFMLAGGFDSMINPLGLSSFCLLGALS
FT                   TYNETPQTASRPFDATRNGFVLGEGAAFLILEEWSKAKARGAKIYAELAGEGNSLSSYR
FT                   ITDSHPNGDGAIQAIKRALEDAGVQPRDVDYINAHGTSTKMNDLSETNAIKVVFGDRIA
FT                   NLPVSSTKSQTGHLIAAAGALEAVLSVKSIEQAQVPKTANLKTPDPECDLDYVVDGPRE
FT                   KSLGVVLSNSFGFGGSNSCLLFKHPEFEEAK"
FT   regulatory      474984..474989
FT                   /locus_tag="lpp0427"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        474998..476275
FT                   /transl_table=11
FT                   /locus_tag="lpp0427"
FT                   /product="hypothetical protein"
FT                   /note="similar to 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11575"
FT                   /protein_id="CAH11575.1"
FT                   /translation="MSQANRVFITGRSALTASGATADETWNAIISGQCGIDEIKFWELS
FT                   EWSHRLGGEIKDFQPSKMLPDRKLIKVISRQDIMGINAAVQAVEHSKMIAYRDSLAGAD
FT                   LFNEQTAIYVGSPGNKYFQQYDFIPLLAKTQGDMRSFANHLFDEVHPMWLLRILPNNVL
FT                   AYTGITYGFKGPNHNVTNHAVGGTQAILEAYHAIRSGQAERAVVVAYDIGTEPQGLFYY
FT                   EKLGVVSNRHLKPFDKEHDGTILAEGAAALVLESEASVKSRAATCYGEIVGGLSASEAT
FT                   GLFSIEADGQHLASLMGQTLSTSGINSEEIGLIVTHGNGNSKSDDSEALAIKSVFKQEE
FT                   VPATAFKWSMGHTLCASGVLDAVLTTYALETKCVPGIANFQQIAPTCEGLSVSREHREL
FT                   ISNSYAMMINRGFASMNVCLVIKACE"
FT   CDS_pept        476268..477113
FT                   /transl_table=11
FT                   /locus_tag="lpp0428"
FT                   /product="hypothetical protein"
FT                   /note="similar to lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11576"
FT                   /protein_id="CAH11576.1"
FT                   /translation="MNKLAQQIEALPITLAGRFIYRFLPYRRRLIFSNISQVYNDQLNE
FT                   YQKKRLAKAYYSHLAKSLKEALQLRFMSEKKLRAQVEVIGHEKMLAVVAQKKGVLVVTG
FT                   HFGNWEFAPLGGVLNFKEFKGQFHFIRRTLRFKFIERIMFKNYYQAGLNVIPKKNSLEQ
FT                   VCVALEQNHAVIFVLDQHASLVNRDGIAVEFFGKKAGTYRSLATISRHTGIPVIPAASY
FT                   RLPNGKHVLEFHDPIPWKDYDTTQESLYRNTLAYNQALEKIILAHPEQWNWMHKRWKLS
FT                   "
FT   CDS_pept        complement(477223..477528)
FT                   /transl_table=11
FT                   /locus_tag="lpp0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11577"
FT                   /protein_id="CAH11577.1"
FT                   /translation="MDERRKYFRLKNHGEINASLDNNPIEIVEISSNGAVVVKQKTDIP
FT                   KEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKNKT"
FT   CDS_pept        complement(477704..480394)
FT                   /transl_table=11
FT                   /locus_tag="lpp0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11578"
FT                   /protein_id="CAH11578.1"
FT                   /translation="MVDFDKPVSKNDILASLLLIADLNRPSLNQPLSWEQALKSFLSLN
FT                   DPLIKTEIFIKWLSQLNPDQLQSSPEIVLLLKHIVEQKLLPYTLKKILIQRENFTTSQI
FT                   NWLCNHCLIVAPDQTTLPDIIKLGSWSWLENHMKRNELLNFDLLKIAILNKDYLASINN
FT                   SKESQLDFIYALNANKFNYQQILELIALAQDSQIKSLLITCLLSKKEYLDNLKEKSFLA
FT                   HLNQSELHSPPRLNALIHQLNLSCLTVAQIELLQPEACVTLLCSIPHFHQLSEKQVEKI
FT                   LLKYPKPDMIAYWLNHYSSRPNAHFILAHLMNLVDVHVVDELNKMDSTKKETIIMNMVE
FT                   HLELFDPTHPLLINQNEEKRLITAIQRYLYGQHHDAYVTYIKLLVYKLLNRNYQFSPQA
FT                   MQLLICLNNLEEFKELNNKIAYLTNYYLRASAQSGDSSLFYNDSRINITSMTQLVQLAP
FT                   KIPTKSKEKSLLSSLFCGIKISESSVMTPTNDIPEHPLINKLIKSKRTVKSIDYFLMHY
FT                   KGDKQVLSKIINDYLSYYVQEGCTEIHRRSIYHLIVLMSLSDISASVREAIYTAFLDYP
FT                   ELHDEQINFSLFIYDAKRTIRHFGAQASEDSYARVIDLCEGALKKLNPNKHKEIISIAT
FT                   QALTEAKIELNFGENNGFIAQLISRLKRCWYYGWTGFFSPNPPTFVAAIDSPIKQSEKK
FT                   TSPLLQQRKYFTTKLETNLSIILDDIKSGYTQQKLNELIEALSMFSLQSNPKNELKIRQ
FT                   KLHRLFHFLLLESKNDLTLDAWLIKNQQLLIANRFRLLEMQLMKGARNEVESLLKEFDE
FT                   DSTHFSPITKEFTHSLPEQNPYKCESVSSNQTPGATILDSATELATSLKSTLGNLGVFF
FT                   SNNIMSAIYPNNKSTPQSTSTMISP"
FT   regulatory      complement(480400..480405)
FT                   /locus_tag="lpp0430"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(480705..481538)
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="lpp0431"
FT                   /product="Diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11579"
FT                   /db_xref="GOA:Q5X822"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X822"
FT                   /protein_id="CAH11579.1"
FT                   /translation="MGIKFTKMHGLGNDFIVLDGVNQSIQLTVKQIQKLANRHTGIGFD
FT                   QCLLIESSQTEGIDFNYRIFNADGQEVGQCGNGARCIALFARYYGLTAKNKLTVATKTT
FT                   LMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPEYSLELNNGNTVNLHAISIGNPHA
FT                   VLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYERGCGETIACGS
FT                   GAVAAAAIARLFYNLSDKITVHLPGGDLCIQWPCPTAPIILTGPAAFVYEGTLLS"
FT   CDS_pept        complement(481548..481676)
FT                   /transl_table=11
FT                   /locus_tag="lpp0432"
FT                   /product="hypothetical protein"
FT                   /note="putative lipopeptide"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11580"
FT                   /protein_id="CAH11580.1"
FT                   /translation="MRHIYFALLLIVVTQASLCLSACGQKGPLYLPEQEKKPTTNQ"
FT   CDS_pept        complement(481835..482212)
FT                   /transl_table=11
FT                   /locus_tag="lpp0433"
FT                   /product="hypothetical protein"
FT                   /note="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11581"
FT                   /protein_id="CAH11581.1"
FT                   /translation="MLFCFMSILFLARKLASDCGFIEQIQQSHNRNQINYRFYSPRTDL
FT                   HGSNTNRLYGSPGKGVISQNTIFIYWYRDGKNSYFIECSNRLPKKELEVLHQLLMDNQH
FT                   SLEEILEASNNRFLSFQTRHT"
FT   regulatory      482362..482367
FT                   /locus_tag="lpp0434"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        482375..483034
FT                   /transl_table=11
FT                   /locus_tag="lpp0434"
FT                   /product="hypothetical protein"
FT                   /note="similar to phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11582"
FT                   /protein_id="CAH11582.1"
FT                   /translation="MSVYMKEPLEKAQACVIWMHGLGADASDMMGLADQLTIEDTALRH
FT                   VFLDAPRRPVTLNGGMVMPAWYDIYGLGFVDEEDTSGIEQSELLIRKVVDAQYNCGFKP
FT                   HQIFLAGFSQGGAMALHTALHMTERLCGVIALSAYLPLAKHNKPQLDKNTPIFMGAGQF
FT                   DPLVLPKWTLQSKDWLLANGYNEVSFHQYPMEHSICFEEIKDLSLWLNKQVQGVLQ"
FT   regulatory      483019..483024
FT                   /locus_tag="lpp0435"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        483031..483465
FT                   /transl_table=11
FT                   /locus_tag="lpp0435"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11583"
FT                   /protein_id="CAH11583.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKG"
FT   regulatory      483440..483445
FT                   /locus_tag="lpp0436"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        483452..483724
FT                   /transl_table=11
FT                   /locus_tag="lpp0436"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11584"
FT                   /protein_id="CAH11584.1"
FT                   /translation="MVKVELVYIANSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
FT   CDS_pept        complement(483812..484126)
FT                   /transl_table=11
FT                   /locus_tag="lpp0437"
FT                   /product="hypothetical protein"
FT                   /note="similar to other protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11585"
FT                   /protein_id="CAH11585.1"
FT                   /translation="MRIMTFFICFILTLTLTQCASYDFSRRITQQGNLLPQSKIARLKT
FT                   GMSKNDVAILMGTSLMSPTFNNDRWDYAYTWRRGKGNLEIRNVVLYFSRGSLVKIEHKP
FT                   "
FT   regulatory      complement(484134..484139)
FT                   /locus_tag="lpp0437"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      484344..484349
FT                   /gene="fur"
FT                   /locus_tag="lpp0438"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        484354..484764
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="lpp0438"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11586"
FT                   /protein_id="CAH11586.1"
FT                   /translation="MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLES
FT                   GEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDE
FT                   IIEQRQKAIAERAHFKMTDHALNIYGICPQCQ"
FT   CDS_pept        484902..485045
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0439"
FT                   /product="hypothetical protein"
FT                   /note="similar to choline dehydrogenase (N-terminal part)"
FT                   /db_xref="PSEUDO:CAH11587.1"
FT   CDS_pept        485188..486258
FT                   /transl_table=11
FT                   /locus_tag="lpp0440"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11588"
FT                   /protein_id="CAH11588.1"
FT                   /translation="MHQKKRSSLELEALLSLFEGSLRTIPFNILAVVVLALGFIYTNEV
FT                   PIKLIIIWFFLILILSVIRWVTSRIIISKEFYTTKGKQSLIGFLLLNFLMGLAWSLSYF
FT                   IFSPYLNNTNELIFALILGGLSTGAIASLSIYLPAYYAYVLPMNFPIIAYNLYLFQFDK
FT                   TIFAVMYSLFLIIVLLTARLNSKLLSKVRVLSITDSLTGLFNRRHFDVVFNNELSRAKR
FT                   NKYPISLVFIDIDNFKYINDTFGHSAGDSFLIHVSNILKQTLRRSSDSMFRIGGDEYAA
FT                   ILINMTPNEVTTVCVSMQEQFNKKNQYKNVSLSMGVISIDSMRVIDQQSAITAADKTLY
FT                   QAKKAGKNQIKSKSLG"
FT   CDS_pept        complement(486569..486955)
FT                   /transl_table=11
FT                   /locus_tag="lpp0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11589"
FT                   /protein_id="CAH11589.1"
FT                   /translation="MKKWTVLAASSLLMVNAYANESFCGYKDFFHLGDKTHPGIYVVSG
FT                   YNDSDVVLQIVGPRSFVIRDGFDCRAGYAHVTVAYDNANWCVLDINDGPFMNHPVVSAS
FT                   CNGLRYINTTYDGFGSYSYSINIE"
FT   regulatory      complement(486965..486970)
FT                   /locus_tag="lpp0441"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      487202..487207
FT                   /locus_tag="lpp0442"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        487212..487811
FT                   /transl_table=11
FT                   /locus_tag="lpp0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11590"
FT                   /protein_id="CAH11590.1"
FT                   /translation="MYSSLFLKKDLGRLPEKVIFLDFDGTVALPARKENGEYDIQPDGS
FT                   IGATHLNKEKFRRLVQFAIHTDIPLYFLSGRPDLQSCVDLMTDFIASVDGFHSGIGGFK
FT                   KDSLFFISKMIIEEGKLVRKEITTKAQVIQSVHHEKYSYLPKESILLVDDIQEYLDPAQ
FT                   ELGYNTLLANPESLEHFDEVEKFIGVTLQKTIAFNT"
FT   CDS_pept        complement(487869..492140)
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="lpp0443"
FT                   /product="SdhA, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11591"
FT                   /protein_id="CAH11591.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTDFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKRLAESLKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVDPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGSLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPENLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQSNGVPYPELQDQNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLVQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   HDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLSYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   TESRAITPVSSIENNGTIELN"
FT   CDS_pept        complement(492303..493046)
FT                   /transl_table=11
FT                   /locus_tag="lpp0444"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11592"
FT                   /protein_id="CAH11592.1"
FT                   /translation="MNNLPPDIMKNIALLISCEHAVNTVPYEYQTLFEPHKNILESHRG
FT                   IDFGALEIAQSIHKNNHCSLFQATCTRLLVDCNRSINHPHCFSEITKNLSSDKKKKILD
FT                   EFYFPFRNRVMDHIHQLISQGLQVWHLSTHSFTPVMNNIIRTTDIGLLYDPRSNSEKIL
FT                   ARQWQKEIKILHPQLKVRMNYPYKGISDGFTTSLRKKYSHHEYIGIELEVNQKLVFHNH
FT                   SLDALKNTLPLSISNTIKAYQKSER"
FT   CDS_pept        complement(493027..494253)
FT                   /transl_table=11
FT                   /locus_tag="lpp0445"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11593"
FT                   /protein_id="CAH11593.1"
FT                   /translation="MVMSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLILRALAGHQVN
FT                   EIELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQHNLLLLPTGA
FT                   HPWMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSNEEEFCQLHNA
FT                   IRLILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIPEFIRTEREYQ
FT                   EQILEPMYRDIGPYDPEGILQYQWLNSRAAIPKFDMKAIEIRILDSQECVEADIAIAKA
FT                   INAILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHINNKKLLEQWQLPLQGMSV
FT                   NTIWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSCVNHDSLKQVYTQLAHC
FT                   LLRNEQFTP"
FT   CDS_pept        complement(494240..495694)
FT                   /transl_table=11
FT                   /locus_tag="lpp0446"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11594"
FT                   /protein_id="CAH11594.1"
FT                   /translation="MQTVIVTDDLDSWSFLSELAPIVHALEYLSGDEYHQNKSFRVINL
FT                   CRSYNYQSIGYYVSLLAQARDHKALPSVHSIQDVLNVSLSKLISQDTHEEIQHSLHDIK
FT                   GNEFVLSLYFGQNLAKRYATLAKQLHGLFPLPLIRFYLEKKKQWRIKTVVPLSLSDVPE
FT                   HHLEFMRQSAENYLSKKRVHQWRKKQRFHDLAILVDPSEPNAPSNKKALELFVSCGEEL
FT                   GLNVDIIDKNEAKAIAEYDALFIRATTSVNHYTYRVSRRAAQENLVVIDDPQSIIKCSN
FT                   KVYLAELLSSHQIMTPDTLFISKYDKELPKIEFPCVLKKPDSAFSHGVVKIDDEKSLQK
FT                   SLNQFFKNSDLVVVQPFIPTEFDWRIGILDNKALFACRYFMAKGHWQIYDWHCQEENKE
FT                   GDSETLPLHEVPEQIIKIALKSTRLIGDGLYGVDIKSHGNKYYVIEVNDNPNIDHGLED
FT                   KILGQNLYEQIMSVFLQRIRRKHGYV"
FT   regulatory      complement(494258..494263)
FT                   /locus_tag="lpp0445"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(495698..496411)
FT                   /transl_table=11
FT                   /locus_tag="lpp0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11595"
FT                   /protein_id="CAH11595.1"
FT                   /translation="MIDLIIQTQPDDETCGPTSLHAIYLYYGLDLPLNEIIQGVDKSLS
FT                   GGTLTPMLGKHALLHGFRTTVYIYNLNIFDLTWFHNGEVNNSFLMDKLEAQMKYKNDPY
FT                   ITKASLAYLDYLKLGGTIRSKSLNVDLLKNYFNKKIPILTGLSATYLYRSAREYFTPEG
FT                   KSVYDDIRGEPCGHFVVLCGYDVKKRLVIVADPHAENPLSHNNYYKVSINRLINSIMLG
FT                   VLTYDANLLIIEPKE"
FT   CDS_pept        complement(496606..497079)
FT                   /transl_table=11
FT                   /locus_tag="lpp0448"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11596"
FT                   /protein_id="CAH11596.1"
FT                   /translation="MSPLTQFKFFLWFFCHFKVALIGYLKPKLIQLTDNEIVVRLPLTR
FT                   RSRNHLHSMYFGALAVGADIAGGLHGFYHAKQAKCKVSLAFKSFQAQFLRRPESDVYFI
FT                   CTEGEVVKKMIEESKKSGERINKPIHIKAYINYLTHPEEIADFILELSLKVIK"
FT   CDS_pept        complement(497076..497627)
FT                   /transl_table=11
FT                   /locus_tag="lpp0449"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative hyperosmotically inducible
FT                   periplasmic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11597"
FT                   /protein_id="CAH11597.1"
FT                   /translation="MPKCMHFILATALIFVTSTFYASNLQEIEQEVSDSVITAKITAKF
FT                   AESRHLNPLKISIDTEKGIVTLSGYAPDKQAFIDALQIAKDTKGVKAVHAKDLHIKKVN
FT                   TAFTDAFITAEVETAVLKAKILDDESIPLVGINASTTNGEVTLSGHVKSAGSIAAIIKR
FT                   VNEIPGVKKIVTNLEIQENA"
FT   regulatory      complement(497636..497641)
FT                   /locus_tag="lpp0449"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(497886..498344)
FT                   /transl_table=11
FT                   /locus_tag="lpp0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11598"
FT                   /protein_id="CAH11598.1"
FT                   /translation="MKSLIKSLLFIVAFSINSSALYAANSNTRVIQWAQQTLIDTLSVS
FT                   YTTKSQDFATVRKNYSLNAWSGITGFLGGNMQSIREKQLTLHPVLLPDTQILSTGLYLG
FT                   MSYWIIRQSVAIDELNIKLTFTLTILGRSGAAGYPYIVQSLSILLNAL"
FT   regulatory      complement(498354..498359)
FT                   /locus_tag="lpp0450"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        498439..501294
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="lpp0451"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11599"
FT                   /protein_id="CAH11599.1"
FT                   /translation="MHTITIRGARTHNLKNLDLELPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDSIEGLSPAISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHTSLHAQTISQMVDQVLALPEDSKVMILAPVVRERKGEHV
FT                   QFLQQLQAQGYVRARIDGELYELDSPPKLGLRTKHTIEVVIDRFKVRPDLAQRLSESFE
FT                   NALNLADGLAIVSSMDGHFKELLFSSRFACSECGYSLSELEPRLFSFNNPVGACSSCDG
FT                   LGVDQFFDPSRVVHDATASLAEGAIRGWDRKTTYYFSMLESLARHYGFDTSTPFCDLSE
FT                   AMQQIVLYGSGREIIEFQYHRPHGGYMVKRHSFEGIIPNMQRRYRESDSGMIREELAKY
FT                   LSSRPCQSCQGARLREEARHVFIDNKNLPEITSYSIEQAYQFFKELKLSGYRGEIAAKI
FT                   NKEIVERLGFLVNVGLDYLSLARSAETLSGGEAQRIRLASQIGSGLVGVMYILDEPSIG
FT                   LHQRDNDRLLSTLMHLRNQGNTVIVVEHDEDAIRSADFVLDIGPGAGVHGGEVVASGSP
FT                   EEVMKNPASLTGQYLSGKKEIQIPKNRIPVNHDRMIHLKGVSCNNLQNVDVSIPLGLLT
FT                   CITGVSGSGKSSLINDTLYPIAANALNRASLMTIGEVKDISGLHLCDKVIDIDQSPIGR
FT                   TPRSNPATYTGLFTHIRDLFSGTPESRARGYQPGRFSFNIKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVSCDVCQGKRYNRETLEIHYKGKNIHEVLDMTVEDACAFFAAIPVIARKCQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRIKLARELSKRDTGNTLYILDEPTTGLHFHDTKQLL
FT                   TVLTRLREQGNTIVIIEHNLDVIKTADWIVDLGPEGGSKGGKIIATGTPEMVAENSRSF
FT                   TGQFLKQILSKSNELLLQKCK"
FT   CDS_pept        501477..502058
FT                   /transl_table=11
FT                   /locus_tag="lpp0452"
FT                   /product="hypothetical protein"
FT                   /note="similar to LemA from Coxiella burnetii"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11600"
FT                   /protein_id="CAH11600.1"
FT                   /translation="MKTFFIAILIIIALAFVWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKDAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
FT   CDS_pept        502069..503088
FT                   /transl_table=11
FT                   /locus_tag="lpp0453"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to C. burnetii heat shock protein
FT                   HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11601"
FT                   /protein_id="CAH11601.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYIFVGLIVDAF
FT                   VLQGMYPHASLENIIHALITFKVVPIATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEASYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
FT   CDS_pept        complement(503115..503888)
FT                   /transl_table=11
FT                   /locus_tag="lpp0454"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to ABC-type multidrug transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11602"
FT                   /protein_id="CAH11602.1"
FT                   /translation="MGFKYQLIALYTLVRREVVRMFRISSQVFLPPVITTTLYFLIFGS
FT                   LIGPRIGDIEGVDYSQFIAPGLIMMSVIINSYGNVSNSLFSVRFQKSIEEMLISPMHNG
FT                   LLLLGYVIGGVLRGLIVAILVFVISTFFLPVELDHLPMTLLVVVLVAAIFSLAGFTNAM
FT                   VARNFDDIMLIPTFILTPLTYLGGVFYSINMLPPFWQKISLFNPILYMVNALRHTMIDQ
FT                   EEVSITLAMIIIFLMLIALTVGNMILLKKGVGFRE"
FT   CDS_pept        complement(503878..504792)
FT                   /transl_table=11
FT                   /locus_tag="lpp0455"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11603"
FT                   /protein_id="CAH11603.1"
FT                   /translation="MHALEIKQLSKTYSNGVEALKGIDLTVNTGDFFALLGANGAGKST
FT                   TIGLITSLVNKTSGNIKIYGFDLDAYPEKAKSCLGLVPQEVNLNIFENCEQILLNQAGY
FT                   YGISRKKALPRAEALLEQLGLWDKRRSIVRHLSGGMKRRLMIARALIHQPKLLILDEPT
FT                   AGVDIEIRHSMWDFLARTNAEGTTIILTTHYLEEAEQLCKNIAIIDKGQIIKNTSMKAL
FT                   LQTLRHQTFIFNTENPIDYLPDIHPFNVTPIDPTTFELRVDNNFSLNEVFAVLTKQGIK
FT                   IHSMRNKTNRLEELFMDLIKNGI"
FT   CDS_pept        complement(504874..504975)
FT                   /transl_table=11
FT                   /locus_tag="lpp0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11604"
FT                   /protein_id="CAH11604.1"
FT                   /translation="MEEIRKAVTGKYPHTDDSSPESTPPSSPELTRW"
FT   regulatory      complement(504988..504993)
FT                   /locus_tag="lpp0456"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(505023..506042)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="PSEUDO:CAH11605.1"
FT   regulatory      complement(506051..506056)
FT                   /locus_tag="lpp0457"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(506168..506806)
FT                   /transl_table=11
FT                   /locus_tag="lpp0458"
FT                   /product="hypothetical protein"
FT                   /note="similar to prolyl/lysyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11606"
FT                   /protein_id="CAH11606.1"
FT                   /translation="MFNPDLIAHNICTQGFHIIDEFLEEAHYYSLRDMAYELKQQNLFR
FT                   NAKIGQNLQAQQNDKIRSDQIFWIDADSPYLPIQAYLKKLISLGNVLNQTMYLGLAEFE
FT                   THFAIYLPGTFYRKHIDQFESTKTRKISFVYYLNDTWQKEFGGELLLYNIEDELIQNIS
FT                   PLGNRFVCFDSQLPHEVHPTQRTRFSMTGWMKTRSTSVLADNKLTQITP"
FT   CDS_pept        complement(506892..507599)
FT                   /transl_table=11
FT                   /locus_tag="lpp0459"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11607"
FT                   /protein_id="CAH11607.1"
FT                   /translation="MHIQIDGIPIEILRKPIKNLNLRIYPPDGLVKVSVPLKYSEQLIK
FT                   QQLQEKSEWIRAQCERIRARSFYREPSLQTGATIPFKGKNYLLIVEEHHGPSQVLIKDE
FT                   LIYCYTKPDLTPQQKQNILERWYRKEMNLVIPRLIQQWEAIMKVKINQWGIKKMKTRWG
FT                   SCNPRAQRIWLNLNLIKKPLECLEYVLVHEMVHILEASHNKRFYALMAQFMPKWQEYQR
FT                   ILEGTPNANTFAR"
FT   CDS_pept        complement(507786..508067)
FT                   /transl_table=11
FT                   /locus_tag="lpp0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11608"
FT                   /protein_id="CAH11608.1"
FT                   /translation="MKNKLAISILLFLLPTAAAMANCDLTKFRWDCDLPVQVKPSPGAS
FT                   SLVYCGSSYGYITKQQYDILARYQRASVNMVLDINGEYIDSPCIGAER"
FT   regulatory      complement(508076..508081)
FT                   /locus_tag="lpp0460"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        508216..509079
FT                   /transl_table=11
FT                   /locus_tag="lpp0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11609"
FT                   /protein_id="CAH11609.1"
FT                   /translation="MLSSTKEYLQALRDGKYLLFLQWPKFIAEYYGKNDKNQEADEMVT
FT                   LLIFEWLNNGFCLDDIKKFAILYAVHEMESRPLREGLSYALTTISIALFPCMVYLTNNL
FT                   QEHYITSKKLSSKEVLQLMTMNNAYLEKQRFVEFLGQEQDKFFTWVKEADSSAVSKAFD
FT                   QIYSVTYLKYLIEDYLSLLESANLPNDQLKSSRISLVVRLAKYLHEQTELTQDVHDEIA
FT                   VYVKKLWEMQPAEFEEEFLKKISPLPFIDNTVRILTGLSARFFSILQPPSPPLNINSDT
FT                   DKNPKI"
FT   CDS_pept        complement(509180..509647)
FT                   /transl_table=11
FT                   /locus_tag="lpp0462"
FT                   /product="hypothetical protein"
FT                   /note="similar to methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11610"
FT                   /protein_id="CAH11610.1"
FT                   /translation="MNGKMLLVSIFNTPVGNLEVAHDEHFIFNASFTDKSGAPAQNQLA
FT                   HLIASELKAYFDDPHHRFQLPLKPQGSLFQQKVWNTLLVIPVGRTVTYGELATKLQSSP
FT                   RAVGQACKCNPLALFVPCHRVVGKHDLGGYMGNPNAISYKKNLLAHEAKMI"
FT   CDS_pept        complement(509651..510016)
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="lpp0463"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11611"
FT                   /db_xref="GOA:Q5X7Z2"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7Z2"
FT                   /protein_id="CAH11611.1"
FT                   /translation="MTNIIDQINAEQMQGKEIPDFNPGDTVLVQVKVIEGNRERLQAFE
FT                   GVVIAKRNRGLNSAFTVRKISHNVGVERVFQTYSPIVDSITVKRRGDVRRAKLYYLRNL
FT                   AGRAARIKEKLSGKKGD"
FT   regulatory      complement(509655..509660)
FT                   /locus_tag="lpp0462"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(510043..510795)
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="lpp0464"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to tRNA
FT                   (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11612"
FT                   /db_xref="GOA:Q5X7Z1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7Z1"
FT                   /protein_id="CAH11612.1"
FT                   /translation="MALHLGVITLLPEIIQGIHYGVTGRAIEQGLVKIDCWNPRDWSSR
FT                   PYKQVDDKPYGGGPGMVMMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQNDLKQIA
FT                   IQKQSLLFVAGRYEGIDERIINHHIDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLG
FT                   HLGSAEQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLGKTWLKR
FT                   PDLLEKIQLSETDKQLLAEFKCEHGDSC"
FT   CDS_pept        complement(510795..511304)
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="lpp0465"
FT                   /product="hypothetical protein"
FT                   /note="similar to 16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11613"
FT                   /db_xref="GOA:Q5X7Z0"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7Z0"
FT                   /protein_id="CAH11613.1"
FT                   /translation="MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFL
FT                   NKQWQPLKLLTIEVRSKAIIAQIEGYPERELVSALTNLDIGVQESQLAALAPGEYYWYQ
FT                   LIGMSVINSKGDLFGKVVEIMPTGSNDVLVVEGEKRHLIPYLPGQFVINIDESQQVITV
FT                   DWDMNF"
FT   CDS_pept        complement(511310..511570)
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="lpp0466"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to 30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11614"
FT                   /db_xref="GOA:Q5X7Y9"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7Y9"
FT                   /protein_id="CAH11614.1"
FT                   /translation="MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARG
FT                   QEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEHSKKSETAA"
FT   CDS_pept        complement(511657..513033)
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="lpp0467"
FT                   /product="hypothetical protein"
FT                   /note="similar to signal recognition particle protein Ffh"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11615"
FT                   /protein_id="CAH11615.1"
FT                   /translation="MFENLTERLTRTFKNLRGQGRLTEDNIQHALREVRLSLIEADVAL
FT                   PVIKEFIEQVKQKSLGQEVLTSLNPDQAFIKIVHDELIHVMGDERVELDYKTQPPAVFL
FT                   MAGLQGSGKTTSTAKLARYLKETENKKVMMASVDVYRPAAIHQLKVLAEQIDVAFFDSD
FT                   PNEQPIKIAQKALESARKQYVDVLILDTAGRLHVDEDMMSEIKSLHKAVNPIETLFVVD
FT                   SMTGQDAANTAKAFHEALPLTGVILTKTDGDARGGAALSVKQITGKPIKFIGSGEKIEA
FT                   LEPFHPERIASRILGMGDILTLIEEVERKADKQASEKLAKKLKKGKGFDLEDFKQQLLQ
FT                   MNNMGGISGMMSKLPGMGQLPKQAMQQVNDKAMAQTIAIINSMTPKERRIPKIIVGSRK
FT                   KRIALGSGTQIQDVNRLLKQFEQMQKMMKKFTKPGGMQKMMRGIGGMAGLKGMFPDDLK
FT                   "
FT   CDS_pept        complement(513290..513952)
FT                   /transl_table=11
FT                   /locus_tag="lpp0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11616"
FT                   /protein_id="CAH11616.1"
FT                   /translation="MPKAFTHLCKKVNLSLYNDTLTVYPKSSVLPKPIQIRSELDLLMV
FT                   LLFSQMDCNSAQVDQFFMMRSNELGVYRFIHRDDTDHDLYHQDEFSMDDNHYHAQFDKA
FT                   IDEIKLENILGILEKHSLISSEEHVSFIEAYHKANTLTEDMPKLETTLSSPLPISSPSV
FT                   HSGAKRPVVKEKEVDTPTTFAGLRVGFFLTSTKTTTKPLSRSHDDEKKIGTNRHEFN"
FT   regulatory      complement(513958..513963)
FT                   /locus_tag="lpp0468"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      514210..514215
FT                   /locus_tag="lpp0469"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        514226..515734
FT                   /transl_table=11
FT                   /locus_tag="lpp0469"
FT                   /product="hypothetical protein"
FT                   /note="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11617"
FT                   /protein_id="CAH11617.1"
FT                   /translation="MIYVLICIMLVCGLVVYQLMPKLLSYSTSLISKKQDTSELTHDGI
FT                   TNVLTQLGHPKFEGVCYGFTLNWALAVAQGKESFFYRQLHHLRTHQFGLPKTLQQIKEK
FT                   KERNQSLSNDEMVIDTLPQLGKKICVAQDPLQYKEKYRKLVWQPDINSILKAINADSSV
FT                   AKHIFYKTHSFLNQDEATEYLELLKRTGIREDVAVIISTADHAMGFKLAGNVWRFININ
FT                   DLYQQDKNKPYFEFSSRNLVKELYRVCAENLQGSRLTVNTDFVSVNPEEKLSRALQNVF
FT                   PVFPVRTKTSYPERLAFFSMAATQGDMNSVKKCIHSGWSIFSRQRLSDDSPILTAIYLG
FT                   RRDVVRAMLSTSRHRVNQKRKSDSSTLLHIACRYGGSGIVEDLLNIRGIKIDPQDNKGR
FT                   TPLMYACKKSVVTEDKKLFNLLFAKGASLSIKDNDGLTALDHALKNEHTLAIQMIEERL
FT                   EKEACAKENSTSRRFKFSETKGTLFQRGVKTISYQSQQPGFGMK"
FT   regulatory      516059..516064
FT                   /locus_tag="lpp0470"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        516071..517474
FT                   /transl_table=11
FT                   /locus_tag="lpp0470"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11618"
FT                   /protein_id="CAH11618.1"
FT                   /translation="MSNKKHSLTIFSLTMITVGSVDSIRNLPATALFGSQLIFYFILGA
FT                   LFFLIPTALVSAELASGWARQGGVYIWVKEAFGKKSGFLAIWLQWIENVIWYPTILSFV
FT                   AGTIGYLINPSLTTNPYFLWAVIVSCFWGATIVNLRGMKSSAMFSNICSLAGLLLPMSL
FT                   IIGLGAVWIAQGNPLQISFDMPSIVPHLSDKGMWVSLTAIILSFCGIEIATVHANDVKD
FT                   PQHAFPKALVYSVGIILSTLILGSLAIAVVLPQKDINLVAGIMQAFSAFFLKYHMDWMM
FT                   PVVAVMLVLGGLGGVSNWIIAPTKGLLVAAEEGNLPEVFQRTNGKGAPAMMLYTQATIV
FT                   TVLSALFLFMPSVNGSYWLLTALAAQLYMLMYLIMFVAAIKLRISQPQHPRPFKIPGGM
FT                   AGMLFVAGIGIIGVVTTLAVSFIPPEGINVGSATRYELTLIIGLLLMCAPPFITSWLQA
FT                   KEADLEPAV"
FT   regulatory      517449..517454
FT                   /locus_tag="lpp0471"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        517464..518054
FT                   /transl_table=11
FT                   /locus_tag="lpp0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11619"
FT                   /protein_id="CAH11619.1"
FT                   /translation="MLYNLARQVKFNNPSCLCNFQKMGYIDELLEELSARLPELEWKIN
FT                   GLSSSISIHNLPKGIFSSVIEFNGPACIKEIRDDIHALQKHKDESIACFLAERIQKKIN
FT                   VLVILCQMDKKNNKPESKISFDLTTLSTRQQWIKTMEENICALEEQHQAMRKTLEQMKS
FT                   CSNPATILHLQTELGNVEKRLTLAKETLNRAIS"
FT   regulatory      518244..518249
FT                   /locus_tag="lpp0472"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        518258..518599
FT                   /transl_table=11
FT                   /locus_tag="lpp0472"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11620"
FT                   /protein_id="CAH11620.1"
FT                   /translation="MSDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDK
FT                   KTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEA
FT                   LEAFEEFSK"
FT   CDS_pept        complement(518813..519256)
FT                   /transl_table=11
FT                   /locus_tag="lpp0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11621"
FT                   /protein_id="CAH11621.1"
FT                   /translation="MRLLFISLILASGYLQADTINNYMNIANNIPQMEMKADPQAQAWA
FT                   RSARHVLTITSESIAETLIQANEAAKTQGKPIFCLPQGVQLNSFVMNELIQQTYKEISS
FT                   QQSDKDKMTVSQVALLGLSKKYPCEPSPQEKQIQHVASLLSPQ"
FT   regulatory      complement(519264..519269)
FT                   /locus_tag="lpp0473"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(519275..519823)
FT                   /transl_table=11
FT                   /gene="lidJ"
FT                   /locus_tag="lpp0474"
FT                   /product="hypothetical protein"
FT                   /note="Predicted membrane protein, similar to hypothetical
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11622"
FT                   /protein_id="CAH11622.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFAAVGLCFVMNLMLGIRASHYGLMLLASLLGLSISVRQMYIHLTPGDPGYGGLFLGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGLMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
FT   CDS_pept        complement(520240..520443)
FT                   /transl_table=11
FT                   /locus_tag="lpp0475"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative transmembrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11623"
FT                   /protein_id="CAH11623.1"
FT                   /translation="MFTKIFIIFVMILIVASLASGLFYLVKDTDKSKRTVKALTVRIAI
FT                   SLSLFVFLFIAFKLGLIQPHGI"
FT   CDS_pept        520511..521239
FT                   /transl_table=11
FT                   /locus_tag="lpp0476"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11624"
FT                   /protein_id="CAH11624.1"
FT                   /translation="MPSLTCFNFRFTSNWPMLILTAVCFFLFISLGFWQIHRADEKIEM
FT                   ITAQQALAKQEPITWQPGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPML
FT                   LDDDSIVMVDRGWVSGDITRRTFPNVQTPNGKFKLFGMVYFPSKKQWVLGPSFEEKENK
FT                   VTLLELIDEEILKQLLQKKVYPFIIRLDKNEPFGFVREWEIVSMPPQRHFAYAIQWFAM
FT                   ALVILIIFVIFNLKKNEKTI"
FT   CDS_pept        521223..521768
FT                   /transl_table=11
FT                   /locus_tag="lpp0477"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11625"
FT                   /protein_id="CAH11625.1"
FT                   /translation="MKKPYKYMTLLLLVVIFAAPGITAYLFYKNPSWLGTSKVNKGILL
FT                   SPPIALKPLDSSAKWRIIYWNPNGCDKTCLKQLNMLGRVRLSFGRKLYQVDEWLLLSNK
FT                   DSLIAEELKPILKEQDIHVAALSLTEMSKLSTLYPEAKIFIANPDNYLILSYQPGCNPG
FT                   DIYKDLKLLLNTTEIKSG"
FT   CDS_pept        521773..522780
FT                   /transl_table=11
FT                   /locus_tag="lpp0478"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins,
FT                   hypothetical cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11626"
FT                   /protein_id="CAH11626.1"
FT                   /translation="MSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCPDWPGCYGR
FT                   MVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQVWFKRRQDQ
FT                   DLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRFRLQIAQLK
FT                   GQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGTWFPELHFAKGFNL
FT                   FSTIGANYQGGILESEVRASIQFIHRIGAILTATYLLTLSSIIVFKTHSIYLRATAIIM
FT                   AMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDKEVSHAY"
FT   regulatory      521798..521812
FT                   /locus_tag="lpp0477"
FT                   /regulatory_class="terminator"
FT   regulatory      522758..522763
FT                   /locus_tag="lpp0479"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        522770..523654
FT                   /transl_table=11
FT                   /locus_tag="lpp0479"
FT                   /product="hypothetical protein"
FT                   /note="similar to Polyprenyltransferase (cytochrome oxidase
FT                   assembly factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11627"
FT                   /db_xref="GOA:Q5X7X6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7X6"
FT                   /protein_id="CAH11627.1"
FT                   /translation="MRTEYAARLPVDWRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVS
FT                   LRLIAFTLLGIGLCAGSAAAINHLVDRHIDSIMARTKKRPVAYGRVSVKQALWFAVIIG
FT                   LMGLSLLILFVNQLTALLTFVTLIGYAGVYTGYLKRATSQNIVIGGLAGAAPPLLGWTA
FT                   VTGQLDPQALLLVLIIFTWTPPHFWALAIYRYKEYQDAEIPMLPVTHGIQFTKLNIYLY
FT                   TVLLLVVSLLPFVVSMSGWIYLLGALVLGIRFLVWAHKLYFTDKPVVAMQTFRFSILYL
FT                   MLLFVFLLVDHYF"
FT   regulatory      523653..523658
FT                   /locus_tag="lpp0480"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        523664..524305
FT                   /transl_table=11
FT                   /locus_tag="lpp0480"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11628"
FT                   /protein_id="CAH11628.1"
FT                   /translation="MNIKIKGGAVTITVLALVSLLAGIYISQNFHFKKKINVADFHGTY
FT                   LENPRTVNNFSLTGTDQKAFNNSSLQGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEK
FT                   KGVKNLPQVVMISIDPQRDSLDKLGSYVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKI
FT                   NNKESSEPENYDIQHSGAVMLFNPQGELNAFFTTPHHADLLAKDYVLLVS"
FT   regulatory      524656..524661
FT                   /locus_tag="lpp0481"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        524671..525579
FT                   /transl_table=11
FT                   /locus_tag="lpp0481"
FT                   /product="hypothetical protein"
FT                   /note="similar to ribosomal protein S6 modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11629"
FT                   /db_xref="GOA:Q5X7X4"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7X4"
FT                   /protein_id="CAH11629.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
FT   CDS_pept        complement(525583..525828)
FT                   /transl_table=11
FT                   /locus_tag="lpp0482"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11630"
FT                   /protein_id="CAH11630.1"
FT                   /translation="MLNKRFSERLNKELDNIGVPEATAERIEILSKLIKIPKFKAEALL
FT                   NGITSPDEAVLKTLAQELEVNADWLIGKSDSKSGAH"
FT   regulatory      complement(525834..525839)
FT                   /locus_tag="lpp0482"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      526134..526139
FT                   /gene="zwf"
FT                   /locus_tag="lpp0483"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        526144..527634
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="lpp0483"
FT                   /product="hypothetical protein"
FT                   /note="similar to Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11631"
FT                   /protein_id="CAH11631.1"
FT                   /translation="MLLKAESKYPCDLILFGTLGDLSCRKLLPALYQLELANLLHEKTR
FT                   IIGCAREELDFSAYADLIKNKIQQFLFDEIDEAVWLRFIKKLAYCKLDLNQSDDYQKLT
FT                   GYVNPSERVVISYLAIPPSLYSQTCRSLARLNLTQKPSRVVLEKPIGHDLPSSVATNEQ
FT                   VACFFSEDQIYRIDHYLGKETVLNLLVLRFANSIFSTNWDNRVIDRVEISVAEEIGVEG
FT                   RWEYYDKSGQVRDMLQNHLLQILSLVAMEPPLSLSAESIRSEKLKVLKSLRFINKSNAH
FT                   DHTVRAQYVANNLANGKKIPGYLEEVGANQASTTETFVAIKAYVDNWRWSGVPFYMLTG
FT                   KRLPKKQSEVVIYFKPQPYNIFHPLNEELYPNQLIIRLQPDEGVEVRIMNKIPGLGERM
FT                   MLHDSKLDLNFHHSFKTQRIADAYERLLLEVMLGNQYLFVSREEIEQAWQWIDSIVSAW
FT                   EEDNIPLYTYPACTWGPKEVIRLFNGQAHVWGDHNAVS"
FT   CDS_pept        527603..528334
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="lpp0484"
FT                   /product="hypothetical protein"
FT                   /note="similar to 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11632"
FT                   /protein_id="CAH11632.1"
FT                   /translation="MFGVITMQFHSFRDAKQLIHDMVEKLRTILSDAIKRRGQAFLVVS
FT                   GGRTPIDLFKELALADLPWEKVVITLTDERCVNLFDPHRNELLVREFLLQEKAKKAKFI
FT                   SLFDEKEDPLGHLNEVNSQIDSLPTFDAVVLGMGEDGHTASLFPCSDELSAGLDDKANA
FT                   VLIVKPRTASFQRVSLSKRRLLNSSTIFLHLVGQRKQVVLEQAMATNNPKILPICAILN
FT                   APDANVQVMYAPNNEEKECIL"
FT   regulatory      528309..528314
FT                   /gene="edd"
FT                   /locus_tag="lpp0485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        528322..530160
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="lpp0485"
FT                   /product="hypothetical protein"
FT                   /note="similar to 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11633"
FT                   /protein_id="CAH11633.1"
FT                   /translation="MHPVINQVTENIQNRSAARRAAYLNQIDKARTKGPQRSILHCGNL
FT                   AHGFAACAKQDKAILRGNAKANIAIVSAYNDMLSAHQPYSTFPDLIKEAISAAGGVAQF
FT                   AGGVPAMCDGITQGQPGMELSLLSRDVIALSTAVALSHNMFDGGLLLGICDKIVPGLLM
FT                   AALAFGHLPFIFIPAGPMPSGISNQEKARIRQLYAAGQVDKNALLDVEAASYHTAGTCT
FT                   FYGTANSNQLVIELMGLQLPGSSFVNPNTPLRNELTKAAACQILSLTDLNSDYMPIGQM
FT                   LDVKNIVNGIIGLLASGGSTNHTMHLVAIAAMAGYWVNWDDFAQLSAIIPLIARIYPNG
FT                   QADINHFQRAGGMAYFVKTLLEGELLHPDVNTVVGFGLDKYTQQPQLIDNRVVWVNGPD
FT                   SSSNNDVLTSAADPFKPQGGLQVLSGNLGRAIIKTSSLYDEHYVIEAPAVVCSSQEEFE
FT                   HLFNQGLLNKNCVVVVRFQGPKACGMPELHQLTPKLGVLMDKGFHVALVTDGRMSGASG
FT                   KVPAAIHVTPEAVDGGGIAKIETGDMILIDCERGILQLLVSDEELAGRSPVAIEGYSSV
FT                   LGMGRELFGNLRLHFTGAEQGACSLFKGNEFFYDAS"
FT   regulatory      530130..530135
FT                   /gene="glk"
FT                   /locus_tag="lpp0486"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        530135..531142
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="lpp0486"
FT                   /product="hypothetical protein"
FT                   /note="similar to glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11634"
FT                   /protein_id="CAH11634.1"
FT                   /translation="MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCA
FT                   EFISLESALLTYKTRHSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEV
FT                   LEVMNDFTAIAMSLPVLSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSA
FT                   FAGEGGHADWGAKTEQEWFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEF
FT                   LSAAQIISLALNQECFIAHKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSL
FT                   VHQSDFRIQFEDKGRFSDFNALIPTYVIAAAQPGILGASVSLKQILTGASHVLF"
FT   regulatory      531118..531123
FT                   /gene="eda"
FT                   /locus_tag="lpp0487"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        531129..531791
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="lpp0487"
FT                   /product="hypothetical protein"
FT                   /note="similar to 2-deydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11635"
FT                   /protein_id="CAH11635.1"
FT                   /translation="MSFSEWKTQPGAVFAASPVIPVIVIKELGDVLPLAEALFAGGIHV
FT                   LEVTLRTPVAIKALELLINTFPDELIGAGTVITPGQLHDVAAAGARFAISPGQTRELLI
FT                   AGQKSEIPLIPGVASVSELMEGLGMGYNHFKFFPAAAAGGIPMLQAISGVFPQVKFCPT
FT                   GGINSKNYEEYLCLPNVACVGGSWIVPEEAIKNHNWSLITELCMAVSSQKRELCSQN"
FT   regulatory      531894..531899
FT                   /locus_tag="lpp0488"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        531905..533326
FT                   /transl_table=11
FT                   /locus_tag="lpp0488"
FT                   /product="hypothetical protein"
FT                   /note="similar to sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11636"
FT                   /protein_id="CAH11636.1"
FT                   /translation="MAWIVAIIGSIAGFLFGYDEGIIAGSLGLVKNHFNLNATHIGVMA
FT                   SALPFGALFGSLLIGAFMASKSVKRFGRRSLLSFAGFLFFVGALGAGFAETISMLILSR
FT                   LILGLAIGMASVLTPLYLAETAAMRSRGAVVAIYQLALTVGIVCSYSVNYLLIEQQAWR
FT                   AMFASSAIPALLLTLGILFMPESPRWLCSVGRHDAAANSLRKLRGKQPVEQELKDIEAT
FT                   LANEPKQGNWLLLFQKPLLPVLMLGTILFCLQQLSGINVVIYFAPEIFKNLGLGSTTGQ
FT                   ILATMGIGLVNLLVTIIAILYVDKLGRRKLLLLGFAGTSLSLFALSLFSLNHVAWLSYL
FT                   SVICLMVYIFSFAISVGPIPHIAMAEIFPLHVRGAGMGMSSMSNWSFNTIVIFSFPVLH
FT                   QMFGIEVTFVLYAVICFLGFIYAYIYMPETRNISLEQIETYIMSGKPLRFLGREDEEVN
FT                   AVSTKSESSLLASTN"
FT   CDS_pept        complement(533416..534723)
FT                   /transl_table=11
FT                   /locus_tag="lpp0489"
FT                   /product="hypothetical protein"
FT                   /note="similar to eukaryotic glucoamylase precursor (Glucan
FT                   1,4-alpha-glucosidase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11637"
FT                   /protein_id="CAH11637.1"
FT                   /translation="MLKRIFFLMIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVA
FT                   SPSQYNPNYYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAG
FT                   QDILGEPKFYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNT
FT                   MDPQSMGTIKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMTQQKALTDGAILAHQLHDR
FT                   QAAVFYEMQANLINSRLQQHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILTNPQKE
FT                   GVFAPHHTFVRNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFI
FT                   LTATMAEYYFTMAHNLSLNSSNKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGV
FT                   QQGATSLTWSYVSVLRAIHLREQLENRIKTMGWNTY"
FT   regulatory      complement(534729..534734)
FT                   /locus_tag="lpp0489"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(534891..535127)
FT                   /transl_table=11
FT                   /locus_tag="lpp0490"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcriptional regulator (XRE-family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11638"
FT                   /protein_id="CAH11638.1"
FT                   /translation="MSIIVNLDVMMAKRKCRLRDLAEAIGITEANLSILKNGKAKAIRF
FT                   ATLEAICAYLHCQPGDLLEYQSTEDNHLIKDRA"
FT   regulatory      complement(535136..535141)
FT                   /locus_tag="lpp0490"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(535214..535753)
FT                   /transl_table=11
FT                   /locus_tag="lpp0491"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11639"
FT                   /protein_id="CAH11639.1"
FT                   /translation="MKKIKSVSHLLFLLFKTLAYGLPLVTTYFILFHFESMLNWGGWHS
FT                   LLSTPVKDPSHFSLLHRFIILLIEALPLSINVLICHQLAKLFRLYEHGYLFEEENIRLI
FT                   KNISIYLISGELIQLLYQPLITAALTFTNPSGQRIASITLGTANLSTLITAFIILIASW
FT                   IIKEAHKLKTDALLTI"
FT   regulatory      complement(535762..535767)
FT                   /locus_tag="lpp0491"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(535881..536876)
FT                   /transl_table=11
FT                   /gene="hemZ"
FT                   /locus_tag="lpp0492"
FT                   /product="hypothetical protein"
FT                   /note="similar to Protoheme ferro-lyase(ferrochelatase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11640"
FT                   /db_xref="GOA:Q5X7W3"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7W3"
FT                   /protein_id="CAH11640.1"
FT                   /translation="MRRGLLLLNLGTPDNADIRAVKLYLREFLTDKRVIDLPTIPRYIL
FT                   VYCLILPFRSPKSAQAYQSIWTEKGSPLLYHSQNLVTKLQSSLKDEYKIALGMRYGTPS
FT                   ITTALAELKDCHSLTILPLFPQYSSAATGSAIEKTLSYLANQEIIPSIKIIRDFYQRPE
FT                   YIQAQAKIMKPYIKDNFHVLFSYHGIPERHIHKSGCDTLCPQTCTPIYDKNQACYRAQC
FT                   YQTSLLLAKELQLGTHQYTTAFQSRLGKTPWIKPYTDEIFAELISKGIKNIVVSCPSFV
FT                   ADCLETLEEIGIRAKEQWEKLGGEQFILTPCMNDHPEWIKAIHSIVNEQI"
FT   CDS_pept        complement(536987..537220)
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="lpp0493"
FT                   /product="hypothetical protein"
FT                   /function="similar to Cold shock-like protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11641"
FT                   /protein_id="CAH11641.1"
FT                   /translation="MARGEVKWFNNAKGWGFIIPEGGGEDIFVHFSSIHGTGYKTLVPG
FT                   QAVTYDVVNGERGLHASNVVALSENAEQEEIA"
FT   regulatory      complement(537225..537230)
FT                   /gene="cspD"
FT                   /locus_tag="lpp0493"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        537457..537870
FT                   /transl_table=11
FT                   /locus_tag="lpp0494"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminus of Diadenosine tetraphosphate
FT                   (Ap4A) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11642"
FT                   /protein_id="CAH11642.1"
FT                   /translation="MFCIDDRIKSSSFILGEWPLSTVLLKNDASYPWFILVPRKMDIQE
FT                   IYQLEKSERFLLIEEINQLSLLVRDYFKPDKLNIGALGNIVPQLHIHIVIRSKNDPLWP
FT                   QGIWQSSIPSIPYPESELKSLLPTLGDLVNKAY"
FT   CDS_pept        complement(537973..538332)
FT                   /transl_table=11
FT                   /locus_tag="lpp0495"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11643"
FT                   /protein_id="CAH11643.1"
FT                   /translation="MIKKIAFTMYPVQNMDRARQFYEKTIGLKVGKISAEGAWVEYDLP
FT                   QGGCFAITTLAQGVIPSANSGGSVAFEVDNLDDLVFQLKSKGVQFKIDLFASPVCRMAI
FT                   AVDSEGNAFTLHQLT"
FT   regulatory      complement(538337..538342)
FT                   /locus_tag="lpp0495"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        538419..539771
FT                   /transl_table=11
FT                   /locus_tag="lpp0496"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11644"
FT                   /protein_id="CAH11644.1"
FT                   /translation="MMCMLKKLMFLLLLGAGLLSCGQSTDQQISNITTPKQFPSSPRDY
FT                   RPVQELPYLAWWKQFQDPELDRLIDTGLKTNMDIHIAMANLQQAQGELQQVKLSWIPNV
FT                   QILGGYSTNPALGVPGGFYGIWPSYILNIMQLYTQQKRAQYQVQYHQAAIDGLRLTLIG
FT                   QVAAAYFTLIAQLEQLKLLYELDRDLKSLIALSRKEINIGLKNDIDLAQLQSNERLIAA
FT                   QIKPIKHNIVVSQNALRYLINENPGLIKSKNNFAQLDFTRFKPGSLPATVLGNRPDMKM
FT                   AEYSLKAARAGIFVAYSDFFPVMQLDDFIGEAHLPDSTFEQATDAYVNWTINPNTLGKI
FT                   SVSKGVYNAKLAEYVKTVRLILKEVDNAFSANKRMREQFLSYRHAQEDYQHKYKLQNGL
FT                   LKSGLMSYKELLESKVYLDTLALSTNQAKLELAMSLVMLYQDLAGGYACSD"
FT   CDS_pept        539911..540948
FT                   /transl_table=11
FT                   /locus_tag="lpp0497"
FT                   /product="hypothetical protein"
FT                   /note="similar to Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11645"
FT                   /protein_id="CAH11645.1"
FT                   /translation="MKKLMEYGGKIKEYLLRLKPKRWFTLTNVIIFIGFLTAIIYVFSY
FT                   LIPFTDNAFVVNNVRPVAALTSGYITDLYVKNGDAVRKGQKLFTVFKKPYEYTVEQLSA
FT                   DLAGAQAKLAVLKATYERDLKLSENEQKIYKKLAQDDQKYLKGYAIKSVSLITLQNSQQ
FT                   ETKAAKDKWQASLKQLEIDQHQITVQENEIKSIQARLKNAKVNLDLTDVYAQGNGVIQN
FT                   LFFTIGTPVNINQPLFSLVDQDNIYIQANFNETDLRDVRKGSKVLIFPRMYLGRKIFHG
FT                   VIDSDYWSANRQLVDDRTQLQNVINENQWILLPQRLPVIIKVTDPDPKYPLRVGASAYV
FT                   YVEVY"
FT   regulatory      540912..540917
FT                   /locus_tag="lpp0498"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        540926..541858
FT                   /transl_table=11
FT                   /locus_tag="lpp0498"
FT                   /product="hypothetical protein"
FT                   /note="Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11646"
FT                   /protein_id="CAH11646.1"
FT                   /translation="MSMSKFIEWIDEVDPYAVQRIALYKSLFIATVMAYVYWVFRPTNF
FT                   TAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSIIA
FT                   LASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFICL
FT                   RFFPNQYLSVWKRALAKFIQSLELDIEGSFTHRGPKFMQEEMTHLGMLRQYRRLIPKKY
FT                   MIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYRLRCAIKTNTFCGTPKMSIM
FT                   PESKLQQYVMRCLQQAFSQWNQLCMILQH"
FT   CDS_pept        541825..542724
FT                   /transl_table=11
FT                   /locus_tag="lpp0499"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11647"
FT                   /protein_id="CAH11647.1"
FT                   /translation="MESVMHDTSALKKKLDYARFIHLVIMFMVAMLIFLFSTFPEKWWV
FT                   LITVLSVSAGIEPGLIIRRAKHRIGGTLLALIILIPLLYLLQLNYRLISILFVLAIVGL
FT                   SVATLNTRRYDISVFFITLVVFFLMAQTEEATSPRGPFEMVLNRGICTLLGVFIVLAGD
FT                   YFLFQAYRYSHRLYFFHQVMVYDFLNDIVRKIDESNTEKINTLLFVEKLRGQFTEHYLP
FT                   ISISSENLKLDFKTSEHTKKRIDIFQETIWEIRRLVFALCISEFVLHSSTASEQHLQRF
FT                   KLLMNKARTHFIQFEGRY"
FT   regulatory      542733..542738
FT                   /locus_tag="lpp0500"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        542746..543126
FT                   /transl_table=11
FT                   /locus_tag="lpp0500"
FT                   /product="hypothetical protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11648"
FT                   /protein_id="CAH11648.1"
FT                   /translation="MSHPDYSVYNEKCPSHNVLEGISDKWSILVISLLSQKIYRFGELK
FT                   REIGGISPKMLTQTLLKLERYGFVQRQSYPVLPMKVEYSLTRLGKELSAILVLLTRWTE
FT                   TNMDKIINAEKTFCEQKLGCHA"
FT   CDS_pept        complement(543128..543496)
FT                   /transl_table=11
FT                   /locus_tag="lpp0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11649"
FT                   /protein_id="CAH11649.1"
FT                   /translation="MDYPTAAMQAEEALHELMKFIWLCHKHKTDKLLYPDDKNLDFSCV
FT                   IHAEMADIDKMWHTFLLFTRDYHEFCDTCLNGVFFHHDPLIGENTPVSEEDYALELTRY
FT                   LTYIHDHLGSETLIKWFQ"
FT   regulatory      543807..543812
FT                   /locus_tag="lpp0502"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        543821..544432
FT                   /transl_table=11
FT                   /locus_tag="lpp0502"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11650"
FT                   /protein_id="CAH11650.1"
FT                   /translation="MNKRNWTAYYNSTKQNTLPRKSLLKAIANFDKEKINLSKSAIDLG
FT                   CGAGIDVMELLRCGWSVIAIDSQLSAIDSLLSSAQELTCTNKLKTIVSSFEALDSLPKV
FT                   NLINASFSLPFLKPVYFYKFWNVILKGLKPGGRFSGSFFGFNDFWNTRTDMIFLNREMI
FT                   CHLFSQFKIEYFQEEEKDEMDALGYYKHWHKFFIVAKKIA"
FT   CDS_pept        complement(544586..545386)
FT                   /transl_table=11
FT                   /locus_tag="lpp0503"
FT                   /product="hypothetical protein"
FT                   /note="ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11651"
FT                   /protein_id="CAH11651.1"
FT                   /translation="MGRSEMKIASAELRELMKAVSEGHYETVNTILDKNPELVNQYVPP
FT                   TYDSPLARVLNKKHIDYKMLDILVKHHVDFDYPINHHKETPIELACKNQDLQLFKYLVQ
FT                   HNAPISEHAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCDAEGNRFEELA
FT                   RKSQLINRFGGIVRYDYVQLLRSIYPIVDREVDVPTINASTEKLTDLLNKIRDQHTSKE
FT                   GYDQQNLKDSISLFFMTGGEVPPSRKVPESRFEEAGIDAPKNAL"
FT   regulatory      complement(545392..545397)
FT                   /locus_tag="lpp0503"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      545644..545649
FT                   /locus_tag="lpp0504"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        545657..547657
FT                   /transl_table=11
FT                   /locus_tag="lpp0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11652"
FT                   /protein_id="CAH11652.1"
FT                   /translation="MQNLDEILKKLGEDLKKTSKETANKLSVLSRKVAEDVVRVSDETV
FT                   QKINEVTKKFSVDTTVSTIDTQKILDDFMKNIRFSRFKQIWQAIEETPKSKRILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKELLPLLIAKVDTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQETKINLSKYLSLVGDKTDISEFLILTIGLFSSLKIADKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVVEQLGEKQVQKIMESSGNLKRFKPTRNDPRRF
FT                   FETRLAQYINGLSHSEKTLEIDLTEESLEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAEAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQREPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMENYKEDPDLQNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
FT   CDS_pept        complement(548479..549255)
FT                   /transl_table=11
FT                   /locus_tag="lpp0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11653"
FT                   /protein_id="CAH11653.1"
FT                   /translation="MRGKREFLKHEYSPGHWSIDYTRAGTSIAVITVRNKYHYSVILNP
FT                   TDCRGYRIIIRYLNEGDSSLSSAFNRPYTVSEQRGLNDVASLMTQVYEKLGLIVQFSQL
FT                   GNNSQSFDKETGVTLIGSEEEPSMLHLHMWGRGDPDMEYIAGVPLRGPEPGLMFDLIAK
FT                   NKTHPINQHAIKWNDEELKACLAMFKLKLAEYVNSPEFTEEFGDTLKVTIHDKKDLGEE
FT                   KESGFGFFHKMKSASDGITTLEKTLALEDNKINPFV"
FT   regulatory      complement(549261..549266)
FT                   /locus_tag="lpp0505"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      549608..549613
FT                   /locus_tag="lpp0506"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        549621..549833
FT                   /transl_table=11
FT                   /locus_tag="lpp0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11654"
FT                   /protein_id="CAH11654.1"
FT                   /translation="MDIHSTYKMLAKMQGNKELSSHKIAETEQAEADTVPQLKLQAEPE
FT                   AKPDMQNILSNMLGISSNKKHSPMD"
FT   regulatory      549991..549996
FT                   /gene="icmT"
FT                   /locus_tag="lpp0507"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        550004..550264
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="lpp0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11655"
FT                   /protein_id="CAH11655.1"
FT                   /translation="MAGGFSATSHWRDSARSARFFVVDARAAFPIFLFLMHIRVWTGVL
FT                   VLVSAIFFGIIEHYGFTVPVFLRWLRSFLAGSVRSARPWWR"
FT   regulatory      550256..550261
FT                   /gene="icmS"
FT                   /locus_tag="lpp0508"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        550265..550609
FT                   /transl_table=11
FT                   /gene="icmS"
FT                   /locus_tag="lpp0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11656"
FT                   /protein_id="CAH11656.1"
FT                   /translation="MERDISKCMAKIAASMNAKFYLNDRFVSFDEVFSETGLLPAIAKR
FT                   ADQLCSLCLGYGLGATYDESEGALLGIRVVFDEVTPNVLRLLCMTDVMNELIQGGPSRD
FT                   YTPLDELMYD"
FT   regulatory      550696..550701
FT                   /gene="icmR"
FT                   /locus_tag="lpp0509"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        550709..551071
FT                   /transl_table=11
FT                   /gene="icmR"
FT                   /locus_tag="lpp0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11657"
FT                   /protein_id="CAH11657.1"
FT                   /translation="MGNNTDDSARNPFGFYTPPRVKEIGESDVTDATLGSVYSEIISPV
FT                   KDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQPILTAKTERMFGAAESEK
FT                   SSEQPSHEERGFKLSS"
FT   CDS_pept        551162..551737
FT                   /transl_table=11
FT                   /gene="icmQ"
FT                   /locus_tag="lpp0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11658"
FT                   /protein_id="CAH11658.1"
FT                   /translation="MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDR
FT                   FLKRIGAASQARLKAESHLANRIALRSGQQEIYVSLYSSDGSNLQSWEKIVGSLPRQMI
FT                   SRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDK
FT                   SISLENISRFVHVSGVYRYSNGRLIKNA"
FT   CDS_pept        551924..553054
FT                   /transl_table=11
FT                   /gene="icmP/dotM"
FT                   /locus_tag="lpp0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11659"
FT                   /protein_id="CAH11659.1"
FT                   /translation="MAQQQQQSGSDNSMAPVWIIILLFITAYFVWALAHQYIVSFVFTI
FT                   NIWQARLVNLFLNNQLLANQIYLMQTLDPNTVNWDQMVTVMRAVGDYMRYPVICILVVL
FT                   AFVLYNSNVTLKYRKTYDMKSLRAQEQFNWPAIMPIVKEDLVSQDVNKGPWAMALTPME
FT                   FARKYNLLRKDDALLDNPVPGEEMTAGIRRGDAKRVFTMQLGPYWDGFERCSPQAYALS
FT                   AVFIARMNRDRDAANNILKVLDKTFVDGKPDFSVARPVMKKYQNSELVQEVVAKHAYVL
FT                   TVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYMLNCVGRQTPYSEVAGPFAHWKAEKE
FT                   MGRRSLVPMIDEAIRALEIAVKEVRLTPRQMEELEP"
FT   regulatory      553035..553040
FT                   /gene="icmO/dotL"
FT                   /locus_tag="lpp0512"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        553051..555402
FT                   /transl_table=11
FT                   /gene="icmO/dotL"
FT                   /locus_tag="lpp0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11660"
FT                   /protein_id="CAH11660.1"
FT                   /translation="MMRGIDSRHELDPTLLLRDTRTFTQRLADFFADPTNISIVLISLA
FT                   AVSYYFSEAATFLLIMGGIFFLYSYTRKQKLPFRLPQISRAKDYNDLKPGINKPNIARG
FT                   ITFFGNDRKTGEELWFANDDMRTHALIFGSTGSGKTETLVSLSYNALVQGSGFIYVDGK
FT                   GDNSLYAKVFSMVRSMGREDDLLLINFMTGARDIVGPQEKRLSNTLNPFCQGSSSMLTQ
FT                   LVVSLMGSSGQSSDGDMWKGRAIAFVEALMRLLVYMRDEGAILLDANTIRNYFDLQRLE
FT                   SIVIDKLFPRDDQESVNIETIPKLVTDPLRNYLNTLPGYNKEKKGKQVSQVLEQHGFIT
FT                   MQLVRSFSSLADTYGHIIRTNLAEVDFKDVVLNRRILVVLLPALEKSPDELSNLGKIIV
FT                   SSLKAMMAAGLGEEVEGDYRDVILRKPTNAPTPYMCILDEYGYYAVQGFAVVPAQARSL
FT                   GFSAIFAGQDLPAFQKASKEEAASIGANTNIKICMKLEDPTETWDFFTKTAGEAYVTKV
FT                   DSFQTKETSIANSYMDTKSSSFEKRARVDLLDLKEQTEGEAHIFFKSKIVRARMFYANP
FT                   KPVKQLKINQFLKVEPPPDDYLMKLQKQLASFQSILESGDLSINKAVENEEITLISKAL
FT                   KESTIVEPIERGVAALIAFHGQNEPEPVEDIVEEEVEGALTIFSKLRIDPNAPPILVAD
FT                   KEVFSEPLLPINETRNQMITIERLAGAKDKYAGTVANELIKDFQIATSYPPEERDVIDV
FT                   QELTGIIRDLSAKISAEREKANKKAAEELT"
FT   regulatory      553098..553142
FT                   /gene="icmP/dotM"
FT                   /locus_tag="lpp0511"
FT                   /regulatory_class="terminator"
FT   regulatory      555801..555806
FT                   /gene="lphA"
FT                   /locus_tag="lpp0513"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        555806..556375
FT                   /transl_table=11
FT                   /gene="lphA"
FT                   /locus_tag="lpp0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11661"
FT                   /protein_id="CAH11661.1"
FT                   /translation="MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRV
FT                   DGACDATIIKMMTDLNKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEVAA
FT                   FLKQFRKIAITVTSYSSKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDK
FT                   PITSYTLGGDRSPNARVEITFRRAVA"
FT   regulatory      556376..556381
FT                   /gene="icmM/dotJ"
FT                   /locus_tag="lpp0514"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        556387..556671
FT                   /transl_table=11
FT                   /gene="icmM/dotJ"
FT                   /locus_tag="lpp0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11662"
FT                   /protein_id="CAH11662.1"
FT                   /translation="MSRETWALIKRNKNFNVHIYRRGLTLLILSLGLSCGLSGLIYYVH
FT                   MHEPERDFYATSGITPPIQLKPMPTPNMSSEALLPPDPPDENLQRIIPQ"
FT   regulatory      556676..556681
FT                   /gene="icmL/dotI"
FT                   /locus_tag="lpp0515"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        556687..557325
FT                   /transl_table=11
FT                   /gene="icmL/dotI"
FT                   /locus_tag="lpp0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11663"
FT                   /protein_id="CAH11663.1"
FT                   /translation="MAEDALTVVALRNKFYKDSQRKVILALLIAIVVNVVLASLVVYMI
FT                   THPPAPKYFATSINGRITPLFPLDEPNQSDSAVLQWANQAAIAAFTYNFVNYRDELQAS
FT                   SGFFTAEGWDQFLGALEQSNNLDAVKAKKLVVSAVATRAPIILQKGVLNGRYSWRVQMP
FT                   ILVTYQSASEFTQQNNVVTMLITRVSTLNSPRGIGISQFVVGPASGGVS"
FT   CDS_pept        557328..558410
FT                   /transl_table=11
FT                   /gene="icmK/dotH"
FT                   /locus_tag="lpp0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11664"
FT                   /protein_id="CAH11664.1"
FT                   /translation="MKKYDQLCKYCLVIGMTFSMSCSTYAADQSDDAQQALQQLRMLQQ
FT                   KLSQNPSPDAQSGAGDGGDNAASDSTQQPNQSGQANAPAANQTANAGGDGQIISQDDAE
FT                   VIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKASTAGTPPKPTATSQFVNLSPGS
FT                   TPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNY
FT                   GNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLH
FT                   VLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQK
FT                   SPVLLVSWHGKVMQLKVEGL"
FT   regulatory      558398..558403
FT                   /gene="icmE/dotG"
FT                   /locus_tag="lpp0517"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        558415..561561
FT                   /transl_table=11
FT                   /gene="icmE/dotG"
FT                   /locus_tag="lpp0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11665"
FT                   /protein_id="CAH11665.1"
FT                   /translation="MASKKENLKSLFSNTRTRVIIVFTAALLIIAVVIGFFKIRSATTS
FT                   SIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQAL
FT                   GEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGGCSKSVITKVMNQGAQLTDLK
FT                   AACSCVQLKDSGYGLQELEQVCECKELKAAGYNARQLKEAGYSAGRLRNCGFDACELRN
FT                   AGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQA
FT                   GVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLKRAGFSAAELKDAGFTARDLL
FT                   NAGFTPADLAKAGFSNAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIR
FT                   QYAGCSAQALKAAGFTDADLASAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGV
FT                   SAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPASIIAD
FT                   GRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAG
FT                   FSAKDLKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAA
FT                   GFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKN
FT                   AGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIP
FT                   SIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLTAATQLVQDW
FT                   KKVETQVYTEGTEETKTSGGESSVPGAGTGAGANNQPVEQGASGAQNQAIIKTGDIMFA
FT                   VLDTAVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISI
FT                   SAYAIDPNTARTALSSRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNN
FT                   ITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI
FT                   "
FT   CDS_pept        561576..562385
FT                   /transl_table=11
FT                   /gene="icmG/dotF"
FT                   /locus_tag="lpp0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11666"
FT                   /protein_id="CAH11666.1"
FT                   /translation="MMAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASFQSGKEGLTK
FT                   KKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTTKPAIPPVTQVATPQPVQTIP
FT                   TTTPIQQVQPTTIIEDDPDLKKKVSAIEMTQQSLRSEVNALGEQINAVNNNIKNLNAQI
FT                   VNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPTVQARIIYYIQAVIPGRAWL
FT                   IGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS"
FT   regulatory      562382..562387
FT                   /gene="icmC/dotE"
FT                   /locus_tag="lpp0519"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        562393..562977
FT                   /transl_table=11
FT                   /gene="icmC/dotE"
FT                   /locus_tag="lpp0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11667"
FT                   /protein_id="CAH11667.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSIKEPVMYLMVGALLIYFPSLVSSVLQTTFGYSNP
FT                   LAYSGGVSSGSDTISALFGSGSLVGRPLVMIIRVIGLIAFVRGWVLIARSASQGQPPGG
FT                   TGKGLIHVFGGILAINIVGTVDMINNTLYGT"
FT   regulatory      562989..562994
FT                   /gene="icmD"
FT                   /locus_tag="lpp0520"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        563003..563401
FT                   /transl_table=11
FT                   /gene="icmD"
FT                   /locus_tag="lpp0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11668"
FT                   /protein_id="CAH11668.1"
FT                   /translation="MNIKVIRKSGYKHWLVSAACLALLTLICQDAAAGVSLGKMASQIT
FT                   GSFTSLTKLITAGSYLAGLGFSIGAIMKFKQHKDNPTQIPIGTPIALIFIAAALLFLPS
FT                   ILGVAGVTMFGGSGGKTAGPTGTIYKTN"
FT   CDS_pept        563599..564225
FT                   /transl_table=11
FT                   /gene="icmJ/dotN"
FT                   /locus_tag="lpp0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11669"
FT                   /protein_id="CAH11669.1"
FT                   /translation="MADNQQRCELKLIASPGSWRLYSARKIDERFKSYEQKIFQRDRYT
FT                   CQFCGFQARLYQDIVNLDGDYTNNRLSNLVTACCFCAQCFFVESVGVGGYGGGTLIYLP
FT                   ELTQAELNSLCHVLFCAITNDTGYKSSAQNIYRSFKFRSQIVEEKFGEGTSDPAIFGQL
FT                   MIDSGVKSEEIREKLFKNIRLLPSRAKFRKQIEKWAASALEEIAD"
FT   regulatory      564248..564253
FT                   /gene="icmB/dotO"
FT                   /locus_tag="lpp0522"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        564261..567290
FT                   /transl_table=11
FT                   /gene="icmB/dotO"
FT                   /locus_tag="lpp0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11670"
FT                   /protein_id="CAH11670.1"
FT                   /translation="MANWSESFFEGVDTFFAWLSTSLKQTTESYIDLETADSPTVLVNH
FT                   DGSLLSVLKIEGITGLAGPEEFERLVEGLANSFQAAMGRPGHALQVYFSHDKQNIVKMI
FT                   KDIYDPAEATASRLELNLRDLFEERVNYLSQYCAEERVYFVLYTRPFNLASDQLKAANK
FT                   AKMKMIKDTKAPPFKNTQTIFAAVPEIRDTHDAYVRAILNDLDALNVIAKLLEVHDAVH
FT                   AIRMTGDPDYTADDWRATLPGDKIPVRELNNFEGDPSDLLWPPLSRQVLPRDAEIIDLR
FT                   TVRVGDKIYASTYIDLFPKDVRPFISLFSRILPSHVPWKISFLLESEGLSTIKLKGLLA
FT                   AILSFSSAQNRLISDSVNLLKYIQLNTDEAIVRLRVVATTWAPEGNIPLLRRRSSELVK
FT                   AIEGWGSTDVSEICGDPFAGFVSSMLATTLNSSAVASVAPLSDVISMLPITRPASPWKT
FT                   GALLFRTPDGKPWPFQPGSTEQTTWIDLVYARPGSGKSVLSNALNLALCLSGGLMRLPR
FT                   IAIIDIGPSSSGLISLLKEALPASKRHLVAYHRLRMTPDYSINPFDTQLGCRYPTALER
FT                   SFLVNFMTLLTTPLGAAKPYDGMADLAGMVVDELYKSMADEFNPTPYAPGIEEFIDSIL
FT                   EEIGFVRDAKSTWWEVTDSLYSAGFVHEAMLAQRYAMPLLADAASICRTPSIEDLYEKI
FT                   TAPTGESLINAFSRMISSAVREYPILSRVTSFDIGDARVVSLDLDEVAKSGGDAADRQT
FT                   AVMYMLARYVLARHYYLTEESLNNVPEQYKEYHKQRVLEIREDHKRIVYDEFHRTAKSS
FT                   AVREQVIIDMREGRKWKVQISLLSQAVDDFDPVMIDFATAIYVMDAGPSQAVEKTSQIF
FT                   GLSETAKIALRTRVHGPRQGGATFLAQFATKTGINVQLLTLTLGPVELWAFSTTAEDAT
FT                   VRNLLYRHLGPSEARRLLAALFPNGTVTKELEARLASMKQKVGLIEDDEREGMINQLVN
FT                   DILDAYSKDPNVKSLPAKVG"
FT   CDS_pept        complement(567388..568644)
FT                   /transl_table=11
FT                   /gene="citA/tphA"
FT                   /locus_tag="lpp0523"
FT                   /product="proline/betaine transport protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11671"
FT                   /protein_id="CAH11671.1"
FT                   /translation="MKQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFV
FT                   SLIATFSLFAIGFIMRPIGGLLLGHYADHAGRRKALILSMSVMTISTALIAVLPDFNSW
FT                   GIIAPLLFSILRLIQGLAVGGELPGSTTYLIEHMFQQSRGLAGSLVLSSAFLGIFIGAL
FT                   TASIFSTLFTGDALLNWGWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKV
FT                   VFTRFKQQLFLSVIITSILAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVL
FT                   IPLMGFLSDVIGRKPIFLIGLFSLCILIFPFFWLLLSGSWWKALCSELLLAIALAPINA
FT                   TVPTIIAEMFPTSVRASGISISYNIGQALFGGTMPLVAFTLIELSSNKMAPAWYLFLWI
FT                   LIVIPITISIRESYQKELT"
FT   CDS_pept        complement(568647..571568)
FT                   /transl_table=11
FT                   /gene="icmF"
FT                   /locus_tag="lpp0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11672"
FT                   /protein_id="CAH11672.1"
FT                   /translation="MDNSLRALCDAIKKILSQLKPQTNQLSFIVITGKNAQGKSALLKQ
FT                   SNMEEMPVFSEEHAKLYFNQKGIIVELGENWLTNSKTLLLTTLKQLNKCNRHLKITGLI
FT                   LCVDVNDLLIAEPAQFTEQKKSHLQLIQRLGVNLGYQAELALIFTKMDTLAGFSEFYQM
FT                   DHVNDLSKPLGFSLDCVNQLSKKIETFSLQFNQLIEALGQQVINKMHPARSTIKRSLIR
FT                   EFPLQLASLRAPIQSLIQGISPKLFHVHSIFFTSAEQGGVSVDRLNKKIQHEYALVVQD
FT                   TFPQATNFRSYFVEGALQTIQEQCIQVPQATKFSQKPFIAVAVSLAGLSLLTLIYNHYK
FT                   TAHILDEASKELLAYEALNNQGTSGAQALYHLSQAANKMNHITSNSISLPTVHQLKLNL
FT                   HNNAQNRLQGEFLPSLANELEQVITSPGNTPITRYKALKIYLMLGDSKYFSSQPILDWF
FT                   QQQWQGRAPGTTQKQLALLKQTLSNPPQNIPIKSQIISDARNYLNALPTSYLYYSIAKE
FT                   YFPQEKQKIVIEGFSIPTDEVPTYFTKTGFTKIINELPKITSTLQSENWVLARQDLSQL
FT                   HNMLIQAYCFDYVTWWQTFMKKSQPLRYQDYQQGRQLTKLIQQSNSFYKFANLIQQETK
FT                   PDLTEGISTFNQFIANQFTDLNLTTLSSIKELDFRISELERFIATLSVVNDGGKTAFTI
FT                   TRSRFLNENSSDPVSLLYSQARQLPEPLSSWTKQIAGDTWVILIRDSRQYINNQWQKTV
FT                   YREFQNSIAQRYPFDSSQTAEIDIADFNRFFSTHGLLNTYSEQYIKPFLDTSSPEWKPK
FT                   AVNDFILPISNEVIDELIRANIITNMFFPDHSDESKIDFSLQKISLDPVVSNLILEIGG
FT                   TKLMDNQTSDSLIRFTWPQNNAKLALDSIEGNHYELAEYGTWAIFKLLEKVNVLVDEQD
FT                   SSSLQILFEVNSNSGRYLLKTNNQINPFTPGILNGFTLNDHIA"
FT   CDS_pept        complement(571568..572353)
FT                   /transl_table=11
FT                   /gene="dotU"
FT                   /locus_tag="lpp0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11673"
FT                   /protein_id="CAH11673.1"
FT                   /translation="MTTEQYPSSLVNRLAITEPALVPSGYYRSKLFIAPFSTNVLVAAA
FT                   GPILSLLERLCLSPSLPPVEDIRENIQHELRAFHSKLDASKYPLDIISIAQYLLSATID
FT                   EILGKSYLRVYNLTTEFKSFTPLSSDGAQPQQRFFEILNYIKERPNQFLDLIELAYFCL
FT                   IAGFEGEYHLKADGRQCLDNTIEDLYQIIQKYRFNKPHRLFNENPLPKTIKKNYKATWI
FT                   TTIAAVGIVILAFVTSHVLLENKAKTVLFGHTQLAMLEN"
FT   regulatory      complement(572360..572365)
FT                   /gene="dotU"
FT                   /locus_tag="lpp0525"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(572638..574227)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="lpp0526"
FT                   /product="hypothetical protein"
FT                   /note="similar to phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase and IMP cyclohydrolase (bifunctionnal)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11674"
FT                   /protein_id="CAH11674.1"
FT                   /translation="MAKKQIYSSFKPRRALLSVSDKRGIRELGQALHDQGVELIATGNT
FT                   AAILREHKLPVTDVSECTGFPEIMDGRVKTLHPAIHAGLLARGEQDSPVLRQHGIKPID
FT                   LLIVNLYPFEQVINHPDCDFNKAIENIDIGGPTMVRAAAKNHAHTYVIVDPNDYSKLIH
FT                   YLQDQKAPSHWNFALAKKAFAHTAAYDAAIANYLTTLDNDYVPTGFPDILTCQFNKITD
FT                   LRYGENPHQQAIFYADKNSHPGSLSTAALLQGKQLSYNNILDADAALDCVKSFSNEKSV
FT                   CVIVKHTNPCGIALSDTSLDAYLKAFQSDPISAYGGIIAFNGTLDSDTAKAILEKQFVE
FT                   VIIAPDANEEAKKILATKENIRVLLTGFWQQGNNFRLSMKKVDGGLLVQEHDSLSLESC
FT                   ELQTVTQVKPTDEQLQNLMFAWLAAKHVKSNAIVYANDLATIGIGGGQTSRVMSARIGL
FT                   WQAEQMGFDPKGAVMASDAFIPFPDTIEIAAKAGISAIIQPGGSIRDEKIISCADQHNI
FT                   AMIFTGVRHFKH"
FT   CDS_pept        complement(574254..575123)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="lpp0527"
FT                   /product="Ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11675"
FT                   /db_xref="GOA:Q5X7S8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7S8"
FT                   /protein_id="CAH11675.1"
FT                   /translation="MWFQLKIEHCPNDKIEEITEELEEYGALSITLTDKNDNPVLEPEP
FT                   GTTPLWPEVIIHALFAQAEEAQYVREQLVAKRPSLHCSLELLADKNWERAWMDDFRPQR
FT                   FGNRLWVCPTWLPPPEPDAVNLMLDPGLAFGTGTHATTSLCLTWLEQADLKNKSIIDYG
FT                   CGSGILSLAAIKLGAKHVYAVDIDNQALQATQSNAHANHITESQLSISTPEALQNPVHL
FT                   IIANILLAPLISLKERFHQLLPSGAHLVTSGILEEQAPLLIDAYDSAFTHIATEYCEGW
FT                   SLLVFTSK"
FT   CDS_pept        complement(575125..576468)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="lpp0528"
FT                   /product="Biotin carboxylase (A subunit of acetyl-CoA
FT                   carboxylase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11676"
FT                   /protein_id="CAH11676.1"
FT                   /translation="MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLA
FT                   DETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIG
FT                   PRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAAGG
FT                   GGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKGHA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLFQD
FT                   GCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECRIN
FT                   AEDPRNFMPSPGTIKLLHQPGGPGIRFDSHIYSSYVVPPNYDSMIGKLISYGATRAEAI
FT                   ARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
FT   regulatory      complement(575130..575135)
FT                   /gene="prmA"
FT                   /locus_tag="lpp0527"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(576477..576482)
FT                   /gene="accC"
FT                   /locus_tag="lpp0528"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(576481..576963)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="lpp0529"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11677"
FT                   /protein_id="CAH11677.1"
FT                   /translation="MDIRKIRKLIELLEETGISEIEIKEGEESLRLSRHSNIVAETAPQ
FT                   IHYVAPSAVKQTAPTPSSNTSTTEPHVIENKQVTSASSGHKIRSPMVGTMYTAPSPESP
FT                   PFVTVGQSVKAGDTLCIIEAMKMFNEIEADRAGKIVEILVKNGDPVEYDQALFIIE"
FT   CDS_pept        complement(576977..577414)
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="lpp0530"
FT                   /product="3-dehydroquinate dehydratase type II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11678"
FT                   /db_xref="GOA:Q5X7S5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7S5"
FT                   /protein_id="CAH11678.1"
FT                   /translation="MKKILVLHGPNLNLLGSREPSIYGHASLTEINGDLIQEADNAGIR
FT                   LSCFQSNAEAELIQAVHQAGIDKINYIIINPAAFTHTSIALRDALSAVAIPFIEVHLSN
FT                   IFSRETFRHHSYFSDIAVGVISGLGTKGYLLALQAIIKELK"
FT   regulatory      577605..577610
FT                   /gene="dcoA"
FT                   /locus_tag="lpp0531"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        577616..579406
FT                   /transl_table=11
FT                   /gene="dcoA"
FT                   /locus_tag="lpp0531"
FT                   /product="oxaloacetate decarboxylase alpha-chain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11679"
FT                   /protein_id="CAH11679.1"
FT                   /translation="MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEV
FT                   WGGATFDACLRFLKEDPWSRLRQLRQVLPNTQLSMLLRGQNLLGYRNYADDVVRAFVKL
FT                   AVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELGKKL
FT                   AEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAG
FT                   CNHIDTAISSFSGGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFE
FT                   SEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAVHKEIPRVRKDLGYPPLVTPT
FT                   SQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRP
FT                   GDLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAP
FT                   DNSVMSEFDIILHGESYHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERS
FT                   SVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQTVLVIEAMKMETEIKAPANGVVAEI
FT                   LCQKGDKVTPGQVLIRVEVS"
FT   regulatory      579958..579963
FT                   /gene="proA"
FT                   /locus_tag="lpp0532"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        579972..581603
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="lpp0532"
FT                   /product="zinc metalloproteinase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11680"
FT                   /protein_id="CAH11680.1"
FT                   /translation="MHPNYYLSPLAVAIALGIASPVKAADPIPLQKSSFSEVTQKFQLT
FT                   LPGVMKGAVVSTNSLQFIRQHTDGNKVTHVRMQQQYAGFPVFGGYAILHSKNATPSLAT
FT                   AKSDVKMNGVIYDGLQAELGQPKPSFVKNASMALQQFKDKYANKQVSEDQVTPMIYIDE
FT                   KHQAHWAYKVSVLVIHDDRIPERPTAIIDAETNKPFVQWDDVKTEKVQAKGMGFGGNRK
FT                   IGEYQFGKDLPLLEITRDSSVEMCFMENTDVKVVDMGHKYYSNNKPMQFTCKETPDTQS
FT                   TKTYYTGYSADGYDRDNGAASPTNDALYAGYVIKHMYHDWYGVEALTKSDGSPMQLVMR
FT                   VHYGQGYENAYWDGKQMTFGDGDTMMYPLVSLGVGGHEVSHGFTEQHSGLEYFGQSGGM
FT                   NESFSDMAAQAAEYYSVGKNSWQIGPEIMKEDSGYDALRYMDKPSRDGMSIDVADDYYG
FT                   GLDVHYSSGVYNHLFYILANQPNWNLRMAFDVMVKANMDYWTPYSTFDEGGCGMLSAAK
FT                   DLGYNLDDIKKSLSEVTINYQSCYVD"
FT   CDS_pept        complement(581605..582453)
FT                   /transl_table=11
FT                   /locus_tag="lpp0533"
FT                   /product="hypothetical protein"
FT                   /note="Putative lipase LipA (L.pneumophila)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11681"
FT                   /protein_id="CAH11681.1"
FT                   /translation="MKTKILSIPGLSIACKVWGNPDNPPILALHGWLDNANSFDDIAEH
FT                   LQNDYYFIAVDLPGHGHSSHLPPGCIYHFTDGIFTVVEIINALGLNKLHLLGHSMGACL
FT                   GSLVAGVAPDRFLSLSLIEGLGPFSHPAETACQQLSKYLDYLSQKQSKKAKGYNKFEHA
FT                   ALARSVKGYVSLDIAKSLCERGIQQENGLYYWRHDRRLLAPSPLQMTEAQVLSCLTEIK
FT                   AQTYLIWASKGFSFDSDKMKARIQAVKNIKIEKLDGGHHIHMEKPEVISRLLAEFYQSI
FT                   K"
FT   regulatory      581630..581656
FT                   /gene="proA"
FT                   /locus_tag="lpp0532"
FT                   /regulatory_class="terminator"
FT   CDS_pept        582903..583676
FT                   /transl_table=11
FT                   /locus_tag="lpp0534"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11682"
FT                   /protein_id="CAH11682.1"
FT                   /translation="MRDRVSMQPEVRSVSLITYNIHKGFGVGAVRFLLPEMRDAIAGLN
FT                   PDFVFLQEVQGKHRKREKRIVSWPDSPQCEYIAENIWPHYVYAKNAVYQSGHHGNAILS
FT                   KYPFESFESINLSNMNRASRGILHTQLKLDNNIIHLLCVHLGLFKAERTEQCKALIQRI
FT                   KDVVPKNEPMIMAGDFNDWRHVISKILAENLGIEEAFVALEGQHARSFPAIKPALCVDR
FT                   VYFRGMKVQEVACLQGKPWRMLSDHLPLYARFELL"
FT   CDS_pept        complement(583855..584865)
FT                   /transl_table=11
FT                   /locus_tag="lpp0535"
FT                   /product="hypothetical protein"
FT                   /note="Similar to fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11683"
FT                   /protein_id="CAH11683.1"
FT                   /translation="MSYEELSNTMEQMLHEGKGILAADESNSTIGKRFASINTENTEEN
FT                   RRDYRLLLATTPDLEQYINGVILFEETFTQTDEHGTPIPELFANKGIIPGIKVDKGLVD
FT                   LANTEHEKVTQGLDGLTERLLHFKKLGAKFAKWRNVYSISEYTPSLTAIKTGAENLGRY
FT                   AAACQSVGIVPIVEPEVLMDGNHSIEHCAEVCEMVLHELFHTLFIHQVELEHIILKPSM
FT                   VTCGKEVTPFSDPEEVADYTISVFRNNVPASVPTINFLSGGQTPQQATANLNAINQIGH
FT                   QPWLLSFSFGRALQEDCLKEWCGNKANITKAQEALIKRARLNSMACLGEYQNDME"
FT   CDS_pept        complement(585015..585749)
FT                   /transl_table=11
FT                   /locus_tag="lpp0536"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11684"
FT                   /protein_id="CAH11684.1"
FT                   /translation="MQINTFPITLEESFMISPKVKHFIFNCELSPPFEYLPGQFITIHF
FT                   EHDGKNLKRSYSIANEPKKDNRIEFAAGYFEGGPGTELLYNLKPGDVIHINGPFGRLIF
FT                   KDETPGRYILVATSTGTTPYRAMLNELGQRIEKHPDLQVVILQGVQRSEEILYPDDFQA
FT                   FAKKYPQASFRPYLSRVQKQDLKDNEYSGYVQHAFPELNLNPTRDMVYLCGNPGMIDEA
FT                   FNYLKEHGFSMQHIVREKYISR"
FT   CDS_pept        585833..586375
FT                   /transl_table=11
FT                   /gene="dotV"
FT                   /locus_tag="lpp0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11685"
FT                   /protein_id="CAH11685.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
FT   CDS_pept        complement(586519..586815)
FT                   /transl_table=11
FT                   /locus_tag="lpp0538"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11686"
FT                   /protein_id="CAH11686.1"
FT                   /translation="MHRVMSNRKNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKNSR
FT                   IYYSPLLQPSVNSEGYKCVLLDPKLKESSPQVYQAIMDFAKANNLKICGEEDL"
FT   CDS_pept        587033..587770
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="lpp0539"
FT                   /product="hypothetical protein"
FT                   /note="similar to CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase (Phosphatidylserine synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11687"
FT                   /protein_id="CAH11687.1"
FT                   /translation="MNKENHSGIYLLPNLLTTVSLFAAFYSIVASTKGQYEAAIVAMFI
FT                   GMIADSLDGRIARLTNTQTEFGAQYDSLSDMVTFGVAPSLLLYNLTLHQLGKFGWLVAF
FT                   IYTAAVALRLARFNTQIGKSDKRYFQGLPCPPAAAVMASFAWICFQNEWANLIVSLFTA
FT                   VLALIVSVLMVSNLRYYSFKEVDYKGKVPFLYVLVMILLFVAIAANPAIVLFASSGIYA
FT                   LSGPMLTVISLHKMRKQRRNMSK"
FT   CDS_pept        complement(587999..588268)
FT                   /transl_table=11
FT                   /locus_tag="lpp0540"
FT                   /product="hypothetical protein"
FT                   /note="similar to sugar transport PTS phosphocarrier
FT                   protein Hpr"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11688"
FT                   /protein_id="CAH11688.1"
FT                   /translation="MIKTKIKIINRLGLHARASAKFVSTAAKFQSHIDVTKDTQTVNGK
FT                   SIMGVMMLAANKGSELTLEIDGPDEERMNEALVELINNRFGESE"
FT   CDS_pept        complement(588459..588758)
FT                   /transl_table=11
FT                   /locus_tag="lpp0541"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11689"
FT                   /protein_id="CAH11689.1"
FT                   /translation="MQINITGHGMDVTPALRAFTEEKFDKLERHFDHIRAINVVFDVEK
FT                   VRQIAEATVLVTKGELHASSESEDMYAAIDTLVDKLNRQLIKHKEKLLAHRDRD"
FT   regulatory      complement(588763..588768)
FT                   /locus_tag="lpp0541"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(588785..590179)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="lpp0542"
FT                   /product="RNA polymerase sigma-54 factor (sigma-L)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11690"
FT                   /protein_id="CAH11690.1"
FT                   /translation="MKPTLQIGIGQHLTLTPQLQQAIRLLQLSTFDLQQEIQLVVESNP
FT                   LLEATPVEEKEDAQINTNQNQDEYSDFQWSQLYNNLNKRNNFEENDYNFDNLHCTTTNL
FT                   QDHLNWQLDLTPMSDIDRVIATTIIDAINDDGFLTIPVSEIHASLNSDDFPLDIEEIEA
FT                   VRHRLQLFDPVGCASVNLAETLVLQLEQLPLEPKLLATAKKVILEDIELLGQHNYRQLM
FT                   KNHQISEKTIHEILQVIHKLNPKPGSLIHQDNIEYVIPDLTVKKIDNQWKVFLNQDILP
FT                   RLSINSQYAALIQRANNSLDNQFLKHNLQEARWFLKSIQSRQETLLKVATCIMEYQHGF
FT                   LEFGEEAMKPLILNDVASALDMHESTVSRVTTQKFINTPRGVFELKYFFSSHVNTDSGG
FT                   ECSSTAIRAVIKKLISTENRKKPLSDSKIAQLIGEQGIKVARRTVAKYREAMGIPPSNE
FT                   RKVISS"
FT   CDS_pept        complement(590387..590551)
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="lpp0543"
FT                   /product="50S ribosomal subunit protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11691"
FT                   /db_xref="GOA:Q5X7R2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7R2"
FT                   /protein_id="CAH11691.1"
FT                   /translation="MAAVTIKVKMESTAGTGYYKTTTKNPRNHPEKMELMMYDPKVRKH
FT                   VLFKEKKVK"
FT   regulatory      complement(590559..590564)
FT                   /gene="rpmG"
FT                   /locus_tag="lpp0543"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(590566..590802)
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="lpp0544"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11692"
FT                   /db_xref="GOA:Q5X7R1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7R1"
FT                   /protein_id="CAH11692.1"
FT                   /translation="MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENR
FT                   FVTLRLSTKGMRIIDKLGIKAVLDKIRAKGEKI"
FT   CDS_pept        591071..591784
FT                   /transl_table=11
FT                   /locus_tag="lpp0545"
FT                   /product="hypothetical protein"
FT                   /note="similar to S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11693"
FT                   /db_xref="GOA:Q5X7R0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7R0"
FT                   /protein_id="CAH11693.1"
FT                   /translation="MQRKIKSYVLRAGRISNRQQQGLDLWLEDYELKFDSPTPWNFAKE
FT                   FGRHDADTIVEIGFGMGTSLFAMAMNNPQCNYLGIEVHKAGVGSLVADLHEHQISNVRV
FT                   VVHDAVEVLQTKIPENSLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPSGFIH
FT                   CATDWEDYAEHILNVLSSESALFNQQKEGGYSPRPDSRPLTKFEQRGERLGHGVWDLVF
FT                   IKNKEVTNDKACNSY"
FT   regulatory      591747..591752
FT                   /locus_tag="lpp0546"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        591759..592883
FT                   /transl_table=11
FT                   /locus_tag="lpp0546"
FT                   /product="hypothetical protein"
FT                   /note="similar to endo-1,4-beta-glucanase (hypothetical)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11694"
FT                   /protein_id="CAH11694.1"
FT                   /translation="MIKHATLISGLIVSFLASAAEMSFLAQLTEVPGASGYEKNVRHLV
FT                   QKQWQPYMAELKIDGMGNLIGQRKDNQQGPKLLFMAHLDETGFMVESITPDGFLKVIPL
FT                   GGIANSVIYAQRWTVSTPKGPVLAYSGMDSPHLLGDKKMLGSPDINALFLDIGAENKEQ
FT                   AQKEFAIQPGLEVTPVSEFSQLSKNRFLGKALDDRLGLAVISDALRAVKQQPNQLYLAA
FT                   TVQEEVGMRGASTVYKATHPDIAINVEVGIADDYPMLLADRKGRIGLGKGPSLFVYDKS
FT                   MIPNQELINWIMELADKNNIPLQLEVEPGYGEDGSKVQASGMGVPVVNIGIPIRYAHQH
FT                   AGIFDKRDYDNTVKLLRLIAENLNQEVVDKIKKS"
FT   regulatory      592948..592953
FT                   /locus_tag="lpp0547"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        592961..594448
FT                   /transl_table=11
FT                   /locus_tag="lpp0547"
FT                   /product="hypothetical protein"
FT                   /note="Protein with ankyrin domain"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11695"
FT                   /protein_id="CAH11695.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKQEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVTGKISLALHL
FT                   LGVDENNFTPEESEKTDVLSILSKVRKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   TKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLAGMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKADALRGIAMLICRGAEPPRNEKMRNLLSSNRVALLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQNSPRVVLK"
FT   regulatory      594646..594651
FT                   /gene="hflK"
FT                   /locus_tag="lpp0548"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        594657..595799
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="lpp0548"
FT                   /product="protease subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11696"
FT                   /protein_id="CAH11696.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VPQSENLKAIKNGTNVSNEEDNLILSGRDLTRPTYSQGRD"
FT   regulatory      595788..595793
FT                   /gene="hflC"
FT                   /locus_tag="lpp0549"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        595802..596716
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="lpp0549"
FT                   /product="membrane protease subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11697"
FT                   /protein_id="CAH11697.1"
FT                   /translation="MNAFKTTLGVLIFLVLVLLFTTMFTVTQGQQGIILRLGRLVKDPQ
FT                   TDAVKVLNPGLHFKTPFIESVRIFDTRIQTMDIKSTRIVTKEKKDVMVDYYVKWRISDL
FT                   AQYFKSTGGNEFKAETLLEQQLNTLLRAQFGKRTISDAVSGGRDDVMEILRNAAEKQAG
FT                   ELGIKVVDVRIKGIELPSNTSNAIYQRMRADMQKIANRHRADGQAAAEQIQAKADADVT
FT                   VLLAKTNSNAQRIRAVGEAEAAAIYSKAYTQNPDFFALYKSLLAYEASFHSKKDILILD
FT                   QSSSFFDYFKQAMPKNDGTAAKK"
FT   CDS_pept        596851..598146
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="lpp0550"
FT                   /product="Adenylosuccinate synthetase (IMP--aspartate
FT                   ligase) (AdSS) (AMPSase)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11698"
FT                   /db_xref="GOA:Q5X7Q5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7Q5"
FT                   /protein_id="CAH11698.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTLK
FT                   INGVKTVLRLIPSGMLRPNVTCYIANGVVLSPQALLSEIKELEGNGVNVRERLRISLAC
FT                   PLILPYHIALDKARETHMGKSAIGTTGRGIGPAYEDKVARRALRVGDLFHRDRFANKLT
FT                   ELLDYHNFVLTQYFKQPAVDLESLLDESLQWAEELRPMVCDVSACLHEHRKQGENILFE
FT                   GAQGVYLDIDHGTYPYVTSSNTCVGSVINGAGFGPRYIDYVLGITKAYTTRVGGGPFPT
FT                   ELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIELNSISGLCVTKLDVLDGLE
FT                   VLRIAVAYKDRDGNILSRPPLAADDFDDLLPVYEELPGWQESTADVTVMSDLPANARAY
FT                   LKRIEEILGIPIDLLSTGPERDSTITLRGPFL"
FT   CDS_pept        598367..598936
FT                   /transl_table=11
FT                   /locus_tag="lpp0551"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetial proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11699"
FT                   /protein_id="CAH11699.1"
FT                   /translation="MEYLTPKGLIPFITELKALNILQQDDNTNIALVSEILARWVVDKE
FT                   WLDEKFYYVNPEVGFNSWLIHEEKDHTLAVNIVAWQSGREITPHDHQTWGVVGSIIGVE
FT                   KNYFWKRMDDGSKPGYAEIIREKTAVIRPAGGVIGFLPNDIHSVINESDDVAISLHVYG
FT                   KNLNYTGRHQYDPVNNLMQPFIVNYS"
FT   CDS_pept        complement(599136..599594)
FT                   /transl_table=11
FT                   /locus_tag="lpp0552"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcriptional regulator of arginine
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11700"
FT                   /protein_id="CAH11700.1"
FT                   /translation="MTHDAFLDDLILSIVQTESIAEQSDLQNSLRKRGYEIPQATLSRR
FT                   LKKMKIAKVSGYYKIIDYNQPGLPLVLNVQISDFGLIILQTHPGNANSLAYYIDRKYVS
FT                   FSIKDSSNSGILGTIAGDDTVLLIIKSKSDQQKVLDILMKEFPYLFAS"
FT   regulatory      complement(599602..599607)
FT                   /locus_tag="lpp0552"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        599725..600459
FT                   /transl_table=11
FT                   /locus_tag="lpp0553"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative glutamine-binding periplasmic
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11701"
FT                   /protein_id="CAH11701.1"
FT                   /translation="MRKVFSLLLISSIIVISSCSEQKNQNTLRFSTSAEYPPFEYIENG
FT                   EIKGFDIDLAKLIAKELGKEAVFDNMQFSAVLPAVNSGQDDVAIATITITEERKKNFDF
FT                   SKPYYFEGMAAVFDTSQPVKEISQLTGKKIAVQLGSVMEIWLHQNFPKAEITALDNNNQ
FT                   AIEALIAGHVDVVLMDGAQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSA
FT                   LENLKAKGEIQKLESIWIKGSI"
FT   regulatory      600445..600450
FT                   /locus_tag="lpp0554"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        600456..601103
FT                   /transl_table=11
FT                   /locus_tag="lpp0554"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11702"
FT                   /protein_id="CAH11702.1"
FT                   /translation="MTEIVQNLFFIGKGIVLTMQLLTGGMLIGVLLGTLLSICRHQGVA
FT                   GFVINRFISILRGTPLILQLSFIYFAVPVLLGMRPSILVAGIVAFGLNSSAYFAEILRS
FT                   GIESLPKGQFEAALTLQIPTFYLWKDIILPQVIKNIFPAMINEMIALLKETALISTIGG
FT                   MDLMRQAQTLAAQQFTYFMPLCITGFYYYSLVLLLEALGKKIEKRGHYAASH"
FT   CDS_pept        601087..601755
FT                   /transl_table=11
FT                   /locus_tag="lpp0555"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid (glutamine) ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11703"
FT                   /protein_id="CAH11703.1"
FT                   /translation="MLQVINASKKIGDVQVLNEINLSIQANSIVGLVGPSGSGKTTLLR
FT                   CIQQLESIDSGSIQCEGKSGFMFQDFQLFPHMTVLNNLIYAPSLHDKTADHIANAWALL
FT                   AMLGLSDKAHSYPQGLSGGQKQRVALARSLMMKPDLLLCDEPTSGLDMATTNDVIALLN
FT                   TVKTLKITMLIASHDLFFLSNIAERLLVVRQGQLIADFKTQEVSDPILYLQQFYQGEIL
FT                   "
FT   CDS_pept        601752..602969
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="lpp0556"
FT                   /product="Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11704"
FT                   /db_xref="GOA:Q5X7P9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7P9"
FT                   /protein_id="CAH11704.1"
FT                   /translation="MKKVIKKIALAYSGGLDTSIMIPWLKEHYEHAEVIAVICDLGQQE
FT                   DLDAIKNKALKSGASKAYVVDVKNEFAIQYLWPLVKSGALYEDQYILGTISRPLIAQKL
FT                   VEIALTEEVNAVAHGATGKGNDQVRFEYSIKALAPQLEIIAPWRTWDIKSRQEAIVYAK
FT                   AHGIEVPVTPKAPYSRDHNIWYISHEGGVLEDPSQEMPDDVLLMTAPVSQTPDEEEVVV
FT                   LDFKKGVPVALNGQELSPVDLLNSLNQKAGQHGIGVADIVENRLVGMKIRGIYEAPAAA
FT                   VLYKAHKLLESLCLTRSTLHLKQSLQQTYANLVYEGRWFSQTKQALDAFIDVTQQHVTG
FT                   CVKLKLFKGNIIPAGMHSPYSLHHPELATFEEDNVYNQKDAEGFINLFSLSAKIYSQVH
FT                   QGGNYD"
FT   regulatory      602950..602955
FT                   /gene="argH"
FT                   /locus_tag="lpp0557"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        602962..604197
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="lpp0557"
FT                   /product="Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11705"
FT                   /db_xref="GOA:Q5X7P8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7P8"
FT                   /protein_id="CAH11705.1"
FT                   /translation="MTNKTWGGRFKKSLDSSVNQFNASLSFDHVLFDQDINGSQVHVKQ
FT                   LAKQKILTEAECQGIYSALEEIRTEIKQGQYSFNERDEEDIHMFIEQLLIQKIGDLGKK
FT                   LHTGRSRNDQVALDLRLYTRDKGCLINELLTRLIDCLDDLTSKHQQDLMPGYTHLQQAQ
FT                   PVALGAYFNAYQCMFGRDKSRLDDWFKRMNYSPLGAGALAGSTLPLDREWVAESLGFAG
FT                   IIPNTLDAVSDRDFVIELCSVAAMIMMHLSRLCEDLILWSTQEFNFVILDDAFATGSSL
FT                   MPNKKNPDVPELIRGKSGRVYGHLMAILTVMKGLPLAYNKDMQEDKEGLFDTINTIIAC
FT                   LQMITPFLQSLTFNTLLMKTKAQSGYLDATAILESLVMKGMPFRNAHHQVGAWIAEAIE
FT                   KQCSLNELLKGG"
FT   regulatory      604188..604193
FT                   /gene="argF"
FT                   /locus_tag="lpp0558"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        604200..605315
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="lpp0558"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11706"
FT                   /protein_id="CAH11706.1"
FT                   /translation="MSFSTSTNLTPIEMQDDDLEKIQSQNNPSAINEVKTNTFVINLQQ
FT                   AIFGLETGSEAVDFDSHKNTGFPFPAGEYKPRHFLTGTELAREEIQFVLSQARSLKQNP
FT                   GLYNQALANKSLVMIFEKPSFRTRLSFALAIQSMGGIVVESIANSRKQETPADMARVLN
FT                   GYADFVMVRTHEDSFLQEMAEYSKIPIINGLSALHHPCQTLADLLSLEEQFGALEGLTL
FT                   TYIGDGNNILHSLMLLAPQLGVTVHYCCPKSNQPNEAIIKEAQSKTGKQMIYCFDKPEE
FT                   AVKQADAVYTDVWTSMGFDNPEAVKIFKGFQVNETLMSHAKPDSVFMHCMPMERGKEVS
FT                   ATLPDSASSIIFRQSENRMHVQKALMLFLDQ"
FT   CDS_pept        complement(605404..606879)
FT                   /transl_table=11
FT                   /locus_tag="lpp0559"
FT                   /product="hypothetical protein"
FT                   /note="similar to adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11707"
FT                   /protein_id="CAH11707.1"
FT                   /translation="MNITRLLTFFTSFFLLCPIYASVDSYFSHIKKDSSALYAFFKTMP
FT                   KGGELHYHLAGGAYPETMLALAANGNYCLDKHSFAVSKDSSHCEGVNVKEVFNNPELYS
FT                   NIIKDWSMKDFIPGKESGHDHFFNGFVKYMPIVFDYRPQLLADIVQRAAQQKEQYMEIM
FT                   IIPDNAHSLTYGDLIKDIPSYDQKRHLLLANKDFQSNIKNTVLESDRILAKASQELGCK
FT                   DNPSSDSCLVKIKFIYYVLREQPVDNVFAQALNAFEAVSKSKGNLIGVNLVQPEDGIIS
FT                   LRDYHKHMSIFEYLHRIYPNVPITLHAGELSPQAVTPENLSNHIRDALLIGHAQRIGHG
FT                   VDIGYENNAEDTLKYMANHHIPVEINLISNLKILNISGRNHPLNYYLTHNVPVVLSTDD
FT                   EGVLRTDLTQQYVEAAKEHGLNYQQLKQINRNTLTYSFLPGKSIWANADKAELIPDCHD
FT                   LGSKSCQKFIEHNEKAKLQWSLEQQLIAFEKNY"
FT   regulatory      607042..607047
FT                   /locus_tag="lpp0560"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        607054..608169
FT                   /transl_table=11
FT                   /locus_tag="lpp0560"
FT                   /product="hypothetical protein"
FT                   /note="similar to ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11708"
FT                   /protein_id="CAH11708.1"
FT                   /translation="MPYFYTRSAPLFFVFVIALIFINFSYAHEFQTDSKNKHKVDVHIG
FT                   IYAPFSSHSAFIGRNILAAMEMGSERLQSSDIHYSFYTLDQLPKNKNAGLVLQKFIDTH
FT                   HINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTKVADGRNNFIVWSPVYDQAKVLVNE
FT                   LKRQQVHHLGIITANQPSSTALTHSVIKQLQADSHIDVAASEFFEPGNKDFSRLTSRIK
FT                   RKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERATPEVVKVFEGQWYVDSHEMQ
FT                   PDFINEFKQNYLNYPVTEAGYAFDLFQLLNKSIVMAIRTQGSPTRQEVVHQLHDIANST
FT                   GVMGTMVLDTKGSLFTKSEVKTVKNGEIHTV"
FT   regulatory      complement(608183..608221)
FT                   /locus_tag="lpp0561"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(608242..609579)
FT                   /transl_table=11
FT                   /locus_tag="lpp0561"
FT                   /product="hypothetical protein"
FT                   /note="similar to carboxy-terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11709"
FT                   /protein_id="CAH11709.1"
FT                   /translation="MVIKKLFSSTLALVYALTLMLPLTAFSAEETNSNYSNTKRIPLED
FT                   VQRFSNAIGEIKKYYVKPVDDKELFDNAIRGMLTGLDPHSSYLNEEEFKELQTSTSGEF
FT                   GGLGIEVTMEEGVVKVITPLVDTPAFKAGIKSGDYIIKLGKESVQGLSLKDAVNLMRGK
FT                   PGTTIELTILRKGVNKPLTFDLIREVIQIKSVKSKMLSEGYGYIRLTQFQALTGKDMIK
FT                   AIEQLKQQAGGKLKGLVLDLRNNPGGLLDSAIQVSDAFLGNDKAGKQEMIVYTEGRLPG
FT                   SKFTALANPGDVLDNAPIVVLINNGSASASEIVAGALKDNKRAIILGTKSFGKGSVQTV
FT                   LPLDGKTGIKLTTALYYTPSGVSIQAKGIIPDIIVEEVDVPKNAVKKDTLAGFTEADLN
FT                   GHLINKDNSENTESKNNQIQTGDLIHEDYQLYAALTVLEGMALANR"
FT   CDS_pept        complement(609660..610802)
FT                   /transl_table=11
FT                   /locus_tag="lpp0562"
FT                   /product="hypothetical protein"
FT                   /note="similar to membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11710"
FT                   /protein_id="CAH11710.1"
FT                   /translation="MHMPSLSNSLSGASLGLALMVILFFCNGLEAKAAPNSITQAQTKL
FT                   KQLDAKINKLKQVLANAQDKRTVLNQELGSTEKQIGEGIRKLRIIQANMSAKEKSIAEL
FT                   QGKINHLNKRLQAQQEMLANHVRARYQMGEYQPLKWLINQDEPFKINRILTYYQYIIRS
FT                   RQQLIDEIARTRQNLNDSKTKLGNELAENKQLQFKLSQNQKQLEQNKRYHSTLIQSIDN
FT                   DIQNNQQSLKDFQKDRDNLSHLMKSLSQQSVIQSGKPFTGMRKKLPLPVQTTHRSLRRM
FT                   NQGVTFFADEGSIVTAVYPGKVVFSDWLKGYGLLLIIDHGQGFMTLYAHNQSLFKRKGQ
FT                   IVQQNEQIASVGHTGGIKQNGLYFEIRQRGKAVNPLDWLS"
FT   CDS_pept        complement(610789..612333)
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="lpp0563"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to phosphoglycerate mutase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11711"
FT                   /db_xref="GOA:Q5X7P2"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7P2"
FT                   /protein_id="CAH11711.1"
FT                   /translation="MSHNAPLVLMILDGWGYNENDRYNAIAKANTPQWDEWWQTCPHIL
FT                   LKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNGKFAKNAVFHEVIDQ
FT                   LKKTEKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALD
FT                   SLKCLNEELAKHPVATINSICGRYYAMDRDKRWERVEPVYNLLTQGKSERQFPDAETAI
FT                   HFYYKNKISDEFVPPTLIGKEHSIQDGDAVLFFNFRADRARQLTSTFLDPLFKGFERKT
FT                   LPKLSCFVSMTQYDKNLFTTTAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFF
FT                   NGGCESVFTNEERIMVPSPQVATYDLQPEMSAHELTKTLIAAINSRDYHVIICNYANAD
FT                   MVGHTGNFEATVQAIECLDQCMQQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTA
FT                   HTSEPVPFLYVGGGWHFTHSEGSLIDIAPSLLALLGITPPPEMTGRILLEKNHAHA"
FT   CDS_pept        complement(612436..612732)
FT                   /transl_table=11
FT                   /locus_tag="lpp0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11712"
FT                   /protein_id="CAH11712.1"
FT                   /translation="MSRDTRNLILKAIILFISLTALVNHAMAFNLLGIGPNPKNLPKEN
FT                   DVRASFNHCKSCDKSTTPPLIITTPVPIIYYPGCRPIQSCDAYGHCEQKEDCY"
FT   CDS_pept        complement(612809..614080)
FT                   /transl_table=11
FT                   /locus_tag="lpp0565"
FT                   /product="hypothetical protein"
FT                   /note="putative phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11713"
FT                   /protein_id="CAH11713.1"
FT                   /translation="MKKSIHRLVKPRLFAMSISLLAFSSIIYGESNGSFALSEHWSMGQ
FT                   QIKLRFDINEVPQSGAVLHLKNGLALTAGDIISLGDLYGIVGKPISHGLTKLEKQTRFK
FT                   EVFNSFARNVIAVSEVEDLNSVIRAEMREVESGIAKGETAEAIYKRIGNEVGRQINCIT
FT                   GGGCNSLTWWLNPGRYLKLAIENYDHFTPNNLIAYKSGHHVALQQALKAKRTGKRSDLE
FT                   IAYAMDAFACHYLSDHFAAGHLRTPREELSAIITPTVLGALLSNYMHNEENKYGIHVTN
FT                   NLGEQWMVYGDYSYFNPFNQTNQQMLLKALQASADEIFEAYYSGVLPEKNQIEDMIPHI
FT                   TKLNDENNMDIAPMFYWDKENKQLLRRTNLTNPYDRHWTNSWWGWSTLLLLKTQYGITS
FT                   TVQLSLSKYLSQYVPEELQDNPLV"
FT   regulatory      complement(614086..614091)
FT                   /locus_tag="lpp0565"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        614430..615146
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="lpp0566"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11714"
FT                   /db_xref="GOA:Q5X7N9"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7N9"
FT                   /protein_id="CAH11714.1"
FT                   /translation="MNHKLPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCC
FT                   LEKKISCLSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPL
FT                   SQVLQKQMYDAEALTRNNQQLILNVVVNYGGKWDIVTAAKKLIHSVLDGKLACDEINEA
FT                   VFAQFLDTSGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTDVHWPDFNEHEFELALT
FT                   SFARRARRFGQISQSE"
FT   CDS_pept        615157..615954
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="lpp0567"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11715"
FT                   /protein_id="CAH11715.1"
FT                   /translation="MFMQRLITTLILAPLVLLAIFYAPSWILWGIVLVILLLAGLECFK
FT                   LIPVDNLTVQACFLIFLLMCFWASGYFYPYWLSVGLLVWLLNGLAILTYPRSQNYWGYP
FT                   IVVAIASLILLPLFTQSLIQISFLQQGKELLVYLLFLIWASDIGAYLAGKQWGKHKLIP
FT                   KVSPGKSWEGVTGGVILAMIVATLGYYYFIPYSIYIWFGLALSTVVISIFGDLFISILK
FT                   RRCQLKDTGNIIPGHGGILDRLDSLIAALPWFYFGLTYIPLGI"
FT   CDS_pept        615987..617339
FT                   /transl_table=11
FT                   /gene="ecfE"
FT                   /locus_tag="lpp0568"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative membrane-associated Zn-dependent
FT                   protease EcfE"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11716"
FT                   /protein_id="CAH11716.1"
FT                   /translation="MLSTLLYFLLALVLLVTIHEYGHFQVARWCGVKVLRFSFGFGKIL
FT                   ARFYDKKGTEYAWSLFPLGGYVKMLDETEGEVSEKEKPFAFNNQSVLVRIAIVVAGPLF
FT                   NFIFAFVALWLVLVIGMHSLAPMIESVRPNSIAARAGLAPKQEILALNGVKINSWRDFQ
FT                   YEIMPLIGSQETVSLTVKSMINGEESTLLLPLDKWQLDNKKPDPIKSLGIVPFIPTIPP
FT                   IVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWLYLVSYVRERPNSQINLDIKRQGKLL
FT                   KITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLRLEQQPPISALGTAFKQTVQLTGTTF
FT                   ILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGLVSYLFFLALVSISLGALNLLPIPML
FT                   DGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLLVALMFVALSNDISRLTS"
FT   regulatory      617494..617499
FT                   /locus_tag="lpp0569"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        617510..619822
FT                   /transl_table=11
FT                   /locus_tag="lpp0569"
FT                   /product="hypothetical protein"
FT                   /note="similar to protective surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11717"
FT                   /protein_id="CAH11717.1"
FT                   /translation="MKKVSNKLILGVCCSTLLAWSSQTFSSDTFIVKGIRVNGLQRVST
FT                   GTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGNVLVVNVVERATIGSIT
FT                   VVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAYTARGKYNSRIETKVTP
FT                   LTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLTTSNLFTYFTKKDQYSK
FT                   PGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIHIEEGPQYHFSGYDVVG
FT                   KTILPKEKIDSLIQVKKGDVFSRKKVTESISAIGLALGDVGYGFPAINAEPRIDENNKT
FT                   VFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLLSLHNIKESERQLRMLG
FT                   YLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNGYQFNASVNQRNFMGTG
FT                   RSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDPKNLNVSTYSSNRYGGD
FT                   ISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNHFQEIRLTSGWSRNSYD
FT                   QMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTRGWIFSVLGNVGYGNTF
FT                   DNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGANFLVNGSVGLILPYPLS
FT                   RDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWRSPFGPLSFSLAKALNP
FT                   QPLDQTQLFQFALSSGF"
FT   regulatory      619925..619930
FT                   /locus_tag="lpp0570"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        619936..620436
FT                   /transl_table=11
FT                   /locus_tag="lpp0570"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative outer membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11718"
FT                   /protein_id="CAH11718.1"
FT                   /translation="MKRLGAVLVALFLGLFGTTVFADWAKIGVVDLQKIMQTSNQMKEI
FT                   QQKLEKEFKPRRDKLVAMEASLKSDMEKFKRDSAIMSASQKKELEKKIVASQQQFERDG
FT                   QQYQQELSTAHNEAMEGLYNKVRTAITKIAKDEKYDIIVQKDAAPFSSESLDVTDKVIK
FT                   AIN"
FT   CDS_pept        620450..621460
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="lpp0571"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11719"
FT                   /protein_id="CAH11719.1"
FT                   /translation="MLTLEELANYLNGVWHGNANHAIFSLSSLARASSKDLAYFDNPLL
FT                   QSVLNSTRAGAVLLKPEHKDWCPVNCIVVPNPSEAMFRAAKSLPHLATNVCGIHPTAQI
FT                   HKSAQIGQYVSVGANSVIGENVQLDDYVTIGSNTTIESSVLIGRGSQLGSGSIIHSGTV
FT                   LGQSVIIDSGCIVGAAPFNCYKEHGVWQQAPNFGGVVIGQRTQIGANTVIHRGSIGDTY
FT                   LGDGVCIDSLVLIAHDVYIGNNTAIAGCAAIGALVQIGSDCIIGGASCLAANIRLTNDV
FT                   VITGMSTVTKSIARSGVYSSGTTVHDHRKWRRNAARFRHLDDYITKLITIEKKIE"
FT   regulatory      620485..620516
FT                   /locus_tag="lpp0570"
FT                   /regulatory_class="terminator"
FT   CDS_pept        621588..622040
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="lpp0572"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier
FT                   protein]dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11720"
FT                   /db_xref="GOA:Q5X7N3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7N3"
FT                   /protein_id="CAH11720.1"
FT                   /translation="MNESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINE
FT                   NFFTGHFPGNPIMPGVLMLEALAQACGILANLSRQPKEGYEFLHYFAGIDNARFKQVVI
FT                   PGDQLRLEVRLAGQKRDFWRMHGEAYIGDKLACSADLLSAAKEIKK"
FT   CDS_pept        622037..622807
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="lpp0573"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11721"
FT                   /protein_id="CAH11721.1"
FT                   /translation="MIDERAMIHPSAKLASGVSIGPGTVIGADVEIGENTWIGPHVVIE
FT                   GPTVIGKNNKIFQFASVGDEPQDITYKGEPTRLEIGDNNVIREYCMISRGTVKGGGVTR
FT                   IGNSNYLMAYSHIGHDCMVGNHIIMVNYAALSGHVTINDYAIIGPYAAVHQFCQVGAYA
FT                   FIARATYVTKDVLPYVMIAGHTTSACGINTVGLRRRGFSSAAIDCLRRAYKIIFRKGLT
FT                   VQQAVSELELIQNECPEIIPMIDALNQSTRGIVR"
FT   regulatory      622799..622804
FT                   /locus_tag="lpp0574"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        622811..623215
FT                   /transl_table=11
FT                   /locus_tag="lpp0574"
FT                   /product="hypothetical protein"
FT                   /note="Similar to integral membrane protein possibly
FT                   involved in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11722"
FT                   /db_xref="GOA:Q5X7N1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7N1"
FT                   /protein_id="CAH11722.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLITN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
FT   CDS_pept        623237..624517
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="lpp0575"
FT                   /product="hypothetical protein"
FT                   /note="Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11723"
FT                   /db_xref="GOA:Q5X7N0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7N0"
FT                   /protein_id="CAH11723.1"
FT                   /translation="MLDNQLLRENPQYVATQLLKRGFQFDAVTFSQLEEKRKALQVSTQ
FT                   SLQNERNLRSKAIGEAKSRGENIEPMREEVNKLGAKLEQQKTELDEILKQIEVISLSLP
FT                   NIPHESVPVGKDELDNQEIRKWGDVPAFSFPVKSHDELGEALGQMDFALAAKITGSRFV
FT                   VMKGHLARLHRALIQFMLDIHIQQHGYQEIYVPYIVNADSLLGTGQLPKFEADLFKLTG
FT                   DNGYYLTSTSEIPVTNTVREMILSAEQLPIRYVCHSPCFRSEAGSYGKDTKGMIRQHQF
FT                   EKVELVWITKPEDSYNALEQLTQHAEVILQRLNLPYRVVALCTGDIGAGSAKTYDLEVW
FT                   LPSQNTYREISSCSNMEAFQARRMKARFRNPDTNEIQLVHTLNGSGLAVGRTLVAIMEN
FT                   YQDEHGNIHIPDALKPYLGGIDIISVK"
FT   CDS_pept        624685..624879
FT                   /transl_table=11
FT                   /locus_tag="lpp0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11724"
FT                   /protein_id="CAH11724.1"
FT                   /translation="MAKNHRYQWKGKIFFRDYLLSHPEAAEKYQQLKIKLAQEHKYDRE
FT                   QYTDAKSEFINQILKLAQN"
FT   CDS_pept        625050..625313
FT                   /transl_table=11
FT                   /locus_tag="lpp0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11725"
FT                   /protein_id="CAH11725.1"
FT                   /translation="MADQPPKSKWHEIKRLSEGDNKVDNNQAPVSTADRIKKLYLDTQV
FT                   GSPIDTVEEADAQRNNLGPKDTKIENSSPENDEPNPDIPTPG"
FT   CDS_pept        625653..626585
FT                   /transl_table=11
FT                   /locus_tag="lpp0578"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to eukaryotic phytanoyl coA
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11726"
FT                   /protein_id="CAH11726.1"
FT                   /translation="MDNLLNEKKLTIFTSNEIQDNLNRVLKNYEQNGIIGLNGYLNQAN
FT                   RISLLNELEIIQKDAEQDIVRYWNNKIIHFYSKDPLKPESVDREYVTEPYFQASSNKAH
FT                   VFYEVIDNMRVVNRIGHGMHLINRYPIMQRAVYDSPVLLDLLKGIGFKKPICHLSVYIP
FT                   KYPNGIGSEVKPHQESTFAFTEPQSVVVLWVALEDALIENACMYGVLGSNHWPLKWVSK
FT                   VDRETKTRHFEQVHQLHIPDFMTEREFYTALEVKAGDALLFHGNFVHCSPMNTSKNSRK
FT                   ALSFQFIETYEVDYPETNWLYPPNKVYLY"
FT   CDS_pept        626621..627433
FT                   /transl_table=11
FT                   /locus_tag="lpp0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11727"
FT                   /protein_id="CAH11727.1"
FT                   /translation="MSMYDKRQFFKTYFSSASEKSILVKLLDKRFHPPSHTANILDLGC
FT                   HDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTAEDYFD
FT                   VCTDHFDWIFASQCLYWSPDLSKIIKQIHEAGDSALIVIRGCHGIYEIQSQFRHYIGNH
FT                   LEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEESLGDKI
FT                   FCEVRDWITSRTSGSIHHEVHFFWLGDAIFTGDYNMNFPVKSKKNSRG"
FT   CDS_pept        complement(627423..628253)
FT                   /transl_table=11
FT                   /locus_tag="lpp0580"
FT                   /product="hypothetical protein"
FT                   /note="similar to oxidoreductase,aldo/keto reductase
FT                   family,related to diketogulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11728"
FT                   /protein_id="CAH11728.1"
FT                   /translation="MDLGFPTFIYGTAWKEKRTSELVELALTTGFRGIDTANQRKHYYE
FT                   EGVGYALQQYYKKSDILRDDIFLQSKFTYAHGQDHRKPYDDTASLTIQVQQSFASSLEH
FT                   LNTDYLNSYILHGPYYQYHFSDEDKEVWNKMESLHKDGKVKHLGISNVSYEQLIELISF
FT                   ASVKPKFVQNRCFARLLWDKQIRNYCQAHRIIYQGFSLLTANQYELRHPKLENLSKKYE
FT                   KSIEQIIFRFSQQIGMLPLTGTTNLDHMKEDLAIHQFRLTDDEINFIENIAFIP"
FT   regulatory      complement(628261..628266)
FT                   /locus_tag="lpp0580"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(628692..629540)
FT                   /transl_table=11
FT                   /locus_tag="lpp0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11729"
FT                   /protein_id="CAH11729.1"
FT                   /translation="MTDLRTEIESLIHNELLPDREYVSAKRFINHYANTNEFWAGLASV
FT                   GITPIINGLYACYYASRAVWATLRTVGNLLILKPGLALDAIKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVEILTRVISSWFVGQEARHDLLETGLMAKWANRVSGYQMVNELPSSNYFNKA
FT                   RFFSSYNNAWDCLEQMASPMTSLAKGGFHSLVEAFYGVESAIECIVNLAICKPLHAKEN
FT                   FHSLQVHFGLAVSLAVMTPINALVEGIAFMTRLGTTWVSACIKPEVTETEHENTTAYQF
FT                   N"
FT   CDS_pept        complement(629527..629817)
FT                   /transl_table=11
FT                   /locus_tag="lpp0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11730"
FT                   /protein_id="CAH11730.1"
FT                   /translation="MPHSIFVVFHTAFFHHNMCCIMADWGVRHNKENLFNELYPIRVLL
FT                   ILWPLVYVQKTLENRCKHQIQHGPILVIYVFFGYTLPACLINIERDHNDRP"
FT   CDS_pept        complement(629878..630369)
FT                   /transl_table=11
FT                   /locus_tag="lpp0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11731"
FT                   /protein_id="CAH11731.1"
FT                   /translation="MPKMRQLFMNAENNVLNTLNSLSKEINKLYGYVTIAGDNFGEPAI
FT                   NSGPCGPFANAFYKIWNQKFTEKVNIAFIMMKNSDECWHILIRLPNGLLFDGGFGVHNE
FT                   DKWNKDTFEIEDMLEYDLQLLEKHSGGLNRTYPRYCPDFSIDVITNLIHKHLELVEKNK
FT                   "
FT   CDS_pept        complement(630329..631087)
FT                   /transl_table=11
FT                   /locus_tag="lpp0584"
FT                   /product="hypothetical protein"
FT                   /note="similar to methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11732"
FT                   /protein_id="CAH11732.1"
FT                   /translation="MTKLKNLDTYLSLCTEVYDLSKPNPPEEDYAFYRSYVINVKGPIL
FT                   EPMCGTGRFLLPLLEEGFEIHGFDASEYMLEALNIKAKAKNLKPTVWRGFVENLTRPEK
FT                   YNLIFIPSGSFCLLIDPATVRLALQTFYNHLSDEGILLFEGETLKAVPQLDVWRGSVWH
FT                   KPNGQMIMLSQLATLKDQVCHSIGKYELVHDNSIIHTEVEELRVRIYDPQELTAILKSC
FT                   GFKNVRLIKAFDSAATPDAQDETIVYECRK"
FT   CDS_pept        complement(631053..631661)
FT                   /transl_table=11
FT                   /locus_tag="lpp0585"
FT                   /product="hypothetical protein"
FT                   /note="Similar to adenosine phosphosulfate (APS) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11733"
FT                   /protein_id="CAH11733.1"
FT                   /translation="MTPHIIGISGITGAGKSTLAKALSLDLKATLISWDDFDDISLEPE
FT                   DYIEWYHKGCNYSEFQREDLAKVLAELKAKREIMHPVLGTLLNPAEYIIFDAPLGKLHV
FT                   QTGEYIDTCVHIEVPLDISLCRRILRDFKDKLQTKENLLEEISFYLNHSRPLFFDDELK
FT                   QSATIVIDGLLSTEVQIQIIKNFLIGKQDDKIKKPGYLS"
FT   CDS_pept        complement(631658..632125)
FT                   /transl_table=11
FT                   /locus_tag="lpp0586"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11734"
FT                   /protein_id="CAH11734.1"
FT                   /translation="MITIDLLKNHPQSIARCATIWHEVLGKIWVPEIPVEQVIQRFSEH
FT                   LNADKLPITFIALDTGKPVGMCSLRENDGIRPEISPWLGSLVVDPVYQRQGIGNKLIEA
FT                   TKNKARDLGFNKLHLFAFDPTIPNYYSRLGWTIIGMDKFKGHPVTVMEIVL"
FT   regulatory      complement(631669..631674)
FT                   /locus_tag="lpp0585"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(632122..633120)
FT                   /transl_table=11
FT                   /locus_tag="lpp0587"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to C.burnetii hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11735"
FT                   /protein_id="CAH11735.1"
FT                   /translation="MKSNHIKRLCQHFNLGDPTQEPQRVPGGLLHIMWQLNTDKGSFAV
FT                   KQLSKDINLTDYHVIRNYELSENIASGFIALGIPAVTAIEKSGKHLFIINETGFLVYPW
FT                   VNAKALDKDVVSVSQALEIARILSKMHQIDLQLKEIEEAEFDIHEKDKIIALIDLSQKK
FT                   KLPIASSLMEKLVTILEINTNYHDAILMLKAHSVISHGDLDQKNVLWDSSKKPILIDWE
FT                   SARKLNPTYEIVNAALDWSGITTQLDKNLFGKMLRAYKEAGGVIDKDIVEAAFFGVLGN
FT                   WINWMVYNIQRAANHCVPEQQKIGMEQVMQVLPTVLRLKSLIPELVNAGKA"
FT   CDS_pept        complement(633117..633527)
FT                   /transl_table=11
FT                   /locus_tag="lpp0588"
FT                   /product="hypothetical protein"
FT                   /note="similar to P.aeruginosa probable fosfomycin
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11736"
FT                   /protein_id="CAH11736.1"
FT                   /translation="MITGINHITLAIKDLNKSFAFYANVLGFKPLVRWDKGAYFLAGDF
FT                   WFCLNVDANQRPTPCYTHYAFTVTQEQFDEMSKAIIQSGIKIFKENTSPDDSLYFLDPD
FT                   GHKLEIHAGNWQSRLIAKKINPGTWQNVEWFV"
FT   regulatory      complement(633128..633133)
FT                   /locus_tag="lpp0587"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(633524..634087)
FT                   /transl_table=11
FT                   /locus_tag="lpp0589"
FT                   /product="hypothetical protein"
FT                   /note="similar to aminoglycoside 6'-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11737"
FT                   /protein_id="CAH11737.1"
FT                   /translation="MNINFEKANASYIELIFSWLKEPFVQEFWDNTQAHKDDILNFING
FT                   RTEPSSYADGKYVYWIASGNGHPFAMLMTIQETSEDEIDEIKLINLSKTGHSYGIDYMI
FT                   GDKNYFGIGYGARTLIEFIDFFIKEVDPKADTFLIDPESDNPRAKHVYIKAGFEYVADF
FT                   LMSGDVSGAGKLHHLLIKRIGLIK"
FT   tRNA            complement(634119..634195)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 84.61"
FT   CDS_pept        634498..635124
FT                   /transl_table=11
FT                   /gene="lvgA"
FT                   /locus_tag="lpp0590"
FT                   /product="hypothetical protein"
FT                   /note="Unknown virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11738"
FT                   /protein_id="CAH11738.1"
FT                   /translation="MADGDIEIKAGFVDTDLDDRKLTMIDDLNNPLAIVERVYLIWWHW
FT                   ADFHLHVISPHIDTITPAIVIEPELIPGSNDHEFVYSIHDSGSKLSTSKSQDMFSAGMS
FT                   MCKLFYTIEKMVHILVDRLKSGGVSLEEEVQIAFAGHEIAQRKAFESIINLPYNVVVTN
FT                   FDPGIWGEKYLQNVKRLADKGYGYPPESPRENYKHPVSSATTARK"
FT   CDS_pept        complement(635154..635531)
FT                   /transl_table=11
FT                   /locus_tag="lpp0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11739"
FT                   /protein_id="CAH11739.1"
FT                   /translation="MFFIKYLGALIYDLIILFILFFAYTSVLLLFTHGQAIPPATRWYQ
FT                   FSLFSITLVYYYGSIRCGGQTVGMKAWRFKLTTDSNKTLSRQQIIARFFYFIPATLIAP
FT                   FCLKGNYVLLHQWTQTHFKKV"
FT   regulatory      complement(635542..635547)
FT                   /locus_tag="lpp0591"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(635681..636820)
FT                   /transl_table=11
FT                   /locus_tag="lpp0592"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11740"
FT                   /protein_id="CAH11740.1"
FT                   /translation="MIAKRPIYNQQLKCVAFEILSCRNVILNEELTRQFYELIYHTDTQ
FT                   LPLFVPFSLKKLLEQFETPINNPIILKLSADEIESVYSLTELQDSLFSIALLINTPQQL
FT                   AWLNFAEYIGLTEQLMSKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCKAMTMDYYCG
FT                   DFLLNYIAEEHTEIAANKLNVLQLIQELQKEDCDLNTITHIIQEDPLLSYQLLKLVNSV
FT                   GFSSGPSIESIDQAVARLGTINLKKWVMLFSMKNISDKPIEILESGLIRAHMAEELAKK
FT                   SSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKNALTNKSGPLGNLLSLVIA
FT                   YEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
FT   regulatory      complement(636826..636831)
FT                   /locus_tag="lpp0592"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      637126..637131
FT                   /gene="sdhC"
FT                   /locus_tag="lpp0593"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        637141..637515
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="lpp0593"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11741"
FT                   /protein_id="CAH11741.1"
FT                   /translation="MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILG
FT                   CSLQSEESFAQTKIILANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLRAGRMS
FT                   AVSIIALAVILAIFLGIWIW"
FT   CDS_pept        637509..637856
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="lpp0594"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11742"
FT                   /protein_id="CAH11742.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNF
FT                   SQWHLLFANKLFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQ
FT                   FIWGLMIIWGQ"
FT   CDS_pept        637858..639627
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="lpp0595"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11743"
FT                   /protein_id="CAH11743.1"
FT                   /translation="MTVARNRFDAVIIGAGGAGMRAALQMTNSGLKVALLSKVFPTRSH
FT                   TVSAQGGITAALGNADEDDWRWHMYDTVKGADYIGDQDCIEYLCKTGPEAVYELEHMGL
FT                   PFSRMDNGKIYQRQFGGQSKHFGGEQAARTCAAADRTGHALLHTLYQQNLKAKTHVFSE
FT                   WYALDLVKNSQGRIAGVTAMCMETGEIVFFQTRVCILATGGAGRIFQSTTNAFINTGDG
FT                   FGMALRAGIPLQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLINKDGERFMERYAPRVK
FT                   DLASRDVVARAMALEIRAGKGFDPKGVDHVKLKLDHLGADLIMSRLPGIRELSMKFAGV
FT                   DPIVEPIPVVPTCHYSMGGIPTNMHGQVITKTDGKEHVVEGLYAVGECACVSVHGANRL
FT                   GGNSLLDLVVFGRAAGIHVEELWQSNQLPDMSYVSEDDVVASLVRYERWENSKDGESHA
FT                   VIRDEMQRVMQEDFGVFRTGEVMASGLKRLQALRDRLAHAKLDDKSQIFNTERVEAMEL
FT                   DNLMATAYATALSAIARTESRGAHSREDYPKRDDANWIKHTLYFEEGEVIDYRPVNTSP
FT                   KYVEPFEPKERVY"
FT   CDS_pept        639640..640362
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="lpp0596"
FT                   /product="succinate dehydrogenase, iron sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11744"
FT                   /protein_id="CAH11744.1"
FT                   /translation="MADSRNVILSIYRYNPEVDAKPYMKDYEIEIPAKSDPMLLTLLER
FT                   LKAEQDPSITYRRSCREGVCGSDGMNINGTNGLACITHLSQLKTDKIVIRPLPGFPVIR
FT                   DLAVDMTQFYQQYERIEPYLQNDEVAPARERLQSPEERAQLDGLYECILCACCTSSCPS
FT                   YWWNPDKFVGPAGLLQARRFLADSRDKATQHRLDLLQDPFSVFRCRTIMNCTNVCPKGL
FT                   NPTQAIAKIRTQMLTQET"
FT   regulatory      640406..640411
FT                   /gene="sucA"
FT                   /locus_tag="lpp0597"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        640420..643230
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="lpp0597"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11745"
FT                   /protein_id="CAH11745.1"
FT                   /translation="MSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVF
FT                   SALPKVNGATKEVSHRDIRDYFLQNADKKLNKIIQIADSQQYQVASLINDFRSLGHLAA
FT                   KLDPLEMTERMPVPRLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRS
FT                   IGIEYMHISDTEVTEWLQHKMESVRGCPEFSKQEKLNILKDLIAADGLERYLGTRYVGQ
FT                   KRFSLEGGDSLIPMMKELIRRSGVNQVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFE
FT                   GKIKYERTGDVKYHLGFSSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRN
FT                   DLAKKDKVVPIVIHGDAAFAGQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPL
FT                   DARSTLYCTDVAKMVQAPVIHVNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHG
FT                   HNEADEPSVTQPKMYKKIKSMPTLREKYGEQLVSVNLLTKTELDKLVDSYREALDKGKA
FT                   VVDLVHEDYEGKQSLDWTPYINAKWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVE
FT                   RLLAERNKMTAGEIPMNWGYAEIMAYASLLHEGYGVRISGQDSGRGTFAHRHAALHDIE
FT                   KGDTFIPLEHISTNPKRYFTVIDSVLSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANG
FT                   AQVVIDQFISSGEQKWGRLCGLVMLLPHGYEGQGPEHSSARLERYMQLCAQHNIQVCTP
FT                   TTPAQIFHLLRRQVIRNFRKPLIVMTPKSLLRHKLAVSPLEALFKGKFHTVIPEIDALD
FT                   AQKVTKVVLCCGKVYYDLLQMRRDKNLNHVAIVRIEQLYPFPKKALMAELEKYQKANEV
FT                   VWCQEEPQNQGVWFSSQHNIRDCLRSDQTLQYAGREFAAAPAVGSPGLHAEQQVALVEQ
FT                   ALLGKK"
FT   regulatory      643253..643258
FT                   /gene="sucB"
FT                   /locus_tag="lpp0598"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        643266..644495
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="lpp0598"
FT                   /product="dihydrolipoamide succinyltransferase, E2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11746"
FT                   /protein_id="CAH11746.1"
FT                   /translation="MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVV
FT                   LEVPSPVDGVLSDILFNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISES
FT                   ESVSTKEDKSTSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAE
FT                   VQKESSMRTLSFGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRS
FT                   QYKDSFEKKHGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTER
FT                   GLVVPVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATP
FT                   IINPPQTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELL
FT                   EDPSRLLLNV"
FT   regulatory      644512..644537
FT                   /gene="sucB"
FT                   /locus_tag="lpp0598"
FT                   /regulatory_class="terminator"
FT   CDS_pept        644558..645721
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="lpp0599"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11747"
FT                   /db_xref="GOA:Q5X7K6"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7K6"
FT                   /protein_id="CAH11747.1"
FT                   /translation="MNLHEYQAKQLFASYGLPVPRGEVAYNVEDALLVASQLSTSRWVV
FT                   KAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEETCEI
FT                   DKELYLGAVVDRATRRVVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCRET
FT                   AFKLGLKDDQIKQFTHLMMGLGKMFVDCDLSLLEINPLVITKSGQLICLDGKINIDGNA
FT                   LFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGG
FT                   EPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVD
FT                   VKIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKKIVAAVSE"
FT   CDS_pept        645796..646671
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="lpp0600"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11748"
FT                   /protein_id="CAH11748.1"
FT                   /translation="MSVLVDKHTKVLCQGFTGKQGTYHTEQALAYGTKMVGGVTPGKGG
FT                   QMHLGLPVFNTMREAVEETQADASVIYVPAPFCKDSIIEAAEAGVKLIVCITEGVPVLD
FT                   MLQVKVYIENNTQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAV
FT                   KQTTDKGFGQSTCIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEF
FT                   IKSHVKKPVVSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADL
FT                   GDAIAEVTGW"
FT   CDS_pept        647094..647741
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="lpp0601"
FT                   /product="hypothetical protein"
FT                   /note="Similar to pyridoxine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11749"
FT                   /db_xref="GOA:Q5X7K4"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7K4"
FT                   /protein_id="CAH11749.1"
FT                   /translation="MSKFRSLADIRRDYGELQLSEESAENDPISQFKLWFDDVLLNEKN
FT                   DPTAMVLSTVDEKGYPDSRVVLLKGLENGNFIFYTNYQSAKAMQIQKNPYAALNFYWPQ
FT                   MARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQEILDRISLEDALNQLIEE
FT                   YGQKPVVRPENWGGYMIIPDEIEFWQGRDNRLHDRIHYYRHGHEWTHRRLAP"
FT   CDS_pept        648354..648725
FT                   /transl_table=11
FT                   /gene="letE"
FT                   /locus_tag="lpp0602"
FT                   /product="transmission trait enhancer protein LetE"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11750"
FT                   /protein_id="CAH11750.1"
FT                   /translation="MNDTTSLLSHLRLRFNIEHPSYEECYIFGYECALAEVPEEDNPFR
FT                   EGSQEAEQWLEGWWAGIYGEKPLFDLNNIEEDILLDKTTAANDQQYHHKNSFLSLVFEI
FT                   GGAIAASAIVGYQLLELVA"
FT   CDS_pept        complement(648796..649185)
FT                   /transl_table=11
FT                   /locus_tag="lpp0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11751"
FT                   /protein_id="CAH11751.1"
FT                   /translation="MNKLNIAIKEAFESSGSSKEANKVYLEFIKANFIIPIESNSDDSE
FT                   PRVLFLEENNHVFLPVFTDMKYLDAWASEISQHIKLLKLSGVDLLKGLGEKVTVCLDIG
FT                   SELYKEFNPSEIERMRSMVLKLFKN"
FT   regulatory      649836..649841
FT                   /locus_tag="lpp0604"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        649849..651117
FT                   /transl_table=11
FT                   /locus_tag="lpp0604"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11752"
FT                   /protein_id="CAH11752.1"
FT                   /translation="MEIYKRKNYLGFAWLVWGLAAAFYFSDYLARVAPGVMHRYLQMDF
FT                   GINEAGFGILTASFYVPYILMQIPVGLTVDRLSIRWLLTIMSLVTAFGCCVFGLADGLL
FT                   TASIGRMLIGFSAAFAFICSLRLATSWFPPTMLGLLSGLTQALGMLGAAAGEAPVSFLV
FT                   SNVGWRHSMLIIAFLFIALSGLLYQFVQDKPGEHRNEIRSVNRISILDSLKIILSNKQT
FT                   WLNALYAGFLFGPTAVIGEAIGPAYLQFGRGLGAHAAAFATGLIFIGWGISGPLSGWIS
FT                   DKMGRRKPLMIISAVCGVILSSLFVFIPEMSQTTAYILFFVFGLTNTGVAISYAVSTEI
FT                   HDRSVVGTSIAFTNMTSIFVGALFQPLVGRIIDIVSGPRAYNVETLLLSDFQAGLKLLP
FT                   LCSLVALILAFTVKETYCKPIRH"
FT   regulatory      651334..651339
FT                   /locus_tag="lpp0605"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        651345..652802
FT                   /transl_table=11
FT                   /locus_tag="lpp0605"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal part similar to unknown virulence
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11753"
FT                   /protein_id="CAH11753.1"
FT                   /translation="MKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEVINQSNGLFA
FT                   DIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKIYHGPIIYAN
FT                   KQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKSTVELSIPSFK
FT                   LTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGKVISEYDLHK
FT                   TTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFSAALKSLFAN
FT                   GQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPELPKLFSKGAE
FT                   FEISKLSLKLPQGMIDGNLLITLPKGDNSNPFELIQKTQGNAKLKMPIEVVKQLMQQSI
FT                   MQQMAKQPEMQQALIQQLQSSQGQSNQAEPTPEQIAAMQVDKQINELEQSGLITVDGKD
FT                   YVIEMSLSEGKFTVNGKPFDPSMMKFQ"
FT   regulatory      652975..652980
FT                   /locus_tag="lpp0606"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        652992..653273
FT                   /transl_table=11
FT                   /locus_tag="lpp0606"
FT                   /product="hypothetical protein"
FT                   /note="similar to DNA-binding proteins Fis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11754"
FT                   /protein_id="CAH11754.1"
FT                   /translation="MTTISNDAGDTTASLAESVTQSVQKYFSELKGTDPVDLYQFVLEE
FT                   IETPLFRAVMEHCKYNQSRAAIMLGISRGTLRTKLRRYFDDKYVGTRD"
FT   regulatory      653293..653308
FT                   /locus_tag="lpp0606"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(653293..653308)
FT                   /gene="prs"
FT                   /locus_tag="lpp0607"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(653335..654282)
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="lpp0607"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0607"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11755"
FT                   /protein_id="CAH11755.1"
FT                   /translation="MSTMMIFTGNANPELALKISSHLQIPIGKATVGTFSDGETMVEIL
FT                   ENVRGKDVFVLQSTCAPANNNLMELLIMADALRRSSAGRITAVVPYFGYARQDRRVRSA
FT                   RVPITAKVVADMMASVGICRVLTVDLHADQIQGFFYMPVDNVYSTPVLLEDITKQKLNN
FT                   IMIVSPDVGGVVRARAVAKRLNDAELSIIDKRRSGPNKSEVMHIIGEPANKNCIIVDDI
FT                   VDTAGTLCTAAQELKKNGAKSVRAYITHPVLSGPAVNNIKHSGLDEVVVTDTIPLSAEA
FT                   QNCEKIRVVSLADMLAQAIKRVNVEESVSSMFAE"
FT   tRNA            complement(654462..654536)
FT                   /gene="tRNA-Gln"
FT                   /product="transfer RNA-Gln"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 68.05"
FT   CDS_pept        complement(654664..655263)
FT                   /transl_table=11
FT                   /locus_tag="lpp0608"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative outer membrane lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11756"
FT                   /protein_id="CAH11756.1"
FT                   /translation="MNAIKRLTIILICFLTACAPPRPSEEPPANREIPLEERKAETATV
FT                   SSWEIKGALAAKTKAKGWSATMNWVQQGANSYQIRLMGPLGGGTVLISKKGNTITFQDG
FT                   SKITTSTNADELLLKQTGIRLPVNNLYYWVRGLPAPGGVQSEKHDQFNHLIQLKQNGYT
FT                   IDFTKYTSVKGIDLPSMIRLEGNGVMVKVVIKNWVV"
FT   regulatory      complement(655270..655275)
FT                   /locus_tag="lpp0608"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        655326..655832
FT                   /transl_table=11
FT                   /locus_tag="lpp0609"
FT                   /product="hypothetical protein"
FT                   /note="similar to phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11757"
FT                   /db_xref="GOA:Q5X7J6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7J6"
FT                   /protein_id="CAH11757.1"
FT                   /translation="MQMVINEMKQKAIYPGTFDPVTNGHIDIITRASTIFPELIVAVAS
FT                   NKNKRPYLSWETRISLLEESVGHLTGVRVVGFDNLLIDFVLEQSAGIILRGLRAVSDFE
FT                   YEFQLAGMNRKLSKKVETLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKK
FT                   RQNEI"
FT   CDS_pept        655822..657546
FT                   /transl_table=11
FT                   /locus_tag="lpp0610"
FT                   /product="hypothetical protein"
FT                   /note="similar to Gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11758"
FT                   /protein_id="CAH11758.1"
FT                   /translation="MKYNYKWLSCLFFLICNIYQVNAKTFPQHPPGYAVASAHPLATHA
FT                   GLEILAAGGNAFDAAVAVAAALAVVEPYHSGLGGGGFWLLHQEKEHLNLFIDGREVAPL
FT                   AASKDMYLAPDGQVIPGLSLNGGLSAAIPGQPAALVYIAKNYGRLPLSKTLAPAIKLAE
FT                   EGFPVDPQFRYFSTLDDRLENLKKYPDTAAIFLKNDKPFEIGEKLVQKDLAKTLRLIAK
FT                   YGNAGFYSGETASLLVQGVNAAGGIWSLDDLAQYKIKVRPPLISAYHNMLIITAPLPSA
FT                   GGVALVTMLNILSKFPLSSFPKLKWVHYVVESMRLAYWQRDQFLGDPDFIKIPLDKLIS
FT                   SDNAKQLSRLISPDKAIDSKVLQGSVPIGKHSNTSHISIIDTEGNRVAATMTINYIFGS
FT                   SVVAKGTGVLLNDEMDDFSTKVGEQNVFGLVGSERNAIEPRKRPLSSMAPTFLEMPGRV
FT                   AILGTPGGSRIPTMVLLASLLFYDGYGAISMVSAMRFHHQYLPDVLQFEPDTFPSSIQQ
FT                   GLQAMGYHLMPLKQYYGDMQAITWDKESNVLTAASDPRHIGLAAAISNMAYGYGVNY"
FT   CDS_pept        complement(657644..659860)
FT                   /transl_table=11
FT                   /locus_tag="lpp0611"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to D-amino acid dehydrogenase,
FT                   C-terminal cAMP binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11759"
FT                   /protein_id="CAH11759.1"
FT                   /translation="MSINKIEEDRDTSSDLEMKTKMYLVHRMDKAGPLTVKDVHILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRHLQFFLNKLDGKSINPILIPLSNKP
FT                   FWQNEPHPFDHYRSTDQLPEKADIVIIGAGLTGASTAYHLIDAVKKRNLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPHVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIARKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKSGIKLYTFVKVQQIKSMDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELSAIKPHQSQIAITESTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPDLKG
FT                   KPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGFAAAEIALTGKNP
FT                   PWLPADVFSPKRLLSDKPLFLEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYS
FT                   TISSLPHGHQEKTCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLNKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
FT   CDS_pept        complement(660069..660800)
FT                   /transl_table=11
FT                   /locus_tag="lpp0612"
FT                   /product="hypothetical protein"
FT                   /note="similar to 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11760"
FT                   /protein_id="CAH11760.1"
FT                   /translation="MKISRLKTFWIITRLFYYTGVACTRSIFKYLFSTPTRPWVDKVIH
FT                   HWVDQLLNAVKVEYKVINPHNVQPQPGKATILMCNHSSAYDIPLGFKAFPNNSIRMLAK
FT                   RELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESGIILWIAPEGTRSKDGK
FT                   LAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTI
FT                   ENKEELIEKTHQSIKKLVGEN"
FT   CDS_pept        complement(660869..661189)
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="lpp0613"
FT                   /product="hypothetical protein"
FT                   /note="similar to suppressor of groEL"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11761"
FT                   /protein_id="CAH11761.1"
FT                   /translation="MLLPWLYLIIAGLLEICWAVGLKYTDGFSKWQPSLFTVTTLIISM
FT                   FLLAKAAQTLPIGTAYAVWVGIGSLGTAIMGILLFQEHLSVFRLLYLVLMLISIFGLKY
FT                   TA"
FT   CDS_pept        complement(661528..662595)
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="lpp0614"
FT                   /product="hypothetical protein"
FT                   /note="Similar to DNA damage inducible protein P"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11762"
FT                   /db_xref="GOA:Q5X7J1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7J1"
FT                   /protein_id="CAH11762.1"
FT                   /translation="MNPIRKIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIA
FT                   TCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLVEPLS
FT                   LDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNG
FT                   QMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSVEYLLQKFGTMG
FT                   QRLYELARGIDNRPVNPERIRKSISVEETYPKDLPNSEACLAVLPDLMARLEARIQRAG
FT                   KISGIHNLFVKLKFNDFQQTTIERVMDKLDLIVLRQLIQEGFARRGMPVRLLGIGIKLK
FT                   QENTYQSIQLPLLDL"
FT   tRNA            662907..662980
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 73.39"
FT   CDS_pept        complement(663035..663655)
FT                   /transl_table=11
FT                   /locus_tag="lpp0615"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11763"
FT                   /protein_id="CAH11763.1"
FT                   /translation="MDIKKLKKAASDFLERYPDGFCHPEMIEMGKKHKMDKMVALAQGS
FT                   FARQNFKNPDEITNSMLKIVTQSSLISIFEKPKFRDFIKRTPPNDKVLIAKGLKELLYG
FT                   NEQEGFEELLFQFQREKLAKWTLMTVFQAYFNPEVDVFIKPTTTKNIIKELNLDIVYNP
FT                   TPSWEFYESYRNIINQMKTKIEKSLAPSNAAFCGFLMMSLDDR"
FT   regulatory      complement(663663..663668)
FT                   /locus_tag="lpp0615"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(663730..664554)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="lpp0616"
FT                   /product="hypothetical protein"
FT                   /note="similar to formamidopyrimidine-DNA glycosylase MutM"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11764"
FT                   /db_xref="GOA:Q5X7I9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7I9"
FT                   /protein_id="CAH11764.1"
FT                   /translation="MPELPEVETTKQGIKPHLEGRIITTAQVRNRKLRLPVPLNLNELC
FT                   EGKHITAITRRGKYILLHMDKGYILIHLGMSGHLRIVSQTANPQKHDHVDLHINNGLAL
FT                   RFCDPRRFGLFIYIDENPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDS
FT                   QIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDF
FT                   YSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT"
FT   CDS_pept        complement(664554..664784)
FT                   /transl_table=11
FT                   /locus_tag="lpp0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11765"
FT                   /protein_id="CAH11765.1"
FT                   /translation="MSDKVQKLIENIVPFIVIGVGIAIVVALLFMFFYVAIWGVIIGGI
FT                   LWLGALAKEYFFPSKSSQKEQGRIIEHDDKK"
FT   CDS_pept        664965..666152
FT                   /transl_table=11
FT                   /locus_tag="lpp0618"
FT                   /product="hypothetical protein"
FT                   /note="similar to fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11766"
FT                   /protein_id="CAH11766.1"
FT                   /translation="MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHP
FT                   VVSHFFRFWLWLTTGMVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYRE
FT                   ARKDRDMVAKYSHGTPTDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWI
FT                   PLFAAGVINGIGHYWGYRNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWW
FT                   EFDIGWMYIRILSLFGLAKVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSYYYKNV
FT                   IRPILKHEKNTSIETKEDKKLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYS
FT                   YKQSLQNVWLKTATTQKELVEALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE"
FT   CDS_pept        complement(666193..666591)
FT                   /transl_table=11
FT                   /locus_tag="lpp0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11767"
FT                   /protein_id="CAH11767.1"
FT                   /translation="MFNKFLVTTLSVVTLTLSPYGFAKDDSCEVQVAVSTPPVQFDQSV
FT                   AFNVTNDDGISKSIILQGGSSPKTIGKLICSPLPYTISATQYFTPTGLTNKHAQPVGQC
FT                   VLKAGNVILNGSNNSVAVVFPNDFICHH"
FT   regulatory      complement(666597..666602)
FT                   /locus_tag="lpp0619"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      666846..666851
FT                   /locus_tag="lpp0620"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        666857..667597
FT                   /transl_table=11
FT                   /locus_tag="lpp0620"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11768"
FT                   /protein_id="CAH11768.1"
FT                   /translation="MDKMIAIVTGGTGGIGSAISQRLADSYQVVACYYKDGRHEEAKKW
FT                   QDEQKQLGYDIDIVYGDIAQYSDCEKITSLVMERYGRIDVLVNNAGITKDCSLRKMTPQ
FT                   QWQQVLDANLTSVFNMTRNVVPVMLERGYGRIVSISSINGRKGQFGQCNYASTKAALFG
FT                   FTKSLALEVASKGITVNTVSPGYIETPMLAALKEDVLNSIISSIPVGRLGYPKEIADAV
FT                   AFLASPDSGFITGANLDVNGGQYM"
FT   CDS_pept        667776..668522
FT                   /transl_table=11
FT                   /locus_tag="lpp0621"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11769"
FT                   /protein_id="CAH11769.1"
FT                   /translation="MLNNNVVLITGGTGDIGTAVAKQLDSTFKHVIALDLVSYDEGEAW
FT                   LHDLKTQGYKNINFRHMDVTDYEQCAEVIGLIIEEFGGIDVLINNAGITRDAVFTKMTK
FT                   RQWDEVLRVNLDGMFNVTKQVVESMKAQESGRIVNVSSVNAQKGQFSQANYAASKAGVY
FT                   GFTKSLAQELMIKNITVNSISPGYVNTRLMKGIRPDILEGIINLIPAKRLAEPQEIAWA
FT                   IEFLISEKSRYITGANLSVNGGLHMY"
FT   CDS_pept        668652..669050
FT                   /transl_table=11
FT                   /locus_tag="lpp0622"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11770"
FT                   /protein_id="CAH11770.1"
FT                   /translation="MTRLIKKYKNRRLYDTEISQYITVEQLQKYVVDGIDFKIEDSETG
FT                   KDLTNSVLLQIIVEMEAGPTQFLSSEILRQIISLANHPMHVSFKEMMEQMFHAMDKPLQ
FT                   NNPYQQATEVWNKQMQQMVHQWQKMFKV"
FT   regulatory      669246..669251
FT                   /locus_tag="lpp0623"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        669257..669550
FT                   /transl_table=11
FT                   /locus_tag="lpp0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11771"
FT                   /protein_id="CAH11771.1"
FT                   /translation="MTQYNFERWSEMAKKIQEPFQAIAELNVKTLQGLSYLKPDELAQV
FT                   KKPEEMLEKQINLAVENGHKALDYMQKSFQIIEKAMLSLVQEAKKTTAEVKK"
FT   CDS_pept        complement(669796..670866)
FT                   /transl_table=11
FT                   /locus_tag="lpp0624"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11772"
FT                   /protein_id="CAH11772.1"
FT                   /translation="MKHTYNPFRYLIYFAFFITSLSSYSSQTTNIKEQTDTGLAPPAPS
FT                   VTTNSAAIEEQANSSIRKLYHTLNTMPNTSMVDRISQISAYFKGTKYILGSLGEGPNAR
FT                   YDQFPRYRVDGFDCDTYVNTVLSLALANSLESFQECLKHTRYKNGKRSYINRNHFTSID
FT                   WNNYNQKRGLLKDITFSIRNEKKQPVALYANALINKPQWYNHKTIDTIRLQKQDKNEQE
FT                   KRLVELKAKGKTLETSLSNVPYIPFTALFSENKPNLHLFSQIPNGAVIEIIRPNWDLRQ
FT                   QIGTELDISHLGFAIWINNELFFRQASSQYGKVVDVSLIDYLDKARSSPTIKGINIQVV
FT                   LPEKPVSNGCQLFDIR"
FT   regulatory      complement(670871..670876)
FT                   /locus_tag="lpp0624"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      670925..670930
FT                   /locus_tag="lpp0625"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        670936..671541
FT                   /transl_table=11
FT                   /locus_tag="lpp0625"
FT                   /product="hypothetical protein"
FT                   /note="similar to Bacillus subtilis spore maturation
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11773"
FT                   /protein_id="CAH11773.1"
FT                   /translation="MLNLIWLGMILISVVVGVIEGRIDEVVRAVTDSAKLGFELALGLA
FT                   GIMTFWLGIMSVATESGLVSILGKVLKPVLKRLFPDIPVEHPAMGAMVMNIAANMLGLA
FT                   NAATPFGLQAMKELQSLNQNLKVATNSMCTFLAINTSSVQLIPVTAIAFLAANGSTNPS
FT                   SVVFTSLIATTVSTLVAIVAVKQLAKLPRFKIERTDSL"
FT   regulatory      671524..671529
FT                   /locus_tag="lpp0626"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        671538..672071
FT                   /transl_table=11
FT                   /locus_tag="lpp0626"
FT                   /product="hypothetical protein"
FT                   /note="similar to uncharacterized membrane protein, similar
FT                   to Bacillus subtilis spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11774"
FT                   /protein_id="CAH11774.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALAMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
FT   CDS_pept        complement(672371..673804)
FT                   /transl_table=11
FT                   /locus_tag="lpp0627"
FT                   /product="hypothetical protein"
FT                   /note="similar to membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11775"
FT                   /protein_id="CAH11775.1"
FT                   /translation="MDKRPNIPKRKSGNSSKLLAFFALVFAFSLPYLLVKNFSHPKRSS
FT                   YADQTDLYPELSDELSRDIPAEASTEIPHEKPDIKSATKPMQTKQDQQDKPINTSHVKK
FT                   DNEWQIVNPRSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKNK
FT                   LEKLIVPVNTIQTLTVYRAGKIYKTKIDSKKTTTQNRYVTATVQGSLYTTAQRFNIPSK
FT                   LVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTYTNRGKTYQAI
FT                   RHTNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYRRAHKGIDLAA
FT                   PIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLSKGSRVKRGQ
FT                   VIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKAKASTLLARL
FT                   KLFEQAQLASKGKKKVNVG"
FT   CDS_pept        674061..675266
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="lpp0628"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11776"
FT                   /db_xref="GOA:Q5X7H7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7H7"
FT                   /protein_id="CAH11776.1"
FT                   /translation="MIVQDSVCSELMRGCEEILPVPELEKKLQKGIPLKIKAGFDPTAP
FT                   DLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTY
FT                   QHQVFKILDPDKTTVAFNSQWLNKFNAVDLIRLAATHTVARMLERDDFNKRYTTGQPIA
FT                   IHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGFEPQVVMMTPLIEGLD
FT                   GVKKMSKSLDNYIGINETPEQIFGKIMSVSDELMWRYIDLLSFKTGKEIQQLKQSVLEG
FT                   KNPRDVKIDFAKEIVARFHDQTQAELAHNNFIERFQKGNIPEDLEELSLVIVEPIALAQ
FT                   LLKQIDLTASTSESIRMVKQGAVKVDGDKISDPSLKLPIGKSYIIQVGKRRIAKLSIQQ
FT                   AD"
FT   rRNA            675455..676963
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            677067..677142
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNAscan-SE vs 1.3 result - Cove score = 88.89"
FT   rRNA            677309..680091
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            680312..680437
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(680614..681150)
FT                   /transl_table=11
FT                   /locus_tag="lpp0629"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11777"
FT                   /protein_id="CAH11777.1"
FT                   /translation="MNYSTRKFEDKYPELGERVYIDPQSTVIGNVTLGDDVSVWPMAVI
FT                   RGDVNYIQIGHSCSIQDGAVLHVTHDGPYTPGGRPLILGQGITVGHKALLHACTIDDYC
FT                   LIGMGSIILDSAHIQKHAMIAAGSIVPPGKILKSGHLYLGSPAQAVRKLTTKEIEQIEY
FT                   SAGHYIRLKNKYLTY"
FT   CDS_pept        complement(681157..682515)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="lpp0630"
FT                   /product="Glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11778"
FT                   /protein_id="CAH11778.1"
FT                   /translation="MKTKHFDLIVLGGGSGGIASAVRAAQYGAKVAVIEQNHLGGTCVN
FT                   LGCVPKKIMYNASSIAETLHKSPDYGFFLENNAKLDWKRLVNKRNAYIERLRENYAKRF
FT                   SQHKITLIQGKGIFHDQSSITIDHTIYQAEHIIIATGGEPALPAINGIKHAIDSDGFFS
FT                   LTKLPAKVAVIGSGYIGVELAGILNSLGSETHLLMRGTRPLSRFDHMIGDTLMEIMQKQ
FT                   GICIHQNHKAQAIHLHSDGRKSILCQSGSIIENIDVIISAVGRKPRTGNLNLDKINVNM
FT                   DDKGLILVDAFQNTSVKGIYAIGDVTNTPALTPVAIAAGRRLADRIFGNQPDACLNYDN
FT                   ICSVVFSHPPSGSVGLTEHEAIEKYGKSKIKIYQTRFIPMYDALSVDKTPTAMKLVTLG
FT                   KKEKIIGLHVVGYSADEMLQGFGVAIKMGACKKDFDNTIAIHPTSAEEFVTMV"
FT   CDS_pept        complement(682746..683726)
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="lpp0631"
FT                   /product="hypothetical protein"
FT                   /note="similar to adenosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11779"
FT                   /protein_id="CAH11779.1"
FT                   /translation="MNLKKAELHVHLEGTISPDLAKKLAKRNHLTLPDGLIALDEKSYL
FT                   SKDFLDFLKVYDTLASVIKNPQDYYDITFDYLKSNAQEHAIYIEMMYSPDHAEQSSGIP
FT                   SKEHLAAIQQAIDDAKSQFDIVGRIIITAVRHFGAEACERVAKQASIDKFPCVTGFGLG
FT                   GDEAKFPPQLFSKAYQIAADSGLECTVHAGEFDSAKGMEEAMKTLPIKRIGHGVRVIDS
FT                   PDIMAMVKDQGIALEVCPTSNIFLGLFKNMNSHPFPKLYEAGIKVSINSDDPPFMSTTL
FT                   AQEYKRVQKAYGYSDNTMNNITRMAIEAAFVDEKTRKELLTKLEQ"
FT   CDS_pept        684108..684554
FT                   /transl_table=11
FT                   /locus_tag="lpp0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11780"
FT                   /protein_id="CAH11780.1"
FT                   /translation="MKNPSILQLNNPALLNKAMQLKSTGKVAISQNQLTYLKIHDEWIH
FT                   ELFPLLQNEQIRKPDYFGNESIGAHISIIYPEENTTINPKELDQEHRFKIKNIIKANLE
FT                   LKKYYAIIVEASSLVRLRKAYGLPENLYFKGYSIHFHITVGVEY"
FT   CDS_pept        complement(684595..685848)
FT                   /transl_table=11
FT                   /locus_tag="lpp0633"
FT                   /product="hypothetical protein"
FT                   /note="Similar to phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11781"
FT                   /protein_id="CAH11781.1"
FT                   /translation="MDYSIYLLFAALILCFLMTWGVGANDLANVMSTTMGSKAVTVRQA
FT                   MLIAIIFEFAGAFLGGEGVTETMRDGIINTSQLSNEPLILIEGMLCVLFACTIWMNLAS
FT                   YLGVPVSITNALVGSMVGFGTIVLGPDAIHWNQVARIAIGWVSSPLISGITAYALFISI
FT                   QQTIFVKSNPLTKAKLYIPIYLFLIGFILSFITVFKGLNHFDIHLNLKQDLAVTLATSI
FT                   IITILGMIFIKRIPEYHKIRRRERFIQVEKYFAVLMAMTACAMAFAHGSNDVALAVGPL
FT                   SIVHSLVMHSNQIFDADNYPSWIILLGCVGVVTGFLMYGRKVIETVGSSITALTPSRAF
FT                   AATLSAATTVVVATSTGIPVSATQTLVGAVLGVGLARGIGALNLIVIRNIFMSWVLTLP
FT                   AASMLTILSYKLLHALLG"
FT   CDS_pept        complement(685858..686529)
FT                   /transl_table=11
FT                   /locus_tag="lpp0634"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11782"
FT                   /protein_id="CAH11782.1"
FT                   /translation="MGSIFNMFGPSPIKPIEQHIRKAHQCAKQLYPFFEAVLKNDWDTA
FT                   NKIKDKIIAIEKEADLIKRDLRLHLPTGLFLPVARTDILELLSAQDRIANKAEDIAALI
FT                   ISRQMSIPKKLIPSFMPFLSRCLDASKQACTAINELDELLETGFRGSEVKIVEEMIVKL
FT                   DEIEHDCDERLADIRHKIFELEKELPAIDVIFLYKLVQWIGELADHAQTVGGRLQILIA
FT                   R"
FT   CDS_pept        686720..687484
FT                   /transl_table=11
FT                   /locus_tag="lpp0635"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11783"
FT                   /protein_id="CAH11783.1"
FT                   /translation="MIKRWLLVILLISGNAFSQQMITKVIELNYLQADKVIQLIQPLLQ
FT                   TDEKVSGSGQTLIVNVSPQTLTQIRNVLHKIDVPPVVFNITVYQGDPEWLSSQDGNDVS
FT                   YSTQPQYEVQRSQSVKVMSGESAFVATGEQVPVVTSVGVGLLATGVSYEQHNIQNGLLV
FT                   HPVLQGSQVKLTVRRVREQENVESDQQFDNQQIDTTIMAPLNKWVPLGTAEGVQNTDSS
FT                   STSYTAGRPFSQNSTLYIKVSVVKSTPSGTTK"
FT   CDS_pept        687786..688349
FT                   /transl_table=11
FT                   /locus_tag="lpp0636"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11784"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7G9"
FT                   /protein_id="CAH11784.1"
FT                   /translation="MAIISSLANHLLIAMPSLKDPNFERSVVYLCEHNEQGSVGLIINR
FT                   PLQFPLSIVFEQLQIEPIRVEKNGLPLLFGGPVQPERGFVIHKQMGGWRSSLFLQDEVT
FT                   VTTSNDIIRAIAYDEGPKDVLITLGYAAWTEQQLEREIMSNTWLVCPYKSEILYEVPFE
FT                   ERWEYAGLTLGIKMNQLSSDAGHA"
FT   CDS_pept        688342..688761
FT                   /transl_table=11
FT                   /locus_tag="lpp0637"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11785"
FT                   /db_xref="GOA:Q5X7G8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7G8"
FT                   /protein_id="CAH11785.1"
FT                   /translation="MPRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNT
FT                   IQKVITQWNPQALIVGLPTCIDDRELYTTSAARHFAKQLHKRFSLPVHLVDERLSTVEA
FT                   RGYLFEQGGYRQIKKAEVDSIAACVILEQWLQQSE"
FT   CDS_pept        688811..689704
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="lpp0638"
FT                   /product="hypothetical protein"
FT                   /note="Similar to aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11786"
FT                   /db_xref="GOA:Q5X7G7"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7G7"
FT                   /protein_id="CAH11786.1"
FT                   /translation="MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYE
FT                   NSTRTRISFELAERHLAMSVVNLDLQTSSEIKGEAIEDTIRTLAAMGIQYFVIRHKQDG
FT                   LQQNLANKLGDTVHIINAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRV
FT                   ANSFQCICSKLGVGDLVLISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQRERLL
FT                   EDDHLDLDFYRNNFALTQKSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVT
FT                   NGVYARMAILESLIAS"
FT   CDS_pept        complement(689818..690201)
FT                   /transl_table=11
FT                   /locus_tag="lpp0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11787"
FT                   /protein_id="CAH11787.1"
FT                   /translation="MILRLMLTLCCIVFPCKLLMAKQIMDNAIMIVKNCYDKSTDLSKT
FT                   FVPCINEEIEKLPDSKNFQIRMKLKSAEKDNNEKISILMVDKTGYMYYCIVTTGKTLII
FT                   NACAGEQGKPLTEGQMLSIDLPE"
FT   CDS_pept        complement(690313..691824)
FT                   /transl_table=11
FT                   /locus_tag="lpp0640"
FT                   /product="hypothetical protein"
FT                   /note="Similar to competence protein comM"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11788"
FT                   /protein_id="CAH11788.1"
FT                   /translation="MSLAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKES
FT                   KDRVRSAIINSQFEFPCRKITVNLGPANLPKTGSGFDLPIALGILAASEQIPLTNLANH
FT                   EFIGELALSGELRGVSAIIPAVLAAHKDNQHLIIANANAAEASLTGHQKVFTANNLREV
FT                   CDYLCQGTSLQSLPPKPDLLLNNYELDWSDIKGQQHAKNAMVIAACGGHSILLSGAPGS
FT                   GKTMMAKRFSTLLPELSETQALECAAINSIRGKLPDFREWRLPPFRAPHHTASPVALVG
FT                   GGNPPKPGEISLAHHGVLFLDELPEFNRQVLETLREPLESGHICISRAAAQIEFPAKFQ
FT                   LIAAMNPCPCGQWGNSQANCMCTPDRISRYLAKLSAPLLDRIDMQVTIHALSQEELIKP
FT                   NTHLEKQSLAIREKVTKMHEIQMARQDSLNANLNSKTCEMVCELGSEEQLFLREVMSKL
FT                   KLSARGYHRLLKVSRTIADMNSSKKVLLNHLQQALSYKQNLHLPK"
FT   CDS_pept        complement(691889..692149)
FT                   /transl_table=11
FT                   /locus_tag="lpp0641"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11789"
FT                   /protein_id="CAH11789.1"
FT                   /translation="MFDPKQFDELANKLFATLPTSLQNFEKDIQQKFKEVLQSTFSRMD
FT                   LVTREEFDVQCKVLARTREKLEQLQHQLEDFIKQQEIKNNK"
FT   CDS_pept        692294..692632
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="lpp0642"
FT                   /product="Nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11790"
FT                   /protein_id="CAH11790.1"
FT                   /translation="MKMITAIIKPFKLDDVHEALMEIGVPGITISETRGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIELALPDNMVEAAIEAICKSAYTGKIGDGKIFVYALEQVVRVRT
FT                   GEVGTDAL"
FT   CDS_pept        complement(692642..693223)
FT                   /transl_table=11
FT                   /locus_tag="lpp0643"
FT                   /product="hypothetical protein"
FT                   /note="similar to 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11791"
FT                   /protein_id="CAH11791.1"
FT                   /translation="MSDQYKVALRNTIKQVRSKLSVSYRTASSNQICTRIRSLEQYRQA
FT                   KRIALYFAVNGEIDLTFLWKSAPLQGKYCYFPVLNNDSTLSFLPATPSTPFKTNKYDIP
FT                   EPDVDIELALPVDELDLIIMPLVAFDAHCTRLGMGSGYYDRTLANKSKAHLLGVAYQFQ
FT                   RVDYIEPRPWDVPLDAVITQKAIYWRNPLA"
FT   CDS_pept        693470..693655
FT                   /transl_table=11
FT                   /locus_tag="lpp0644"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11792"
FT                   /protein_id="CAH11792.1"
FT                   /translation="MSDLFEEDEEEVIEVVDDFDDVEVDTEIIEAPGVSLDARRRLENM
FT                   LEEKRLRDELDDFVDY"
FT   CDS_pept        693669..694484
FT                   /transl_table=11
FT                   /locus_tag="lpp0645"
FT                   /product="hypothetical protein"
FT                   /note="similar to aminodeoxychorismate lyase (PabC)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11793"
FT                   /protein_id="CAH11793.1"
FT                   /translation="MPTRVIEDKGDMTPSFGIDDRIFLGEGLFETIRVNSSKPSFAYMH
FT                   WERLGNSARQLGIPFEISFDDWFEHLIQKIQKDNLYHGGIKAILSGGPASRGLAERGQV
FT                   SQLIFQTFNYSIQKHPVRLISINWLRDKANPLYQLKSVNYLEAIIAQRQAIAVGADDAL
FT                   FFNTENHVTETTCANLFLIENNILYTPRVDDGILPGITRARLISHCQQHKMSVQEISLT
FT                   KKRIEDADAVFLTNSLQGIRRVLSLDNIIFEVNHPIIDKLIFLLNQDES"
FT   CDS_pept        complement(694511..695194)
FT                   /transl_table=11
FT                   /locus_tag="lpp0646"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein. Predicted
FT                   membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:lpp0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11794"
FT                   /protein_id="CAH11794.1"
FT                   /translation="MRVLNSCNKVRGIFTLTQKTIKTFCLILAILVLIIFAVVFHNHSL
FT                   EIIDYIDDLGWLAPVLFLITYCLATLLLLPTMVLTLAGGAVFGPVFGTLLNLLGATSGA
FT                   AFAFLITRHLVYDWFSTKKGEKLNKLIAGVDEKGWVFVAFLRLFPIVPFNLVNYGLGVT
FT                   GISFRLYLLTTFIFLIPAEIIYTYFGYVGMDALTRPGHLYRNGGIFLTGLAIFFLLVIR
FT                   IMKKR"
FT   regulatory      695365..695370
FT                   /locus_tag="lpp0647"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        695376..697550
FT                   /transl_table=11
FT                   /locus_tag="lpp0647"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11795"
FT                   /protein_id="CAH11795.1"
FT                   /translation="MTWKEKQKQRARAWIKILLEKWFRIEVKGQYQANSHSVIIANRAS
FT                   IIDVLLLSVFLPERLTLALHPDMFKKIWVKTLLFFADVIVVDPGSAQATRVLIRAIRAG
FT                   KRCLLFPQGLLRQQEDSLKVFEGPGLILQKVGAEVIPVRIEGAEHSIFSNSKNKHRIRI
FT                   FPKITLHILPAQKLIQDENTGVDREGISLRLFQLISDLSFANSFKPYVLFSALIEGVSI
FT                   GAKNKTKIEDNNRIPLTYRQFLARCFILGRQIKKQTAIGETVGVMMPTTIAGMVTFFAL
FT                   QAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTARQFIETARLEPLVEELQQAGIRIHY
FT                   LEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKISPDTTGIILFTSGSEGKPKGVALSH
FT                   ANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGLTAGSVLPLVNGLNCFFYPSPLHYKV
FT                   IPGLVYQTGATILFGTDTFLTGYARAAGKHDFNSVRYIFAGAEKVKPETIRYWSEAFGA
FT                   RIYEGYGATEASPVISLNCPLASVPGSVGMILPFMDFKVEPVEGIVQGGRLKLCGPNIM
FT                   LGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFITIAGRAKRFAKIAGEMVSLTAVEGI
FT                   AASIWPELLHAAVVQKSPRKGEQIFLFTEAEYADKVSFIKKVKERGQSELLVPHMIYPA
FT                   CQIPVLPSGKIDYITLEKQFLEQKETMETV"
FT   CDS_pept        697551..697970
FT                   /transl_table=11
FT                   /locus_tag="lpp0648"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11796"
FT                   /protein_id="CAH11796.1"
FT                   /translation="MKLIWIVLALILAFVVILYLFPQINFREMPKGLVEGQLPDDKPNW
FT                   VSSMVNESDSHYIAPLKVESMPQLVACIERKIPELKIQKQEASLLVGYRQSRFFHFVDW
FT                   LCIHADGNVISSATMGYSDFGKNRELVEKIRSLCL"
FT   CDS_pept        complement(698057..698440)
FT                   /transl_table=11
FT                   /locus_tag="lpp0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11797"
FT                   /protein_id="CAH11797.1"
FT                   /translation="MRKKNRILLASLFLLGSLNAFASQDLTVVNTSDDLGYVTIGSYSC
FT                   ELTSSCAIPPDNSIRINSDIVEAACANTPVDCEIVFGVDSIKARVATGSFSLNEGIQYI
FT                   AQSRWLNYSAKRLSKTVAEIYKR"
FT   regulatory      complement(698447..698452)
FT                   /locus_tag="lpp0649"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(698489..700231)
FT                   /transl_table=11
FT                   /locus_tag="lpp0650"
FT                   /product="hypothetical protein"
FT                   /note="similar to poly-beta-hydroxybutyrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11798"
FT                   /protein_id="CAH11798.1"
FT                   /translation="MTHDTELSELMQAVAKKSLQIMTDFKEKPIPLSSLVSQYIDLTEH
FT                   FQNLIAVILKNPEKVWQMQLNYLEDALSLAQAQFNYWLEGKPLPINDQRFNGEDWINNP
FT                   FFNLLSQHYLLANEHMNSLLENMEYGDENLAKRVRFFTRQYLDALSPANFIHTNPQLMA
FT                   ETLQSHGKNLLRGLHNLLSDVEAGSSRLIIKMTDTEAFKIGENLATTPGKVIFRNSMME
FT                   LIQYCPRTTKVKSIPLLIVPPWINKYYILDLSPHNSLIRWLVEQGITVFIISWVNPDKT
FT                   YANKSFYDYLNEGPREAISVIQKQLRVKQVNTLGFCIGGTLLASLLAYNKATKDLSIRS
FT                   ATFLAAMIDFSDPGDIAVFIDEQQINKLEEEMKSKGYLAGKFMASSFNSLRANDLIWSF
FT                   FIKNYLRGKNPVPFDILYWNADSTNMPATMHSQYLRWMYLHNDLIKPGKIRLNHTPIDV
FT                   TNIDIPTFFLSTQKDHIAPWKTTYKGFELMKGPKRFVLGGSGHIAGIINPPTQQKYGYR
FT                   TNSSMDLSAEQWFEKSKEHSGSWWPEWLNWLKLHSGRLTNSPDINHLPFAPIMDAPGSY
FT                   VLKK"
FT   CDS_pept        700672..701133
FT                   /transl_table=11
FT                   /locus_tag="lpp0651"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11799"
FT                   /protein_id="CAH11799.1"
FT                   /translation="MLRVSKLADYGTVVMVYLAKHSQELCNARDIALHTHLTVPTVSKI
FT                   LKRLTSAGLLTSVRGVSGGYRLQRPAAEISVSQVIFALEEHRGFTECSMQPNDCFLQGV
FT                   CTIQGNWRLISHAIETALDSVSLEALAKPTLPTRDVERVRQLASGVNRG"
FT   CDS_pept        701126..702574
FT                   /transl_table=11
FT                   /locus_tag="lpp0652"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11800"
FT                   /protein_id="CAH11800.1"
FT                   /translation="MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIK
FT                   GEPEFLLEWRLKAFRHWLTMPHPEWSSVHYPPIDYQSVSYYSAPKSKKDAPKSLDEVDP
FT                   ELLKTYEKLGIPLREQEMLAGVAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYP
FT                   DLVKKYLGSVVPYRDNFYAALNSAVFSDGSFVYVPNGVRCPMELSTYFRINAASTGQFE
FT                   RTLIIADVDSYVSYLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGK
FT                   GGIYNFVTKRGACRGKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQ
FT                   QADTGTKMIHLGKNTRSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGS
FT                   QCSAHTFPYIEVKNPTAQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVL
FT                   KELPMEFAVEATKLLGISLEGAVG"
FT   CDS_pept        702576..703328
FT                   /transl_table=11
FT                   /locus_tag="lpp0653"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11801"
FT                   /protein_id="CAH11801.1"
FT                   /translation="MLNIKELNVAVNGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSK
FT                   VLAGHPSYEVTRGDISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVN
FT                   AVRKGQGKNTLDAIEFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALE
FT                   PKLAILDETDSGLDIDALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANG
FT                   RIITSGDKSLALELEKKGYSWLEEVEQL"
FT   CDS_pept        703325..704611
FT                   /transl_table=11
FT                   /locus_tag="lpp0654"
FT                   /product="hypothetical protein"
FT                   /note="Similar ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11802"
FT                   /protein_id="CAH11802.1"
FT                   /translation="MSDILDYYQQQAQLGVSQIPWLAQLQSKALTDLKRRGFPTRYDEE
FT                   WKYTLVDSLLQQHFVPPDPTVKPALKTAFDDSPVKNLFLIQNGFISQEQEWIKNLPQGV
FT                   LILPLSLALIHYADLVKPHLGKIMEQEHGFHYLNTAMLQCGVFIYIPEGICLEEPIVLK
FT                   HIQDQTNQAMYLRHLILMEKESQATLIEEYHGEENICYFTNSITEVFLGAGAKLNHYKI
FT                   QKESKSAYHLGHLSVRQSAASQFSSHSLSLGGKLVRSDISVSMQEEQAQCLMNGIYAPG
FT                   DGQHIDHHTVVHHLVPNCRSDQDYKGILKGHSRAVFNGKVIVAKNAQHTDAKQQNKNLL
FT                   LSANAEIDTKPQLEIFADDVLCSHGATVGQLDEEAIFYLATRGISRDEASHYLIQAFAN
FT                   DNLRLIPNRDLADWMGNLLTQQLGYANEY"
FT   CDS_pept        704601..705845
FT                   /transl_table=11
FT                   /locus_tag="lpp0655"
FT                   /product="hypothetical protein"
FT                   /note="similar to cysteine desulfurase and to
FT                   selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11803"
FT                   /protein_id="CAH11803.1"
FT                   /translation="MSTNPSLMTSFDVNKIRKDFPVLHQKINEYDLVYFDNAATTQKPK
FT                   AVIDAIAQFYEKDNSNVHRGVHALSVRATEMYEAARAKVKRFINARSPRECIFVRGTTE
FT                   AINLVAQSLVAPRILPDEEILITHMEHHSNIVPWQMVCKKMGCKLQVAPISLNGEVILE
FT                   EFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQD
FT                   LDCDFYAFSGHKMYGPTGIGVLWGKEELLNSMTPYQGGGEMINSVSFEATEYAAIPHKF
FT                   EAGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAANKV
FT                   PIISFVHGKIHAHDIGTILDSEGIAIRSGHHCTMPLMDFYDVAATSRISMSFYNTFKEI
FT                   DYCMEALQRVKEVFA"
FT   regulatory      705829..705834
FT                   /locus_tag="lpp0656"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        705842..706291
FT                   /transl_table=11
FT                   /locus_tag="lpp0656"
FT                   /product="hypothetical protein"
FT                   /note="NifU protein family, possibly involved in the
FT                   formation or repair of [Fe-S] clusters"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11804"
FT                   /protein_id="CAH11804.1"
FT                   /translation="MSMELRELYQEIIIDHNRNPRNHHAMEDATTEAKGFNPLCGDKLT
FT                   VYLKLQGDLIRDVSFIGCGCAISQASASLMTDALKGKSIKEAHELFHRVHRMLTQEEED
FT                   SLVSMDKLTVLAGVKAFPARVKCATLAWHTLEAALNKETEVVKTE"
FT   CDS_pept        706363..706698
FT                   /transl_table=11
FT                   /locus_tag="lpp0657"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11805"
FT                   /protein_id="CAH11805.1"
FT                   /translation="MFGFKKKQSNESIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVN
FT                   DEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQDRMTEAAR
FT                   LELGIFY"
FT   CDS_pept        706701..707654
FT                   /transl_table=11
FT                   /locus_tag="lpp0658"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11806"
FT                   /protein_id="CAH11806.1"
FT                   /translation="MSDNSWLPSASIQLLRARAELIGKIRQFFTERQYLEVETPVMARH
FT                   GVTDVYLSNIKAIFRGETCYLQTSPEYHMKRLLAAGSGPIFQLARVFRDDELGRWHNPE
FT                   FTLLEWYQLHIDHHVLMDEVDLLLQIILKSRPMIRKTYQQAFEEACGIDPFSTSIEQFN
FT                   KVLAQHDLDGVLSPNEQDRDQYLFLLMSHVVEPFLAEESTPVAVYHFPASQAALAQVKE
FT                   GLAERFEVYYQGVELANGFHELTDVEAQKKRFMLDQQHRKQKGLTAMEADAYLLKALEY
FT                   GLPPCSGVALGVDRLLALALKQPSIEKILSFDFSRS"
FT   CDS_pept        complement(707727..708641)
FT                   /transl_table=11
FT                   /locus_tag="lpp0659"
FT                   /product="hypothetical protein"
FT                   /note="Similar to methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11807"
FT                   /protein_id="CAH11807.1"
FT                   /translation="MELPYHFSTAYVSKPEFIEALSEELGEVSNKIGSLVFSPHQKLDV
FT                   CFALDVWLEPEIVTFQSISEAAKILRQAGKFWYLHPVTEIRRSRLIEEQLRKCPSLMSH
FT                   FPVTSDIPPIGVFSLLDRNTLLFSAKRLKKWPDGQCYFIEDKVNPPNRAYLKLWEALFL
FT                   LNKYPLPGETVLDLGASPGGWTYVMQSLGTQVTSVDKAELDTKIMALPRVSFLKQSAFA
FT                   LDPEQLTESYDWVLSDVACYPDRAYTLIKKWIASKKAKQLIFTIKLQGQTDLNTIKRFQ
FT                   SIPNSKVINLFYNKHEVTFFYPV"
FT   CDS_pept        complement(708888..709532)
FT                   /transl_table=11
FT                   /locus_tag="lpp0660"
FT                   /product="hypothetical protein"
FT                   /note="similar to a domain of alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11808"
FT                   /protein_id="CAH11808.1"
FT                   /translation="MEKIFWSNPYQHTLDTKIISINGNEILLEKTIAFSFSGGQESDRA
FT                   FINGLEVLSSRIDGNLIYYTLPDDHNLAPNDVITMTIDWPRRHRLMRLHFAAELILELV
FT                   TRTSMLEKVGAHISESKARIDFKANFNISSIFSQLLDEYNAIIRQDLVIYKGYHDVTNQ
FT                   RRFWKIDGFAEVPCGGTHVHSTSEVGFIRLKRSHPGKSIERIEITLMDDSR"
FT   CDS_pept        complement(709535..710830)
FT                   /transl_table=11
FT                   /locus_tag="lpp0661"
FT                   /product="hypothetical protein"
FT                   /note="Similar to major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11809"
FT                   /protein_id="CAH11809.1"
FT                   /translation="MNQNSFKPKNNFVSLVMWALPLSFFTFQFLLRLWPGLTMQDIMAQ
FT                   FSIDAASFGLIAAFYYYGYAGMQIPVALLLDKFGARFVVFAFAMLCGIGTLVFIGTNNF
FT                   YLALSGRFLIGVGSAAGFLGVSKVVSEWFSHSQYSRMIGLSFSVGLLGAIYGGKPLAHL
FT                   IQNFSGQQVGLALAVFSILLGCCALLILRSPPNNTHSVTKTMNLSHCSSLFSSWIIWAL
FT                   ALANLLMVGALEGFADVWGVPYLIAKYALNKTDAAFLISFIFMGMIFGGPLLAFLSQKL
FT                   GNYFVIALCGTGLAFLFLILLYTATLHWWQLGTLFFAIGLLCCYQVIVFAAGSTLVPYE
FT                   GLGVTIAFLNCINMLGGSFFHTLIGKLMDSSWSGQMSANGLKLYEMESYQWALSLIPFC
FT                   ALCGSLLIVLIHIKTRAYAAPELMKKTSLTGV"
FT   regulatory      complement(709539..709544)
FT                   /locus_tag="lpp0660"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(710836..710841)
FT                   /locus_tag="lpp0661"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        711484..712797
FT                   /transl_table=11
FT                   /locus_tag="lpp0662"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11810"
FT                   /protein_id="CAH11810.1"
FT                   /translation="MYNILLIFIAFLLVLLNAFFVSAEFGMVKLRATRIQAIKENYGLR
FT                   GRILEQVHQNLDAYLSACQLGITLASLGLGWIGEPAFAELLGPLFVALGISSVHIVTIS
FT                   SFFIAFFLISFLHIVIGELMPKSIAIRQSELISIWTAVPLYWFYWIMYPAIWLLNTCSN
FT                   FFLKLSGMDIKNEYEGFYSSEELKLILSGQHLQSELKEDEREILEHTLDLAELNVTEVM
FT                   RPEDEMIIIDINEPFETIKDKILKYRYSRYPVYDSGTKEMIGVIHVKDLFADLLLQKNI
FT                   NTLKPYVRPVLKVSHKLPAMDLLRKFRAGMPHFALVYKHKSSLLGFVTLDNLLHILIGR
FT                   IKDEFHKTHEDWVKNSDGTITTKGDCSLYSLERALDCDITLSPDEEELNTLYGLIITRH
FT                   GKLPNEGEIIQFVEFDALIEKVQDSFITKIKVFPKIKN"
FT   CDS_pept        complement(712857..713903)
FT                   /transl_table=11
FT                   /locus_tag="lpp0663"
FT                   /product="hypothetical protein"
FT                   /note="similar to alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11811"
FT                   /protein_id="CAH11811.1"
FT                   /translation="MSETIGYAAHKAGAPLKPFTFERRPVGAHDVAIDILFCGICHSDL
FT                   HQVNNDWAGAFYPMVPGHEIIGRVKEVGHQVRRFKAGDLVGVGCMVDSCRQCTYCHQHE
FT                   EQYCKSGATFTYNSQDNHLGGVTYGGYSKHIVVTEDFVLKIDESLDPAAAAPLLCAGIT
FT                   TYSPLKRAKVGKMSKVGIVGLGGLGHMAVKLARAMGAYVTVFTTSINKIKAGKDLGAHD
FT                   VVLSTDNNVMQTLANQYDFILDTVSAKHDLGQYLNLLKVDGQLTQVGLPSDPLEVTMFP
FT                   VILKRLSINGSLIGGIKETQEVLDFCARHGITADIELIKMHEVNSAYERLLKGDVKYRF
FT                   VIDMSTLD"
FT   CDS_pept        complement(714104..714448)
FT                   /transl_table=11
FT                   /locus_tag="lpp0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11812"
FT                   /protein_id="CAH11812.1"
FT                   /translation="MRKHKNKMVRIFLLALGLFSSTTINAWYGSGITIGVARANVHYYG
FT                   DDIRVYDPWGYGYYDRNYYYNGVRNIIVPSVIVPNVVINVPVQRYYVPSCEEMEVCDPY
FT                   GQCWLEQFCR"
FT   CDS_pept        714635..715039
FT                   /transl_table=11
FT                   /locus_tag="lpp0665"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11813"
FT                   /protein_id="CAH11813.1"
FT                   /translation="MHKLIELQGVGPKYAEMLKRVGIESQEDLLRVCSGRRGRFRVAEQ
FT                   TGISHKLILKWTNQADLARVNGINEEYAELLEQAGIDSIPELAHCNPEQLYSSLKEKNE
FT                   QCHLAQHVPGLSQVVTWVEQAKKLPRAVYH"
FT   CDS_pept        complement(715075..715764)
FT                   /transl_table=11
FT                   /locus_tag="lpp0666"
FT                   /product="hypothetical protein"
FT                   /note="Similar to polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11814"
FT                   /protein_id="CAH11814.1"
FT                   /translation="MLLTTLTRTKKKSQQLLILIGFLLGMSPVMALEIITIEKKENYHM
FT                   LKTRAENIQFPLNREDQDLIEAMKKKLYALGGVGLAAPQVNSAKQIIAVYIPEEAQLLR
FT                   DNAKIYPMHILINPNYEPLPQARIISDFEGCYSVSSKAGKVPRYDEIQLKYYDEEGNVH
FT                   QQIENGFYARVLQHEIDHLNGVLITDRLTPDCVQGTIEEMMTIRRAELPLEKRKLFDQI
FT                   MAKKLKK"
FT   CDS_pept        716007..717194
FT                   /transl_table=11
FT                   /locus_tag="lpp0667"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Na+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11815"
FT                   /protein_id="CAH11815.1"
FT                   /translation="MIDVGKIITDLAWPISLLIAWFAGELGYRWAKLPHISIYAIVGFS
FT                   LASTQIGLLPSIQPPSILLLANIGFGLILFESGYRINLRWLSYNPWVAASSITEATLTF
FT                   CLVYILVKSFGLQTSTCLLLASLSMATSPATVVRVINEQRSSGQVTERVLHLSVINCVL
FT                   AVFLFKVIIGLVVFRTSGNLWEAAYASLTVTAISTIWGIIFGVIMPILLKTVKSTCQDN
FT                   TLAFACAVILLVILTHNLKLSPVLATLTFGLVSRHGRMVFSPSQPGFGTLGDLLSVLLF
FT                   VFIAATIEWQRVVTGVWIGLSIITVRFVAKIIGISLFAHISGISFKKGILTGLAMTPIS
FT                   VFVILILEQSRYIGINLVDTLAPLAMVALTLEILGPIMVQRALIKANEISAIKEF"
FT   CDS_pept        717196..718317
FT                   /transl_table=11
FT                   /locus_tag="lpp0668"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11816"
FT                   /db_xref="GOA:Q5X7D7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7D7"
FT                   /protein_id="CAH11816.1"
FT                   /translation="MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDILELLGRSS
FT                   FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHIRDTLVTVGDRLNIGICGGGTHPFQM
FT                   WSNQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHIGCEDGNQALFLLHSLNRYIPHFIA
FT                   LSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPFVLNWDEFSLGYFEKMEHTGIVKSMK
FT                   DFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYMQALCSYLLENKEPLPHEDDYLVY
FT                   NYNRFQACRFGLDGTLVHPKTYEQILLREDILTTLRRLKPYANQLNSTMALEHIYEITH
FT                   KGSDASFLREKYAEHRTLESVVNESLKQFRSSK"
FT   regulatory      718346..718368
FT                   /locus_tag="lpp0668"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(718382..718783)
FT                   /transl_table=11
FT                   /locus_tag="lpp0669"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11817"
FT                   /protein_id="CAH11817.1"
FT                   /translation="MINQQIEIFLKSPAFAVVGASSNREKYGNKVLRCYLRNGKKVYPV
FT                   NPHETLIESLPVIHSVNDLPDNVHSISIITPPSITEEVVKEAVKKGIQHIWMQPGAESD
FT                   SAIQYGLDHKLNVISGGPCILVVMGYEEN"
FT   regulatory      complement(718794..718799)
FT                   /locus_tag="lpp0669"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        718931..719788
FT                   /transl_table=11
FT                   /locus_tag="lpp0670"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11818"
FT                   /db_xref="GOA:Q5X7D5"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7D5"
FT                   /protein_id="CAH11818.1"
FT                   /translation="MNKELESIYQNIANQSELGQTANYDSYYNPKRLYPIPRAPKRQEI
FT                   NLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLN
FT                   NSTFPDVETVVQTISKDLSHCIGSEVAVNVYPLSEIASQTIYAAFDGICLDKLDIECSV
FT                   YHVMPDFLSTSSKLVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGKKINHEGLLKYLIS
FT                   FRNHNEFHEQCIERIFADIMRFCQPESLAVYGRYTRRGGLDINPIRSTEPCAFDGQNIR
FT                   LIRQ"
FT   CDS_pept        720181..721272
FT                   /transl_table=11
FT                   /locus_tag="lpp0671"
FT                   /product="hypothetical protein"
FT                   /note="Similar to L.pneumophila major outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11819"
FT                   /protein_id="CAH11819.1"
FT                   /translation="MKKYHQLLMGITLLLFGVCNYAGDTGPVENSDLFRVFIPNLKPGY
FT                   DFSATAFYLQPGANNLGWGVITTVLPIPSPNWQVVTFNPDYQVGFNLGGRYVFANSGSD
FT                   LQLNWSHLRTNDTDNVFVNPSSQWISPFSQTGTPPTPSGQITGVALLKLAHASLDFSYD
FT                   AVSLDVGKFINFGSKLQTRLFTGLSSAWIKEELISTFRGFSLPILSLNNTSTYKGVGPR
FT                   LGFNNSYNISHGFNLVGQLAGSVLYGRMQPAQYQFTGTSQQLIIAGIFVNREGLANPSV
FT                   NQLVPALDAKIGLSYLYSLKQNWDLNFEAGYMGALYFNPLSSYETNTNVIALDTGSLST
FT                   SSAKHTQSNFSVGGPYITVSLRT"
FT   CDS_pept        complement(721432..722004)
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="lpp0672"
FT                   /product="hypothetical protein"
FT                   /note="Similar to 3-methyladenine-DNA glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11820"
FT                   /protein_id="CAH11820.1"
FT                   /translation="MSQNIILNRCEWVGQNKPHYELYHDTEWGIPVHDDEKHFEMLILE
FT                   GAQAGLNWETILKKRDGYRRAFKQFNPQAVAQMTDDELNALLTNPEIIRNRLKIFSTRK
FT                   NAKVFLSIQQEYGSFDSYVWQFVNGAPIINRPESIRAIPATSKESDALSKDLKKRGMSF
FT                   VGSTIIYAYMQAIGMVNDHIVTCFRAK"
FT   regulatory      722310..722315
FT                   /locus_tag="lpp0673"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        722321..722701
FT                   /transl_table=11
FT                   /locus_tag="lpp0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11821"
FT                   /protein_id="CAH11821.1"
FT                   /translation="MTQAAFGEFCWNELATSDVKKAKDFYGKVFGWQFREIESKEMTYT
FT                   LIQCNDKEMAGIWQIPKDQQSHIPPHWMAYIYVQDVSEALKKAKQHGAQEVKGITQAGE
FT                   MGRFAIIVDPTGAHVALWESFE"
FT   CDS_pept        complement(722802..723755)
FT                   /transl_table=11
FT                   /locus_tag="lpp0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11822"
FT                   /protein_id="CAH11822.1"
FT                   /translation="MARNKRLDRFHNAQNSNTCGYDQAFSEIQDGRKRSHWIWYIFPQL
FT                   ENLGKSPSAKLYGIKDFNEACDYLKDPVLFKRYFELIKLIEEKLKNIPLPHLMGGFPDD
FT                   RKFISSLTLFQATSNYLSSKDTDSQNKYHELYETCNRVFKQIAPQGYSPCQQTELLVKH
FT                   QSNSPVKKTTEKSSQPPQVTIFSPKRSKPNTAHPILKDLAQYINKRGNEWSYHYNFLGL
FT                   VAFVYFIQDLILGTDHFNHKAREVKLTAASKLQKILDPQCHERCNLNPSERKALSDGRL
FT                   GEIINKHGGLNKILTEAPDKPPKNDRAQEINSNPFL"
FT   CDS_pept        complement(723866..725290)
FT                   /transl_table=11
FT                   /gene="sidA"
FT                   /locus_tag="lpp0675"
FT                   /product="SidA protein, substrate of the Dot/Icm transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11823"
FT                   /protein_id="CAH11823.1"
FT                   /translation="MSKKYRTPIRLSDKMKTLKKNLQEQLTQSKSLGEQIHAGTTTAST
FT                   ITTGINHLFNVIASFLSSYRQIPLVGGVLQLVAILAKSISIVSDPEKSIAEKIISSILI
FT                   AAIIALSIAAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFID
FT                   LVAKRIEPNNDKYNDLFEIRAIELQHELEKSYPNQIEQQQLKEELNFINAVLRKKNITP
FT                   GNNKENDAYKLNQLYAKRAEQLKTLVDKIALINPTGKRAEQNKLLSEIKALQKEITKTD
FT                   DSIEEIIAPLAKIERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMV
FT                   PIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAEKTAKHEDAVLDEALNVYEQQLNLEL
FT                   VSPSNPARQVKNILIVHDKVPALSPTESTVSSLDSRFTLFGSSSREHTKIAEQKTTDTT
FT                   NEQVPTTFDSISKPTR"
FT   CDS_pept        complement(725451..727379)
FT                   /transl_table=11
FT                   /locus_tag="lpp0676"
FT                   /product="hypothetical protein"
FT                   /note="similar to probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11824"
FT                   /protein_id="CAH11824.1"
FT                   /translation="MTRAQTCPHQTTVISNLKIIPLTLGWLLKSALLIIIIAVFIPLSP
FT                   KMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATDFMMVGGSLYL
FT                   ALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEISGKETS
FT                   FKSNFCTLFALLFTPFGLFPLIKGSLLILSIITVLLCSLFLILYKQRNLAVLCLASPVV
FT                   SILFFWIASGQSIFNLPAYVSNTILLASGFTEAMAIEGDNKELIFFGVTSSCILLSILL
FT                   QKQLSPLSKAFLFCIYLVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNSNNKVI
FT                   VPLLALSLYTASYINGHYTKISVRDNFISTYTAAYYGLKNRIQNKNWLKENFSLTMNYL
FT                   KARDDFPRLPGTTDIYSYNQTSLIASGMTWSPRPIFQSYSVFTAKMAEINTNYLLSENK
FT                   PDNILFKVEPIDNRIPSMEDGMSWPILINHYQPVRLENDFLFLRKKLVNKPVTSLVPLK
FT                   TEIHTFGEQVKIPDTDKSLFVEIDIQPTLWGMLATTFFKPHQLEANLELKNGTQRQYRL
FT                   ISNMAKSGFLLSPFIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTKYTIHY
FT                   KTFASNN"
FT   CDS_pept        complement(727505..727897)
FT                   /transl_table=11
FT                   /locus_tag="lpp0677"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein, predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0677"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11825"
FT                   /protein_id="CAH11825.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWVMGWPVVITLFAWLVLLGGLIRFLCPDTAVRIGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
FT   CDS_pept        728034..728411
FT                   /transl_table=11
FT                   /locus_tag="lpp0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11826"
FT                   /protein_id="CAH11826.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDAPNELH
FT                   NDENVTNHPIQVMVIQLNDKA"
FT   CDS_pept        728612..729919
FT                   /transl_table=11
FT                   /locus_tag="lpp0679"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown eukaryotic proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0679"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11827"
FT                   /protein_id="CAH11827.1"
FT                   /translation="MHTQRGLEVTTGSIEAVDSINYFHEQVLSSGQNAIQILDSAKKHT
FT                   DNLLIQTYAAAFYLYAQEDVANEQASDYLQSAFRLLTSANEREKLIFEAVTNWSKRDYA
FT                   NAISLLVTLLERYPRDTLALKFMEWLFYCTGQAFNAEYFLKVCDKCAPENQDESHFLAI
FT                   HSFALELCGQYSKAKEMAEEAITMNLLTPWAHHTLAHVHLLTSDITGGINRLRDLQKTW
FT                   EDILPLLKGHNTWHLALFYLANRNEEEVKKLYPHISGALPDTVLEQLDTISLLWRMDMA
FT                   GLPQDRLLNQVVDHLSTHPLEYYTGFTNAHFIYCLVKSGYKNEADESLKRMKFYACSPS
FT                   SDALWGDVVLPLCQGIYAFADADYKTALMLMEPVIGECAQLGGSDAQIELFFQTYLLVL
FT                   IHNKQKDKALQFFTEHLKYYNNTPLSDWWFQSANKA"
FT   CDS_pept        complement(729945..732152)
FT                   /transl_table=11
FT                   /locus_tag="lpp0680"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar with DNA uptake/competence proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0680"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11828"
FT                   /protein_id="CAH11828.1"
FT                   /translation="MEIFCFLIGVLYAYTYNIYLTIAIPLLFYITPRYPIVLFFIAGCG
FT                   FALIHQWIVSPKGMPDTQVITQAQLEGTIASIPMQHPNKTQFHFAIEKINNNPAQGLIQ
FT                   LNWYNKPPVLRAGQRWQLSVKLKKPRNFHNPGGFNYVRYLAARHIHWTGYIRYRNNKLI
FT                   SNQPPSFSWLALREKIGDALTKLAPDTETAGIIEALTLNVTHHISSDHWNLFRRTGTIH
FT                   LFGISGEHIALVSGIFFIVMRWIWSINYRCCLFLPANTIASIGGLLAALPYAFLAGFEP
FT                   PVQRALIGCVLYTIYAIGKQRFTPWQIWRYALFLVLCIEPHAVFLQGFYFSFLAVACLL
FT                   LTHQRWPLKNYKKTLALQLSCLIGLMPLTLHWYSYGSINGFLANLFAIPLVSFLIVPLA
FT                   LMTMITSPFHWSWILMKPLAWLVALLLQGLTYVEQIAGINITWSITSVTMMLAMTAGLF
FT                   LRVLLPVKPFKHLAILWIILPLFPPRTAIYPGEALINILDVGQGLAVAIQTQHHVLLYD
FT                   TGDSYFQGSDLGQMAIIPFFRSIGIKTIDKIVISHPDKDHKGGLNSLEKEMKVNQLIVN
FT                   DPYFYKRGSNCHSYPQWQWDGVSFRFLPIRESFNKKNNNSCILQVSNSAGRVLLTGDIE
FT                   KAAEEYLVRNYGSQLASEILVVPHHGSKTSSSYRFLLEVNPLYAIASLGFDNRFKFPHS
FT                   KTLQSMKTLGITFFRTDECGMAAIKLPASGKINKPTCMQAV"
FT   CDS_pept        complement(732230..732679)
FT                   /transl_table=11
FT                   /gene="pilE"
FT                   /locus_tag="lpp0681"
FT                   /product="type-IV pilin"
FT                   /note="competence and adherence associated protein -CAP-"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11829"
FT                   /protein_id="CAH11829.1"
FT                   /translation="MLSHVHFMKNSRMKQSAFTLVEVLISMVIMGILVSIAYPSYLQYI
FT                   QKSRRADAHATLTQDQIILERCYSQNFSYAAACGALPAFPQTTPNGYYTINISNLTATT
FT                   YTLTATPVGTQAKDTECASMSINQANVKTAVDSSANAQPECWNPG"
FT   CDS_pept        complement(732691..736200)
FT                   /transl_table=11
FT                   /locus_tag="lpp0682"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to type 4 fimbrial biogenesis protein
FT                   PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11830"
FT                   /protein_id="CAH11830.1"
FT                   /translation="MDALKLCILIREGAQKAIRVLPRIFLAISLSASVSLYAVPLTIPQ
FT                   IPLIIASPIHPQVLILIGNSQSMDGNLSGAIMTGSGSLSSGLSSLYNSSSPVNYTVPAG
FT                   FTPPVQGPDANGLAPYTVIQGGNKVDNSSSRLNVAKAGVKAIIENYMPTTDFALGTYST
FT                   SNISTYNTWVYYMSPPGSNFVFTNTPVAGNRYVINPCYNYGSASSTVSSNCASIGSLYG
FT                   TSLVSSSQYLQIGGASDDPTINDVLYAGSGFPGVFVSFNGPSPATPYPPNFSLSNYNNG
FT                   NVLLSYSSTRPSIGSFATGPTNAGFVPFSQQVMYVQRGFGYYSNQSFNTGNMRVNMTTA
FT                   GTNPTTTSVTNAINAFLPHLRPETNSTSTTEIKAAAVQSPLAGLLTRSRSFMKTVGTTS
FT                   GNCPQKQYIILISDGLPTQDLQARYWPPLGSAAATGYGVTATFNADGSLNSTNSQALSD
FT                   AINEINALKNDGVLTFVIGMGAGVDPAVNPEAAATLRAMAVAGGTENYYPATSPQALVN
FT                   SLNSILSNIQNGSFSTSAAAISSTRIDSSTVEYQANFITRDTPYQDWTGNLTAIELDEN
FT                   TGQPTNIIQWSAQSTLDSLVSGTGWSTNRKIATWDPIAADGVPFRWANINATQQAQLQP
FT                   SDLLGENRLEYLRGNATLEKRNGGTFRDRSHVLGDIIDSQVIYVGPPSGPYLTASYISF
FT                   AKANANRQPMLYVGANDGMLHAFNATTGEEFFAFIPNAVFNNLHQLTSPLYNQNHLFFV
FT                   NGSPESADVQFSDGSWHTILVGGENAGGKSIFALDITNPTNLSSEPGVANAVLWEFADT
FT                   DLGFTYSKPQIGQIRSGSPSSLNFAVFFGNGYNNTNNKSVFYAVDPQTGTLLRKIDLCA
FT                   AVPSACNVNLPQGLSTVALGQKDGLQADPVTVVYAGDLQGNLWAIDVSSADPASWSARV
FT                   LFQARDSAGTPQPITTPPLVTLNPNYPRNPGLFVVFGTGQLLTTSDLVTTQRQTIYGVW
FT                   DKPLSSVPYVRANLQQQTLTLVNSATSGLSTNIITATATTINWSNKVGWFADLPIAGQR
FT                   LITTPELINGAFIATLNTPPLNSCGFGFTSMLLELNFLNGGAFQYARFDISGDGGFDIA
FT                   DQYNGAYPVGIGLSNSYANSPTVLGPNKDNNLVILITQSDGTQTTVIAPNITPRKIGWW
FT                   QIQ"
FT   CDS_pept        complement(736213..736725)
FT                   /transl_table=11
FT                   /locus_tag="lpp0683"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Tfp pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11831"
FT                   /protein_id="CAH11831.1"
FT                   /translation="MNVSFTAQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQAGYFLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
FT   CDS_pept        complement(736722..737789)
FT                   /transl_table=11
FT                   /locus_tag="lpp0684"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Tfp pilus assembly protein PilW"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11832"
FT                   /protein_id="CAH11832.1"
FT                   /translation="MNIKYRLQQGFSLVELMIATLVGLILTYSILQIYLAQTQLYKASN
FT                   SQDLIQSTENAISNLLIPMIRSAGFAGCGSIITAVSSLNAGGPRPLGILNTTPTILMGY
FT                   NGSGASFTITQSNPANSTNASHWSPALDSTLVGNAQQGSDVLVVLGSTSDSYPTGITAI
FT                   DPGSNTFVVQGTSGMSLTSGMFGAVSDCGKTVIFQITGVAGTTITHDAGAGVLQNASSA
FT                   FPVNFQTGSQFIPIQQTAFFVGQGQGGQSALMRASLVGNNWTIQPLVPGVEIMKVQYGI
FT                   GNNGVITRYVSANAVTDWAQVYAIRLGFLIAGQLGSGSLTTRQYNVLDTQVTVPADNRL
FT                   RHVFELTINLRNSIS"
FT   CDS_pept        complement(737786..738325)
FT                   /transl_table=11
FT                   /locus_tag="lpp0685"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar with pre-pilin leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0685"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11833"
FT                   /protein_id="CAH11833.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLARYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
FT   CDS_pept        complement(738338..738916)
FT                   /transl_table=11
FT                   /locus_tag="lpp0686"
FT                   /product="hypothetical protein"
FT                   /note="similar to type-4 fimbrial pilin related protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11834"
FT                   /protein_id="CAH11834.1"
FT                   /translation="MYNDLCKDSFDTEAPLNSNPLSIAGFTLVELLVTLSVFAIILTLI
FT                   VPSLRTMILNSRLTSNIDSLVSSLNYARGVALDRAVNVAVCPLGSPGSTACGANWSSGW
FT                   IVVTQPVAGAPTLLKSHQTSVNDPVITSNVSSVVFDPHGLSTTQSNFTMCDNRGNAFAR
FT                   SAMVLATGFVQSGTTPGQAVWNNGALNCP"
FT   CDS_pept        complement(739267..740127)
FT                   /transl_table=11
FT                   /locus_tag="lpp0687"
FT                   /product="hypothetical protein"
FT                   /note="Similar to peptidoglycan GlcNAc deacetylase
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11835"
FT                   /protein_id="CAH11835.1"
FT                   /translation="MKIKTVTRYLLLFSIFFLIGFNNVFAQKKAIAITIDDLPFVGEYR
FT                   NFHLNMMMNTMKDEKIPATGFIIAKEVRPDNWEILHKFREAGFGLGNHTFSHANLNKLK
FT                   AKEYIQEIKEADSLLMPVLTEPKYFRYPYLAMSSGSKKNKILCYLEKHHYQVAPITIDS
FT                   KDFVFNQRLLSVPELGRRAYLDELKPFYLDFIWQQTLKAEEHTQYHHNPDQAQILLIHA
FT                   NLLNAYVLPDIINLYKQNGYTFVSLEDALKTFKENYHCHKTRILTKKPAGEETDLNIES
FT                   FMDWD"
FT   CDS_pept        complement(740304..741641)
FT                   /transl_table=11
FT                   /locus_tag="lpp0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11836"
FT                   /protein_id="CAH11836.1"
FT                   /translation="MTFVLKEFDALKSHFNDTVKIILQREKKDKIEDLPNPRKEELQFL
FT                   TAVLNQLEAKIDELKPRSLASYVHVFYGAMLLVCKDVENNLRVMEKKENSLLFTRLMDG
FT                   MGISDENIPTSEQNIMFYRGLNKFLNFIYESNDSRKGLKKEHFLQVLSLKKIYSLAKLS
FT                   YEQEEAAENNALAKLTADGKTKANANSFHVEKPIDSSIVEQFKSWDEMKGALHQLILDE
FT                   LSDKNVAKISALSQARSAQLKFLQTMAEQLDKIPNQSLEPSEKMAILAGAMYIVRGQIA
FT                   QEYGKDPLSNDKISATVIHTGLSTILHANADCCEDKEVLIAAANKFIRHMVIERPEQSN
FT                   KKITKESVRENNMFSDIAGFQLISVLTLIQNMIKTCRTDAIEACVTKRKEELEALKPKK
FT                   EGYSIASSVTGYVGSWFKKAPSMSEEDEEDDLKDQNTAEETSKPTV"
FT   regulatory      741929..741934
FT                   /locus_tag="lpp0689"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        741941..743422
FT                   /transl_table=11
FT                   /locus_tag="lpp0689"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11837"
FT                   /protein_id="CAH11837.1"
FT                   /translation="MSFQTDKEIQQKFFNYTLFVLVVLLICRLIANYFFPLFDTTESRY
FT                   AEIARKMLETGNWVTLQQDYGVPFWAKPPLSIWLSAFFMQLLGVNEFAVRLPGLLLSIG
FT                   VLWLVWGVAKKQSGSMAALFSLLTLAGSLYFFLDAGTVMTDPALLFCITLASVSFWHAM
FT                   VYENKIWSYAFFAGLGLGLLAKGPIAVVLVGMAVFFWVLLRNEWLNLWKRLPWVKGTLL
FT                   LLLIAVPWYVLAELRTPGFLNYFILGEHFHRFLTPGWSGDKYGIVHHVPKGTIWLYATA
FT                   GVFPWNIIAGGWLVKHGKMLPSLCQSGDGWLSYLTLWMITTLLFFTFASNIIYPYVFPS
FT                   LPAFALFFAEILNRLNLELKHLKWIFISSLLCGVLFLAVAFVFSVKPNVVPNTHKPIIT
FT                   AWLNQNPTAGSYLVYWGYKTDFSAEFYSEGQVKAVKNSNDLCKLISNRLENYLVINSKE
FT                   TQQIREGLLARFTLIDTFRVHRDTLILFYAPVLTC"
FT   CDS_pept        743613..744242
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="lpp0690"
FT                   /product="hypothetical protein"
FT                   /note="similar to thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0690"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11838"
FT                   /db_xref="GOA:Q5X7B5"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7B5"
FT                   /protein_id="CAH11838.1"
FT                   /translation="MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQ
FT                   YGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEI
FT                   TDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQ
FT                   AVIEGEQVLIGGNESYVATCRLHYKRGEAGKTFPRNKLFNKDTNTF"
FT   regulatory      744232..744276
FT                   /gene="tdk"
FT                   /locus_tag="lpp0690"
FT                   /regulatory_class="terminator"
FT   CDS_pept        744290..745561
FT                   /transl_table=11
FT                   /locus_tag="lpp0691"
FT                   /product="hypothetical protein"
FT                   /note="Similar to major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0691"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11839"
FT                   /protein_id="CAH11839.1"
FT                   /translation="MVSHSVAVESRTFVPRGDFMAWVVCLSAGLFFLYEFFQLNIFDVI
FT                   NQSLREDFHIDATQLSWMSSTYLWADILFLLPAGLILDRFSTRKVILTAMLVCVVGTIG
FT                   FAVTESFFLASFFHFLSGIGNAFCFLSCVVLVSHWFPPRRQALVIGSLVTMAFIGGMMA
FT                   HTPFAYLNDLFGWRRALLIDGVVGAFLILWIYMIVQDRPEESPAHKLTNEGQILSSFMK
FT                   ALSNKQNWLAGLYTSLLNLPIMVLCALWGASYLQVAHHLPDIAASNVVSLIFMGSVVGC
FT                   PLVGWLSDTQGRRKPLMIFGAIATLITTIPLFINVVLTQMSLSILFFALGLFTSTQVIS
FT                   YPLVAESNQLENTGAATGIASVIIMGGGGVAQVLFGWLMTHHAGTNVTAYTVSDFQFAM
FT                   WMFPVAAIAGLVAVLMTRETYCKR"
FT   CDS_pept        745574..746857
FT                   /transl_table=11
FT                   /locus_tag="lpp0692"
FT                   /product="hypothetical protein"
FT                   /note="Similar to major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0692"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11840"
FT                   /protein_id="CAH11840.1"
FT                   /translation="MQVVDEFKAFDVKASLMPWLVCFAATMFFFYEFIQGNMFASIAAN
FT                   IMQDFQIQADKMAYLSSIYYLANVIFLFIAGMVLDRFSIKNTILIAMFLCVISTFILSY
FT                   SDSFYVALFCRFVTGIGSAFCFLGPVRLASHWFPPQRMALVTGAIVTVAMTGGMLAQYP
FT                   LTKLVLYVGWRQAVQDVGILGLAMLVLMFFWIKERPQVAIKKEGKPINVLVAARKAYLN
FT                   AQNLRAALYTSLMNMAIAVFGAMMGTLYLEQRLGISPDQAAMINGMLFFGAIIGSPLMG
FT                   WISDKVGLRVLPMKGGVLASLLILLGVLYLPVSVTMMAVLFFLLGLFTSAQVISYALVA
FT                   ESSPPMMTATAVSVVSILTQGGYLIYQNLFSALLTNYGDVRLINGVPVYLLEAYQHAAI
FT                   ILPIGLLIALLLLFGLKETRCQQVEHTV"
FT   CDS_pept        746854..748077
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="lpp0693"
FT                   /product="Phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11841"
FT                   /db_xref="GOA:Q5X7B2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7B2"
FT                   /protein_id="CAH11841.1"
FT                   /translation="MTGRVCVLVMDSFGIGASLDAARYGDAGANTLVHIYEACKRGECD
FT                   IDGVRKGPLMLPNLAGKGLYHAAMASSGLPFIDLSALAIPSGYYGYAVEQSLGKDTPSG
FT                   HWEMAGVPVTFEWGYFPDKSYCFPEELISEFIKQCNLPGVLGEKHASGTIIIDELGEEH
FT                   IRTGKPIVYTSADSVFQIAAHEEAFGLQRLYDICKIARNLVDKYQIGRVIARPFTGKPG
FT                   SFKRTGNRKDYATPPPEKTLLDFLKEDGREVIAIGKIADIYAHQGVTQEIKADGNMALF
FT                   DATLSAMKTAPQGSLVFTNFVDFDSSYGHRRDVAGYAHALEQFDVRLPELEALLQPDDM
FT                   VFIAADHGCDPTFPGSDHTREHIPVLMFGPQVNSKFIGRRDCFADIGQSIAEHLQLSSP
FT                   LTHGVSFL"
FT   regulatory      748267..748272
FT                   /gene="hslV"
FT                   /locus_tag="lpp0694"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        748281..748829
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="lpp0694"
FT                   /product="Peptidase component of the HslUV protease (Heat
FT                   shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11842"
FT                   /db_xref="GOA:Q5X7B1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7B1"
FT                   /protein_id="CAH11842.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
FT   regulatory      748817..748822
FT                   /gene="hslU"
FT                   /locus_tag="lpp0695"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        748831..750156
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="lpp0695"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   HslU"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11843"
FT                   /db_xref="GOA:Q5X7B0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7B0"
FT                   /protein_id="CAH11843.1"
FT                   /translation="MVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKIKDPVLR
FT                   NEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDSIIRDLT
FT                   DMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFRKQLREG
FT                   ELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVAKAMKIL
FT                   REEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGVQRDLLP
FT                   LVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALSVEDFVR
FT                   ILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRLYTVMER
FT                   LLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
FT   CDS_pept        750356..751495
FT                   /transl_table=11
FT                   /locus_tag="lpp0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11844"
FT                   /protein_id="CAH11844.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNADFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYTLPELQADYWGTEAPVFSAGNKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALHDQGAGFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGAISNEEVLNIYHQVYKKHLKIISYSLDPE
FT                   ANEIKVFSHAGIGLNHIRGLARKFKVPYSEESAVDLAKTIDAINKKFAEKASAGEIHTL
FT                   YTHDMMYRGYAGEYLNSTDEVVAATVWGREYGDLIRTSKKFKVTFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQCLNPDKKV"
FT   CDS_pept        751592..751930
FT                   /transl_table=11
FT                   /locus_tag="lpp0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11845"
FT                   /protein_id="CAH11845.1"
FT                   /translation="MTFPDSYKRIWDSTPGHSNITKIKALLKDYTKEDSIWGSFWRLIF
FT                   TLHWGRHHVKSVHQIAQTQYTSVEAILSDLKALKPREGGSLDKRIKFIESQIITQRGDN
FT                   PDLQFNLK"
FT   CDS_pept        complement(752080..753318)
FT                   /transl_table=11
FT                   /locus_tag="lpp0698"
FT                   /product="hypothetical protein"
FT                   /note="similar to tRNA processing ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11846"
FT                   /protein_id="CAH11846.1"
FT                   /translation="MNWKEKVKTKFYSCDRFVRFVIQHFIQDDCTYIASALAFTSLLAV
FT                   VPLMSVGLAIFSSFPVFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFTSQVSKLSIWGI
FT                   VFLIFTALLVMFTIEQAMNKIWRVSSSRHGVSAFLLYWAIISLAPVLLGLSLAASSYLF
FT                   SMPILADHRAPYTILHYSPFFLSLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAK
FT                   HAFAYYLIRYNTYELLYGAFAAVPIFFIWVYWVWIITLLGAEISYAFSVHHQRRGGKSL
FT                   DGFSHALLWLHQLWLAQQHGKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADG
FT                   HYMLSRDLSHVTLYDLTQLLPYRLPTHLELQYSKASLAEQWRAAFKRHNEELKKSLDIN
FT                   LEELFKKTGTVLK"
FT   CDS_pept        753773..776812
FT                   /transl_table=11
FT                   /gene="rtxA-1"
FT                   /locus_tag="lpp0699"
FT                   /product="structural toxin protein RtxA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11847"
FT                   /protein_id="CAH11847.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNAQGQASLVKSGARLQEGDVLTLLS
FT                   GEAYIQFIHGFPEALALGKPVNLYGVSPALQYGVEELNEQLVQEALAKGIDPSVILDVL
FT                   GSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGVI
FT                   AESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIADSAGQARIASSSLSSLLTSSAD
FT                   VAASFAFNSNLSALPTLKSGGIDLSYELSADKRTLTLRESNTQGPGAEVMKFELTADGQ
FT                   LTQTLMNSIDHPTADSDDGEWMRLDLSPLIDVTFTRTIDGSVLESRTLPANAVVAGIQD
FT                   DVPIARAQLTNNEILLDETIGMKVGDVDAANDDFNPTTTADPFNNTYGIPIGLVQNANL
FT                   LDTSTSEMGGDYKNATMTHLIKITDAVSGLQTTDGTPVNLFLESNGDISGRAGDIGAPA
FT                   VFAIRMNPNTGAITVAQYGSIKQFDTNSYDEAVDLTGRISVVVTAKDSDGDVSNAEIPI
FT                   GQLIIFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSD
FT                   LFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVV
FT                   FKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSA
FT                   KXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYA
FT                   KLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKN
FT                   TNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTD
FT                   KDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETQGMKAGDANANDEAASADA
FT                   NDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGT
FT                   EVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKL
FT                   EVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETQGMKAGDANANDE
FT                   AASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTATNQAIVLS
FT                   ANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQ
FT                   AGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGD
FT                   ANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATN
FT                   QAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHDESGAGG
FT                   IIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETK
FT                   GVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGL
FT                   VDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHENASDHD
FT                   ESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAAL
FT                   TLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVS
FT                   APASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIKHE
FT                   NASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAV
FT                   KAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTL
FT                   FKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQY
FT                   RAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGP
FT                   VVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSD
FT                   GXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGD
FT                   VEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLGQMMR
FT                   FEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDLFTLT
FT                   KDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLL
FT                   TASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLD
FT                   LGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGYAKLVGS
FT                   DLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDV
FT                   VFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDS
FT                   AKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASADANDIGY
FT                   AKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGGTEVLGK
FT                   NTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLT
FT                   DKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXNDEAASAD
FT                   ANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVLSANAGG
FT                   TEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLK
FT                   LEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAGDANXND
FT                   EAASADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLVXAPASGLVDTATXQAIVL
FT                   SANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDHDESGAGGIIERI
FT                   QAGSLKLEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAALTLDETXGXKAG
FT                   DANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTAT
FT                   NQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAG
FT                   GIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDET
FT                   KGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASG
FT                   LVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKHENASDH
FT                   DESGAGGIIERIQAGSLKLEVTLTDKDGDSAKXXLDLGQMMRFEDDGPVVDMAVKAGAA
FT                   LTLDETXGXKAGDANXNDEAASADANDIGYAKLVGSDLFTLTKDAGSDGXQSTLFKLLV
FT                   XAPASGLVDTATXQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASXGDVEVFQYRAIKH
FT                   ENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMA
FT                   VKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQST
FT                   LFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQ
FT                   YRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDG
FT                   PVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGS
FT                   DGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNG
FT                   DVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMM
FT                   RFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTL
FT                   TKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVL
FT                   LTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDL
FT                   DLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANGNDEAASADANDIGYAKLVG
FT                   SDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGD
FT                   VVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGD
FT                   SAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIG
FT                   YAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLG
FT                   KNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTL
FT                   TDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASA
FT                   DANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTATNQAIVLSANAG
FT                   GTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSL
FT                   KLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANAN
FT                   DEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVGAPASGLVDTATNQAIV
FT                   LSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGAGGIIER
FT                   IQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDMAVKAGAALTLDETKGVKA
FT                   GDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPASGLVDTA
FT                   TNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASDHDESGA
FT                   GGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGAALTLDE
FT                   TKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLLVSAPAS
FT                   GLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASDGDVEVFQYRAIKHENASD
FT                   HDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDDGPVVDMAVKAGA
FT                   ALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQSTLFKLL
FT                   VSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVFQYRAIK
FT                   HENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQMMRFEDDGPVVDM
FT                   AVKAGAALTLDETQGMKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAGSDGEQS
FT                   TLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASNGDVEVF
FT                   QYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDDLDLGQMMRFEDD
FT                   GPVVDMAVKAGAALTLDETQGMKAGDANANDEAASADANDIGYAKLVGSDLFTLTKDAG
FT                   SDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKVLLTASN
FT                   GDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKGELDLGQM
FT                   MRFEDDGPVVDMAVKAGAALTLDETKGVKAGDANANDEAASADANDIGYAKLVGSDLFT
FT                   LTKDAGSDGEQSTLFKLLVSAPASGLVDTATNQAIVLSANAGGTEVLGKNTNGDVVFKV
FT                   LLTASNGDVEVFQYRAIKHENASDHDESGAGGIIERIQAGSLKLEVTLTDKDGDSAKDD
FT                   LDLGQMMRFEDDGPVAGTISLVADEDNLPRGNNDTASGDAAQSNLTGTLPVNFGADGAG
FT                   SIDFQGMHGLSAVIGNDNITYNWNASTNTLTAYQTGGALGVNDVFKIVVNPTTGQYTFT
FT                   LLAAINHHAVADNTEGLVDPFVNLNYRVIDGDGDTAIGTLKVTIDDDIPKAITPEEGFV
FT                   TNQAGIVRTFDLDFDANIDNNVGADQLGTITFSGITNGQVVTGTVDGVPNQTLTSGGSA
FT                   IHYYVSGNNVVEGWINGGPGDVGSTIVFRTTLQPDMNYNASNDTYKFELFQPISTSTNV
FT                   SIANFSGVNATSREFIYLENASGPGEDILFSAYIRNDNGTFTDATVNTNPDGIGVNNQN
FT                   MNDRENLRVDFVRNASTTGTNQNMTYEYDDHYLVNNFSFKIIQVTGNPPTGSLEVWVRA
FT                   YNADDDDPTDNTASSANNLAHQDALRDDPQVALTQILVNGVPVTPTTVNASGGYLISGL
FT                   NLNDTITIRSANGYDRVEIENPRSGAHGVSNSSLNNETFDIGLFSYNTIKTTPSEININ
FT                   MGLSLTDSDGDKINSSIEINLAPSVFKVGENVDDTSSSNVPHRVGGDTGVIDGSGGADI
FT                   LVGDVGGVEVVGTTARLAFILDESGSMSQNFGGTTRLEVLKQAMTDILTELSNTPNASI
FT                   TVHLVKFASVVNGTGTFEITGGGLQQALDFISGLQIQQGLLAGTNYEAALGQTVQWFSS
FT                   QSGTVDVQQTLFFTDGVPTFYMDGNSTEYTNLARVYGNGSQTEEVLWENLFGEHAGGQA
FT                   TSDRINNLTESDSRDLDGLQSYSIDTNNDGIFEIQSVNSRSSGTTQTTNDLVRSVADTF
FT                   NEVQALQAYGPLRAVSIADNANVYLQEIDSTGQPYLADSPEVLQDILDELNPFNVLLAA
FT                   GSDTIQANQEDDLIFGDVLFTDKLAEDEGLDLPKGSGWAVFEELEANHGWSRQDTLDYI
FT                   RNHADELGRETVLSSGSKRSGGHDIISGGQGDDRIYGQEGNDVIDAGSGDDVIDAGSGD
FT                   DVIVGGTGNDTLTGGSGADQFVFFRGHGSNNAGTAPTDIITDFEVNIDKIVINANNIIG
FT                   VSVSNPVSNPDLSKTYTITVNYSDAPSIEHFKVTLSNGALLNDSGKTHLNGVVISGGTA
FT                   TIDGTIVGAVLYLDLNANNQEDEGERLGITNQYGHVEWVVDLSKFDVNGDGQYVIGEAR
FT                   AVQTGGFDIDTGLSYEINLYGPVGSAVISPLTSLLQAQLEAGMDYETANAALVARLGLP
FT                   EGTQIISFNPITGSGEVLAQNAGVMTAAIQFAEIAAIHYSTDEGHVSFAVFEAISKALL
FT                   ELPEGVVADFGDEGFLQSIANYLGLDALVTSDMIDYMATSQKALEASILTLAPGEDALT
FT                   AISKIQHVTQGIYAQAIEMALIGYLPLDALKNMSAVLKAYADGDITDEQLNSFEDKLSA
FT                   VIVNWEDNNVTDASHQATLQTERTVDDSSVKSEANHEMAQEVNAVINDFMDEHNISLYY
FT                   YDQQAQMPQETQEEQQPVEAQAEETVIHDDVVQDLLLDDHSLTMLANNPELNGGNGNDV
FT                   LHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSGDDDGGVDTITDFKANPVDQSSDASVL
FT                   NLSDLLSDADLETNSLDNYLNVSTTEEGDTAIKVDPNGNGNFDAPAQTIILEDVDLTAV
FT                   FATNNSHDIVNQMIANGNLIVEQ"
FT   regulatory      776826..776852
FT                   /gene="rtxA-1"
FT                   /locus_tag="lpp0699"
FT                   /regulatory_class="terminator"
FT   CDS_pept        776991..777590
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="lpp0700"
FT                   /product="hypothetical protein"
FT                   /note="Similar to flavoprotein WrbA (Trp repressor binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11848"
FT                   /protein_id="CAH11848.1"
FT                   /translation="MSNPYILVLYYSRTGSTAQLAQYIARGVESVSGLEARLRTVPPVS
FT                   TTCEAVDKPVPDAGAIYVSLDDLRHCNGLALGSPTRFGNMAAPMKYFWDGTTSLWLGGD
FT                   LVNKPACVFSSSASMHGGQETTLISMMIPLLHHGMILLGVPYTEPALTSTQSGGTPYGV
FT                   THVAGGDNENPLSQDEISLAKALGERLGRVAMGLKV"
FT   CDS_pept        778084..778434
FT                   /transl_table=11
FT                   /locus_tag="lpp0701"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11849"
FT                   /protein_id="CAH11849.1"
FT                   /translation="MVPADAKLLKQAKSLRKRSTDAENCLWYYLRAHRLKGYKFKRQVP
FT                   IGNYIVDFVCIQRKLIVELDGGQHLLNKEYDKDRSAYFSTLSYKVLRFWNDDVLLRTGD
FT                   VLESIVRCLEES"
FT   CDS_pept        778490..779272
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="lpp0702"
FT                   /product="hypothetical protein"
FT                   /note="Similar to exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11850"
FT                   /protein_id="CAH11850.1"
FT                   /translation="MKVISFNANGIRSSARNGFYDWLVGQDVDFVCIQETKSQVEQLIP
FT                   EELYFPRDYFCDYFDAEKKGYSGVAIYSKYKPVRIVKGLGFDYCDKEGRYIQFDYPKLS
FT                   VISLYLPSGTSGEDRQEVKYAFLEQFARHLMNLKNEGRELIICGDYNIAHKKIDLKNWR
FT                   GNQKNSGFLPEERAWMDELFGSMGFVDAFRVHNQEEEQYTWWSYRARAWEKNVGWRIDY
FT                   QVITPGLTEYVADSRIFREARFSDHAPLMIEYKGDWCV"
FT   CDS_pept        779265..780035
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="lpp0703"
FT                   /product="hypothetical protein"
FT                   /note="Similar to exodeoxyribonuclease III XthA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0703"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11851"
FT                   /protein_id="CAH11851.1"
FT                   /translation="MFKLASWNVNSLKVRLEQVLQWLESSQVDLLAMQETKLTDENFPV
FT                   ASFTDKGYHVIFSGQKTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKGIRLINL
FT                   YVPNGGELTSDKYQYKLDWLNKVTRFIENQLSIYSKVAVVGDFNIAPEDRDVHDPVEWE
FT                   GCVLVSPAERQAFMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLS
FT                   HELNALCRQSKIDKEPRKAERPSDHAPVWVELEL"
FT   regulatory      780158..780163
FT                   /gene="rpmE"
FT                   /locus_tag="lpp0704"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        780172..780399
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="lpp0704"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11852"
FT                   /db_xref="GOA:Q5X7A1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X7A1"
FT                   /protein_id="CAH11852.1"
FT                   /translation="MKASVHPDYQTVKVTCSCGEVFETRSTLCKDLNIEVCSMCHPFYT
FT                   GKQKLVDTGGRVQKFRDRYNMRTGQAKSKE"
FT   CDS_pept        780526..781761
FT                   /transl_table=11
FT                   /locus_tag="lpp0705"
FT                   /product="hypothetical protein"
FT                   /note="Similar to NADP-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0705"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11853"
FT                   /protein_id="CAH11853.1"
FT                   /translation="MDNEVIKQRALDYHEFPVPGKLSVHLTKSTNSQDDLSLAYTPGVA
FT                   APVLAIAEAPENAYRFTSKGNLVAVMTNGTAVLGLGNLGPLASKPVMEGKAVLFKRFAD
FT                   LDVFDIEIDAEDPQSFIATAKRIAPTFGGINLEDIKAPECFEIEQALIEQLNIPVFHDD
FT                   QHGTAIVVAAGLLNALELQNKKLSDIKIVCMGAGAAGIASMRLLVALGAPKSNMLLLDT
FT                   KGVIHSGREDLNPYKFAFARNTSCRTLEDALVDADVFIGVARPDLLNAHLLSLMAPNPV
FT                   IFALSNPDPEIKPELAHSVRKDLVMATGRSDYPNQVNNVLCFPYIFRGALDVRATCINQ
FT                   AMQIAAVEAIRQLVHEPVPQVVKDNYPGVVNWDFGPDYIIPKPIDPRLKERVPAAVAKA
FT                   AIASGASQFNNL"
FT   regulatory      781962..781967
FT                   /locus_tag="lpp0706"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        781973..783265
FT                   /transl_table=11
FT                   /locus_tag="lpp0706"
FT                   /product="hypothetical protein"
FT                   /note="Similar to major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11854"
FT                   /protein_id="CAH11854.1"
FT                   /translation="MHTENRTNYAMIGWLLCGLGAIFYSYEYLLRIAPSVMENALRTHF
FT                   NLSASGFGFLSSIYYLAYVPMQLPVGVLLDRYGPKRLLTMACLVCVIGTYMFTGTTIFW
FT                   VAATGRFLVGFGSAFAFVGVLKIATLWLPENRLAMISGMTSALGPIGAMLGDNFLELFI
FT                   VKMGWVKTLNMTAAFGIVLTLVLWVGIRDRKGQHRQSGTVPTLKKGLVDLGIIITSRQI
FT                   WVNGMYGCLVYLPTTVFAELWGIPYLHHAHGLTTQAAGLANSVLFLGFIIGAPIMGYIS
FT                   DRLYRRKFPMLIGASGAAIVMMMILYLPGLNESNIQALMFLLGLLYSAQAIVFAVGREL
FT                   SPGEAAGTAMAVTNMIVMLGAMFLQPLVGHLLDFSLSTHLSDTTGIVVDNMSKLYTVDD
FT                   YQFALSIIPLGILIAAILTFFLKETHAKAPK"
FT   CDS_pept        783246..784523
FT                   /transl_table=11
FT                   /locus_tag="lpp0707"
FT                   /product="hypothetical protein"
FT                   /note="Similar to major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0707"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11855"
FT                   /protein_id="CAH11855.1"
FT                   /translation="MQKHLNNMTTKKQISYGVLVCFIGAVFYCYEFILRIVPGALQTEL
FT                   STALGHISATTFGQISALYYFAYSPMQMPVGMLMDRYGPRRLLTFACLCCALGSWMFTL
FT                   TWSIVLVGIGRFLVGFGSSFAFVGVLSLALHWLPRRYFSLVAGLITTLGMLGLVYGEIK
FT                   ITEWSEVIGWDHVLMHIAMIGSALCILTFFVVRDGPEGYQPNKYPWPEFFHNVLKVLTS
FT                   HEVWLIGFVGACLYTSLSVFGELWGKTYLEQAHHLTKVEAAKTVSAVFLGWAVGAPLAG
FT                   YISDITRRRLLPLVIGAIVSLICISFVLYCPGLSYLTLNILLFLYGVFSATEIIVFIMA
FT                   KECSGAKLSGTVFAVTNMIISLAGAIFQPLVGKLLDTFGDSGIVAGEHIYTVDDYQVAL
FT                   SILPISLLLVTILAFFIKDKDHSNNS"
FT   CDS_pept        complement(784554..785372)
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="lpp0708"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0708"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11856"
FT                   /protein_id="CAH11856.1"
FT                   /translation="MVKIRPFLKWAGSKYNCLNEIISSLPTGQRLIEPFAGSGVVFMNT
FT                   SYSSYLLAESNSDLVNIYRILQLNGESFIDYCQQYFTPEANCKEKYYELRSEFNNLMDS
FT                   NQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYFPRKEMMLFYKKCLSAQFIHG
FT                   DFRNTFALAEPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIP
FT                   VIISNHDTEFTRHHYKKAQIKSFYVPRWISCRSQMRLPVKELVAVFNCPS"
FT   CDS_pept        complement(785543..786739)
FT                   /transl_table=11
FT                   /locus_tag="lpp0709"
FT                   /product="hypothetical protein"
FT                   /note="Similar to tyrosine-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0709"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11857"
FT                   /protein_id="CAH11857.1"
FT                   /translation="MINSKLIGGILLIVGTSIGGGMLALPVSTAEVGFTNSLFFLFFCW
FT                   LVMTAGALLILEVNLRLPAGSNMISMAKSTLGLPGQVIAWITYLLLLYTLLAAYISGGS
FT                   DVFSSLLHKAHIDLPNWITSVIFTAMFSLIVYSGIRSVDYVNRGLMFGKLGVYILLVII
FT                   ISPHVSTAGLTGGSAKAFTGTLMILVTSFGFASIVPSLRDYFNDDIRSLRRVILFGSLI
FT                   PLFCYIVWDAVIMGVISREGENGLLSLMNSDHATSGLTEALSQSVSSQWISGFFGFFTS
FT                   ICMVTAFLGVSLGLFDFLADGLKLKKSGNQGKYTLALTFIPPLAVVLFNPGIYLHALSY
FT                   AGVCCVILLLLLPSIMAWKGRQTCSQSPSETHLIPGGNPALSLIGFIAIGLLIIAIMY"
FT   regulatory      complement(786807..786812)
FT                   /locus_tag="lpp0709"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(786940..788130)
FT                   /transl_table=11
FT                   /locus_tag="lpp0710"
FT                   /product="hypothetical protein"
FT                   /note="Similar to tyrosine-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0710"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11858"
FT                   /protein_id="CAH11858.1"
FT                   /translation="MRSRFIGGILLIVGTSIGGGMLALPVANAATGFWQSSLFLLICWA
FT                   FMTFGAFFILEANLYLSRGKHMVSMAKATLGDYGLLTAWISYLFLLYTLLSAYISGGAD
FT                   VLNSLLSKVNWHLSDWQASSLFTLIFGLVVYGGIHSVDVANRALMFGKLAVYCILVILI
FT                   APHIEFHYFQHGDYRQIGGAIMILITSFGFAIIVPNLRDYFDDDIKTLKKVIFIGSLIP
FT                   LICYIAWDAVIIGSLPSAGTSGLESLMQNPRTTSALASLLTDKVENTTISALFNFFTSI
FT                   CMLTAFLGVSLCLFSFLADGLKLRERGSHGIGLFVLTFLPPLLIVIYYPGAYIYALRYA
FT                   GIFCIILLLLLPALMCYFGRKRYKSPFWVPGGKISQFAVIIISVVLLAHEFIALFK"
FT   CDS_pept        complement(788141..788833)
FT                   /transl_table=11
FT                   /locus_tag="lpp0711"
FT                   /product="hypothetical protein"
FT                   /note="Putative lipoprotein, similar to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11859"
FT                   /protein_id="CAH11859.1"
FT                   /translation="MSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDRRAVKRVGVDT
FT                   GIGAVAGVIASGTASGTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQDIQYVEYGDTR
FT                   TLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLS
FT                   QAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSPAQPP
FT                   QPQMAYVK"
FT   regulatory      complement(788838..788843)
FT                   /locus_tag="lpp0711"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        789064..789264
FT                   /transl_table=11
FT                   /locus_tag="lpp0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0712"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11860"
FT                   /protein_id="CAH11860.1"
FT                   /translation="MKIPVQLKNIGGNIPENDIALQVSYFINLKITNCFPKVTLILLQL
FT                   QARLMSVLEIISREIKMFSLL"
FT   CDS_pept        789717..790562
FT                   /transl_table=11
FT                   /locus_tag="lpp0713"
FT                   /product="hypothetical protein"
FT                   /note="similar to membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0713"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11861"
FT                   /protein_id="CAH11861.1"
FT                   /translation="MSKKAIAISIVIALFFITAIWFAYSFVKQEENQNWLTLYGNIDIR
FT                   DVSLSFRVSGRILSMDVDEGAHVKKGQVLARLDKDTFIANLEMAKAQLEQAIANQKNAS
FT                   RTYKRREQLVDDGAVSKALFDDAVAMKDSSSAEVSVAKANLEKAQISLNDTEIHAPTHG
FT                   TILTRIQEPGAIVNVAEPVYTLAIDNPVWVRTYIDEPFLGRIYPGQDALVYTDSNPEKP
FT                   YKGHIGFISPQAEFTPKIVETTQLRTDLVYRIRVVIDQPDNGLRQGMPVTVKIHLKANS
FT                   "
FT   CDS_pept        790565..792307
FT                   /transl_table=11
FT                   /locus_tag="lpp0714"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC-type multidrug transport, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0714"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11862"
FT                   /protein_id="CAH11862.1"
FT                   /translation="MNSSKPLVSINGVSKCFPGNTDPALDNVSATIFEGQITGLVGPDG
FT                   AGKSTLMRLICSLMLPTQGTITVDSLNTRTDSEKIHAITGYMPQKFGLYEDLTIIENLR
FT                   LYAELRNLHGEKREEQFRTLLKFTALEPFQRRLAGNLSGGMKQKLGLACALMGEPKLLL
FT                   LDEPSVGVDPISRRELWTMVQGLLGRGMGVVWSTAYLDEAEKCDQILLLNAGKPIYHGK
FT                   PGDFLQKTKDRTFQICGVSLLNRRQALMNALNTPEVIDGVIQGKNIRIVISDKKIKPSL
FT                   DLITREPGVHFQEVESRFEDAFIDSLKTKISGRSLLAEHIAEKPHSDKPIIEARKLTKR
FT                   FGSFTAVSNNEFTIKRGEIFGLLGPNGAGKSTTFKMMCGLLQPTQGQAFVMGLDLKTSS
FT                   SEARSRIGYMAQKFSLYSHLDALQNMRFFSGLYGLSGKRQEAQINSMIEIFDLKKHLKQ
FT                   NSGDLPLGFKQRLALACAVMHEPDVLFLDEPTSGVDPLTRREFWTHINGMVNKGVTVMV
FT                   TTHFMDEAEYCDRIALIYRGKNIATGTPDDLKDKVRNSTLPNPTLEDAFIELIRLDELR
FT                   EPVH"
FT   regulatory      792312..792317
FT                   /locus_tag="lpp0715"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        792325..793446
FT                   /transl_table=11
FT                   /locus_tag="lpp0715"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0715"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11863"
FT                   /protein_id="CAH11863.1"
FT                   /translation="MNIRYLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADNLSGNPKPALQTIVDGSYPQVAGFAENYALGALQTWVSSQAYEHGQMTLKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   ARDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
FT   regulatory      793621..793626
FT                   /locus_tag="lpp0716"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        793632..794717
FT                   /transl_table=11
FT                   /locus_tag="lpp0716"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS4 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0716"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11864"
FT                   /protein_id="CAH11864.1"
FT                   /translation="MSITELSDILNGYFSWNKSRIECFATMLISLIKVRTVNLTEIACG
FT                   FSSPAKQDSRYTRIKRFFREFKIDFSSVSVWVIHCFGLSGQALYLSMDRTNWRWGKKDI
FT                   NILMLSVVYKGIAIPLFWTLLAKGGNSDTRERIEIVQRFITKFGKSMIAGLLADREFVG
FT                   DNWFAWLLTEKIPFCIRIKNNVITTNSRGLEVSIDALFYDLKSGEQRILQGLRKLWRQK
FT                   IYLSALRLADGELLIVATDHLMDEPIEHYALRWEIETLFSCLKGRGFNFEDTHMTQPDR
FT                   IEKLLVLLTIAFCWAHKTGEWRHVQKAIKIKKHGRKGVSFFRYGLDLLRDAALNGCQFI
FT                   RHSFSDILGFLCISRVICAAE"
FT   regulatory      794730..794735
FT                   /locus_tag="lpp0717"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        794743..795036
FT                   /transl_table=11
FT                   /locus_tag="lpp0717"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknow proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11865"
FT                   /protein_id="CAH11865.1"
FT                   /translation="MQVKQPAIYIMANKRNGTIYTGVTSDLIKRVYEHKYGDVPGFTQE
FT                   HGCKFLVYYELIEDMISAIAREKQLKGGSRKKKLALIEKLNPYWEDLYEKLL"
FT   CDS_pept        795137..796207
FT                   /transl_table=11
FT                   /locus_tag="lpp0718"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative ABC transporter permease
FT                   protein, hypothetical start codon"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0718"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11866"
FT                   /protein_id="CAH11866.1"
FT                   /translation="MTLFKDPKGRIVLIAPPLLQLLIFSFAATMEIKNISIGILNQDSG
FT                   KHGYEVIQRFIGSPTFSKVFFIQKQSDIKSIIDNQEAMVVMTIPQDFSRKIESNSQANI
FT                   QLILDGRRSNATQIVNGYISSIIENYNQEIQKTHGAIMTPPVMVTRSWFNENLLYLWFT
FT                   VPSLVCILSMLISLVVTALSVARERELGTFDQLLVSPLTPYEILIGKTIPAIIIGLAEG
FT                   LLMWVAAVWLFDVPFYGSPLLMVYILFIFIMSTVGVGLFISSMCKTQQQAILGVFIYMV
FT                   PVVTLSGYASPVENMPEWLQDLTWFNPLKFTLIAVIGIFLKGMSALEVFITTWPLLLVG
FT                   AVTLFIAGWFFKQRME"
FT   CDS_pept        796216..797655
FT                   /transl_table=11
FT                   /locus_tag="lpp0719"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0719"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11867"
FT                   /protein_id="CAH11867.1"
FT                   /translation="MDRKLALLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISS
FT                   SAPVHLTWWKAFHDPLLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGS
FT                   ASANSLQISKGTLEGIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKAS
FT                   LEEAYESRRTILLSTIAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVS
FT                   SEVDVSLAEGQLKNTESVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQ
FT                   KVPMGLRSDILRQRPDIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTL
FT                   FQSSSGFWLMGPQVSLPIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVR
FT                   YSQSLDTNHSLRAAIIANKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVS
FT                   SLTALISLYKALGGGWENFEA"
FT   CDS_pept        complement(797980..799761)
FT                   /transl_table=11
FT                   /locus_tag="lpp0720"
FT                   /product="hypothetical protein"
FT                   /note="Similar to soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11868"
FT                   /protein_id="CAH11868.1"
FT                   /translation="MKRLLIFLCGLLCSFNLFALSGQAYMDRFNRYLAWYEQLPINPSP
FT                   EFLEFVKESTPLANKLRDKWLYELARIKDWANYNKYYQPTNDINLRCFAQIAKFNLGLY
FT                   KEAIAGSIPIWLTGESRPQACNTLFALLLKQDNFDQKFITQRITLALDKRNVLLARYLL
FT                   KQYKTPHDTEIKNLTSVYENPSNISKLNPGKLNDYFYLYGLKRLVSINMDKAVKLWQEK
FT                   KTNIMLNERQKQDFLAHLALYKAMRNHADAQEWFAKIKPEYYTDVLVDWQIRFALKNKN
FT                   WKQVEKLINNSPNKEMPCWQYWLARSLEEQGKKAEAIKIYEPLAKNRHYYGFLASKRLK
FT                   KRPSFDNEKPTTNTEILKPYQPVIEQVKNFYNSKQLLQASRLLNDFISELPKEEASALV
FT                   YWIATELKWHGKSVYLSNNDTLNNQLALRFPLAYKDTIKVYASKYAIPPELVYAIIRQE
FT                   SGFREDVTSSAGAKGLMQVMPQTASAVSKTSKIPYSDHKQLFLSQKNINIGIAYLQHLT
FT                   KRFSNHPVLVAAAYNAGPRQVVYWLKNHPPKEIDIWIETLPWQETRNYLKNVMAFYIVY
FT                   QYRLNQQPDMNRFLTPL"
FT   regulatory      complement(799766..799771)
FT                   /locus_tag="lpp0720"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(799803..800456)
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="lpp0721"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11869"
FT                   /protein_id="CAH11869.1"
FT                   /translation="MTFQILPSLLSADMTRLGEEVDAVMKAGADFIHFDVMDNHYVPNL
FT                   TFGPAFCDALIKKFPNLPIDVHLMTTPVDTLIEAFAKAGAKRISIHPDATIHLDRSLQL
FT                   INNLGCEAGLVLNPATSIDTLTWCAHNLKFVLVMTVNPGFGGQKLIPEVIPKLSKIRQQ
FT                   YPNLDLCVDGGVTPQNIASLAHAGANQFVAGSAIFNSSNYSETIKRMREQLASI"
FT   CDS_pept        complement(800670..801134)
FT                   /transl_table=11
FT                   /locus_tag="lpp0722"
FT                   /product="hypothetical protein"
FT                   /note="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0722"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11870"
FT                   /protein_id="CAH11870.1"
FT                   /translation="MKALIAKTYLLADKIFDFLAPIFILLTRLYLAQVFFLSGLTKISN
FT                   WQATLSLFQNEYMVPVMSPTLAAYLGTACELGFPVLITLGLGSRLVLFGLFLFNLFAVF
FT                   SYQFLWTPDGAVGLTDHMQWGIMILMLLCTGPGKLSIDYLIRRFYLKLDN"
FT   CDS_pept        complement(801131..801910)
FT                   /transl_table=11
FT                   /locus_tag="lpp0723"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0723"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11871"
FT                   /protein_id="CAH11871.1"
FT                   /translation="MRNTLLETIQKEWIAQFKEEALSSPLKNRLARSNFDGISVYMESH
FT                   HATLFNHLKSTFPLCMRLVGENFWYALLHRYINNCESTQYDINQYGDSLPQFIANFEPA
FT                   KELPYLQQLCAIEWHWHTLKLLSPVNPFDFEAFSSIDEISFQSLCFHLTPNLKILCSEY
FT                   PIYQIWAMNYFQQDKQIQISGCPEKVVIYQHNDLPCIMLISEEEYIFLELLSSGNQTPW
FT                   QKVVTELSKWISEEKIGDTLTKALRYQWINHFSLEAI"
FT   CDS_pept        complement(801903..802772)
FT                   /transl_table=11
FT                   /locus_tag="lpp0724"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0724"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11872"
FT                   /protein_id="CAH11872.1"
FT                   /translation="MYSNHSTDQAAPYSGCSGIGLRLEHIDNILKEQPTVDYFEVLADN
FT                   YMKQSGAQFKQLLKIAEFYPMSLHSVGLSIATSSEPDYQYLQQIKNLAHCLNSKLISDH
FT                   LCWTHANQFFTHELIPFPYTEETLSFIIEKTNRIQEYLNQPIMYENVSRYVTYRQNTLS
FT                   EAEFLNELSTATGCGILLDINNLYVNWYNHGDDPDKYLHSINTKNVWQMHLGGFSKQEG
FT                   YLLDSHSDKVYQDVWQLYEKAQNLFINTPTVIEWDNDLPDFSLLYDEMCKAKTIIKRVA
FT                   ERSMNHYA"
FT   CDS_pept        complement(802778..803032)
FT                   /transl_table=11
FT                   /locus_tag="lpp0725"
FT                   /product="hypothetical protein"
FT                   /note="Similar to hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0725"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11873"
FT                   /protein_id="CAH11873.1"
FT                   /translation="MNNISKITMAAVMAAGLSIATIPANADTPNDMEKCQGVAKAGKND
FT                   CGTAQHACAGQSKTDGSTTDWIYLPKGTCEKLVNGTVKS"
FT   CDS_pept        803369..804394
FT                   /transl_table=11
FT                   /locus_tag="lpp0726"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted esterae"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0726"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11874"
FT                   /protein_id="CAH11874.1"
FT                   /translation="MAKDTKMINLALQGGGAHGALAWGIIDRLLEDGRINFDAISATSA
FT                   GAMNAAVLAYGFATGGKEGAREALHQFWKMVSDAGQIYNPLKKTPLEELLGIGIENSMS
FT                   FFMFDLMTKILSPYQFNPLNFNPLKEILEKIVDFEKIKSCKSIKIFISATNVRTGKINV
FT                   FDNKKISADAVMASACLPFMFQAVNIGEDYFWDGGYMGNPAIFPLIYNSECRDILILHI
FT                   NPIYREHVPDTAAEILNRVNEISFNSSLMREMRAIAFVTKLIDSGWIKDEYKNNLRKLY
FT                   LHAIRADVSMESASVASKLNPEWSFISHLYEEGRKKGEEWLKSNFKHLGKVTTIDLDEY
FT                   L"
FT   CDS_pept        804510..806726
FT                   /transl_table=11
FT                   /locus_tag="lpp0727"
FT                   /product="hypothetical protein"
FT                   /note="similar to NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0727"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11875"
FT                   /protein_id="CAH11875.1"
FT                   /translation="MQQEDQAQIPQNSRSFSRNTARCFDTFMDTVDFLGRIGWPVIDLA
FT                   FRIWIAQQLLVSAILLSNHWDTAVYLAKNEYPVPWLSPEWEALLGILAQFVGGISLLLG
FT                   LFTRCGAAVIIGFAVMTQVYYQPIDLNLLWIALMLGYVLRGPGPLSLDNLFEHGFSRSP
FT                   LPFAMLIVTFVDRTREFFSSLYLFSLRMWLMISLLLINQHIQLISSDALPLLMPWLPLN
FT                   SASIVFNNVSLFMAIFLGLGLATRVVAIFGLIVVLLSFTPGVTGFYLYWMVLMAILFIS
FT                   GPGILSLDHLIFHALKKHYPQLSGKPAFSLDGLPRVVIIGAGFGGIACAKALRHMPVKI
FT                   TLIDRHNYHLFQPFLYQIATGSLSPADIAISIRSIFLEQFNAEILLGNVTGINKEERLV
FT                   IADNFTIPYDYLVIATGATHSYFGKDSWAPYAPGLKTINDGTSVRSRIIKSFELAEIAE
FT                   SDEERKQFLNFVIVGAGPTGVELAGAIAELARFGIVKEFRHFDPASANIILVQAAPRIL
FT                   PTFSEQISQKAQRYLESMGVKVLVNSMVEQIDSDGVIINKERIYSKSVFWAAGVAASPA
FT                   SKWLQLEADPAGRVKVNDDLTVAGYSNIFAIGDTAASNAWNGKPVPGIAPAAKQGGAYV
FT                   AKVISKRIYNNNSRYKPFKYIHYGSLATVGRKAAVAEFDRFKISGELAWWFWGGVHVFF
FT                   LVGSRNRLSVILNWFWSYYTFRANNLLITDDSLNKKNKSGTSEV"
FT   CDS_pept        806768..807532
FT                   /transl_table=11
FT                   /locus_tag="lpp0728"
FT                   /product="hypothetical protein"
FT                   /note="similar to acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0728"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11876"
FT                   /protein_id="CAH11876.1"
FT                   /translation="MDKYLSANSLEGVIDNEFSMPAPRWLNTYPAGPYRFINREFFIIA
FT                   YETDPDLLQAILPPDMELLEPVVKFEFIRMPDSTGFGDYTESGQVVPVRYKGEEGGFTI
FT                   SMFLDCHAPIAGGREIWGFPKKLAKPKLFVEEDTLIGILKYGSIDIAIATMGYKHRPLD
FT                   AEKVLESVKKPVFLLKNIPNVDGTPLVNQLTKTYLTDVTVKGAWTGPGSLELHPHALAP
FT                   ISNLYIKKIVSVSHFITDLTLPYGEVVADYLA"
FT   CDS_pept        807569..807841
FT                   /transl_table=11
FT                   /locus_tag="lpp0729"
FT                   /product="hypothetical protein"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0729"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11877"
FT                   /protein_id="CAH11877.1"
FT                   /translation="MNKRPIQNTAVIAAALGAALASIYTYTDWLSSDEITVKRERCYNV
FT                   ARAGKNDCATSQHSCAAQSTADRDPEAFIMLPKGLCERIVGGRSG"
FT   CDS_pept        807834..809147
FT                   /transl_table=11
FT                   /locus_tag="lpp0730"
FT                   /product="hypothetical protein"
FT                   /note="similar to adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0730"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11878"
FT                   /protein_id="CAH11878.1"
FT                   /translation="MDSYSKLPLRIRKEIEAQQYTGELLVAGVQLGVIVLLSIINIFSS
FT                   AGYSPGAPVQSSSLGLWLFAILILLRLWFVYTNQLNPIFLGFFIVAEMALLLFIIWTYY
FT                   LQFETTPTINLKNPHINYVYVLIALRALRFEPVWVILSGLTAALGWGIIAWQTLSSSGM
FT                   NVITWDYVTFASTRSVYLGAVFDVILSVLLVTTIIALVLTRAKHTLFQAVEQTSAAKDL
FT                   SRFFDTSVVEKITTSEKSLQAGYGELRQAAIMFIDMRGFTKASVKLSPSELIGLLAEYQ
FT                   RLLVPIIQKNNGSIDKFMGDGILASFGAVTPSNTYAADALRTVDEIVASVDVWSENRRK
FT                   KEQIVVGVGIGLASGEVVVGVIGYENRLEYTVIGEAANLAAKLEKHNKEEKTQALTTRD
FT                   TFLEAVKQGYEDKITKKELNARNVGGVGEPLDLVVLAK"
FT   regulatory      complement(809108..809128)
FT                   /locus_tag="lpp0731"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(809167..809982)
FT                   /transl_table=11
FT                   /locus_tag="lpp0731"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0731"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11879"
FT                   /protein_id="CAH11879.1"
FT                   /translation="MPRMKQIQEFFLNTVLNQQDTAIFKYFCPNEITNEFRFDIYRNTI
FT                   LQNLRHSLEMTFPAIWKLVGKGCADGLALHFIQDKNNLPTTNCLDDWGEKFPLFLKNNP
FT                   TVSHLLYLKNIAEIEWLKHLSYCSRDCLVFDPQKLQKHLNDRVEKLILLFNPSVFLYSS
FT                   SYYLKNIFDLIENPTETGSIDFQQIPSYAVISRQKNQTVIHWITHDLFHFLCHIKAGAS
FT                   LGFAYENTLENNPDFDLLTALQFLLRNELLEDSFIHSNYHLTHANNCPE"
FT   CDS_pept        complement(809975..810802)
FT                   /transl_table=11
FT                   /locus_tag="lpp0732"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0732"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11880"
FT                   /protein_id="CAH11880.1"
FT                   /translation="MHKIINGAMTGIGLRAPHYAQILEEKPDIDWLEVHTENFLVKGGP
FT                   LLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDRFQPALLSDHLSWSTIG
FT                   NTYLPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPSSYLEYQTSSYSEPDFLAE
FT                   IIKRTEARLLLDINNIYVSCSNNKQDPYQYIQRIPHEAVQEIHLAGHSIVYQDNTNFLR
FT                   IDTHNNYVCHEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKSACYA"
FT   regulatory      complement(809993..809998)
FT                   /locus_tag="lpp0731"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        811100..811366
FT                   /transl_table=11
FT                   /locus_tag="lpp0733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0733"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11881"
FT                   /protein_id="CAH11881.1"
FT                   /translation="MSQNWPTRDKDLQTARVIMEEYANERDSDSLGLFEIVVDQNEKRM
FT                   NFRLSGWVVILAKHFTSLYGVSQGDYVTRQVISRCITQGQTLH"
FT   CDS_pept        complement(811621..812373)
FT                   /transl_table=11
FT                   /locus_tag="lpp0734"
FT                   /product="hypothetical protein"
FT                   /note="similar to amino acid ABC transporter, periplasmic
FT                   binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:lpp0734"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11882"
FT                   /protein_id="CAH11882.1"
FT                   /translation="MKFIQGLLLSFFFLVSPLHAQNEPIPLIVGVGGFYPPFIMQGTNN
FT                   ELFGYDIATMTELCKIMKRQCNFRVMRFRQLIPALINKQIDVAISAMSITSERSNLVNF
FT                   SMPYLLSYSRFLTNEVHNTHQPFNLMLLKGKRIGVEQNTVFSQEVRRIGIIDPVIVEFD
FT                   RTEEMLEALSANKIDFVLMDNPAALYWSANSSGRLLVIGSPMLVGYGLGIAVNRENSVL
FT                   LKSLNDALVEYQRSDKYKENYNKYMMNF"
FT   CDS_pept        812511..815252
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="lpp0735"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0735"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11883"
FT                   /protein_id="CAH11883.1"
FT                   /translation="MSPQSDIETLISTKSWLIEKYVAPLHHPLRESAEKLILVSDYACR
FT                   QIRLLVSLLESDSCCSLWSRESYFYAIQQISLELSQAQYMQELRRFRHTHFLRLLLLEI
FT                   ADLASTQEVMQSWSDLADSIILHTLKYIGFTLLSRYGVPRNSEGKEIQLYALAMGKLGG
FT                   RELNYSSDIDLIFAFNEVGSTDGEEQITNQHYFSKMVQTFVHLLQSVTPDGFVFRVDLR
FT                   LRPNGDSGPLVSSFAAMETYYQEQGRDWERYAMVKARVIAESLHEPFPWFERLIIPFVY
FT                   RRYVDFGVIESLRGMKAMIEREVQLNPLLNDIKRGRGGIREIEFIIQNIQLIRGGRLPQ
FT                   LQVQNAMLALAVIKKEKLLPRCDALKQAYLFLRKLENILQSLNDQQTHSLPEDQLKKVQ
FT                   IVYAMGFTDWEQFFNKLQQYQRIVSNFFHSILGKVDDYEDEKRLLNNQLFSLWQGHVES
FT                   NMAVNLLISLGYENAQHCYQMLHAFRHGPRCRRLSQGARIRLDRFMVLLLTELTYCPKT
FT                   DEVLLQVIHLLENIVGRSAYLALLTENPHALRELLFWFVNSPFISSLFVSQPFLLEILL
FT                   EQEKDWHPDSLSQMEQTIVEKLEHTNDVEVHEEILRQFKLTNWMVAARAELYGLCDAVR
FT                   IGKFLSDVAQVIVSQVLIIASKQLCGRHPEMAQIQSRFAIIAYGKLGSREMSYASDLDL
FT                   VFLHSAKPSEEALVTRLTQKILHMLTTRTQMGVLYHVDTRLRPSGAAGLLVSHVDAFVE
FT                   YQKTQAWTWEHQALLKARILSGNSKIKNQFSQLKKSVLLLERDSKLLQRDVLTMRSKID
FT                   QFQESDEVKLARGGLLDLEFLVQFLILNLRDPKFSSYTNTLSQLKHLFLSNVLTKSQFT
FT                   TLKKAYQYFHYLMHQKIVQSDVINDDEMQNAVSSVCKDLYRY"
FT   CDS_pept        815538..816728
FT                   /transl_table=11
FT                   /locus_tag="lpp0736"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0736"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11884"
FT                   /protein_id="CAH11884.1"
FT                   /translation="MYQKTGIFSDEFFGQFLRTLGKCYVQCADVGECYATLSKITDKDG
FT                   ESWYKAWYEMANTLKTKANISWEANHFITAAYAYLRAAEYYRASEFFLRANPDDPRVIA
FT                   CFDQLQFCFERAMHRLHPGAQKIWIPYDDQTLSGYLFFSDQSPKATLIVPGGYDSTFEE
FT                   NYALVPAALLHGYHILIFDGPGQGHVLRRQKLYMRADFEHVVSQVVDWLDEQSELGTSS
FT                   YVLIGRSFGGYLAPRAACSEKRLAALICDPGQMDIAGSLNKMLPPNLMMLLKEGKADEL
FT                   NACFYQLFSENPMKEFYFKSRMYTHGLATPFDYLQALSAYTFVDRVQEITCPTLVCDNP
FT                   SDRISNRGNTLYEALRCEKNYVMFDAKLGAGMHCEADANGQFQQVIFDWLDERFTQ"
FT   regulatory      816781..816786
FT                   /locus_tag="lpp0737"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        816796..817368
FT                   /transl_table=11
FT                   /locus_tag="lpp0737"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0737"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11885"
FT                   /protein_id="CAH11885.1"
FT                   /translation="MRIGIAILVVLVCCTLQGCKKEKSPYQTTSYVESQLFIVSSPDGG
FT                   YIKEWYADEGQLLHKEDKIVTLDGVNSIKAPADSVMTERYYLKDEYVPPNFPIASLSLP
FT                   SQMKILFYVPESHLEKIKLGKKIRILLNEKKYSGKISFISNQAEYTPDAIFSEKNRYKL
FT                   VYKVKADLSQGLRDLLKIGQPVEVNYE"
FT   CDS_pept        817361..818287
FT                   /transl_table=11
FT                   /locus_tag="lpp0738"
FT                   /product="hypothetical protein"
FT                   /note="similar to ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0738"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11886"
FT                   /protein_id="CAH11886.1"
FT                   /translation="MSKWSSKQIIIDVSGLAKSFNGINVVVNLNLQIEEGTIFGFLGPN
FT                   GSGKTTSLRLLSGLIIPDKGQGRCLNLDLMTQTKLIQAQIGYMPQNFCLYQNLTVYENL
FT                   DFIARIYQLKNRKERLKEIIELLALSDNQQRITATLSGGWKQRVALAAALLHKPRILLL
FT                   DEPTSGIDPQSRLLIWEHIQSIVSKGVTVLLSTQHMDEAERCHQLVYMSAGEIIARGSV
FT                   IEIIQSTGLHSWVVKGESFSRLKDILVNNPAIQMIEKGNEMRISSIVDDIHQVLDPFVL
FT                   NNYEIKKTDTTLEDAFIYKIMKEGNPK"
FT   CDS_pept        818284..819420
FT                   /transl_table=11
FT                   /locus_tag="lpp0739"
FT                   /product="hypothetical protein"
FT                   /note="similar to ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0739"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11887"
FT                   /protein_id="CAH11887.1"
FT                   /translation="MKSHFSMQRLWAIIRKEFLLMKRDPATIVIMAILPLILVCIAGYA
FT                   INTYPQKVPTVLINLDNTDVTRELVREIQNTGYFSFVASTNDSESAHHLLKTGKAILVL
FT                   TIPVNFTKALRRNQNPALLLEDGSIDAIASGRAIIALAGLKSSFIEKMGQKGINIPLQR
FT                   PDFQIINHRLYDPDRVTQFYVVPGMIGLVLMLTMLLITVVVAFRDVQGGTIEYLLASPT
FT                   RPSEILLGEIFSYILIGYLQLSFGLILSYYLFHVPFIGAPLLLYLCTLPYIVAELSLGL
FT                   TIATFCTSQFEAVQVINVFIAFSILLTGFTFPIFGMPEWAQYLGLFLPLTHFFKIMFGI
FT                   MLKGNNFGEIWANLWPLLAYCLTMISLATWRFKRHFVR"
FT   CDS_pept        complement(819490..820809)
FT                   /transl_table=11
FT                   /locus_tag="lpp0740"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0740"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11888"
FT                   /db_xref="GOA:Q5X765"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X765"
FT                   /protein_id="CAH11888.1"
FT                   /translation="MNHKVGFVSLGCPKALVDSERIITQLKAQGYELVPTYEDAGVVVI
FT                   NTCGFIDSAVQESLDTIKEAMAENGRVIVTGCLGAKADVIKNACPDVLHISGAHAYEEV
FT                   VNAVHQHLPPPADPFTQLIPPQGIKLTPRHYAYLKISEGCNQKCTFCIIPTMRGKLQSY
FT                   PMAQILTEAKKLKQAGVKELLVISQDTSAYGVDTRYQQIEWQGKTVNTRFYDLCEQLGE
FT                   LGIWVRLHYVYPYPHVDDIVPLMRDGLILPYLDIPLQHANSRILKAMKRPASSENTLLR
FT                   IASWREICPDITLRSTFIVGFPGETEEEFSELLAFLKEAQLDRVGCFKYSPVEGAKAND
FT                   LDNPVSEDIKEERYHRFMQVQAEISRNKLKNKIGSTQTVLIDEITEDQIIARSKSDAPE
FT                   IDGLVYLPKISGITVGSFAEAMITDSDDYDLYGDLEYSLA"
FT   CDS_pept        complement(820899..822659)
FT                   /transl_table=11
FT                   /gene="dsbD/lidC"
FT                   /locus_tag="lpp0741"
FT                   /product="hypothetical protein"
FT                   /note="Similar to thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0741"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11889"
FT                   /protein_id="CAH11889.1"
FT                   /translation="MKKWLLFSLLFLTSLCVYAEPLPASEVFKVSVKKIDPNTFAIQWN
FT                   ILPKYFLYSDRIQLNSDNDDIAQLGTLRFPTPLTKTDKQGRTFKVYRNQLNLPVGVLGI
FT                   TPGETIVNLRFQGCADDGFCYPPEVKQIKLAIDDKLALSQVDLETFHAPEATPLEKPEQ
FT                   DIADIFANHNWIMILLIFYGFGLLLSFTPCILPMVPVLSGIIVGHGKTATTKKAFFLSL
FT                   SYVLSMSVTYAIVGAVVALLGANLQISMQSPWAISLFSLIFVLLALSMFGFYEFKLPDA
FT                   WQSKIVGSSREQRGGHYLGAAIMGCLSTLILSPCVTAPLIGVLTYIAQTGNVLLGSVTL
FT                   FTLSLGMGTPLLLIGTSAGKWLPETGSWMNAVKAFFGILLLAVAIYLMARILPAGLVMG
FT                   LWACLLIFSGIYSGALTKSNTNQEKLCQGIGIILLTYGLLILIGASMGSSNPLQPLANL
FT                   QAAPTVSNAFESAKAQSVKSVELAIKQAFGKPVMLDFYADWCASCKVMENTTFKDPRVQ
FT                   KALSHFIVIKVDVTANNKNDRALMQHFRVVAPPTFIFFNAEGVQLNNLKRVGELNANEF
FT                   MQTIKSIDEN"
FT   regulatory      822832..822837
FT                   /gene="groES"
FT                   /locus_tag="lpp0742"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        822845..823135
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="lpp0742"
FT                   /product="10 kDa chaperonin (Protein Cpn10) (groES protein)
FT                   (Heat shock protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0742"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11890"
FT                   /db_xref="GOA:Q5X763"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X763"
FT                   /protein_id="CAH11890.1"
FT                   /translation="MKIRPLHDRVVVRRMEEERTTAGGIVIPDSATEKPMRGEIIAVGA
FT                   GKVLENGDVRALAVKVGDVVLFGKYSGTEVKVDGKELVVMREDDIMGVIEK"
FT   regulatory      823149..823154
FT                   /gene="htpB"
FT                   /locus_tag="lpp0743"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        823163..824809
FT                   /transl_table=11
FT                   /gene="htpB"
FT                   /locus_tag="lpp0743"
FT                   /product="60 kDa chaperonin (Protein Cpn60)(groEL
FT                   protein)(Heat shock protein B)."
FT                   /db_xref="EnsemblGenomes-Gn:lpp0743"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11891"
FT                   /db_xref="GOA:Q5X762"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X762"
FT                   /protein_id="CAH11891.1"
FT                   /translation="MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGA
FT                   PTVTKDGVSVAKEIEFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHK
FT                   AVAAGMNPMDLKRGIDKAVLAVTKKLQAMSKPCKDSKAIAQVGTISANSDEAIGAIIAE
FT                   AMEKVGKEGVITVEDGNGLENELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLV
FT                   DKKVSSIREMLSVLEGVAKSGRPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFG
FT                   DRRKAMLQDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTIIDGEGKATE
FT                   INARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAG
FT                   YEASVVVNKVAEHKDNYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTE
FT                   CMVADLPKKEEGVGAGDMGGMGGMGGMGGMM"
FT   regulatory      824836..824852
FT                   /gene="htpB"
FT                   /locus_tag="lpp0743"
FT                   /regulatory_class="terminator"
FT   CDS_pept        824932..825372
FT                   /transl_table=11
FT                   /locus_tag="lpp0744"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to DNA-binding ferritin-like protein
FT                   (oxidative damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0744"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11892"
FT                   /protein_id="CAH11892.1"
FT                   /translation="MSKVIKKLEVALADTYALYLKTQNYHWHVTGPQFKSLHELFEMQY
FT                   KELAEAVDQIAERIRIMGHKAPATFAEFNQLKTIKDGDSGLSANEMVSELAKDNMMIVK
FT                   DLNQAIKIAQENEDEGTVTILSDRVAAHEKAHWMLSASKEKK"
FT   CDS_pept        825629..827746
FT                   /transl_table=11
FT                   /locus_tag="lpp0745"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein, predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0745"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11893"
FT                   /protein_id="CAH11893.1"
FT                   /translation="MFRFLFPVSLFISSILLFSIQPMVAKAILPIYGGTPGVWTVCVLF
FT                   FQFILLIAYGYVWLLSQIKKPAVWRLIHMVLVVLSFTALPLLFHPAARDGQPEWVILHN
FT                   LLIQLGLPLLVIGASAPLLQFAYSQTKSKGASDPYYLYISSNLGSLSALLFYPWVIERF
FT                   IGLTRQFYLWNFGFAIYLLLLVTVLFFTKYQPLILTEKKEVDFLPWREIAYWIFLSFIP
FT                   CSLMLGVTLYITTDVAATPLFWVLPLALYLLSFVFTFTATPLISQKWISRNCLFFLVFT
FT                   ILGFIFGVSQIRVWQLVLFNLLSFFILALLCHGQLFARRPKPHKLTLFYFCLSIGGVLA
FT                   GIFNGILAPNWFNYVYEYPLAILLSLFALQLPKTNRGWWVPLVVLGLLSLHYFIPTVPW
FT                   FKSTTTFHILAILALGIIVIWHRNKINLVLSMLILFVFLYFPPLQDKQILLKERNFYGV
FT                   KQVFKKDDVHALISQSTLHGMQVMNGEKASYGRSSYYGAIAPIVDILKKEFHPLSATIM
FT                   GLGAGTLLCQFRATDSIKVIEIDQQVIDLAKNNKLFTYIRDCSPSAEIIKQDGRLALVN
FT                   MPDASQDLLILDAFNSDAIPVHLMTLEAFTLYKKKIVEDGVILVNLSNRHLQMLPVINA
FT                   IGRALNMITLFLAHKGDKKLGQFNSEWAMLTSNQSLAFQVMKGTNWKFVADDDQFLWTD
FT                   DYSNIIPLLKW"
FT   CDS_pept        complement(828080..829960)
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="lpp0746"
FT                   /product="Topoisomerase IV subunit B"
FT                   /function="required for chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0746"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11894"
FT                   /protein_id="CAH11894.1"
FT                   /translation="MSENYTAEAIEVLSGLEPVQRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EVLAGFASRIIVTLHEDGSIEVEDDGRGMPVDLHPQLGLSGVEVIMTRLHAGGKFSDKN
FT                   YSFSGGLHGVGVSVVNALSERLDVTIKRNGIIYQMTFANGDKLCELNETGVTKKRETGT
FT                   VIRFWPNGKYFDTTKISVKHLTHVLRAKAVLCSGLSMTFINKITNEEMNWCYEQGLTDY
FT                   LQQTLPEDYLPEEPFAGAFKSDEATVDWALAWSDSANGNLNESYVNLIPTIQGGTHVNG
FT                   LRSGLFEAMSEFCELRNLLPRGVKLTADDLWESCQYVLSIKMKEPQFAGQTKERLSSRQ
FT                   TSGLVSNVIKDAFAIWLNQHRNQGEAIAALAIERAQKRLKQAKQVARKRVSQGPALPGK
FT                   LADCLQTDLSQAELFLVEGDSAGGSAKQARNKDYQAILPLRGKILNSWEVDSSQVLASQ
FT                   EIHDISVAIGVDPGSSDLEGLRYGKICILADADSDGAHIATLICALFLRHFKPLVKAGH
FT                   VFVAMPPLYRIDAGKLIHYALDDEEKNRIIQHLSQTTKSKVNVQRFKGLGEMNPIQLRE
FT                   TTMDPNTRRLVQLTLDDEEQTEAIMDMMLNKKRAADRKLWLETKGNLAEI"
FT   CDS_pept        830094..831902
FT                   /transl_table=11
FT                   /locus_tag="lpp0747"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0747"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11895"
FT                   /protein_id="CAH11895.1"
FT                   /translation="MQNTAKINQLSVAFKSPDKTVLALDKLSFSLNPGETLVLLGESGC
FT                   GKSLTSLAMMRLLPRAGVYGIDSQINIHGEDILNLPEKMMRELRGRRLAMIFQEPMTAL
FT                   NPVLTIGEQIAEVLKRHRSLTKEQIKERVILLLNEVEMPQPQMRIYQYPHQLSGGQKQR
FT                   VVIAMALACEPDILIADEPTTALDVTIQAQILALLKKIQKKHQMSLLLITHDLGVAKTM
FT                   ADRVCVMYAGQVVEQASVKDFFSKVSHPYVQQLLTSLPSFAKRNEKLSIIAGTVPSLES
FT                   MPSGCRFHTRCIYAFERCHHEEPQLQEVEQRILRCHLYPDIKELPLLDKNKISWVPSVE
FT                   KEEIVFSVDDLSVHFIHKKGFLSRKKTIFKAVDGLSFTLSRGKTLALVGESGCGKTTAS
FT                   RALLRLLPAAGGEIRYKDSDVLSMTGSALRRYRKKVQIIFQDPFSSMNPRMTVGEIIAE
FT                   GMHAQGMKPSYIRKQQKSLIEQVNLPITSLHRYPHQFSGGQRQRICIARALATEPDILI
FT                   CDEPTSALDISVQAQILNLLKELQQQRGISYLFITHNMGVVSYIADDVLVMKDGLAVEY
FT                   GACEKVLRQPEHPYTRQLLNAVLDIE"
FT   CDS_pept        831991..836274
FT                   /transl_table=11
FT                   /locus_tag="lpp0748"
FT                   /product="hypothetical protein"
FT                   /note="LigA protein(Legionella Infectivity Gene A)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0748"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11896"
FT                   /protein_id="CAH11896.1"
FT                   /translation="MKITRNQLNFKGVKEFGGCLTRNDEQIEFINKEIKLLKELIEFNI
FT                   LKGIDENKSQSLFDAVIEAVEKAGLDVEHELLIQFIQSTSAIIDSKSTDLPELISLLTV
FT                   LIKSSKKYDKSELTRYCRLIDKLEKTDEKSLEQWIKILTILGRNVESVNDDLLFNVQSR
FT                   LEIHSVLLKDISSLFDYPPYPALDVFSEKLREYSRELKLYIDSFDRDPAGSRAPKVNQE
FT                   GILVKSREQILNEQFDTSQIQEVIAKIESLVDGSGLSCKGQYELAQQVVFINAIGRDFP
FT                   LKIANETYTDLTQLGRNKLQELSDFLIMEMRRLDISKEDKLRTQLKLLAVMREQYFRST
FT                   GIFFDTTQMISLLLSLHHQEQNVLMGVSCNENLSAPPAAILAAMQWVLADGGTVDLCFA
FT                   NHGLIAQDYLEKGDRDFFTCLGIPSSVVEANSESGTYRVGGINYSTLSDLTSYHSHAVI
FT                   EDEELSMDRCGYPVSSYLILNHIDFSNVDDRTLSHFSSLYDYYKGKGRVIRITEIEETV
FT                   GEVVGQISRFDMDVGYRVFPARKNLQEELNTQSLAERRREEAVKQYFIQSVSNIQQAVL
FT                   NQLEEWQAFLHLIYPKSEWRQLDNELFAQRNELIDSLKKQWTKCLEDSDPKKMYPNPYV
FT                   RRDVFQRLQTRELEKAIQAYEKSVSSIWNLNRDQLKAKTENRFASDSVNALRCKYLEEV
FT                   DLSEQIKWSKLSARLKKKEATHEKKRSHRHLESAVEVTGAMLSYHDGDLEPYRLAFVHS
FT                   QLKLWARDISKEINNSSLPACVKQGLIERANNADNFLALELLLIDYESRWLDKEKLSEK
FT                   FRMQPIISDMLRVYKQAGFEEHKELKILKETYLDSTATQIIHHLDKTLAWAKPENRGPW
FT                   YWIERSAVKKAANEILVLANGVKQARDSLSKQIAIKKLYRGLCKHQAQLEDVWIFSFDH
FT                   KNTRDLINQTLNTMDSLTVLGRDEGGLDINFIQECKEEAQYYLLGEKFSSVLEDFEKNN
FT                   SQILTAHSEWQKVKRQLQQKQNESRKVYTLNEMYYVLCKKINELSISYSLLREPLVQLR
FT                   GMIRTLWNSFQEKHQDIIDESKYFDFKARKIKEELEGIEGYSVFNVKVKKGYTGFNEYV
FT                   ELIIEGEGTSALFEGFMQYKSRLTELKEEYRQLEFSLKQNRLELLNLNRIHAKHLPFLK
FT                   DRIKGNPEVELFPEQCRSKVKEILTLKEWINGQIPENLSQFPENMQNHFLDRNTLKNMD
FT                   RNTMTMEQIDKIKDEQLKADLTELYNKMHKVDEEQSQSWFSTVTRRIVGLIPSMFRQEE
FT                   TEDDWRYQFNELQGRTDSILQSLLTKKIMTKYDALVNEMVLIQSNLAQQMDSGNKKIQF
FT                   LSDKILEEERKTNVIIKRFDNLNDFYDFEAKLKRVKTAPPIAPVNEVQIESKNRILSCG
FT                   EGAFSNPEEEFQTDSVMQPPMVFSI"
FT   CDS_pept        complement(836632..838341)
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="lpp0749"
FT                   /product="Prolyl-tRNA synthetase (Proline--tRNA
FT                   ligase)(ProRS)(Global RNA synthesis factor)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0749"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11897"
FT                   /db_xref="GOA:Q5X756"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X756"
FT                   /protein_id="CAH11897.1"
FT                   /translation="MRASQWFLVTQKETPNDAEIASHQLMLRSGMIRKLGSGLYTWMPL
FT                   GLRVLRKVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGGQLLTMKDSNQREY
FT                   CFGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSF
FT                   HLSLESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGGSASHEFQVLAESGEDLIF
FT                   YSDASDYAANIEQATSLKPPKANQACNETITLVDTPNQKTIDEVASFLGIASNQTIKTL
FT                   IVKGKEHPMVALVLRGDDELNEVKATKHPLVHSPLSFIDEELILKTLKTPLGSIGPIQL
FT                   NIPVIVDHHALAMPSFVCGANQADKHFINAAWERDAKYDDAYDLRNVKEGDQSPDGRGT
FT                   LHCCRGIEVGHVFQLGDKYAKAMNASVINEQGQLQTMIMGCYGLGITRVVAAAIEQHHD
FT                   EHGIIWPQALAPFQVNIIPLNGARSQTVKEQAESLYQQLKSHGIDVLLDDRNERAGVLF
FT                   ADNDLIGIPHRLVVSERNLEQGCIEYKSRTSSETQLINLDKVVNFIIELINK"
FT   CDS_pept        838515..841352
FT                   /transl_table=11
FT                   /locus_tag="lpp0750"
FT                   /product="hypothetical protein"
FT                   /note="Ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0750"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11898"
FT                   /protein_id="CAH11898.1"
FT                   /translation="MPNLPGLYFFQAYPREEIWRLFVDGRFWSKENGWRGYESREPGCL
FT                   NAALESLCSIALQVEKSGEEFELSVDLIKKIHKKCGKKVEELQEKNPGELRTNEPVSFG
FT                   IPAGRASIKGIEEFLSLVFLTEGEAAFGPGKAGPFGPCFDKNYFKNLSPEQIPNLAKQI
FT                   YFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSFNQEIKIAETLDEKLKIIVKHIRMYE
FT                   VLHPFRDANGRTFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVE
FT                   IIEQSKKKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDLSDLNPEKLHRKTQKCL
FT                   SSLNEQYPLHRGAIYLSDPGEIKLLLSNRDESQINQRIEQGAPPLYVGKTPAHLAVISG
FT                   NMAMIDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKD
FT                   NHGKTAFHYAAEFGTPEIISALTTTAVIQINEPDNSGSSAITLAYKNHKLKIFDELLNS
FT                   GADISDELLEAIWARKDKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVD
FT                   IDIPLTKEQATPLMLSVNSGHLKLVSYLLKKGANKSTTDTSGNSILHYVFYSKAENREA
FT                   LVNIITENDKKLINQPNANGNPPLYNAVVVNDLKMATILLEKGARVDFEDRLGNNILHS
FT                   VMRRCDLPIILDIVKKDSTLLHKRNSERRNPFHHALHEMPTFPSSKETEEIHFMNLSDF
FT                   LLKEGVDLNKKDIKGKTILDIALSKQYFHLCVKLMKAGAHTNISSSSKFLKNSDANSIL
FT                   ERPFKFKNDLKKELDENPLIAMAQINDLYVQIKNNRIRTPTGYAPKEGVSFFKGKSNDA
FT                   KAHDEVLSVLKELYDSKLTEMLGNLPGEGLEEIKRSQKFFDGELKLLIKNQDISRKVDK
FT                   KSIQEAVGTSLKLKW"
FT   CDS_pept        complement(841359..843017)
FT                   /transl_table=11
FT                   /locus_tag="lpp0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0751"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11899"
FT                   /protein_id="CAH11899.1"
FT                   /translation="MRDKIITGKKIIFSQSVAKDQTKDLSNFLAERFYSVNQSHNHAII
FT                   IGSSLSHQENDIEHDTILDTSGVLVTTDTNGIVNGARVATTDGLGGGNGDEEEDDEIYK
FT                   VSHFSCENFLNCDQNIDTTLNLITQPKASEKKQTAPKTLQHTEASMAAFIYQNHPGKGY
FT                   IGEFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQT
FT                   LKLAEGDIIISMTDGIWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDSPYPSSFDI
FT                   ARIITSSAMSRSLERRKTLIKLINEIEQQHFHEKSVKTINEVLEYFLKTGHVETAQTLK
FT                   AILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTINVTRIPYHLDELIRSFINY
FT                   PEKHQILAPLFKARIKSEADLEEAFHRLSLETVQAEIECPISEAHFERAFKKETLDKTQ
FT                   AVLTHYFRISTGLDSKKNYQERLNDLSAYFSKESSLEKNDIKLLLSMLDSEIKPKTGVF
FT                   QTLFGENQNKLYKAFHKKIELQLLDGEIENKNELK"
FT   CDS_pept        complement(843158..845464)
FT                   /transl_table=11
FT                   /locus_tag="lpp0752"
FT                   /product="hypothetical protein"
FT                   /note="Similar to inorganic transporter and to carbonic
FT                   anhydrase (bi-functional)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0752"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11900"
FT                   /protein_id="CAH11900.1"
FT                   /translation="MIDRNIVNLRLFRIYSKRYLKFDFVAAIVVFLVAIPLCLGIALAS
FT                   GAPLFSGILSGIIGGIVVGIFSGSQVSVSGPAAGMAAVVLAAISQLGDFNTFLLALTIA
FT                   GLLQMIIGALRAGFVADYVPSNVVQGLLCSIGILLIIKQLPLAFTLSSDFDELKTHLLE
FT                   TTEGFTVSPLLALSQHINEGALIITTLSLAILIYFDITKNKILKEIPAPILVVLAGILL
FT                   NELFIWTNSSLAQNSPQLVNIPDTNGFFQFFSHLEYPDWSAWTNPKVYLYALVICIVAS
FT                   LETLLNLKASERLDKKRRHSPTNQELVAQGLGNITSGLVGGIPVTSVIVRTSINIHAGS
FT                   KTKFSAVLHGFFILFAVMLIPGALNKIPLSSLAAILIYTGYKLNKPAIYINIFSQGSDR
FT                   FIPFIVTVISIIAFNLLAGILIGLAISLFYILKSNSQARIDIIKEIYPNGSTYRLMLPQ
FT                   QMTFLNKAALVAELDTLPRRSQLIIDARHSQYIDKEILDLFNELKEELAGSKQISVNFT
FT                   GFQEHYKIHNYIDFITVTTYDVQTNLTPAQVLNILLEGNQRFLSDNRIHRSNQIDIKYT
FT                   AKTQHPIAVVLACIDSRVPVETIFDMSFGDLFCVRIAGNVINDDILASIEYACNVVGAK
FT                   LIMVLGHTRCGAIQSACDGIEKGHITQLLSKIKPAVNAEKETTTERNGKNQTFVNHVTE
FT                   LNVANTLQNIYKKSDILRTMIDSNEIGMVGAIYDVSSGKVSCKTYTEELSTLDGDENKL
FT                   LAQKFETILLEAKAS"
FT   CDS_pept        complement(845654..846505)
FT                   /transl_table=11
FT                   /locus_tag="lpp0753"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0753"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11901"
FT                   /db_xref="GOA:Q5X752"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X752"
FT                   /protein_id="CAH11901.1"
FT                   /translation="MSSNPSSVEKKLLHYTGKAIADFNMIQRGDRVMVCLSGGKDSFTL
FT                   LTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTRDTYSIVKEK
FT                   IPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYNGDIRSMPP
FT                   KLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQENLMRKKVASLIDQLA
FT                   IENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSIQCEEVFNAQEFEIEDE
FT                   KI"
FT   CDS_pept        complement(846523..847890)
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="lpp0754"
FT                   /product="hypothetical protein"
FT                   /note="similar to outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0754"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11902"
FT                   /protein_id="CAH11902.1"
FT                   /translation="MRKSLFCWILTLGVSTHVFATDLMDIYQQALENDTIFKEAYDTYM
FT                   SSTEAIPQARAALYPQVGLGSQAGRNYQDAVAGAFSANQYYGSYLWQVNASQALFNYQA
FT                   WAKVAQAKASVKAAQATFNDAAQNLILRTAKAYFDVLFAKDTLDFAEAKKRANKRQYDQ
FT                   ATQRFQVGLDAITSVYEAKAAYDQSIATVIAARNNQINQSENLRKLTNHVYETLAPLKD
FT                   SKIPLVKPEPNDVNQWIDTGLKQNYKLYAAKYNLEVAKDNVKAISAGNWPVFSLQSNAS
FT                   QVHNNASGNTVFIPSKQTQANIAIAMNFPVFQGGLVQAQTRQAQYGFQSTSEKLEQTYR
FT                   DVIVNSRIAFNTITDGISKVKADRQTVISVQNSLQSTEAQFEVGTRTMVDVVNAQQRLF
FT                   EAQEQLARDQYDLINSILTLKYLAGTLNVNDLEQINSWLATTRVNGFSPVDNKTSK"
FT   CDS_pept        complement(847902..848552)
FT                   /transl_table=11
FT                   /locus_tag="lpp0755"
FT                   /product="hypothetical protein"
FT                   /note="Similar to L-isoaspartate carboxylmethyltransferase
FT                   protein pcm"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0755"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11903"
FT                   /protein_id="CAH11903.1"
FT                   /translation="MNHSARINMIKQQLRTGDVLNESILDLYDELLRHEFVPEPFSHFA
FT                   YSDMQIPLAYGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISI
FT                   DYYSEFTANAKRKLEEHNCNNVELITGDACRGWLESAPYDVMVFTGAMEKLTDTHKLQI
FT                   LPGGKLFAILGKSPVMKAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF"
FT   regulatory      848722..848727
FT                   /gene="kbl"
FT                   /locus_tag="lpp0756"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        848733..849917
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="lpp0756"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0756"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11904"
FT                   /protein_id="CAH11904.1"
FT                   /translation="MLERFINYLQNELETLKADGLYKSERVISSQQQADVKVNEREVIN
FT                   LCANNYLGLANDPELIAEGQAALAKYGYGMASVRFICGTQTPHKQLEQKISHFLSQEDT
FT                   ILYSSCFDANTGLFETLLTEEDAIISDALNHASIIDGVRLCKAARYRYANNDMKALEEQ
FT                   LIAAKNARFRLIATDGVFSMDGILANLPAICELADKYDAMVMVDDSHAVGFMGKTGRGT
FT                   PEHFGVSDRIDIVTGTLGKALGGASGGYTASNQVVIDWLRQRSRPYLFSNTLAPVIAHT
FT                   SCVVLDKLSTNNSLAEKLKRNSHYFREGMTQLGFELIPGEHPIIPVMLGDASLAGRIAN
FT                   RLLDLGVYVVGFSYPVVPKGLARIRTQMSAALELHHLDKALKAFETVGKEFSVI"
FT   regulatory      849991..849996
FT                   /gene="tdh"
FT                   /locus_tag="lpp0757"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        850004..851026
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="lpp0757"
FT                   /product="threonine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0757"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11905"
FT                   /db_xref="GOA:Q5X748"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X748"
FT                   /protein_id="CAH11905.1"
FT                   /translation="MKSLVKAKKEPGIWMQDIPVPEYGVNDVLIKIKRTAICGTDIHIY
FT                   SWDEWAQATIPVPMTVGHEFYGEIVEVGKEVQGLKVGQRVSGEGHITCGFCRNCRAGKR
FT                   HLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAAHCALAFDVV
FT                   GEDVLITGAGPIGIMAAAIVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLID
FT                   VANELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHVALLGIPPQETPIDWNQVIFKGL
FT                   VIKGIYGREMFETWYKMIAMLQSGLNISPVITHNFPVDEYQHAFQIMASGQSGKVILNW
FT                   "
FT   CDS_pept        851069..852742
FT                   /transl_table=11
FT                   /locus_tag="lpp0758"
FT                   /product="hypothetical protein"
FT                   /note="Similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0758"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11906"
FT                   /protein_id="CAH11906.1"
FT                   /translation="MAQYIFTMNRVSKIVENQRFILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLLRIMAGVDTQYEGEARPQPGIKIGYLAQEPELDLNKTVREIVEEGVAEIKEKLSRF
FT                   DAISMRFAEPMSDDEMNTLLMEQGELQNEIEACGGWDLERKLDVAADALRLPEWDAIIG
FT                   KLSGGERRRVALCRLLLSSPDMLLLDEPTNHLDAESVAWLEHYLEEFSGTVVAITHDRY
FT                   FLDNAAEWILELDRGEGIPYKGNYSSWLEQKEARLSMEKKQEDALQRAIKAELEWVRTS
FT                   PKGRHAKNKARLARFEEMNSKEFQKRNETNEIYIPPGERLGDLVLEGEKICKSYGDRIL
FT                   IDNFDFKLPKGGILGIIGPNGAGKSTFLKMLTGQEEPDKGVIRIGETVKLAYVDQMRDN
FT                   LNPNNSVWQEISDGHDIMQIGNFQMPSRAYVGRFNFKGTDQQKKISQLSGGERNRVHLA
FT                   KLLKSGGNVLLLDEPSNDLDVETLRALEEAILNFPGCAIVISHDRWFLDRICTHLMAFE
FT                   GDSQITFFEGNYTEYETDRKRRLGDEANRPSRIKYRKLSD"
FT   regulatory      852768..852773
FT                   /locus_tag="lpp0759"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        852784..853395
FT                   /transl_table=11
FT                   /locus_tag="lpp0759"
FT                   /product="hypothetical protein"
FT                   /note="Similar to enhanced entry protein EnhA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0759"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11907"
FT                   /protein_id="CAH11907.1"
FT                   /translation="MKKIYWAVILMCLGLTSCVEFDESTLITDDAGYVHRTVHYLRDKR
FT                   GRNYFPMQIKAPGERLFVFDPKASAWAAYDEEGHRVMTGAGSGGIDVCEENPNQSCRTI
FT                   TGTFRIYNKRGIDCRSGEYPVDTKGGAKMPYCMYFYRGFTIHAAYEVPEHPSSHGCVRV
FT                   FPSAAKWLNEEFLRVGTKVIVLAYPDQNGVKTMSSLEKVN"
FT   CDS_pept        853505..853942
FT                   /transl_table=11
FT                   /locus_tag="lpp0760"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein, predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0760"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11908"
FT                   /protein_id="CAH11908.1"
FT                   /translation="MDYITSFTPYLSAIGGLLIGLSAVLFLWLNGRIAGISGMIHGLFP
FT                   PEKPFPAWRIAFLLGLAAAGLIYFISPVIQFPLRTHYPVFLLLISGFLVGFGTRMGQGC
FT                   TSGHGVCGLARFSKRSFIATLLFILSAMITVYLIRHVGGLY"
FT   regulatory      853927..853932
FT                   /locus_tag="lpp0761"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        853942..854367
FT                   /transl_table=11
FT                   /locus_tag="lpp0761"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein, predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0761"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11909"
FT                   /protein_id="CAH11909.1"
FT                   /translation="MYNIMSFLCGLLFGAGLTISNMINPNKVLNFLDINGFWDPSLLIV
FT                   MAVAVTVTFLGYKLINKFDKPILCNQFYLPEKKNIEKKLILGSIIFGIGWGVAGYCPGP
FT                   SITALTTFNSDPVYFVIGLIAGSWTYYWLFKKRTIQK"
FT   CDS_pept        complement(854407..855579)
FT                   /transl_table=11
FT                   /locus_tag="lpp0762"
FT                   /product="hypothetical protein"
FT                   /note="probable outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0762"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11910"
FT                   /protein_id="CAH11910.1"
FT                   /translation="MRLIFTGVLCLLTLNAQANVIQYFAGISYNNPADLFKVKNGILLI
FT                   GGTGSYADLQFKGSALNFNTFQYESGVNHSRTYIVWPYGRVAKRLNDKTVVAVDLTEPF
FT                   NSNLDWGNDAFTRYAATQNYLTDVDLSPKISYAISKKLQIGGGINFNVLLKNEVNWAFP
FT                   TGQSTYANLINRSSSFGVGYNLGINYAVNDTNFLGITYYSRIRQNTSGTSYLGLAANPD
FT                   FQFGFYMPATTVASYVHIFNPKWLINLQVFQSEWNANQKVRLYNTAAPPPFTNFIFDMH
FT                   FDASYAYLAAIRKQVSDKLGIALAGMIDDGPEEDGLRTIVFPSDTQYFLGLIGDYRFTE
FT                   HASMELILGHVYSNPSIQNKAKVNNVPVPFTTGRVTINANVLDLKVKIEG"
FT   CDS_pept        complement(855636..856610)
FT                   /transl_table=11
FT                   /locus_tag="lpp0763"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to L. pneumophila IcmL protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0763"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11911"
FT                   /protein_id="CAH11911.1"
FT                   /translation="MKKTVLWGALFTLITTQANSEATQQAISTQSSASTGTNVVSESTN
FT                   QVPATNQNTQQNQLNQPVQSNGQQPTQTIQNNQPNQPSQTGEQQSNQNTQNNQQNQPAQ
FT                   QQTTQQPAQQQVPSQQTAPVINCDYKISAETKAIEQSLVLTWSEKAIIQSFDFDPATVD
FT                   AQLQKLQACFTDQGWLSFNSALQKSGNLDAIKSQKLHVSSQIDGQPQVTEAIENQWKII
FT                   IPLQVVYQNDKEKVTQLLNVNVTVGRKITGDLGINQMIAVPRTATNTSQTNSPSNTNPA
FT                   DANTSTPQTPGDTTNNATQTNTQTQTGTPTNSPPSGSTTNTQN"
FT   regulatory      complement(856618..856623)
FT                   /locus_tag="lpp0763"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(856623..857582)
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="lpp0764"
FT                   /product="hypothetical protein"
FT                   /note="Similar to formimidoylglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0764"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11912"
FT                   /db_xref="GOA:Q5X741"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X741"
FT                   /protein_id="CAH11912.1"
FT                   /translation="MFDDLSNYRPANPALWQGRMDTANQERFFQKITFIDNQNELMTKD
FT                   KKTIFLGFASDAGIKRNLGRTGAKLGPDQIKTQLAKLPCHNNKHYVDLGNVVCENDELE
FT                   LSQSQFAQIVHFCHENGHQICAFGGGHEIAWAHYQGLSSLYPKLGVINFDAHFDLRPYK
FT                   KGEFGNSGTPFSQIATYCEEKKMPFHYCCIGVQKFGNTPSLFEKAKELNVSYLSAEDLY
FT                   EQSQAWQIAFLDDFILNLDHIYLTICLDVLAECYAPGVSAPQALGLSPWQIMPLLKYLI
FT                   QSGKVVSLDIAELSPPLDSELKTARLAALIIAELLDTN"
FT   regulatory      857909..857914
FT                   /locus_tag="lpp0765"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        857920..858681
FT                   /transl_table=11
FT                   /locus_tag="lpp0765"
FT                   /product="hypothetical protein"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0765"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11913"
FT                   /protein_id="CAH11913.1"
FT                   /translation="MYLITGGGSGIGRALAFALAKRNKQVFIVGRREKLLQETASLSAN
FT                   IHYLCADVSTPQGRELIKASLSATPQIDGLINNAGTLEPTLLLKDISFAEWHQALNTNI
FT                   DAALFLPQLLYDKLSGGRVLNVGSAAAYFPIKGWGAYCVSKAALAMLTRCWQIECDSLA
FT                   FASVMPGIIDTHMQAIARNGINLDPEQVNFYRRLKDHNRLISPETVAEFFIWLLLDIDN
FT                   ETYVSKEWDIYDTTHHSAWLKPPHQVLHWEF"
FT   CDS_pept        858681..859892
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="lpp0766"
FT                   /product="hypothetical protein"
FT                   /note="similar to imidazolone-5-propionate hydrolase HutI"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0766"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11914"
FT                   /db_xref="GOA:Q5X739"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X739"
FT                   /protein_id="CAH11914.1"
FT                   /translation="MFACDELLLNASTIDATGLQLSNQAIVIRKGRIEWCGSEDQLPAH
FT                   FQESAKSRKDCHGQLITPGLIDCHTHLVYAGHRAAEFRLKLQGVSYADIAKSGGGILST
FT                   VQMTRDASEEELVDQSLPRLLALKNEGVTTVEIKSGYGLDLQNELKMLRVARQLGEVAG
FT                   IRVKTTFLGAHAVGPEFKGNSQAYVDFLCNEMLPAAKNMDLVDAVDVFCESIAFSIRQA
FT                   EQIFQAAKDLNLPIKCHAEQLSNMGASSLAARYGALSCDHLEFLDENGALNMVKANTVA
FT                   VLLPGAFYFLKEKQKPPVDLLRQVGVGMAIATDSNPGSSPTTSLLLMMSMACQFFSMSI
FT                   PEVLSAVTYQASRALGMEKDIGSIEAGKIADLVLWSIKDSAALCYYFAYPLPHQTMVAG
FT                   EWVS"
FT   CDS_pept        859919..860614
FT                   /transl_table=11
FT                   /locus_tag="lpp0767"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0767"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11915"
FT                   /protein_id="CAH11915.1"
FT                   /translation="MPIQMNLINKIGLVFGLLFYSFLASAITTEVIKKETAEYLLDIKY
FT                   PQGFQSNGVNQAVKEFITNQQKSFMNELSEDADTPADAPGKTGLNITYSIPYQSTNALS
FT                   VRFNISIYHRGAAHPSNAVKVLNFIKNQPVQLSDLFVPGSDYLQPIADLAKKEITAKKI
FT                   SDENWIKEGTKPTQENYSIWHFTKKGIAIVFNTYQVAAYVYGEQTVDIPLSLISAMVKP
FT                   EISKAVWGN"
FT   CDS_pept        860614..862614
FT                   /transl_table=11
FT                   /locus_tag="lpp0768"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transporters"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0768"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11916"
FT                   /protein_id="CAH11916.1"
FT                   /translation="MSDTPFIAANKKVAELTFRVIILAIILTVLLAMSNAYLALKLGIL
FT                   TSASIPAAIISMGILRFFKNSTILENNAVQTAASAGEAVAGGIVYTIPALIIIGFWNHF
FT                   DYVTNFFIAVCGGILGVLFSIPLRRILVNDQTLKFPEGRAIAEVLKSSADKVGIKDIFL
FT                   GGLVGGLLELLQIGFKVIASSWNYWFVVKRSLFGLGAGFSATMIGAGYLVGHDMAISIF
FT                   LGAVISWLIALPIASQFYPDFLNQYPAEQAATLLWNSEMRYLGIGAMLFAGIWTFIKLV
FT                   KPLTRSVKTSFRTYISKSKFREQYPRTEKDIPMPFILMGIGLMAGILFLFFQIIFPLGQ
FT                   VGLDNDFSPTIVFIGVIYVLVVGFLFSVITAYFSGMVGVTASPGSSVVISGMLFAAWLL
FT                   VSAINHLLPLPLTSHQIQAAEAITIIIGAVVTGIAAIANDNTQDLKVGQLVGATPWKQE
FT                   VMLLLGVVISALVIPPVMQILFNVYGIAGVMPHAGMDVTQSLPAPTAALMAAITEAVFR
FT                   NSLPWNMMLAGSCIILLAIFLNRILNIKRFLNLSILGIAIGMYLPLSSSVPLFIGGMIA
FT                   LFVQKQLGRVKIASEESMIRKQKGTLIACGLVAGSAIMDVLLAIPFSIFHSPDALQLVG
FT                   TSWKQYGVYLGVFSTLLLAWWISHRVCRSKI"
FT   CDS_pept        complement(862645..862857)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0769"
FT                   /product="hypothetical protein"
FT                   /note="similar to putative integrase"
FT   CDS_pept        complement(862999..863358)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0770"
FT                   /product="hypothetical protein"
FT                   /note="similar to transposase, partial"
FT   CDS_pept        863397..863732
FT                   /transl_table=11
FT                   /locus_tag="lpp0771"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS5 family)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0771"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11919"
FT                   /protein_id="CAH11919.1"
FT                   /translation="MLTDDEWNRIKDCLPGKPGDPGRRGADNRLFIDGIMWMARNGAKW
FT                   RSLPEEYGKWSTVHKRFIRWSKKGIWQMIFNTLAVDTDTEWLMIDSTIIRAHQHAAGAK
FT                   GGKKNRH"
FT   CDS_pept        863645..864127
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0772"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase (IS5 family)"
FT   CDS_pept        complement(864103..864360)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0773"
FT                   /product="hypothetical protein"
FT                   /note="similar to transposase, partial"
FT   CDS_pept        complement(864361..864750)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0774"
FT                   /product="hypothetical protein"
FT                   /note="similar to tranposase, partial"
FT   CDS_pept        complement(865026..865229)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0775"
FT                   /product="hypothetical protein"
FT                   /note="similar to transposase"
FT   CDS_pept        complement(865196..865414)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0776"
FT                   /product="hypothetical protein"
FT                   /note="Similar to transposase, partial"
FT   CDS_pept        complement(865372..865704)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0777"
FT                   /product="hypothetical protein"
FT                   /note="similar to tranposase"
FT                   /db_xref="PSEUDO:CAH11925.1"
FT   CDS_pept        complement(865705..865884)
FT                   /transl_table=11
FT                   /locus_tag="lpp0778"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0778"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11926"
FT                   /protein_id="CAH11926.1"
FT                   /translation="MARAIVDATNAFENDLFEKLKNSFSTTDKAQLNSLLLPYKEGLYY
FT                   LGLANKEINNPSLD"
FT   CDS_pept        866241..871886
FT                   /transl_table=11
FT                   /locus_tag="lpp0779"
FT                   /product="hypothetical protein"
FT                   /note="Repeats in the N-terminal domain, similar to
FT                   autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0779"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11927"
FT                   /protein_id="CAH11927.1"
FT                   /translation="MGLKSNNKVVDQTIIPALFGCFIFSSQALALDSTWTGTISTSWGT
FT                   AGNWSSGIPGLPVGVATDKATFTGTTPFTTVANNNVVRTLATLEFSAGATQYTITNLTA
FT                   GGAFTLSGQGIVNNSANTQIITNTQSFTFTNLADAGTNVLFNNNAGGTLTFLGNSTATN
FT                   TTIANAGALNISGLTASEISIGSLSGTAGTINLGSKKLKTGGLNTSTTVASVISGVGGV
FT                   LEKEGSGTLTLTGANTYTGGTIISGGTLQIGAGGTVGSIAGNILNNAALIFNRSNALTY
FT                   AGVISGTGTLTKLGAGVLTLTGNHTFSGDTTISAGTLSIGSGGTTGSIVGNIIDNSALI
FT                   FNRSDNLTYAGVISGSGTLTKQGSGVLSLTGTNLYTGTTTITAGTLSIGDGGILGSVAG
FT                   NITNSATLRFNRADNLSYGGVISGTGALQKQGAGTLTLSGNNTYSGTTTISGGTLLLTG
FT                   NKSGAGTTTVNATTNLQIGNGGVTGLIAGNITNNGTVAFNRSDAITYVGVISGSGVLQQ
FT                   LGSGVLTLIGANTFTGGTTISSGTLQIGAGGTVGSIAGNILNNAALIFNRSNALTYAGV
FT                   ISGTGTLTKLGAGVLTLTGNHTFSGDTTISAGTLSIGSGGTTGSIVGNIIDNSALIFNR
FT                   SDNLTYAGVISGSGTLTKQGSGVLSLTGTNLYTGTTTITAGTLSIGDGGILGSVAGNIT
FT                   NSATLRFNRADNLSYGGVISGTGALQKQGAGTLTLSGNNTYSGTTTISGGTLLLTGNKS
FT                   GAGTTTVNATTNLQIGNGGVTGLIAGNITNNGTVAFNRSDAITYVGVISGSGVLQQLGS
FT                   GVLTLIGANTFTGGTTISSGTLQIGAGGTVGSIAGNILNNAALIFNRSNALTYAGVISG
FT                   TGTLTKLGAGVLTLTGNHTFSGDTTISAGTLSIGSGGTTGSIVGNIIDNSALIFNRSDN
FT                   LTYAGVISGSGTLTKQGSGVLSLTGTNLYTGQTLFNQGTISIIQDANLGAGGALTFNGG
FT                   VLQTTADLTSNRTATLNSGNGTFFTDAGTTLTYNGQITGIGQLRKNGDGTMILGSTLNN
FT                   YSGGTLILDGTLQATTATLPGNVIVNSGAYLEFHQNFDGTYNGVISGAGDVIKDGSGNV
FT                   TLTGIQTYSGQTTINQGGIQGTTTSINNQSVNTTAVNTALIFNQNFDGTYSGILSGLGS
FT                   LLKFGTGTVTLTGANTYSGGTFIDAGAFSISSAANIGGSASPLVFFSGALITTATMILD
FT                   NTTHLGLLGGTFVTNPATTLTMNGQVMGVGSLTKEGSGTLILNNASNNYTGGTIVQEGI
FT                   LQAGVSGGLSNHSHYTINGGQLDLNGYALSMGLLTGLGGTVDVTATSLILEQSLDSTYA
FT                   GSFLGDTTAIIEKNGSGQLTLTGNSSSYQGAMNIDQGTLVMNGQMNGHLNIGNSGTLKG
FT                   VGAVNDLSVYGTIAPGNSIGTLTVNGNYIQNPGSFYELEFNPSGNTDLISVLGTATING
FT                   GTVRLLPDQPPYTPGTKYTILEAQGGVSGTYSDLTNPNLPYLFFDLSYDANHVYLEVFR
FT                   SGIDFSALAITPNQIATANAIETIRPSNPLYIAIVNLDTAEEAQSAFNLLSGEIHASII
FT                   GSVVEESRYLRDAIFQHLTDENPNNNDGVWLRTYNAKTTRDTDNNAATLDGNSSGFFIG
FT                   VDKKITSNVKIGSVFGYGTRQDSVPHRLSNANLQQFDFTLYSEYVHQQLYLRYGYGHFW
FT                   YSASTHRTVELPTLVNYLRSDYSLYSNQFFAEMGLKGLYKNTPVDPVAQVAFIEAGNNQ
FT                   FNERGGISALSGSANHMKTPITTLGFRSKTTLFNSDKLDVNSNGMLGWQHAYSDTVPGS
FT                   IMGFASSANFLIGGTPIAKDSALVNTGLEFKNPQYDSLKMNLFYQGVFADNVSNNSILV
FT                   SLNWGFN"
FT   CDS_pept        complement(872079..873152)
FT                   /transl_table=11
FT                   /locus_tag="lpp0780"
FT                   /product="hypothetical protein"
FT                   /note="Similar to two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0780"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11928"
FT                   /protein_id="CAH11928.1"
FT                   /translation="MYWRFANSMSITNRLLLIFIGSTVLILSIITGLIYPPMKELLHHT
FT                   HLNNEHYNYLLTRICIKNFFVGLWSSTLIIILASYLLAKKSMRPIKIFTKELASINASS
FT                   LEKRLPYTGNPKELEELALTCNDMLFRIESAFSHIKQFSASIAHELRNPIHYLRNATEI
FT                   TLTKPQTIETYQHVLQTHLEEYQSLTQLIDNLLFLTRCEHGQLQLNVRRLSANHLISSI
FT                   IEYYYSIAQEKSIEIQMFGEAHIEVDEHLFKRVISNLIDNSLTYTNKGGRIIIIIEKRT
FT                   DDSIQICIKDNGIGISKEHLPLLYHGFYRVDYSTKKENAGLGLGLAIAKSIMEHHKGEL
FT                   VVDSKVGLGTTVILTLP"
FT   CDS_pept        complement(873133..873804)
FT                   /transl_table=11
FT                   /locus_tag="lpp0781"
FT                   /product="hypothetical protein"
FT                   /note="Similar to two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0781"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11929"
FT                   /protein_id="CAH11929.1"
FT                   /translation="MRLLIVEDHKRTADFICKGFNEYQFQADAVYDGAEAIYRISEINY
FT                   DAVVLDVMLPIMDGWAVLEKIRELKPDLPVLMLSACDDVDSRVKGLEMGAYDYLVKPFS
FT                   FNELLARVKSLLRRKPKESPILLKINDLTLNLQKHTAIRGDKKLPLTAKEFMLLTFMLK
FT                   RSGEVLSRTVIAEQVWDINFDTNTNIIDVAIKRLREKVDNDHPTKLIHTVRGVGYVLEI
FT                   R"
FT   regulatory      complement(873158..873163)
FT                   /locus_tag="lpp0780"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        873953..874948
FT                   /transl_table=11
FT                   /locus_tag="lpp0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0782"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11930"
FT                   /protein_id="CAH11930.1"
FT                   /translation="MSKNESGTAKPIIKPTLMFFNSKLTDLNDKRLQLNRGKGLAKYLA
FT                   KSQKNTRDLAPLDAALGVMSFSLYMLRFSANVGLLAHLILVESQEKTNHKIRRDIYYSL
FT                   LNDSLWCVVNLTQFFWLSYRNSISAGLQGMQLETLAQLIDILVMIIRYQQDKKEYDLKY
FT                   NQAMGMERSRLAIEWQNKELNGLRSLLTSLSVVIAFGLFSFSAVAVPLSPVISSIILIS
FT                   SLLRVLIDIEKDRQLIHQLKLNETSREQIKNEQLAMTNARMKDLNKIILNSVFLPIGFF
FT                   LLITTPIPLTIIACVSMLLVHWLITNLINMRYSPNISVSPTIQTAELSLC"
FT   CDS_pept        complement(875049..875510)
FT                   /transl_table=11
FT                   /locus_tag="lpp0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0783"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11931"
FT                   /protein_id="CAH11931.1"
FT                   /translation="MKKILYVIPGILLITNSFALDIPGNITNSNKDLLPSPFPVYVIEG
FT                   SAVVNHPYPGAKKVLLPTDNGYVDYPGCYIACYSHNTGVYAISPTISVMGQIRVKGQYD
FT                   ARICQPDGYKNQDISAAYQFKQLCAEKIPACQNNSCWAGGDTGGWFGIQ"
FT   CDS_pept        complement(875599..876846)
FT                   /transl_table=11
FT                   /locus_tag="lpp0784"
FT                   /product="hypothetical protein"
FT                   /note="Similar to proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0784"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11932"
FT                   /protein_id="CAH11932.1"
FT                   /translation="MVTQFNTLKSYIFPIILLLSILLGGLTGYVFNQNVAWLKPFGDIF
FT                   LNLIFTTIVPLIFFSVSSAIARTGSIGKLGKIFYSMTVIFLFTGIVAAIYALFVVLLFP
FT                   PAQNMPILLESSKQLSPTNLPERLIEIFTVPEFSKLFSHEHILALVLFSILVGLAVAHS
FT                   KDKGTIFNSFLKAGEDVFMSVFRLIMYYAPIGFFAYFAVIVSEIGPQLMENYLRIAILY
FT                   YTASVFYFFFALTAYAYLAGKSQGIRLFWGNIFLPAATSIATCSSAASIPANLMATKSM
FT                   RIPAEIYETSIPLGSIIHKDGSVMGGVFKIAFLFGIFHLPFASLPVLMMALGVSLLVGT
FT                   VMGAIPSGGMLGELLILSVYGFPPSVLIAVAAISIIIDPIATMVNVTSNSVCSMMIARL
FT                   VEGKNWFLRSSDENNL"
FT   CDS_pept        complement(876968..879733)
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="lpp0785"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0785"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11933"
FT                   /db_xref="GOA:Q5X728"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X728"
FT                   /protein_id="CAH11933.1"
FT                   /translation="MDKTYSPEAIEKALYKKWESHHYFQPRGEGKRFCIMLPPPNVTGS
FT                   LHMGHGFQHTIMDALTRYHRMLGDKTLWQPGTDHAGISTQLVVERQLEAQGVSRKDLTR
FT                   EQFLDKVWQWKEESGNTITQQMRRLGASVDWSRERFTMDEGLSAAVQKVFVQLYEEGLI
FT                   YRGTRLVNWDPKLGTAVSDLEVLSEEEDGFLWHIRYPVVDSEEFLIVATTRPETLLGDC
FT                   AVAIHPDDSRFRHLIGKQVHLPLCDRTIPVIADDYVDKEFGSGCVKITPAHDFNDHEVG
FT                   KRHQLPQINILTKKGTINKNAPLKYQGMDRFVAREQIIKDLEKEGLLAKTEPHKLKVPR
FT                   GEKSNVIIEPLLTDQWYVKTKPLAEPAIAAVKKGDIRFIPETWDKTYFQWMDNIEDWCI
FT                   SRQLWWGHRIPAWYDNHGNIYVGYSENDVRFKHKIDQSTPLKQDEDVLDTWFSSALWPF
FT                   STLGWPERTPELEQFYPTSVLVTGFDIIFFWVARMIMMGLKFTGKIPFKEVFITGLIRD
FT                   SEGHKMSKSKGNVLDPLDIVDGIDLDSLIAKRTSNLMLNSVRDRITKATRKEFPEGISA
FT                   YGTDALRFTYCSLASTGRNVRFDLGRVEGYRNFCNKLWNAARYVLLNTDEEQIDFGDGA
FT                   FQYSPADQWILSRLQNTVSKVHHYFETYRFDLLANTLYEFVWHEYCDWYLELSKPILQD
FT                   DQALSAMKRGTRRTLIHVLDQILKLLHPLMPFITEEIWQKTTKFTSENGISIMLSTYPK
FT                   VNEEFINPAIEEELDWLKSAIQSLRTIRSEMSISPAKLIPLYIRNITPELKERIAKYEK
FT                   ILKTLSKIDKINYLAPDEKVPVSATAVLGEIELLIPMADLIDKEAELSRLNKELAKLNK
FT                   DIELAQGKLNNPKFTDKAPEEIIAKEKDKLAQAQVAKDKLLQHKNRIESL"
FT   CDS_pept        complement(879992..883039)
FT                   /transl_table=11
FT                   /locus_tag="lpp0786"
FT                   /product="hypothetical protein"
FT                   /note="Highly similar to multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0786"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11934"
FT                   /protein_id="CAH11934.1"
FT                   /translation="MKFTDLFIKRPVLSIVVSMLIFLFGINSIYKMQIRQYPKMENTVI
FT                   TIMTGYPGADAELIAGFITTPLESAVASAEGIDYMTSSSQQGLSTITLNIKLNFDPQIA
FT                   FTDVMSKVQQTLNQLPKESQQPVILKKSDSSTALMYISLDSKDMTPQQITDYATRVVQP
FT                   QLQTVDGVAKADILGGQTYSMRIFMNPIKMAALNVTPADVSAVLASNNFLTAAGSTKSE
FT                   YVAINVTAKTDLNNVEEFERLIVKSDKGSIIRLRDIAKVELGSQNYDSSVTFNSKKAVF
FT                   ISITPTPTANPLTVINDARKLFPSIVREFPPSLTGTIVYDATAFIRASIHEVMETIIEA
FT                   AVIVIIVIFLFLGSVRSVLIPVVTIPLSLVGVCTLMLILGYSINLLTLLAFVLAIGLVV
FT                   DDAIVVVENVHRHLEEGKTPFESAIIGAREIATPVIAMTITLAAVYAPIGFMSGLTGAL
FT                   FKEFAFTLASAVIISGVIALTLSPMMCSKILSEEATSGKFAIFLDEFFNKLKRVYQNAL
FT                   HSLLDTREMMLLLAGVVILMLPYLYSNTAAETAPDEDQGFFFVMATAPQYATLDYIEAY
FT                   TKPFDAIYKSFPETENYFTVNMSQPISGMVLKPWDQRKKSQFALKQPLQNKLSKIAGLN
FT                   AFAIVPPPLPGGGGGPAVQFVVKTTNDFQSLMDVSNKLTEKARNSGLFIYIDNSLKFNQ
FT                   PQVEFSINRAKASEMGLDMRALGSSLTSALSGNYINYFNLEGRSYQVIPQLARKFRLTI
FT                   EQLGQIYVKTLNGTMVPLSTVITPTEKTQPNAATHFQQLNSATIQAVMMPGKTLGQGLE
FT                   FLQKAAQEVLPKGFTYDYGGESRQFMQEGSALIFAFLFAIVVIFLVLAAQYESFRDPLI
FT                   VLISVPMSICGALIPLNLGVATINIYTQVGLITLIGLISKHGILIVDFANHLQREKNLD
FT                   KRAAVEESAGIRLRPILMTTAAMVFGVIPLLIASGAGAASRFDIGLVISTGLLIGTCFT
FT                   LFVVPTLYTYLAEDHRHKPNEPAEIQ"
FT   CDS_pept        complement(883156..884418)
FT                   /transl_table=11
FT                   /locus_tag="lpp0787"
FT                   /product="hypothetical protein"
FT                   /note="Similar to efflux transporter, RND family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0787"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11935"
FT                   /protein_id="CAH11935.1"
FT                   /translation="MNKRLTIMGIILLVVFGGIIAFNLIKAYMIKQFFASYAPPAVTVS
FT                   SAVAQAVDWKPTIDAVGNFVAINGVDVNSEASGNVVQIHFESGQYVEKDEPLITIDDSI
FT                   DQALLKFNQSELTLKELSYKRQTDLFKRGATPSSSVDEAKANLQQAQAKVEQIQAQIKQ
FT                   KHIGAPFSGRLGIRQVNLGQYVTPGQTSIVSLQSLDPLYLEFYLPEQYYKRIHLNQPVT
FT                   FRVEEFPNILFEGVIHAVNSKVDLTTHNVQVQALLPNCPADAIQDPTKSPLIKARKQVR
FT                   GDKLIVACSTELNKQNKIRNFVFIPGMFASIEVDQPAEPNTIIVPSTAISYSLYGNAVY
FT                   IIEKSKEGKKNKDGTDQLVVNRVFVTTGEQQGNYTVIKKGIKAGQLVVSTGDLKLQNGT
FT                   PVVINNSVKLDTDSDPNQLGQ"
FT   regulatory      complement(884424..884429)
FT                   /locus_tag="lpp0787"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      884648..884653
FT                   /locus_tag="lpp0788"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        884659..885063
FT                   /transl_table=11
FT                   /locus_tag="lpp0788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0788"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11936"
FT                   /protein_id="CAH11936.1"
FT                   /translation="MKLKSLLFVVCFSLFSNVFAANLHLHPKADNADKKSIQKSVTYPG
FT                   YCQIEIINQSFTDVRVFGTFDDGTTIDFNIYRYESPHYISLFYNFYCHSGMYITITSPY
FT                   YTIYSGWTNVNSTIRVVPYLKEAKAELSTR"
FT   regulatory      885115..885120
FT                   /locus_tag="lpp0789"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        885129..885566
FT                   /transl_table=11
FT                   /locus_tag="lpp0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0789"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11937"
FT                   /protein_id="CAH11937.1"
FT                   /translation="MKYLIPCVVLFPLLSSCTVIQEDFYQPEYLGPAPRVEVTPSYPQG
FT                   HYHRHYNQRYHSNNRYYSAPRGQVHYEHAKTQGHAAVVTPPPSQARVEVQKNVHGHNAN
FT                   NGQVHGHAHDNGNVHSHPDSSNVHGHDTSNPEEQKKIHGHS"
FT   CDS_pept        885691..886002
FT                   /transl_table=11
FT                   /locus_tag="lpp0790"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted periplasmic or secreted
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0790"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11938"
FT                   /protein_id="CAH11938.1"
FT                   /translation="MRDSLKMLLVGSISMIIIACAASPLSESTGEYLDSSTTTAKVKAS
FT                   LVDQLGTMGFAVKVKTYKDQVQLSGFVDSQKIKQRAGIIAAGVDGVKSVRNDLIIKTR"
FT   CDS_pept        886030..887283
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="lpp0791"
FT                   /product="hypothetical protein"
FT                   /note="Similar to serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0791"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11939"
FT                   /db_xref="GOA:Q5X722"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X722"
FT                   /protein_id="CAH11939.1"
FT                   /translation="MFDESYSIKNFDDVLFKAISDEKRRQEEHIELIASENYVSPRVLE
FT                   AQGSVLTNKYAEGYPGKRYYGGCEFVDVAEELAISRAKLLFGAHYVNVQPHSGSQANAA
FT                   VMMALLSPGDTFMGMALPHGGHLTHGSKVNFSGKLYHSVEYGVDSNTGLIDYDALEKLA
FT                   LQHKPKLIIAGFSAYSRILDWARFREIADKVGAYLMADIAHVAGLVAVGLYPSPVPYAD
FT                   VVTTTTHKTLRGPRGGLILCKENEEIEKKLNSSVFPGMQGGPLMHVIAAKAVAFAEALL
FT                   PEFKTYQQQVLANARTMCSVLQSRGYDIVSGGTDNHLLLVDLINKGITGKEADAAVGRA
FT                   NITVNKNSVPNDPRSPFVTSGLRLGTPAATTRGFKEREITLLSNWVADVLDNVHDETNI
FT                   SRVKTQVLLLCREFPVYA"
FT   CDS_pept        887286..887753
FT                   /transl_table=11
FT                   /locus_tag="lpp0792"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0792"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11940"
FT                   /db_xref="GOA:Q5X721"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X721"
FT                   /protein_id="CAH11940.1"
FT                   /translation="MYCPFCHAEETKVVDSRLVADGAQVRRRRECLECHERFTTFETAE
FT                   LIMPLIIKRDGRREPFHIDNLRSGMLRALEKRPVSVDDLEKAIISITEEIRRRGEREID
FT                   SQVVGELVMKELFRLDHVAYVRFASVYKRFKDVSDFRQTIDQMKNEDKEKS"
FT   CDS_pept        887811..888254
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="lpp0793"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N utilization substance protein B
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0793"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11941"
FT                   /db_xref="GOA:Q5X720"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X720"
FT                   /protein_id="CAH11941.1"
FT                   /translation="MEKQSIRGKRRARKFALQALYQWLMSGTDLHEIEAQFRTINNMDK
FT                   VDGEYFCRLLYGIPTHVEALEASLLPYLDREINALNPIELTVLRIGSFELFHCPEIPYK
FT                   VILDESVSLTKEFGSQEGYRYVNGVLNNLAKQVRSVEVSLDNE"
FT   CDS_pept        888247..889203
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="lpp0794"
FT                   /product="Thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0794"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11942"
FT                   /protein_id="CAH11942.1"
FT                   /translation="MNEFTLIDHYFKSIPCKRNDVLFGIGDDAACLQVPDGMHLLVSTD
FT                   TLVSGIHFLPQWDPYDIACKAVMVNISDMAAMGAQPCWVTLALTLPELNQSWLDSFARG
FT                   IKDSLGLYNVDLIGGDTTKGPLSITLTIMGLTPQGQAIRRCGAQAGDAIMVSGELGAAG
FT                   LAVKLLDEHKKVNAKDKVELMNKLLHPKPRVDLCHLLRKYATSAIDISDGLGADLNHIC
FT                   AASGVGANLFEEAIPRHPLLNQYCPEQALDLALSGGDDYELCFTVSIQQLDSFNRDLQK
FT                   ENLICFPIGVIEEKPGLRIQSADSPSKELQPRGYSHF"
FT   CDS_pept        889293..889775
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="lpp0795"
FT                   /product="Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0795"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11943"
FT                   /protein_id="CAH11943.1"
FT                   /translation="MNQVNLANRVWQDPVYFIAFGFGSGLMSIAPGTWGTLAAIPLYLL
FT                   MINAHWSIYLLWTALAFALGVWVSDRVTEDLGVHDYKGIVWDEVVGYLLTMFLVPKGIS
FT                   WMLIGFILFRIFDIWKPQPIRMVDQRVHGGLGIMLDDVLAAVPAWCIMQILVWSFA"
FT   CDS_pept        889775..890827
FT                   /transl_table=11
FT                   /locus_tag="lpp0796"
FT                   /product="hypothetical protein"
FT                   /note="Similar to predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0796"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11944"
FT                   /protein_id="CAH11944.1"
FT                   /translation="MNENHKELISIGLTVSIVIFSLYIVHKFIPSMIWAAIIVIATYPL
FT                   YTRWRKLFGNKHNTSAFLFTTLMGLLFLIPLSWLIGILIKESQLFINFLQHINKEGGAA
FT                   PEFFKNIPLVGDDLIQYWDVNIGKPGNIKEFLSNLHVTLTPTSYYIKQIGVNLAHRSFQ
FT                   VGFTLLTLFFFYRDGDKLLLQIQHIGEYCLGDRWFRYSDRLPSALRGTVNGTIVVGIGV
FT                   GILMGVCYALVGFPAPTLTGFITALAAMIPFVVPVVFIIVALILLSVGSLIGGIIVLVW
FT                   GTLVMFVADHFVKPVLIGGAIQLPFLAVLFGILGGVETLGLLGLFLGPMVMVLFVTLWQ
FT                   EPQGHKKSSG"
FT   CDS_pept        complement(890819..891556)
FT                   /transl_table=11
FT                   /locus_tag="lpp0797"
FT                   /product="hypothetical protein"
FT                   /note="Some similarity with outer surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0797"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11945"
FT                   /protein_id="CAH11945.1"
FT                   /translation="MKKLIQLSVLSGLLLSGSTFAFNQPQGFYVGILGEISHGPSGEDL
FT                   IFTEPNRTITANVEYSPVSGGGGAVLGYKISHYRIEGEVLYNRISTGPFTISSCTLQSP
FT                   NVLTPTGVCPSAFEVNRLGYDGSSAALYGLLNLYYDFFSSVNESTYVPYIGIGAGQVRI
FT                   QNRNNFVKTTPVNLPASAGFSTTMVSGAGQGIVGVGYLMDDFAWLAMDFRFLTTSSLSD
FT                   FNNSRYTLSTFNVGINFTFDKST"
FT   CDS_pept        complement(891566..892204)
FT                   /transl_table=11
FT                   /locus_tag="lpp0798"
FT                   /product="hypothetical protein"
FT                   /note="weakly similar to outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0798"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11946"
FT                   /protein_id="CAH11946.1"
FT                   /translation="MRITLLTTAILATGVAYAAVPVDGWYASAFGGYTYIPPNIYNFAY
FT                   GVFRDEVGYNNGYNAGGRVGYQSNPIRYEVEYTYLRGEARKFNLNFITQLGVTGFTSAN
FT                   TIMANIYYDCPDMLPAIAPFIGLGIGYASLRTELDSIGPFRPSYFTTSDSAFAYQGTVG
FT                   ITYNFSENYAANLAYRYIATDNSSNFGKTYQAHLASVGAIYRFDQGNYK"
FT   CDS_pept        892394..893818
FT                   /transl_table=11
FT                   /locus_tag="lpp0799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0799"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11947"
FT                   /protein_id="CAH11947.1"
FT                   /translation="MPPKDGKELLDIVDNLNEFAEKLLSRIADESDEGCKQLVHVLESA
FT                   RARYNKPIESWLKGWFYQFTRKRGQEIDMAIKGMEAFPDAYTRLQEFKLLVGKGEWEHG
FT                   SFNYYLFDELIKSVPGYKPLESELVHPIILKLRQKINKRIDEFMSQYLATQKLIEARKQ
FT                   ELLQTHQSAQKFIDNVSIINDLEAAKKSAKENKGIIQFCLIFESDIWKLSWVDATGKVY
FT                   ALEPGEELIQILIDGKIKDIVKDIDNLSALHLKQLKQECVKAREMLLGRVQLLINPKDP
FT                   RTQAELTNDVLKENGTSATFVLRGKPNEYSLWWINTLGFAHEISLEPYASMKTWLNDQS
FT                   HPLKEEHIPQLKTYLLNVNTIKSIDVKEDMKEFKAQLQECLAAGPKSKIPPASGAIKTT
FT                   NAKKLDLRLFGDVERCLRSQLSERQEEKAAIQEPGKINLNKYENIATLFGNRAQNMEQH
FT                   EGQHSKPNDSLSIRSI"
FT   regulatory      complement(893827..893868)
FT                   /locus_tag="lpp0800"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(893870..895480)
FT                   /transl_table=11
FT                   /locus_tag="lpp0800"
FT                   /product="hypothetical protein"
FT                   /note="Similar to glutamine-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0800"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11948"
FT                   /protein_id="CAH11948.1"
FT                   /translation="MNAPLTILMAQINPTVGAIDANTKKIIDVIQNHQANHDVIIFPEL
FT                   TLSGYPAEDLLFRKEYHDKIMLNLQDIQDTTKDCYVIVGHPMIHIGDCYNGFSIFYQGE
FT                   KIRAYHKQKLPNYGVFDEARYFTPGKKDPCVLSIKNHKLGFCICEDLWQKGPVDDLLDS
FT                   GISILISLNASPFDYRKYQLREELLRSYAKRGVYIIYVNQIGGQDDLLFDGQSLAMDNQ
FT                   GIIRALAPAFEESLCTVNIDGNKIDGSSTPYLDKEALIYKALVCGTRDYVRKNNFPGVL
FT                   LGLSGGIDSALTLAIAVDALGAEQVHAVLMPSRYTASISNEDALEQLSNLKVAHSIIPI
FT                   EPMFQSMIESLHPVFKDLPPDTTEENIQARIRGMLLMALSNKTGKMVLTTSNKSETAVG
FT                   YATLYGDMAGGFAVLKDVLKTQVYELVRYRNKISLVIPERVITRPPSAELKPNQTDQDS
FT                   LPEYGELDAIIMAYMEQNLSPSEIIAKGFKPQVVNKIIQLIKRNEYKRRQAAPGIKISN
FT                   LAFGKDWRYPITNGFNQCI"
FT   CDS_pept        895764..899030
FT                   /transl_table=11
FT                   /locus_tag="lpp0801"
FT                   /product="hypothetical protein"
FT                   /note="Similar to DNA/RNA helicases, superfamily II, SNF2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0801"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11949"
FT                   /protein_id="CAH11949.1"
FT                   /translation="MLNEAISKMPEAFEAKILLRGEEYFQKGQVLNIRLSDGLLKGRVK
FT                   GSASQIYDIHMDLKSWPAKPSRCSCAYQYNCKHAAACLFALRDREKINLQSLPSNKLDR
FT                   KLDVWLKNLRAQEASEIKREEATHHLTYLIDLKLRGYEHKVSIKLALAKLLKRGGYGKK
FT                   IIFNTLANSKKQHFMGDDNDIVAQLLFKCNVSGWFDNLLIRNTELLDKIIATGRAFFIE
FT                   NEDTPIKKGETLTGECQWILSWNGNQILKLRHDNQNIEPLLLDESWYFDIKNVVMGHLN
FT                   SPYPIKQLRHLLDAPPIPLEQAELLAKKMSKNCPEFPMPNVFNQKETKQLKPIPVLILD
FT                   AVTEQEEHRWIDDGEENNSLYIAKVFFDYEGLLVPFAEECEKVVSLKGDVLVEYQRDKE
FT                   FEDLKIQELRNSIDLRPYHQWEKYHWNLPDHSFFILKDVQIVSDLESLYQQSLPYLKDH
FT                   GWRIEFASPFYQEIVSADEVEWYSDIQESTTDFFSYQLGILVEGKPVSIVPLVADLIQR
FT                   YKGNDLDNLPDEQLVKLPLLDGRLLQLPMGRIKPLVRLLLQFGLRQIDQNLQLQINKYQ
FT                   LVLMQEVELAIAATKSRWQGAESLREELRKLVRLNDLPEIKIPSGLQAHLRDYQHYGLN
FT                   WLQFLRVSRFNGVLADDMGLGKTVQTLAHLQYEKEQSRLHKASLIIAPTSLVGNWFAEA
FT                   KRFTPEIRVLIYHGSDRHQDNFDDYDLIISTYGLIHRDKEKFVGYPFYYLILDEAQFIK
FT                   NARTKTTQIIQQLKASHRLCLTGTPLENNLGELWSLFHFLMPGLLGDAKQFRLWFRTPI
FT                   EKYADMGRRDLLAKRVQPFLLRRTKNQVANELPPKTEITRTIELVGAQRDLYEAIRMSM
FT                   EKKVRDAIARQGLGKSHILLLDALLKLRQVCCDPRLLSMSEAEIAHGTSCKLDALMELL
FT                   DNLVEEGRRVLVFSQFTSMLKLIEELLIVRQYDYLKLTGQTQNRQALVDQFQQGDTPIF
FT                   LISLKAGGTGLNLTRADTVIHYDPWWNPSVEDQATDRTHRIGQESPVFVYKLITSGTVE
FT                   EAILGMQEKKRQLVEGILSTDASRSMVLSEEDLNQFFMPL"
FT   CDS_pept        899289..899723
FT                   /transl_table=11
FT                   /locus_tag="lpp0802"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0802"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11950"
FT                   /protein_id="CAH11950.1"
FT                   /translation="MKLWKVLCSFVIAVCYLPLAFAASQSPAGTWTTIDDKTGAKRAVV
FT                   NLKVSNGTLSGTIVKVYPQPGDTGICSKCPGAFKDKKIQGLTFVWGLKDEGNGVWSGGS
FT                   ILDPKTGKIYKAKMTLQGNKLYVRGYFGVSALGRTQTWIR"
FT   regulatory      899754..899802
FT                   /locus_tag="lpp0802"
FT                   /regulatory_class="terminator"
FT   CDS_pept        899901..901283
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="lpp0803"
FT                   /product="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0803"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11951"
FT                   /protein_id="CAH11951.1"
FT                   /translation="MLDLQISKKTVDPLKRPPHSVEAEQSIIGGLMLDNQVWDKVSNKL
FT                   CETDFYRTEHRILFRAISALAKKDQPFDVVTLLDALKTRNELDDAGGEAYLFELANNTP
FT                   SVANVTAYADIVREKSVQRQLIAVATEIADSAYNPAGREVPELLDMAETKVFAIGEQTA
FT                   SDGGPENIKSILVRAVEKIDALYHNGDAITGLATGLSDLDEMTSGLQPSDLIIVAGRPS
FT                   MGKTTLVMNMAEHAAIKAGKPVLVFSMEMPADSLAMRMMSSLGRIDQHRIRTGKLDDND
FT                   WPRVTSAVHMLSEAPLFIDDTPALSPGEMRARARRLAKEHGSLGLIVVDYLQLMKVPGF
FT                   NADNRTAEISEISRSLKSLAKELQVPVIALSQLNRSLEQRADKRPVMSDLRESGAIEQD
FT                   ADLICFIYRDEVYNEDSPDKGTAEIIVAKQRNGPIGKVRVAFLGKYTRFEDLAFNGYQG
FT                   VE"
FT   regulatory      901270..901275
FT                   /locus_tag="lpp0804"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        901285..902358
FT                   /transl_table=11
FT                   /locus_tag="lpp0804"
FT                   /product="hypothetical protein"
FT                   /note="similar to alanine racemase 1"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0804"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11952"
FT                   /db_xref="GOA:Q5X709"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X709"
FT                   /protein_id="CAH11952.1"
FT                   /translation="MSRPTRLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVRE
FT                   VAPVLDGRIEAFGVACLEEALAIRALGVETPCILFQGVFSSDELSVAVENDFACVLHHA
FT                   QQLEWLIKTPLPYPIKVWVKVNTGMHRLGFKIHELQKVMGALQTCTWVDKSIGLMTHLA
FT                   CADEPHRPENQQQISLFQEISIPGFRQRSIANSAAIISFPDSQADVVRPGIMLYGVSPF
FT                   ANQNAHDLGLIPVMRFMSAISAIHDNPSFAQVGYGGTWKSDKPSRIGVVAAGYGDGYPR
FT                   HISEKTPVWVRGREVSIVGRVSMDMLTIDLTEHPDIEIGDEVELWGTHVLVERIAKSAG
FT                   TVGYELLCQISERVRYK"
FT   regulatory      902416..902421
FT                   /locus_tag="lpp0805"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        902431..902880
FT                   /transl_table=11
FT                   /locus_tag="lpp0805"
FT                   /product="hypothetical protein"
FT                   /note="similar to surface antigens (17 kDa)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0805"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11953"
FT                   /protein_id="CAH11953.1"
FT                   /translation="MKKLIVASLSLTFMLGGCASMNKEGVGTITGGVVGGLLGSQFGGG
FT                   SGKVAAAGAGALLGAYLGGQIGKTMDKVDRLEMQRALETAPTGKAVAWSNPDTGYRYTV
FT                   QPTRTYYNAQQPCREYITKAMIGGKTQQIYGKACRQADGSWRVVN"
FT   regulatory      902892..902918
FT                   /locus_tag="lpp0805"
FT                   /regulatory_class="terminator"
FT   CDS_pept        903188..903622
FT                   /transl_table=11
FT                   /locus_tag="lpp0806"
FT                   /product="hypothetical protein"
FT                   /note="Similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0806"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11954"
FT                   /protein_id="CAH11954.1"
FT                   /translation="MAHLIHSVLPVPPRKIAYIHPDDSVKECIKQMVEKDIGALVVFDN
FT                   DAHLIGIVSERDILRCYFHKSLSLETAKVSDVVYTNVTILSPHDSVEKAMQVITETKRR
FT                   HVLIQEEGELLAILSIGDLLYHVLEDKLRVIEHLENYIHS"
FT   CDS_pept        903731..904918
FT                   /transl_table=11
FT                   /locus_tag="lpp0807"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0807"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11955"
FT                   /protein_id="CAH11955.1"
FT                   /translation="MKTMKQMIRLTMLLLMLSFNLWAINSSSPWYTEEKGKGLVINVEL
FT                   YLSSTCPHCHKADEFFKEIEKHYTWLHVERYIIDKDKKALKRFGDLLTELNRYDFAVPS
FT                   IFFCNSRWVGFATAQTTGKDLLNGIEYCKEEIVKNGRLTPATENVLNRWGNASLFDSNI
FT                   TGSPSTNTFIFVVAIIDAISPCALFTITAFLGLLFMIEKRKLQFISGSVFILTVAGVHY
FT                   FQQVYPTLFFESLSWFRIPAALVGLFAFYFAGQYYKKHSIQPLFIVLAFLLALTVPMFQ
FT                   QTCLMNWSYVFEQWLHNQNVSGVQMGLYQFAYQLIYIFPLIILMFLYWILMKIHFFKKF
FT                   KTKLTTIGFLYILAIALLLIVYPYALSNLALSLFLIVSLGISGLLLNWFNASKMT"
FT   CDS_pept        905030..905326
FT                   /transl_table=11
FT                   /locus_tag="lpp0808"
FT                   /product="hypothetical protein"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0808"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11956"
FT                   /protein_id="CAH11956.1"
FT                   /translation="MDDNNSEFKHLFPIAVEVTEGKTYVWCGCGKSKTQPFCDKENCGD
FT                   KAVSFIAELTEDVYFCNCKQTKNPPFCDGSHAKILLEVVKKKAKQMNRKGSLK"
FT   CDS_pept        905323..906873
FT                   /transl_table=11
FT                   /locus_tag="lpp0809"
FT                   /product="hypothetical protein"
FT                   /note="regulatory protein (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0809"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11957"
FT                   /protein_id="CAH11957.1"
FT                   /translation="MIDQELKKKIVNTISQYEHKCDKMQSQINTLRSVINQLIINPIGI
FT                   NYELDDRLSQLRNYLDTEFEPAVIEKKVKRLAEILSKMQRKKAENSRLVNGLIKQGVES
FT                   IGRIANKSQDKRAVTKLQKMLDTEMESHAILIRFNQVLTQCISSVIKEMEKLPQITKVD
FT                   TPQKSYQSEISLKVNDSLQQLLNHLSIPQDLDSKRGVIKTNLEHALTDEELSTIIDNLT
FT                   ELVVESFNVEQNRFKGFLQQLTDQLNDFEIYLRVSGDARKKASEDSRLLECGIQDNLDQ
FT                   IKNHLDTSKTIEELSSKVSQNIKMIGDRLKEYRHNEKIREEEYAKQVSELQARLQESEQ
FT                   NAEEIKNLLAFQKYRINHDSLTGLPNRESYDEHILDSFQRWKRSSSALSLAVCDIDHFK
FT                   RINDNFGHLAGDKVLKKVAMIFKSSIRTVDFIARIGGEEFVFIFEQTSSKEAFGILEKL
FT                   RKLVEDCLFYYRDKKVDVTVSFGLTTVTEEDDIESLFMRADNAMYKAKNAGKNRVEIL"
FT   CDS_pept        907025..908014
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="lpp0810"
FT                   /product="Lipoic acid synthetase LipA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0810"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11958"
FT                   /db_xref="GOA:Q5X703"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X703"
FT                   /protein_id="CAH11958.1"
FT                   /translation="MGKLIDIPIVVESGQKYKTSQGVTAIKDGIKSSGQDHERLPKPKW
FT                   LRIVNHTTPAYSQVKEQVQKHRLATVCEEAKCPNISECWSHGTATIMLMGAVCTRACRF
FT                   CSVDTGNPHGWLDAEEPENTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKK
FT                   RSPRTKVEALTPDFQGSERDVAVLLDSGVDVFAQNVETVERLTHPVRDNRAGYQQTLNV
FT                   LAFAKKYRPDVLTKTSLMLGLGETDEEIIQTMDDLRTHHVDILTLGQYLQPTKNHLPIA
FT                   RYVTPETFSELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLDV"
FT   CDS_pept        complement(908326..908607)
FT                   /transl_table=11
FT                   /locus_tag="lpp0811"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0811"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11959"
FT                   /protein_id="CAH11959.1"
FT                   /translation="MFWVYILQCSDKSYYTGQTDNLEKRLTQHQDKMIPGCYTSTRLPI
FT                   QLKFSQEFMSREEALNAERQIKGWSRRKKEALINGDWQALSDYSKRKN"
FT   CDS_pept        complement(909490..910998)
FT                   /transl_table=11
FT                   /gene="iraB"
FT                   /locus_tag="lpp0812"
FT                   /product="di/tripeptide transporter homolog IraB"
FT                   /function="involved in iron acquisition"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0812"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11960"
FT                   /protein_id="CAH11960.1"
FT                   /translation="MKLISQAVKNYLPELSLRQKQTNNIIFITFWSQFSVYALNTVLVL
FT                   FLTRPLIAQGLGYSQAKAYAFIGVTQATGYLMPILGGYMADNIVGVRRSILLGSIMLAC
FT                   AYLLVMLSGYTISSLGDQLFIIAFAFIPATNSLLMGTASSMVSHIYSDDAIKAKSAMTY
FT                   YYMAINVGALLATMIAPVLLESRYGPLSVLTLTFIGKSIAALNFAKRYSIYDSVIWGMD
FT                   KSKFSNQGLLRLVAYIAAIYSLTLYAYTHVYIASTLIGAGCAIGILWFLIKTIMLKGET
FT                   RSKQMIAVLLIIEAIVFFIIYNQMNSTLVLFAENNSDLSFLWFKISPAQYQMLNPLLIL
FT                   LIGSQLPRFYRFFSRFTIPYQFAAGTILSGIALLVMAFAAQNAINGLVNGNYIALTYIL
FT                   ISIAELWVSAIGLSMIGLYCDARAIAFAMGVWYLASSMSNAISGRIAGWVAIPENINSA
FT                   LESLPYYKNYYLIMGISALGLGILMYFVAYYLHKIMKRRGIELA"
FT   CDS_pept        complement(911037..911855)
FT                   /transl_table=11
FT                   /gene="iraA"
FT                   /locus_tag="lpp0813"
FT                   /product="small-molecule methyltransferase IraA"
FT                   /function="virulence determinant"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0813"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11961"
FT                   /protein_id="CAH11961.1"
FT                   /translation="MSLKAMYNQIAENYATANRFGSISESHHVAIEQMRKFHLGLKPHY
FT                   KILDLGVGNGSFLQKLHHLMPMANFTGIDVSSEMLKRASEALPLTTIEGSAAEANKFLP
FT                   AHSQDLVLAHFINAYIPINVLFDEAKYLTRANGHFSLITTTYDSFPVAQQQLANFIAQD
FT                   TILSRVVGHYYKSIVKNTTVAANLDELLLAFKQHQFNILDHQRIEIPITLNNIDELALF
FT                   GIEGTWFLNTLSIRMLPKYFLIQRLKRLFSKIFTFPYHDTHIIDVVLARK"
FT   CDS_pept        912015..913397
FT                   /transl_table=11
FT                   /locus_tag="lpp0814"
FT                   /product="hypothetical protein"
FT                   /note="Similar to LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0814"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11962"
FT                   /protein_id="CAH11962.1"
FT                   /translation="MSNARIGIDMSKIYAPKSIDLSSFQLPDEKLQTKYGLPHKVEFCK
FT                   SCVISNQRPNSAVEYEHKKESKKHTIHFDDEGICDACRVAERKKSTINWEERDRQLREL
FT                   CDRFRSKDGSYDCVVPGSGGKDSFYAAHILKYKYGMNPLTVTWAPHMYTPWGWRNFQSW
FT                   IHAGFDNHLFTPNGRVHRLLTRLAVENLFHPFQPFMIGQKAYAPKMALLHKIKLVVYGE
FT                   NEAEYGNPIGDTESAKRDWKYFTADDKSKIFLGGTSVQELKSDFGLNDNDLDAYLPADP
FT                   QQIEEQQVEVHYLGYYLKWHPQSCYYYSVEHGGFEASPERTPGTYSKYNSIDDKIDDFH
FT                   YYTTLTKFGIGRATYDASQEIRSGDITREEGVALVKRFDQEFPERFAEEIFKYLSINLK
FT                   EFPIASQMFEQPIMDRAYFMALADTFRSPHLWKKDGEQWKLRHQVTNLEKTKAEYLDLE
FT                   TV"
FT   regulatory      913384..913389
FT                   /gene="hisF"
FT                   /locus_tag="lpp0815"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        913397..914158
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="lpp0815"
FT                   /product="hypothetical protein"
FT                   /note="Similar to imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0815"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11963"
FT                   /protein_id="CAH11963.1"
FT                   /translation="MSNVRLIARLDIKGPNLIKGVHLEGLRVVGNPNEYAMAYYAQGAD
FT                   ELIYMDTVASLYGRNNLSEIVKTTAENVFIPITVGGGIRSVDDAKQLLRCGADKVAINT
FT                   AATKNPTLISDIARRFGSQCVVLSIEAKRTVNGRWEVMTDNGREHTGMDVVDWARNGEE
FT                   FGAGEILLTSIDQEGTRKGFDLELVKQVSSMVSIPVIASGGMGKLEDLTEVVCESKADA
FT                   VAMADVLHYKRIGLPEIRKYALDNGIHVRVL"
FT   CDS_pept        914155..914796
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="lpp0816"
FT                   /product="hypothetical protein"
FT                   /note="similar to Imidazole glycerol phosphate synthase
FT                   subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0816"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11964"
FT                   /db_xref="GOA:Q5X6Z7"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X6Z7"
FT                   /protein_id="CAH11964.1"
FT                   /translation="MSSVSIVDYGVGNLLSVARAFQYFDASVNLVSTPEEIMSADRLVL
FT                   PGVGAFEDGMKGLTTLNFIEPIKQFARSGKPFLGICLGMQMMLSRSTEFGQHEGLDLIA
FT                   GEVVSVPSHGVDGQLHKIPHIGWNELVSTSEGEDWCHTILKNIPLNSSVYFVHSFMAMP
FT                   SNPKKRLADTLYDGQAISAVIKDENMYGCQFHPEKSGEVGLSIIQQFLQI"
FT   CDS_pept        914809..915507
FT                   /transl_table=11
FT                   /gene="neuA"
FT                   /locus_tag="lpp0817"
FT                   /product="CMP-N-acetlyneuraminic acid synthetase"
FT                   /function="peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0817"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11965"
FT                   /protein_id="CAH11965.1"
FT                   /translation="MRILAVIPARAGSKRLPGKNTRLLAGKPLIAHTIVAALQSSCCEE
FT                   IVVSTDSKQIADVAVQYGASVPWLRSEDLATDTSDVIHTVIDLLFKFQQMDVFFDSVLL
FT                   LQPTSPFRKPETIRHAVEIHKVTGKSVVSVSPISLKPSWCRSIDSQGNLVKPELFQDLE
FT                   IYCNENPIYKLNGSIYIATAKQIIENKSFYSEPTKPLLLNSISESIDIDTPIDWALTEK
FT                   LMELNQEALV"
FT   CDS_pept        915504..916526
FT                   /transl_table=11
FT                   /gene="neuB"
FT                   /locus_tag="lpp0818"
FT                   /product="N-acetylneuraminic acid condensing enzyme"
FT                   /function="peptidoglycan biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0818"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11966"
FT                   /protein_id="CAH11966.1"
FT                   /translation="MTCFIIAEAGVNHNGDLQLAKELVYAAKESGADAVKFQTFKADTL
FT                   VNKTVEKAEYQKNNAPESSTQYEMLKALELSEEDHYLLSELANSLGIEFMSTGFDEQSI
FT                   DFLISLGVKRLKIPSGEITNVPYLQHCASKKLPLIISTGMCDLQEVRVAIDTVKPYYGN
FT                   SLSDYLVLLHCTSNYPASYQDVNLKAMQTLADEFQLPVGYSDHTLGILVPTLAVGMGAC
FT                   VIEKHFTMDKSLPGPDHLASMDPEEMKNLVQSIRDAETVLGSGEKKPSDNELPIRALVR
FT                   RSITLRRDLVKGAQISKEDLILLRPGTGIAPSEISNIVGSRLSMNLSAGTTLLWEHIEA
FT                   "
FT   CDS_pept        916526..917659
FT                   /transl_table=11
FT                   /gene="neuC"
FT                   /locus_tag="lpp0819"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /function="LPS O-antigen biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0819"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11967"
FT                   /protein_id="CAH11967.1"
FT                   /translation="MIRKIIYVTGTRADYGLMREVLKRLHQSEDIDLSICVTGMHLDAL
FT                   YGNTVNEIKADQFSICGIIPVDLANAQHSSMAKAIGHELLGFTEVFESETPDVVLLLGD
FT                   RGEMLAAAIAAIHLNIPVVHLHGGERSGTVDEMVRHAISKLSHYHFVATEASKQRLIRM
FT                   GEKEETIFQVGAPGLDEIMQYKTSTRDVFNQRYGFDPDKKICLLIYHPVVQEVDSIKIQ
FT                   FQSVIQAALATNLQIICLEPNSDTGGHLIREVIQEYIDHPDVRIIKHLHRPEFIDCLAN
FT                   SDVMLGNSSSGIIEAASFNLNVVNVGSRQNLRERSDNVIDVDVTYDAILTGLREALNKP
FT                   KIKYSNCYGDGKTSERCYQLLKTIPLHSQILNKCNAY"
FT   CDS_pept        917649..918257
FT                   /transl_table=11
FT                   /locus_tag="lpp0820"
FT                   /product="hypothetical protein"
FT                   /note="Similar to acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0820"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11968"
FT                   /protein_id="CAH11968.1"
FT                   /translation="MHTNLKIIGCGGHCKVVIDALSLTQHSLQVSLCDSNKSFLGQEVC
FT                   GVLVDSTMDSLADYIGYVHVSIGNNQARKNVIDLMNSNANLFTIIHPAAIIAKSARLGA
FT                   GSFIAAQAILGPECQVGEGCIINHSAVVDHEVIVGSCSHIAPNSTLGGRVKIGERVLIG
FT                   AGAVVLPGVTIGDGAIIGAGSVVVKDVKENAVVKGVPAV"
FT   regulatory      918256..918261
FT                   /locus_tag="lpp0821"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        918268..919770
FT                   /transl_table=11
FT                   /locus_tag="lpp0821"
FT                   /product="hypothetical protein"
FT                   /note="similar to polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0821"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11969"
FT                   /protein_id="CAH11969.1"
FT                   /translation="MITIKELYIQKQENLKTALSKLDATAQGVLFLVDSDEHLIRTVTD
FT                   GDIRRLLLKGFTLDSTLEELSEHSSKALPVSATIQDAYHLMQEYELDHIPVIDESNRPI
FT                   RLIHRRELSSNILLSSPHIGEHEQQYVQEAFATNWVAPLGPNVDSFEKEVAEYINIKSA
FT                   VALSSGTAAIHLALVLLDVKPGDIVFASSFTFVATVNPILYQGATPVFIDSDLDTWNMS
FT                   PVALERALRESKAKNQMPKAVIIVNLYGQSANYDALCQLCNEYNVPIIEDAAESLGATY
FT                   NNKYSGTFGKLGVFSFNGNKIITTSGGGMLVSEDESLIQRARFLSTQAREPMPHYEHTV
FT                   VGYNYRMSNVLAGIGRGQLKVLEKRVKARRAIFERYKQALESYPFIDMMPEITQGYSTR
FT                   WLSTLVIKPTPNKIKPEEVIEQLKPFNIEARRTWKPMHRQPLFAGSKYYPHDEQFSVSD
FT                   YLFDHGICLPSGSNLTPRDIDRVIHCLNDIFIKYKQNNFEVA"
FT   CDS_pept        919860..920423
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="lpp0822"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="rhamnose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0822"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11970"
FT                   /protein_id="CAH11970.1"
FT                   /translation="MNIINTQIDELKIIEPKIYGDERGFFYESFQAKRYEELLGITDRF
FT                   VQDNFSRSQKGVLRGLHYQSQQTQGKLVSVLAGEVFDVAVDIRLGSPTFGQWVGVILSG
FT                   ENKRQFWIPKGFAHGFYVLSAMADFAYKCTDYYHPESEFSIHYLDPQLAIDWPLGEQVQ
FT                   LSPKDAAAKLLNLIDAELLPRYQA"
FT   CDS_pept        920424..921308
FT                   /transl_table=11
FT                   /gene="rmlD"
FT                   /locus_tag="lpp0823"
FT                   /product="dTDP-4-keto-L-rhamnose reductase"
FT                   /function="rhamnose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0823"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11971"
FT                   /protein_id="CAH11971.1"
FT                   /translation="MKILVTGANGQVGTEIIKRFSSSEHEVYACTRDILDCSKLERVHD
FT                   VLSEIKPDLIINAAAYTAVDKAEDEPDLAHIVNAEFVCRLVNYCTLKNVPLIHLSTDYV
FT                   FDGEKEGAYHETDIPHPVSTYGRTKWEGEQAILSQLKKYIILRVSWVFGEQGKNFVKTI
FT                   LNLASSRKELNIVSDQSGRPTSARDIARVLFEIVQKIRHSSFDYWGLYHYAGQGVTNWH
FT                   EFANVFLNMAKEKQLLLTLTDLNPIKSQEYPTRATRPKNSVLDTTKIETILGIKSCSWK
FT                   NDLPDVIDHFTKK"
FT   CDS_pept        921268..922347
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="lpp0824"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /function="rhamnose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0824"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11972"
FT                   /protein_id="CAH11972.1"
FT                   /translation="MICQMLSTILQKSKNLTMKNQMNNLLVTGAAGFIGSNFVKFMNDK
FT                   YPEIKIISLDKLTYAGNKANLSEMAECKNHLFVQGDILDKSLVLSLLREYEIDTLVHFA
FT                   AESHVDNSIDNPQIFLETNVIGTFTLLEAARIYWLNERQWDKSKCRFHHVSTDEVYGSL
FT                   EREEPAFTEKNSYQPNSPYSASKASSDHIVRAYYHTYGLPVTTSNCSNNYGPNQHKEKL
FT                   IPKVVYACVNQLPITVYGNGSNIRDWLYVMDHCEAIDTIIQKGALGEVYNIGGNNELDN
FT                   LSLIKMICQMMDDLKPMEKPYHSLITFVEDRKGHDKRYAIDNSKIQKELGWVPQGDFVH
FT                   KLSNTVHHYLTRYEREINI"
FT   CDS_pept        922386..923885
FT                   /transl_table=11
FT                   /gene="gpi"
FT                   /locus_tag="lpp0825"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /function="Involved in glycolysis and in gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0825"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11973"
FT                   /db_xref="GOA:Q5X6Y8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X6Y8"
FT                   /protein_id="CAH11973.1"
FT                   /translation="MIRNSMKSHTELLSWNLLQKEADRVRLNSDSLTCVVPDSNNYESS
FT                   KQINCIEYDYSRQRVNRTIIDLLIDLANEVKLQEKIDNLINGKKINISENRPALHTALR
FT                   DLGNKSIMIDGLDIMSAVINTREKIKVISNQIREKKWLGHSGLPITDIVNIGIGGSDLG
FT                   PRVCINALSNYISKEFNYHFISDVDPASFNDVIAKINPQTTLFIVSSKSFTTKETLLNA
FT                   RKAFALYEDTASIDQHFIAVTAHPERAYQMGIKTVLPIWDWVGGRFSFCSAVNLITAIA
FT                   IGYEQFVELLAGAHDVDTHVQFTDFKNNIPVLMALIGIWNNNFLNIHNLLILTYSKKLE
FT                   YFVPYVQQLDMESNGKSIDVNGSMVDYATGPIVWGGLGNQAQHSYFQLLCQGTHRCVGD
FT                   FITLKTNDEHEINSMCHYKMKVLSEGIQTIENPYGYIPGNMPMNHLILSDCSPYTLGAL
FT                   VALYEHKIFVQSVIWNINPFDQPGIESAKSAHREITLSSES"
FT   CDS_pept        924040..924915
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="lpp0826"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /function="rhamnose biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0826"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11974"
FT                   /protein_id="CAH11974.1"
FT                   /translation="MKGIILAGGFGTRLYPLTKSISKHMIPVYDKPMIYYAISTLMLAN
FT                   IREILIISTEEHLPLYQNLLSDGSQWGISFAYLVQNEPRGIAEAFILGEKFIGNDSVCL
FT                   VLGDNIHQGRGFSELLQNAKSKLNGATVFAYYVDKPQAYGVVEFNEKQQVLSIVEKPAQ
FT                   PKSNYAVTGLYFYDNQVIEIAKSLKPSGRGELEITDINQFYLYENKLDVQILGRGFVWL
FT                   DMGTPETLLSASNYICTIEQRQGLKIGCPEEIAWRMKFISDDELLCRARELNKSSYGQY
FT                   LAELLNHKRY"
FT   CDS_pept        924936..925892
FT                   /transl_table=11
FT                   /locus_tag="lpp0827"
FT                   /product="hypothetical protein"
FT                   /note="similar to NAD dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0827"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11975"
FT                   /protein_id="CAH11975.1"
FT                   /translation="MAKILITGATGFIGRSLVPALLSEGHDVRCAVLQLDSTLQAEQIV
FT                   INNLEVHTDWTDALRNVEIVIHLAARVHIMKEYATSSLDEYCKINSIATKNFVEQAVQN
FT                   NVKRFIFLSTIKVHGEFSQNNLPFSEDCRTQPEDPYAKSKLYAEQFIQEICQNARMEFV
FT                   ILRPPLVYGPYVKANFLRILQLVDKKWPLPFGSIYNKRTFIYIDNLVSAISAVVSEPSA
FT                   ANQVYLVADDCSWSLTQLVQTLSRKMNTKLFLIPIPVQILIFLFKLCGLKNINTRLFSS
FT                   LEVSNEKIKSQLGWTPPVSSIDGLEKTVKWYQNEYNT"
FT   CDS_pept        925876..926880
FT                   /transl_table=11
FT                   /gene="wecA"
FT                   /locus_tag="lpp0828"
FT                   /product="alpha-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0828"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11976"
FT                   /protein_id="CAH11976.1"
FT                   /translation="MNIILNVFLIFVSAILTKLFALFAQHTKLIDIPNERNLHSRPTVR
FT                   GGGLVFIGLSLFCWFFICNSQFFLTLDQFIFSIAIIFIATISFIDDFYNLSVTIRFFFQ
FT                   CLIAFLIVIFILPSQLDFGLFLFENTYLIAFFLFFAVIWAINHFNFMDGLDGFCASQAI
FT                   FLLAAYALFFNSAGSLIYQDFCLILISSLAGFLIFNFPPAKIFMGDVGSASLGLITFFI
FT                   AIIAQKNYQIPILYWFILNSLFLFDSTVTLIRRIIKHEKWFSPHKKHAYQRLKQLGINS
FT                   RFILLGQAIINGSLFLSVMFMHFQFFNLKNLIIIQLCYLSAIYFFIEKKYPME"
FT   regulatory      926985..926990
FT                   /locus_tag="lpp0829a"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        926995..927237
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0829a"
FT                   /product="hypothetical protein"
FT                   /note="Similar to N-terminal part of Legionella
FT                   hypothetical protein"
FT                   /db_xref="PSEUDO:CAH11977.1"
FT   CDS_pept        927224..927763
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0829b"
FT                   /product="hypothetical protein"
FT                   /note="Similar to central part of Legionella hypothetical
FT                   protein"
FT   CDS_pept        927739..928236
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="lpp0829c"
FT                   /product="hypothetical protein"
FT                   /note="Similar to C-terminal part of Legionella
FT                   hypothetical protein"
FT                   /db_xref="PSEUDO:CAH11979.1"
FT   regulatory      complement(928298..928329)
FT                   /locus_tag="lpp0830"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(928337..930133)
FT                   /transl_table=11
FT                   /locus_tag="lpp0830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0830"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11980"
FT                   /protein_id="CAH11980.1"
FT                   /translation="MPSIISDNPKNWSEEIKNYLCRSSPERYEKMATNNAIEPYISKAI
FT                   SWGYAEWKNRKTLLDDIETEMLRLATLPDLSDFNDNEIYSSKKNYLSKEILENYLIKAS
FT                   PENFNTVFRQPGWKSHVNFLIEKGNRELERQIINGNGVENSVDTVCAELAKLMNDFENS
FT                   FFDEIYGNSTPRYLLPNLFEKAIAEYKLLATIKERTRFIEAFIEIVMFDWQFSGTLDSD
FT                   LFKNAYSKEVLYYYGIGARLFVLGEFKEAQEYFKKIINIEPKPIDYLMLSKTYRALNEK
FT                   VETFNTIKDGLTHFPNDFLLTLALSGTLYWMGETKLANETLEPVKKDFNTMYKSEIEGA
FT                   KKLAVEISEAIKCDKIYRDQKNDIYDDKYTKKAWYQYWYHYNCFRPTQHPEAYMIDYIP
FT                   RYLTSIAKDATITLKGVLDFGTLCAEPLYRFAKNNPEIQCVGIDRQDLVKELNDKAYSL
FT                   NNLRFEAGDIFEYLEHFALLVPNHRMLFHCRTAVLCYPNFLLKLYKKCAELGIEYICLM
FT                   ESNSLSRDTLTFYNYGEMPNISIARRGSLINHDYFLLLEQSGYEIVKKDFHLAPHLLED
FT                   YAALIGSNTTLVAQLKLLTQSQ"
FT   CDS_pept        complement(930136..931254)
FT                   /transl_table=11
FT                   /locus_tag="lpp0831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0831"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11981"
FT                   /protein_id="CAH11981.1"
FT                   /translation="MKILVTARDVGAALNIIEIVKILKQYAGVTVFIYAQPPASKYFLR
FT                   AGIQPVFEVPLPPSRSLNEASDLLSYANQLIDKLNPDIILSGLSSPGEAGIDEAIIAEC
FT                   PAHIKTFVLQDFWGEVNFFFEKLADCYLCIDHHAAEITKKRFNAKTEVIGSPRHAIYQT
FT                   LNIEEQRNYIREYFNITQSTKTIGLFGQALHGIPGYMETISQWLEACLQQEKTKLVILY
FT                   RPHPRESEADKEETISLLISSGLEWKILSTQLVEESLLACDLVCSFFSNCLYDAAYLNY
FT                   FSLRPILTPVVLNFHPQIKNYTNQLSLYEISPYRKQELAFFCEYPHTLAKDIDYLLSSE
FT                   CSHKYWLHSKVKLEHPTKSLTRELAILLTGEP"
FT   regulatory      complement(930143..930148)
FT                   /locus_tag="lpp0830"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(931265..932266)
FT                   /transl_table=11
FT                   /locus_tag="lpp0832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0832"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11982"
FT                   /protein_id="CAH11982.1"
FT                   /translation="MIVRNPTWNSLTPPLPKFVSCDTVETNFLKEKLGEDGGIYTAQFD
FT                   LKSTYAFLFQRKNDQKKFFIKKVSAEHKRQYQQSEDLAQFIACPDYIVNIAINCISNEE
FT                   ENSLYYVYPYIHGKRLFAEPEQIITLATALAKLHLKKKSYPDQQLIIKNTTERTSQLNF
FT                   IRKALADGCYSYIPHFSFVKKMAQQYDFDWINQEDAQPIHGDLNAGNLLLSEDNMICFF
FT                   DFEDALHSFHPVVLDLLFVIERIIFNQNSSTEQLLNLGLMFIHAYKEAGGTYQYKTRDE
FT                   FGLTILALKAFCLLTLLAEKNKNILNSEWDKFFKLTQKAGNERDLIKTILQG"
FT   CDS_pept        complement(932256..933347)
FT                   /transl_table=11
FT                   /locus_tag="lpp0833"
FT                   /product="hypothetical protein"
FT                   /note="Similar to sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0833"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11983"
FT                   /protein_id="CAH11983.1"
FT                   /translation="MSQPFTIGPFSVEENHPPIFLAEIGTFFNQDLGIAEQLLHKIITI
FT                   RDKVPYQPLILKTEILNNPNICLPVDYEETYTSKSGEVRKENYRSLIERKVLPLEHYSM
FT                   LFSLLKNANLPFIVSIYELDTIDFAIKQGACALKTSSSNIVHVPLIRHLAKTGLPLIID
FT                   TGRSSLTDICKAVETAKSAGCEKIIIEHSPDGHPALPEAHNLRMLRTLNQCFSLPVGLS
FT                   DHYNGIEMLYMSIALGASILEKGVHLYPEDIDQDISHTMGIEQLAKTLETIYNCWQALG
FT                   QPMRDLEAPIKGVLGSSQRTCLVAKQKLQPGSLISLDNTTFAFPCKGVPTQYWDLVNGW
FT                   ELQNKVSIGEPIKWSDIKQKNDC"
FT   CDS_pept        complement(933360..934079)
FT                   /transl_table=11
FT                   /locus_tag="lpp0834"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0834"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11984"
FT                   /protein_id="CAH11984.1"
FT                   /translation="MSTVAQYKNYYHYISDGWSKEPKEMFKFLAQKIKELPLKPGSKLL
FT                   DIGCATGELIHFLSKHFPQLQYTGIDVFDDLIEVCKVLQPNVNFINASALDLPFEFENQ
FT                   FDIITVVSVISIFDTIDLDIFWDNLFKATKDNGVIYVLSPFNEYGVDCEIRHRKRINNI
FT                   KGEWERGWNIFCKETIAEYLEGRCKNWFFHPFKFNLELNQREDVIRTWTMKTEFNDKQL
FT                   TNGMKLLVDHYLLEIHI"
FT   CDS_pept        934395..935912
FT                   /transl_table=11
FT                   /locus_tag="lpp0835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0835"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11985"
FT                   /protein_id="CAH11985.1"
FT                   /translation="MSNTVLAIVYEAYQFNVFFQLFQKLAGERKYNFIMYSPYYLPNTE
FT                   QYIQLCTRDGFHYIYSTTKYGGDAGVLDQIDNLSINLNNICVTKNKSNQFLRTYLILKN
FT                   KFRELARLPVTRFKKILLYLLKKLDDLDLYKKITKEILEFIDYYTDTSYKINSIIDKIN
FT                   PSLLLFTEDVVERDSNIWIKIAQKKGILSAILSSSTATVTEAAETYFNNPHYYFPTHLP
FT                   LYLQIGLKIFIRKWCFNYRDRKFIRLPLKQLIAMDLLDLAPKQPWTINSGDSTLILVES
FT                   QFSKDLLVKEGINRRRIKIIGSLKFDSMAPVLNDSTRYKQELYQKYNLNLTKKLILCAF
FT                   PPNLPNRLSYDFQNYEDMTKKWISTLQLSDYNVLYSVHPSGFPDTANAIRSLDQIVVEE
FT                   DIANLIPLCDVYLASVSSTIKWARACNKLVLDYDCFHFNYRTYEKDPAIIAVKSLNELK
FT                   EWITRLNNQSVSKIHDQLNPSLHPNYWGIIDGRSLWRINNYIDCLIK"
FT   CDS_pept        936145..937827
FT                   /transl_table=11
FT                   /locus_tag="lpp0836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0836"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11986"
FT                   /protein_id="CAH11986.1"
FT                   /translation="MKSILFVINEAGEFVELSKIALAIQQQGYDINFLFVSSSYINLEN
FT                   DCKFCEVNGFTFYYPFKSFNKLRAQKIEKEFDFVSTRNHPIENQLGNGYIPYSFLLKSK
FT                   RKSYFFICPILFLISFVGIFAAITKFLCKITKKIISITANTVLKFFEKLFRKKTFNNSS
FT                   QILLSWYSAKSRGIKNFYYAYRVFKCNSFDLLIFGQEFPGSVNSLLIKACNNKNIPTLI
FT                   IPFAVGTTKEIVESLYDKDIFDVSSSITNYLASLLYPNWINFYKGKKMLRLTGKQIFFL
FT                   ELMGLAPEHPWLPNNSFVTKIAVESEKMFSYYQSMKFPVHQLSLTGSLSDDILVEATTN
FT                   GQEIKKKICQKMNLDPEKPILLCAWPTDQFGSRFVSLEFKNYEQLCRAWAKCLKEIERE
FT                   GKYSVIIRPHPVTNKEILGKILGQCDLKQFISYDDTIQLITCCDLFVACVSSTLRWAIA
FT                   KGIPAINYDCYQYGYTDFDAKGVFNVNDFKSFSAVLEELTRDRQKYEGAKQNQQECASA
FT                   WGILDGNSQKRIVNLINKLVQSESVIDIENKNYDLNILKNSDV"
FT   CDS_pept        937793..938644
FT                   /transl_table=11
FT                   /gene="wzm"
FT                   /locus_tag="lpp0837"
FT                   /product="ABC transporter of LPS O-antigen, Wzm"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0837"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11987"
FT                   /protein_id="CAH11987.1"
FT                   /translation="MTSISSKTQTFKETVVYGVDKFRLLAVLRNIWDYRLLLWIFCKRD
FT                   LKGRYSQTILGLGWVILTPLITVGVFVIVFGIMIKVPTDGLPTVMFYLVAVIPWYSFLN
FT                   VLNPSIQMIEGNASLITKVYFPRALIGGAYAMGAAVDFLMAYVFLITPFAIYYGLWSIK
FT                   LLIIMPFLLISTLMIGLGIGLVLAPINAKYRDIKHFMPLALQLFYYSTPAIYPVSAVPV
FT                   WAKPWYAVNPLSLVITSYREVLMGHWPSPTIIMTLSGMAIITFLVGLVAFHHMEHKVVD
FT                   IL"
FT   CDS_pept        938641..940065
FT                   /transl_table=11
FT                   /gene="wzt"
FT                   /locus_tag="lpp0838"
FT                   /product="ABC transporter of LPS O-antigen, Wzt"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0838"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11988"
FT                   /protein_id="CAH11988.1"
FT                   /translation="MSWSIRIENLSKQYRIGSTTTTAAELINEKLRKFLLLLDFKKRNR
FT                   FSSDKPLPSSIAQEGRTVVDASQISPEYPNHFWALRDINLEIEAGERLGIVGQNGCGKS
FT                   TLLKILSRIVSPTEGLFRFRGRLISLLEIGTGFHGELTGRENIFLNGTIMGMKTHEIKN
FT                   RLNQIIEFSELGSMIDTPVKRYSSGMYIRLAFAVAAHLESEILIVDEVLAVGDAAFQRK
FT                   CTEKMLDLANQGRTLLFVSHDMETVNRICNRAIRMSHGRIVGDSKFDTSAASKSSVMDI
FT                   TRDYLRSGAKYKSEQVWPSDKPMIFLNSLKLNRVRLIDYDNKVRSNFNLNETIVVEIDF
FT                   TIIKETYPFNIHLYLKDSSGRVIFVSMDNHAWQSKKVRPLGNYTERCTLYSPLLNIGDY
FT                   HIDIEFWPGNALENRLVVNSVVSFELKDGAVNEGVRGNWASDWPNSLIRPQLDWSISTN
FT                   KKQHLVLKEHELVTEK"
FT   CDS_pept        940071..941219
FT                   /transl_table=11
FT                   /locus_tag="lpp0839"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0839"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11989"
FT                   /protein_id="CAH11989.1"
FT                   /translation="MNKYGGAIILLSFPHQLIHALAALFTDREQRRINKDAPILIFIWS
FT                   YRWFDHKKNSPFLEIIKKLSKIENCQLYIPSLLQRVFGLSEFRALKQRVKYVNKIFPLK
FT                   DYDSFYYSHDFSADHTAQVFMQAFPNIYKVCFGDPPGFLYKNYTSVMECMENIKTGLKG
FT                   IFWKSRLKNIEKWYGYDKAYVAMNLSTDIQSYPLLTTTIPNINFINLLNRLKSNLPTLE
FT                   QEEHAFIETLESFNQNKRFQLLVLSNFTESGLISRENELKLYLELCHRHCPPGSTIIIK
FT                   PHILSNPAFLQSLKSSLGKYQVILFPENLRCIPLEMLTELLSKCNIISVSSSSIFLSYL
FT                   YGKEKIIHALTLSDVRQFFNEDSCAQMSEATQTIINTLKNFN"
FT   CDS_pept        complement(941233..942123)
FT                   /transl_table=11
FT                   /locus_tag="lpp0840"
FT                   /product="hypothetical protein"
FT                   /note="Similar to putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0840"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11990"
FT                   /protein_id="CAH11990.1"
FT                   /translation="MSKSGEKYKPADEAFSRLSKHQQHLLKSTVPIQIIISDNASSDNS
FT                   LALLEQSKLNKQTITIHRNNSNYGFSYANNAVFTKISTPFILYLNPDCFVENDTIENLL
FT                   HTMHQHNDAGMVGCLVNNMDGSVQIGCCGLTPTPARVLNQLLKLSKIFPNNPKFGGYLF
FT                   SKEKLPTKPAEVELISGSCMFVRKKAIDEVGLLDDNYFLYCEDYDWFYRFTQSNWKIIF
FT                   NPNTKVTHIKSFSTKQIPFKVLLYKAKGMWRFYNKFFKENSSPATTLIIRVGIIARFFS
FT                   LSGLLLFKKLLRTSN"
FT   CDS_pept        942904..943977
FT                   /transl_table=11
FT                   /gene="lag-1"
FT                   /locus_tag="lpp0841"
FT                   /product="O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0841"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11991"
FT                   /protein_id="CAH11991.1"
FT                   /translation="MYNKLTTSQATYLNFLRGFSAIIVLAGHTLSGIPGVISFGKQLPF
FT                   QSLAVNAFFWLSGFLITYHCITKKPYTFAEYMIDRFCRIYVIYIPVLILSVFLLVKADL
FT                   ASMPELKEWVANIFMIQHTPFNRIFEFLPTIPPLAQISPLWSIAVEWWLYTLFGIAFFF
FT                   HKSSFANRLIMSILIIPALLVAGYFTLKEYVALVWFLGSGCAYHFCNINRKYNNHGILM
FT                   LSLITGAAFLVRFHVLKHSLMNMYDLQLVIPGCIFLYSLLLLLSTNKLSKKIELISAFL
FT                   AFISYTLYLSHEPIRRVVSTFIEPTNLKRGFLICGVCIACATIIAYLLENKHLVVREWL
FT                   KSKLLQKNTSNKLAYST"
FT   CDS_pept        complement(944090..944983)
FT                   /transl_table=11
FT                   /locus_tag="lpp0842"
FT                   /product="hypothetical protein"
FT                   /note="similar to glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0842"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11992"
FT                   /protein_id="CAH11992.1"
FT                   /translation="MVANLVTVVIVNYNSGEMLGKCVEHLLKSTVPIQIIISDNASSDN
FT                   SLALLEQSELNKQTITIHRNNSNYGFSYANNAVFTKISTPFILYLNPDCFVENDTIENL
FT                   LHTMHQHNDAGMVGCLVNNMDGSVQIGCCGLTPTPARVLNQLLKLSKIFPNNSKFGGYL
FT                   FSKEKLPTKPTEVELISGSCMFVRKKAIDEVGLLDDNYFLYCEDYDWFYRFTQSNWKII
FT                   FNPNTKVTHIKSFSTKQIPFKVLLYKAKGMWRFYNKFFKENSSPATTLIIRVGIIARFF
FT                   SLSGLLLFKKLLRTTS"
FT   CDS_pept        complement(944977..945996)
FT                   /transl_table=11
FT                   /locus_tag="lpp0843"
FT                   /product="hypothetical protein"
FT                   /note="similar to glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0843"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11993"
FT                   /protein_id="CAH11993.1"
FT                   /translation="MIERAFSLLFIQFSIMQIQNTEINIGVIIVNYNSAHCLSKAITAL
FT                   EKQSYKPYQIILFDNSSIENLPEIVHTTKLPIKIVVSNINLGFAAGNNKAIEYLDPEVN
FT                   WIALLNPDAYPHKDWLLEMVSAIKTHPQYAFMGSKLICENEPYLLDGTGDVYHISGKAW
FT                   RLNHRKPLDKAPKDMQELFAPCAAAALYRRDAFNAVKGFDEQYFCYYEDVDLAFRLWLA
FT                   GYKGCYIPTAIAEHTGSAITKKHSDFYTYYGHRNLVWTYFKNMPLLLLIATLPLHLLLN
FT                   IATLLLFIKRKQTFVIIKSKIDAIKGLPTLLQQRRHIQKSRVLSNFQLLKILKKGLPW"
FT   CDS_pept        946208..946915
FT                   /transl_table=11
FT                   /locus_tag="lpp0844"
FT                   /product="hypothetical protein"
FT                   /note="similar to glyoxalase II"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0844"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11994"
FT                   /protein_id="CAH11994.1"
FT                   /translation="MIFHQLFDQDSCTYTYLIGSTVSKHAIIIDPVRSQVSHYINLINK
FT                   LELNLVASIDTHLHADHITGSGQLTILTDCHSMIGMESKAKFVHIKFHDNEILNFGNIK
FT                   IKAMHTPGHTPDSYCFVMEDRIFTGDTLLINATGRTDFQNGSASAQYDSLFNKLLKLPG
FT                   FMRIYPGHDYNQKQYSTIDDEKKNNPRLQVKSRQEYVEMMGNLNLSFPKNMHFAVPANL
FT                   NNGLTEQEVNALV"
FT   regulatory      947459..947464
FT                   /gene="csrA"
FT                   /locus_tag="lpp0845"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        947474..947668
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="lpp0845"
FT                   /product="global regulator CsrA"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0845"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11995"
FT                   /db_xref="GOA:Q5X6W9"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5X6W9"
FT                   /protein_id="CAH11995.1"
FT                   /translation="MLILTRRIGETLIIGDDVNITVLGVKGNQVRLGINAPKDVSVHRE
FT                   EIYLRIQQEKESDDSEQAV"
FT   CDS_pept        complement(947794..949776)
FT                   /transl_table=11
FT                   /locus_tag="lpp0846"
FT                   /product="hypothetical protein"
FT                   /note="Similar to O-antigen acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:lpp0846"
FT                   /db_xref="EnsemblGenomes-Tr:CAH11996"
FT                   /protein_id="CAH11996.1"
FT                   /translation="MSNTARINYRKDIDALRGVAVLLVIFDHLHINLVPAGFLGVDVFF
FT                   VISGFLITQIIFRNTKTQTFSLIKFYLNRMRRILPALMLVLLVSSVMSYFLLLVPDLKN
FT                   YSTSLLATILSSSNIYFWKFINIGYFSTDATIQQLLHTWSLGVEEQFYLIWPIILIVLT
FT                   KKFTDKKIILGTILLTIISFFA